BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25095_g1_i2 len=1153 path=[4435:0-321 13:322-390 4825:391-447
4882:448-495 4929:496-500 617:501-524 4957:525-571 688:572-660
5091:661-732 1162:733-760 5189:761-766 2221:767-770 852:771-810
6319:811-893 5656:894-895 1469:896-902 2362:903-930 6399:931-977
6423:978-981 2438:982-1152]

Length=1153
                                                                      Score     E

ref|XP_010326194.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    362   4e-120   
ref|XP_006339532.1|  PREDICTED: short-chain dehydrogenase/reducta...    357   3e-118   
ref|XP_010326198.1|  PREDICTED: uncharacterized protein LOC101260...    364   7e-117   
gb|KDP28662.1|  hypothetical protein JCGZ_14433                         348   1e-114   
gb|EYU32078.1|  hypothetical protein MIMGU_mgv1a010860mg                348   2e-114   
gb|EYU32077.1|  hypothetical protein MIMGU_mgv1a010747mg                342   3e-112   
gb|KHG00239.1|  Uncharacterized protein F383_18135                      342   6e-112   
ref|XP_002301348.1|  short-chain dehydrogenase/reductase family p...    339   3e-111   Populus trichocarpa [western balsam poplar]
emb|CDP11266.1|  unnamed protein product                                339   4e-111   
ref|XP_010053674.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       333   8e-109   
ref|XP_011094700.1|  PREDICTED: uncharacterized protein LOC105174332    344   1e-108   
ref|XP_007051877.1|  NAD(P)-binding Rossmann-fold superfamily pro...    342   4e-108   
ref|XP_011023378.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    330   1e-107   
ref|XP_002267348.2|  PREDICTED: (+)-neomenthol dehydrogenase            330   2e-107   Vitis vinifera
emb|CBI40296.3|  unnamed protein product                                329   3e-107   
ref|XP_010661731.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    329   3e-107   
ref|XP_010661732.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    328   7e-107   
ref|XP_011094713.1|  PREDICTED: uncharacterized protein LOC105174340    347   7e-107   
ref|XP_010544713.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       327   1e-106   
emb|CDP08858.1|  unnamed protein product                                327   2e-106   
gb|KHG00238.1|  Uncharacterized protein F383_18135                      337   2e-106   
ref|XP_010661735.1|  PREDICTED: (+)-neomenthol dehydrogenase            327   2e-106   
gb|EYU32079.1|  hypothetical protein MIMGU_mgv1a010703mg                326   5e-106   
emb|CBI40298.3|  unnamed protein product                                325   8e-106   
ref|XP_009116784.1|  PREDICTED: (+)-neomenthol dehydrogenase            325   1e-105   
ref|XP_009343598.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       324   2e-105   
ref|XP_008232781.1|  PREDICTED: short-chain dehydrogenase/reducta...    324   2e-105   
ref|XP_007224111.1|  hypothetical protein PRUPE_ppa015667mg             324   3e-105   
ref|XP_011023377.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    324   3e-105   
ref|XP_008375920.1|  PREDICTED: (+)-neomenthol dehydrogenase            323   5e-105   
ref|XP_002511824.1|  carbonyl reductase, putative                       331   9e-105   Ricinus communis
ref|XP_009338796.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       322   1e-104   
ref|XP_006491048.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       322   2e-104   
ref|XP_010544712.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       322   2e-104   
emb|CDP08863.1|  unnamed protein product                                322   2e-104   
ref|XP_010053670.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       322   2e-104   
gb|KDP28661.1|  hypothetical protein JCGZ_14432                         322   3e-104   
ref|XP_007218747.1|  hypothetical protein PRUPE_ppa009290mg             322   3e-104   
gb|KCW78028.1|  hypothetical protein EUGRSUZ_D02253                     321   3e-104   
ref|XP_002301344.1|  hypothetical protein POPTR_0002s15770g             321   6e-104   Populus trichocarpa [western balsam poplar]
ref|XP_007135022.1|  hypothetical protein PHAVU_010G095300g             320   6e-104   
ref|NP_191681.1|  (+)-neomenthol dehydrogenase                          320   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343607.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       320   9e-104   
ref|XP_010053669.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       320   1e-103   
ref|XP_007051880.1|  NAD(P)-binding Rossmann-fold superfamily pro...    320   1e-103   
ref|XP_007051881.1|  NAD(P)-binding Rossmann-fold superfamily pro...    320   1e-103   
ref|XP_007219267.1|  hypothetical protein PRUPE_ppa018232mg             319   2e-103   
ref|NP_001190151.1|  (+)-neomenthol dehydrogenase                       319   2e-103   
ref|XP_011023382.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    318   8e-103   
ref|XP_007051882.1|  NAD(P)-binding Rossmann-fold superfamily pro...    318   8e-103   
ref|XP_006402505.1|  hypothetical protein EUTSA_v10006127mg             318   9e-103   
ref|XP_007221198.1|  hypothetical protein PRUPE_ppa026931mg             317   1e-102   
gb|KHM99404.1|  (+)-neomenthol dehydrogenase                            317   1e-102   
ref|XP_007219247.1|  hypothetical protein PRUPE_ppa018029mg             317   1e-102   
ref|XP_006583333.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    317   2e-102   
ref|XP_002301346.2|  hypothetical protein POPTR_0002s15820g             317   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_008246061.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    317   2e-102   
ref|XP_002320111.2|  hypothetical protein POPTR_0014s07590g             317   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006576352.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    317   2e-102   
ref|XP_007219248.1|  hypothetical protein PRUPE_ppa018033mg             317   2e-102   
ref|XP_009594774.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    317   3e-102   
ref|XP_007135023.1|  hypothetical protein PHAVU_010G095400g             316   4e-102   
gb|KHN27306.1|  (+)-neomenthol dehydrogenase                            317   4e-102   
ref|XP_002267820.2|  PREDICTED: uncharacterized protein LOC100243097    326   5e-102   Vitis vinifera
ref|NP_001276230.1|  (+)-neomenthol dehydrogenase-like                  316   6e-102   
emb|CDX71758.1|  BnaC08g31160D                                          315   6e-102   
ref|XP_008232775.1|  PREDICTED: LOW QUALITY PROTEIN: (+)-neomenth...    315   1e-101   
ref|XP_002301343.2|  hypothetical protein POPTR_0002s15800g             315   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_007218752.1|  hypothetical protein PRUPE_ppa009330mg             314   3e-101   
gb|AES80102.2|  NAD(P)-binding rossmann-fold protein                    313   4e-101   
ref|XP_011023384.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       314   4e-101   
gb|KDP28664.1|  hypothetical protein JCGZ_14435                         313   6e-101   
gb|AET02077.2|  NAD(P)-binding rossmann-fold protein                    313   7e-101   
ref|XP_002876599.1|  short-chain dehydrogenase/reductase family p...    313   8e-101   
ref|XP_003521915.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       312   1e-100   
ref|XP_002511821.1|  carbonyl reductase, putative                       312   1e-100   Ricinus communis
ref|XP_003627602.1|  (+)-neomenthol dehydrogenase                       312   2e-100   
gb|KDP28663.1|  hypothetical protein JCGZ_14434                         312   2e-100   
emb|CDP08861.1|  unnamed protein product                                312   2e-100   
ref|XP_007139902.1|  hypothetical protein PHAVU_008G068200g             311   2e-100   
ref|NP_179996.1|  Short-chain dehydrogenase/reductase 2                 311   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051884.1|  NAD(P)-binding Rossmann-fold superfamily pro...    311   3e-100   
ref|XP_010661730.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    311   4e-100   
ref|XP_011091821.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       313   5e-100   
ref|XP_002511823.1|  carbonyl reductase, putative                       311   5e-100   Ricinus communis
ref|XP_008232812.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       318   5e-100   
ref|XP_011035794.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       311   6e-100   
ref|XP_002880558.1|  short-chain dehydrogenase/reductase family p...    310   7e-100   
ref|XP_003627593.1|  (+)-neomenthol dehydrogenase                       310   8e-100   
ref|XP_011023381.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    312   9e-100   
gb|KEH23344.1|  NAD(P)-binding rossmann-fold protein                    310   9e-100   
ref|XP_010053680.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       310   1e-99    
ref|XP_011023379.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    309   1e-99    
ref|XP_009347861.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       310   1e-99    
ref|XP_008246060.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    310   2e-99    
ref|XP_007221124.1|  hypothetical protein PRUPE_ppa018330mg             309   2e-99    
ref|XP_008232780.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       309   2e-99    
ref|NP_001077951.1|  Short-chain dehydrogenase/reductase 2              309   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003627601.1|  (+)-neomenthol dehydrogenase                       312   2e-99    
ref|XP_008337474.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    309   3e-99    
gb|ACN87275.1|  short chain dehydrogenase/reductase                     309   3e-99    Nandina domestica
emb|CDP01393.1|  unnamed protein product                                309   3e-99    
ref|XP_003600313.1|  (+)-neomenthol dehydrogenase                       308   3e-99    
ref|XP_008227552.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       308   3e-99    
ref|XP_009350263.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       308   4e-99    
gb|KHG24616.1|  Uncharacterized protein F383_06242                      309   4e-99    
ref|XP_010052706.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    308   4e-99    
ref|XP_008337412.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    308   4e-99    
gb|KDO86074.1|  hypothetical protein CISIN_1g021246mg                   308   6e-99    
ref|XP_008369757.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       308   7e-99    
ref|XP_010671895.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       308   8e-99    
ref|XP_009377413.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    307   1e-98    
ref|XP_003627600.1|  (+)-neomenthol dehydrogenase                       307   1e-98    
sp|B2X050.1|MNR1_CAPAN  RecName: Full=(+)-neomenthol dehydrogenas...    308   1e-98    Capsicum annuum
gb|KHM99407.1|  (+)-neomenthol dehydrogenase                            306   1e-98    
ref|XP_002320110.2|  hypothetical protein POPTR_0014s07580g             307   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_007051886.1|  Neomenthol dehydrogenase, putative                 307   2e-98    
ref|XP_006339531.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       307   2e-98    
ref|XP_007220894.1|  hypothetical protein PRUPE_ppa014652mg             306   3e-98    
ref|XP_010429384.1|  PREDICTED: short-chain dehydrogenase/reducta...    306   3e-98    
ref|XP_009377415.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    306   3e-98    
ref|XP_010429382.1|  PREDICTED: short-chain dehydrogenase/reducta...    306   3e-98    
ref|XP_007220474.1|  hypothetical protein PRUPE_ppa008632mg             307   4e-98    
ref|XP_007218749.1|  hypothetical protein PRUPE_ppa009309mg             306   4e-98    
ref|XP_007218746.1|  hypothetical protein PRUPE_ppa009281mg             306   4e-98    
ref|XP_006587860.1|  PREDICTED: (+)-neomenthol dehydrogenase            306   4e-98    
gb|ACJ84918.1|  unknown                                                 306   5e-98    Medicago truncatula
ref|XP_010053677.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       305   5e-98    
ref|XP_006294712.1|  hypothetical protein CARUB_v10023750mg             305   6e-98    
ref|XP_007051878.1|  NAD(P)-binding Rossmann-fold superfamily pro...    305   7e-98    
ref|XP_007219208.1|  hypothetical protein PRUPE_ppa017299mg             305   8e-98    
ref|XP_003627603.1|  (+)-neomenthol dehydrogenase                       305   1e-97    
gb|KHN29385.1|  (+)-neomenthol dehydrogenase                            304   1e-97    
gb|KCW78041.1|  hypothetical protein EUGRSUZ_D02263                     305   2e-97    
ref|XP_010661729.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    305   2e-97    
ref|XP_008232776.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       304   2e-97    
ref|XP_009803547.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       304   3e-97    
ref|XP_008343393.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       303   3e-97    
ref|XP_006583334.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    303   4e-97    
gb|EYU32087.1|  hypothetical protein MIMGU_mgv1a010340mg                304   4e-97    
ref|XP_007051876.1|  NAD(P)-binding Rossmann-fold superfamily pro...    305   4e-97    
gb|ABM54181.1|  short-chain dehydrogenase/reductase                     303   6e-97    Capsicum annuum
gb|KHN04648.1|  (+)-neomenthol dehydrogenase                            303   6e-97    
ref|XP_010098430.1|  (+)-neomenthol dehydrogenase                       311   9e-97    
ref|XP_007218748.1|  hypothetical protein PRUPE_ppa009292mg             302   9e-97    
ref|XP_010326206.1|  PREDICTED: (+)-neomenthol dehydrogenase            312   1e-96    
ref|XP_009796277.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       301   2e-96    
ref|XP_008338485.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       308   2e-96    
ref|XP_007139906.1|  hypothetical protein PHAVU_008G068600g             300   3e-96    
ref|XP_008355449.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       301   5e-96    
ref|NP_001242019.1|  uncharacterized protein LOC100803877               300   5e-96    
emb|CBI40299.3|  unnamed protein product                                300   5e-96    
ref|XP_011094727.1|  PREDICTED: uncharacterized protein LOC105174344    311   5e-96    
ref|XP_006583329.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       300   5e-96    
dbj|BAO45879.1|  neomenthol dehydrogenase-like protein                  300   7e-96    
gb|KHN04649.1|  (+)-neomenthol dehydrogenase                            300   9e-96    
ref|XP_006583331.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    300   1e-95    
ref|XP_003623885.1|  (+)-neomenthol dehydrogenase                       310   1e-95    
ref|XP_003600294.1|  Ribulose bisphosphate carboxylase small chain      301   1e-95    
ref|XP_008232811.1|  PREDICTED: uncharacterized protein LOC103331916    310   1e-95    
ref|XP_003600307.1|  (+)-neomenthol dehydrogenase                       299   1e-95    
ref|XP_007139905.1|  hypothetical protein PHAVU_008G068500g             300   1e-95    
ref|XP_011035784.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       299   2e-95    
ref|XP_008232796.1|  PREDICTED: uncharacterized protein LOC103331896    310   2e-95    
ref|XP_006418460.1|  hypothetical protein EUTSA_v10008335mg             299   2e-95    
ref|NP_563635.1|  Rossmann-fold NAD(P)-binding domain-containing ...    298   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AFK37109.1|  unknown                                                 298   2e-95    
ref|XP_011091833.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    299   3e-95    
ref|XP_006582932.1|  PREDICTED: uncharacterized protein LOC100803...    298   3e-95    
emb|CDP08857.1|  unnamed protein product                                298   5e-95    
ref|XP_006491047.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       297   6e-95    
ref|XP_010054778.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...    297   7e-95    
ref|XP_006445104.1|  hypothetical protein CICLE_v10023386mg             298   7e-95    
ref|XP_007214062.1|  hypothetical protein PRUPE_ppa017566mg             297   7e-95    
gb|KDO86072.1|  hypothetical protein CISIN_1g039097mg                   297   9e-95    
ref|XP_007051879.1|  NAD(P)-binding Rossmann-fold superfamily pro...    298   1e-94    
ref|XP_007135024.1|  hypothetical protein PHAVU_010G095500g             297   1e-94    
ref|XP_002892041.1|  short-chain dehydrogenase/reductase family p...    297   1e-94    
gb|KEH18924.1|  NAD(P)-binding rossmann-fold protein                    296   1e-94    
gb|AAF78417.1|AC009273_23  Contains similarity to a retinal short...    298   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523034.1|  PREDICTED: (+)-neomenthol dehydrogenase            296   2e-94    
gb|ACJ84741.1|  unknown                                                 296   4e-94    Medicago truncatula
ref|XP_006588341.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       295   4e-94    
ref|XP_003600308.1|  (+)-neomenthol dehydrogenase                       295   5e-94    
gb|KHN29382.1|  (+)-neomenthol dehydrogenase                            298   6e-94    
ref|XP_008337732.1|  PREDICTED: short-chain dehydrogenase/reducta...    295   7e-94    
ref|XP_008353984.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    295   9e-94    
ref|XP_004229931.2|  PREDICTED: uncharacterized protein LOC101261456    305   1e-93    
gb|KHG16333.1|  (+)-neomenthol dehydrogenase -like protein              294   1e-93    
ref|XP_010053671.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       295   1e-93    
ref|XP_008353985.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    294   2e-93    
gb|KEH23343.1|  NAD(P)-binding rossmann-fold protein                    293   2e-93    
ref|XP_009138784.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    293   3e-93    
gb|ACN87274.1|  short chain dehydrogenase/reductase                     293   3e-93    Chelidonium majus
ref|XP_008343394.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       292   6e-93    
ref|XP_010053676.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    292   7e-93    
ref|XP_007135015.1|  hypothetical protein PHAVU_010G094800g             291   1e-92    
ref|XP_007212966.1|  hypothetical protein PRUPE_ppa021111mg             291   1e-92    
gb|KEH18922.1|  NAD(P)-binding rossmann-fold protein                    291   1e-92    
ref|XP_010053675.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    291   1e-92    
ref|XP_009138783.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    291   2e-92    
ref|XP_007135017.1|  hypothetical protein PHAVU_010G094900g             291   2e-92    
ref|XP_008232813.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       293   2e-92    
gb|KHG24614.1|  hypothetical protein F383_06242                         303   3e-92    
emb|CDX90062.1|  BnaA10g00200D                                          290   3e-92    
ref|XP_008353983.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       290   4e-92    
gb|KCW78035.1|  hypothetical protein EUGRSUZ_D02259                     291   5e-92    
ref|XP_003600309.1|  (+)-neomenthol dehydrogenase                       290   6e-92    
ref|XP_010053672.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    291   6e-92    
ref|XP_009119740.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    290   6e-92    
ref|XP_007218771.1|  hypothetical protein PRUPE_ppa009526mg             290   6e-92    
emb|CDY15148.1|  BnaC05g00270D                                          290   7e-92    
gb|KCW78042.1|  hypothetical protein EUGRSUZ_D02266                     288   1e-91    
ref|XP_010474804.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    289   1e-91    
ref|XP_008778203.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       289   1e-91    
ref|XP_003521180.2|  PREDICTED: (+)-neomenthol dehydrogenase-like...    289   2e-91    
gb|KHG17192.1|  (+)-neomenthol dehydrogenase -like protein              288   4e-91    
gb|ABC88670.1|  (-)-menthone:(+)-neomenthol reductase                   288   5e-91    Mentha x piperita
gb|KEH18923.1|  NAD(P)-binding rossmann-fold protein                    287   5e-91    
gb|KHG24615.1|  hypothetical protein F383_06242                         299   6e-91    
ref|XP_007218773.1|  hypothetical protein PRUPE_ppa009560mg             287   6e-91    
ref|XP_009400275.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       287   1e-90    
gb|KHN04645.1|  (+)-neomenthol dehydrogenase                            286   1e-90    
ref|XP_003627589.1|  Carbonyl reductase                                 286   1e-90    
ref|XP_004510824.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       286   1e-90    
ref|XP_010457077.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       286   2e-90    
ref|XP_010910358.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       286   2e-90    
pdb|3O26|A  Chain A, The Structure Of Salutaridine Reductase From...    286   2e-90    
ref|XP_008337634.1|  PREDICTED: uncharacterized protein LOC103400719    295   2e-90    
sp|A4UHT7.1|SALR_PAPBR  RecName: Full=Salutaridine reductase            286   3e-90    Papaver bracteatum [great scarlet poppy]
ref|XP_004510823.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       285   3e-90    
gb|KCW78026.1|  hypothetical protein EUGRSUZ_D02253                     285   4e-90    
ref|XP_003528868.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       285   5e-90    
emb|CDY56927.1|  BnaAnng14460D                                          285   6e-90    
gb|EYU32080.1|  hypothetical protein MIMGU_mgv11b021529mg               284   8e-90    
ref|XP_003623884.1|  (+)-neomenthol dehydrogenase                       301   9e-90    
ref|XP_010918528.1|  PREDICTED: salutaridine reductase-like             285   1e-89    
ref|XP_004976337.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       284   1e-89    
ref|XP_006339786.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       290   1e-89    
gb|KEH23345.1|  NAD(P)-binding rossmann-fold protein                    283   2e-89    
gb|AFK39427.1|  unknown                                                 282   2e-89    
gb|KHN27304.1|  (+)-neomenthol dehydrogenase                            283   3e-89    
gb|AAQ55960.1|  menthol dehydrogenase                                   283   3e-89    Mentha x piperita
ref|XP_006445101.1|  hypothetical protein CICLE_v10024172mg             283   3e-89    
ref|XP_011091841.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    282   5e-89    
ref|XP_003600312.1|  (+)-neomenthol dehydrogenase                       282   6e-89    
ref|XP_004510835.1|  PREDICTED: uncharacterized protein LOC101496709    291   1e-88    
gb|EMT05793.1|  Short-chain dehydrogenase/reductase 2                   282   1e-88    
ref|XP_010272342.1|  PREDICTED: LOW QUALITY PROTEIN: (+)-neomenth...    284   1e-88    
gb|KEH18926.1|  NAD(P)-binding rossmann-fold protein                    284   2e-88    
ref|NP_001053402.1|  Os04g0532100                                       281   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004510837.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       281   2e-88    
ref|XP_006491049.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    281   2e-88    
ref|XP_004513824.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       280   3e-88    
ref|XP_006477446.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...    281   3e-88    
ref|XP_010251642.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    280   3e-88    
ref|XP_004493025.1|  PREDICTED: uncharacterized protein LOC101510344    290   4e-88    
ref|XP_010651837.1|  PREDICTED: salutaridine reductase-like             280   6e-88    
ref|XP_010651771.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       280   9e-88    
ref|XP_004976336.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       280   1e-87    
emb|CBI17141.3|  unnamed protein product                                281   1e-87    
dbj|BAJ88471.1|  predicted protein                                      279   2e-87    
ref|XP_003614999.1|  (+)-neomenthol dehydrogenase                       278   2e-87    
ref|XP_004976339.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       278   3e-87    
ref|XP_010251641.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    281   4e-87    
ref|XP_007135019.1|  hypothetical protein PHAVU_010G095000g             277   4e-87    
gb|ABR15427.1|  menthol dehydrogenase                                   278   4e-87    
ref|XP_008375601.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       277   5e-87    
gb|KEH18925.1|  NAD(P)-binding rossmann-fold protein                    285   6e-87    
ref|XP_002511822.1|  carbonyl reductase, putative                       278   7e-87    Ricinus communis
ref|XP_010233762.1|  PREDICTED: short-chain dehydrogenase/reducta...    278   1e-86    
ref|XP_010251640.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    281   1e-86    
ref|XP_007051885.1|  NAD(P)-binding Rossmann-fold superfamily pro...    276   1e-86    
ref|XP_011080504.1|  PREDICTED: short-chain dehydrogenase/reducta...    275   4e-86    
gb|EEC77696.1|  hypothetical protein OsI_16759                          275   6e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_004295129.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       275   7e-86    
ref|XP_002446843.1|  hypothetical protein SORBIDRAFT_06g023540          275   8e-86    Sorghum bicolor [broomcorn]
ref|XP_002454578.1|  hypothetical protein SORBIDRAFT_04g033750          275   9e-86    Sorghum bicolor [broomcorn]
ref|XP_011080505.1|  PREDICTED: short-chain dehydrogenase/reducta...    275   1e-85    
ref|XP_010053673.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    273   1e-85    
ref|XP_004976338.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       274   1e-85    
gb|AGT17182.1|  hypothetical protein SHCRBa_069_M12_R_80                274   2e-85    
ref|XP_006652564.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       273   2e-85    
ref|XP_002446846.1|  hypothetical protein SORBIDRAFT_06g023570          273   2e-85    
ref|XP_006340272.1|  PREDICTED: short-chain dehydrogenase/reducta...    273   3e-85    
ref|XP_008238881.1|  PREDICTED: salutaridine reductase-like             273   4e-85    
ref|XP_004958737.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    273   5e-85    
gb|ACN87276.1|  short chain dehydrogenase/reductase                     272   5e-85    
ref|XP_010651769.1|  PREDICTED: salutaridine reductase-like             272   6e-85    
ref|XP_007209393.1|  hypothetical protein PRUPE_ppa009165mg             272   6e-85    
ref|XP_009614219.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    272   8e-85    
ref|XP_004958738.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    272   1e-84    
ref|XP_010313462.1|  PREDICTED: short-chain dehydrogenase/reducta...    271   1e-84    
ref|XP_008790461.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    271   1e-84    
ref|XP_008337547.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    270   2e-84    
ref|XP_006658151.1|  PREDICTED: short-chain dehydrogenase/reducta...    273   2e-84    
ref|XP_010313459.1|  PREDICTED: short-chain dehydrogenase/reducta...    270   2e-84    
gb|EMT32844.1|  (+)-neomenthol dehydrogenase                            270   3e-84    
emb|CDP19124.1|  unnamed protein product                                273   3e-84    
ref|XP_004958736.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    273   3e-84    
ref|XP_009620597.1|  PREDICTED: short-chain dehydrogenase/reducta...    270   4e-84    
ref|XP_004298764.1|  PREDICTED: short-chain dehydrogenase/reducta...    270   4e-84    
ref|XP_006652563.1|  PREDICTED: salutaridine reductase-like             270   5e-84    
ref|XP_007205614.1|  hypothetical protein PRUPE_ppa009101mg             270   5e-84    
dbj|BAD25368.1|  short-chain dehydrogenase/reductase protein-like       270   5e-84    
ref|XP_006387687.1|  hypothetical protein POPTR_0675s00200g             270   7e-84    
dbj|BAG89111.1|  unnamed protein product                                270   8e-84    
ref|XP_002446848.1|  hypothetical protein SORBIDRAFT_06g023590          271   8e-84    
ref|XP_008790460.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    271   1e-83    
gb|AAQ55959.1|  neomenthol dehydrogenase                                270   1e-83    
ref|XP_008678868.1|  PREDICTED: salutaridine reductase-like isofo...    269   1e-83    
emb|CBI17143.3|  unnamed protein product                                279   1e-83    
ref|XP_002446845.1|  hypothetical protein SORBIDRAFT_06g023560          269   1e-83    
gb|EEE67842.1|  hypothetical protein OsJ_25630                          271   1e-83    
ref|XP_008661912.1|  PREDICTED: LOC100282122 isoform X1                 269   1e-83    
ref|XP_006387460.1|  hypothetical protein POPTR_1018s00210g             268   2e-83    
gb|EYU46137.1|  hypothetical protein MIMGU_mgv1a009586mg                270   2e-83    
ref|XP_010053301.1|  PREDICTED: salutaridine reductase-like             268   2e-83    
ref|XP_009400596.1|  PREDICTED: uncharacterized protein LOC103984761    284   2e-83    
ref|XP_006445100.1|  hypothetical protein CICLE_v10021613mg             267   2e-83    
ref|XP_008678867.1|  PREDICTED: salutaridine reductase-like isofo...    268   2e-83    
ref|XP_002466231.1|  hypothetical protein SORBIDRAFT_01g003960          268   2e-83    
emb|CDP20218.1|  unnamed protein product                                266   2e-83    
ref|NP_001060679.1|  Os07g0685800                                       270   3e-83    
ref|XP_006340274.1|  PREDICTED: short-chain dehydrogenase/reducta...    267   4e-83    
ref|XP_008374039.1|  PREDICTED: salutaridine reductase-like             267   4e-83    
ref|XP_004976333.1|  PREDICTED: salutaridine reductase-like             268   4e-83    
ref|XP_009420957.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       267   5e-83    
ref|NP_001278579.1|  LOC100282122                                       267   5e-83    
ref|XP_009620596.1|  PREDICTED: short-chain dehydrogenase/reducta...    270   6e-83    
ref|XP_008667598.1|  PREDICTED: hypothetical protein isoform X1         268   7e-83    
ref|XP_007139903.1|  hypothetical protein PHAVU_008G068300g             265   7e-83    
ref|XP_008667599.1|  PREDICTED: hypothetical protein isoform X2         267   8e-83    
gb|EEC82711.1|  hypothetical protein OsI_27383                          269   8e-83    
ref|XP_003580211.2|  PREDICTED: uncharacterized protein LOC100839967    277   1e-82    
ref|XP_011028496.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    266   2e-82    
ref|XP_009369037.1|  PREDICTED: salutaridine reductase-like             266   2e-82    
ref|XP_009358607.1|  PREDICTED: salutaridine reductase-like             266   2e-82    
ref|XP_008796756.1|  PREDICTED: salutaridine reductase-like             266   2e-82    
ref|XP_010685513.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       265   2e-82    
ref|XP_008451083.1|  PREDICTED: short-chain dehydrogenase/reducta...    265   2e-82    
ref|XP_004958735.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       268   2e-82    
ref|XP_009799308.1|  PREDICTED: short-chain dehydrogenase/reducta...    268   3e-82    
ref|XP_010093838.1|  Short-chain dehydrogenase/reductase 2              267   3e-82    
ref|XP_004144091.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       265   3e-82    
dbj|BAJ93733.1|  predicted protein                                      265   3e-82    
ref|XP_008374041.1|  PREDICTED: salutaridine reductase-like             265   3e-82    
ref|XP_004300771.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...    265   3e-82    
gb|ACG31770.1|  carbonyl reductase 3                                    265   3e-82    
gb|ACZ34296.1|  broad substrate reductase/dehydrogenase                 265   4e-82    
ref|XP_003601313.1|  Short-chain dehydrogenase/reductase                265   4e-82    
ref|XP_004978151.1|  PREDICTED: uncharacterized protein LOC101786803    275   4e-82    
ref|XP_011028503.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       265   6e-82    
ref|XP_002461236.1|  hypothetical protein SORBIDRAFT_02g043370          265   1e-81    
ref|XP_009358609.1|  PREDICTED: salutaridine reductase-like isofo...    264   1e-81    
ref|XP_006829842.1|  hypothetical protein AMTR_s00119p00110100          263   2e-81    
ref|XP_011028494.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    263   2e-81    
ref|XP_010053299.1|  PREDICTED: salutaridine reductase-like             262   2e-81    
ref|XP_002521626.1|  carbonyl reductase, putative                       263   3e-81    
ref|XP_002446847.1|  hypothetical protein SORBIDRAFT_06g023580          263   3e-81    
ref|XP_009358608.1|  PREDICTED: salutaridine reductase-like isofo...    263   3e-81    
ref|NP_001053401.1|  Os04g0531900                                       263   3e-81    
ref|XP_008667386.1|  PREDICTED: hypothetical protein isoform X1         263   4e-81    
ref|XP_010052778.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       262   4e-81    
ref|NP_001137015.1|  hypothetical protein                               262   7e-81    
gb|KDP42906.1|  hypothetical protein JCGZ_23848                         261   8e-81    
ref|XP_004976335.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       261   9e-81    
emb|CDX89104.1|  BnaA04g00820D                                          259   2e-80    
ref|XP_011028501.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       259   4e-80    
ref|XP_009348824.1|  PREDICTED: salutaridine reductase-like             259   4e-80    
ref|XP_008661582.1|  PREDICTED: hypothetical protein isoform X1         259   5e-80    
gb|ABR15425.1|  (-)-isopiperitenone reductase                           260   5e-80    
dbj|BAJ88645.1|  predicted protein                                      261   8e-80    
tpg|DAA36696.1|  TPA: hypothetical protein ZEAMMB73_857259              259   9e-80    
ref|XP_010943682.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       261   1e-79    
ref|XP_006341723.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       258   2e-79    
gb|KGN66402.1|  hypothetical protein Csa_1G600920                       261   2e-79    
ref|XP_009369038.1|  PREDICTED: salutaridine reductase-like             258   3e-79    
gb|AGT17181.1|  hypothetical protein SHCRBa_069_M12_R_60                257   5e-79    
ref|XP_004975343.1|  PREDICTED: salutaridine reductase-like             257   5e-79    
gb|ABW86886.1|  menthol dehydrogenase                                   256   1e-78    
gb|EMT32843.1|  (+)-neomenthol dehydrogenase                            258   1e-78    
gb|ACG28450.1|  carbonyl reductase 3                                    256   1e-78    
ref|NP_001147467.1|  LOC100281076                                       256   1e-78    
gb|ACG44790.1|  carbonyl reductase 1                                    256   2e-78    
tpg|DAA36701.1|  TPA: hypothetical protein ZEAMMB73_024733              256   2e-78    
emb|CAD41155.2|  OSJNBa0081C01.25                                       255   3e-78    
ref|NP_001136865.1|  uncharacterized protein LOC100217017               255   3e-78    
ref|XP_008230969.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       255   3e-78    
sp|Q6WAU1.1|IPIPR_MENPI  RecName: Full=(-)-isopiperitenone reductase    255   4e-78    
ref|NP_001148440.1|  short-chain dehydrogenase/reductase SDR            254   5e-78    
gb|ABW86884.1|  isopiperitenone reductase                               254   6e-78    
gb|EMS50397.1|  Short-chain dehydrogenase/reductase 2                   256   6e-78    
ref|XP_011028502.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       254   6e-78    
emb|CAE03869.2|  OSJNBa0081C01.19                                       254   8e-78    
ref|XP_009620590.1|  PREDICTED: short-chain dehydrogenase/reducta...    254   9e-78    
ref|XP_010031633.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       254   9e-78    
ref|XP_002454580.1|  hypothetical protein SORBIDRAFT_04g033780          253   1e-77    
ref|XP_002454574.1|  hypothetical protein SORBIDRAFT_04g033710          253   2e-77    
ref|XP_004248578.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    252   5e-77    
emb|CBI40300.3|  unnamed protein product                                249   8e-77    
ref|XP_008667878.1|  PREDICTED: uncharacterized protein LOC100280...    251   8e-77    
gb|ACL53476.1|  unknown                                                 251   9e-77    
gb|KHG10923.1|  Salutaridine reductase                                  251   1e-76    
ref|XP_002454575.1|  hypothetical protein SORBIDRAFT_04g033720          251   1e-76    
ref|XP_002450746.1|  hypothetical protein SORBIDRAFT_05g016850          251   1e-76    
gb|ACN35858.1|  unknown                                                 251   1e-76    
ref|XP_002454576.1|  hypothetical protein SORBIDRAFT_04g033730          250   2e-76    
ref|XP_004953254.1|  PREDICTED: salutaridine reductase-like             250   2e-76    
ref|XP_008344427.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    250   3e-76    
ref|NP_001146814.1|  uncharacterized protein LOC100280419               251   4e-76    
ref|NP_001141151.1|  hypothetical protein                               249   5e-76    
ref|XP_006340278.1|  PREDICTED: short-chain dehydrogenase/reducta...    249   5e-76    
ref|XP_006385156.1|  hypothetical protein POPTR_0004s24370g             249   6e-76    
emb|CAN66802.1|  hypothetical protein VITISV_041905                     249   8e-76    
gb|KCW78040.1|  hypothetical protein EUGRSUZ_D02261                     246   9e-76    
gb|EMT04347.1|  Short-chain dehydrogenase/reductase 2                   251   1e-75    
ref|XP_010651611.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    248   1e-75    
gb|ACU16111.1|  unknown                                                 245   2e-75    
tpg|DAA36698.1|  TPA: hypothetical protein ZEAMMB73_569025              251   2e-75    
ref|XP_010240175.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...    253   3e-75    
tpg|DAA36697.1|  TPA: hypothetical protein ZEAMMB73_569025              250   8e-75    
ref|XP_002274970.2|  PREDICTED: (+)-neomenthol dehydrogenase-like...    248   1e-74    
ref|XP_004953251.1|  PREDICTED: salutaridine reductase-like             245   2e-74    
emb|CBI24368.3|  unnamed protein product                                248   2e-74    
ref|XP_002454577.1|  hypothetical protein SORBIDRAFT_04g033740          245   3e-74    
ref|XP_004976334.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-isopiper...    245   3e-74    
ref|XP_007221117.1|  hypothetical protein PRUPE_ppa018152mg             242   4e-74    
gb|EEC77693.1|  hypothetical protein OsI_16756                          252   2e-73    
gb|EMT24464.1|  Short-chain dehydrogenase/reductase 2                   254   7e-73    
ref|XP_011043675.1|  PREDICTED: short-chain dehydrogenase/reducta...    241   2e-72    
ref|XP_011043658.1|  PREDICTED: short-chain dehydrogenase/reducta...    242   2e-72    
ref|XP_008344423.1|  PREDICTED: short-chain dehydrogenase/reducta...    240   4e-72    
ref|XP_002313619.2|  hypothetical protein POPTR_0009s15990g             240   7e-72    
ref|XP_008344425.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    239   8e-72    
gb|AET02065.2|  short chain dehydrogenase/reductase                     236   2e-71    
ref|XP_011043666.1|  PREDICTED: short-chain dehydrogenase/reducta...    239   2e-71    
dbj|BAD25370.1|  short-chain dehydrogenase/reductase protein-like       237   3e-71    
gb|EAY86850.1|  hypothetical protein OsI_08234                          235   2e-70    
ref|XP_009369057.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       234   2e-70    
emb|CAJ86410.1|  OSIGBa0125M19.13                                       236   3e-70    
ref|XP_004953252.1|  PREDICTED: salutaridine reductase-like isofo...    235   6e-70    
ref|XP_004953253.1|  PREDICTED: salutaridine reductase-like isofo...    235   7e-70    
ref|XP_009614220.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    232   1e-69    
emb|CAE03868.2|  OSJNBa0081C01.18                                       233   2e-69    
gb|AFW58954.1|  putative lectin-like receptor protein kinase fami...    245   3e-69    
ref|XP_009594776.1|  PREDICTED: short-chain dehydrogenase/reducta...    227   3e-68    
ref|XP_010238633.1|  PREDICTED: short-chain dehydrogenase/reducta...    229   3e-68    
ref|XP_010238632.1|  PREDICTED: short-chain dehydrogenase/reducta...    229   3e-68    
gb|AFW63154.1|  hypothetical protein ZEAMMB73_375424                    241   4e-68    
ref|XP_006652562.1|  PREDICTED: salutaridine reductase-like             228   6e-68    
emb|CDP08864.1|  unnamed protein product                                230   9e-68    
gb|AFW63153.1|  hypothetical protein ZEAMMB73_375424                    240   2e-67    
emb|CDP18266.1|  unnamed protein product                                226   1e-66    
ref|XP_004955551.1|  PREDICTED: salutaridine reductase-like             223   4e-66    
gb|KEH24287.1|  short chain dehydrogenase                               222   5e-66    
gb|EMT12915.1|  (+)-neomenthol dehydrogenase                            231   9e-66    
gb|AFK42212.1|  unknown                                                 218   4e-65    
gb|EMS62603.1|  Salutaridine reductase                                  222   5e-65    
ref|XP_010227207.1|  PREDICTED: uncharacterized protein LOC100837839    229   1e-64    
ref|XP_010327320.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    219   1e-64    
gb|EMT27615.1|  Short-chain dehydrogenase/reductase 2                   219   1e-64    
ref|XP_009358725.1|  PREDICTED: salutaridine reductase-like             215   9e-64    
gb|EMT30728.1|  Ubiquitin carboxyl-terminal hydrolase 22                226   4e-63    
gb|EMS46558.1|  (+)-neomenthol dehydrogenase                            214   2e-62    
ref|XP_002446844.1|  hypothetical protein SORBIDRAFT_06g023550          211   6e-62    
ref|XP_004976332.1|  PREDICTED: L-type lectin-domain containing r...    224   9e-62    
ref|XP_006440589.1|  hypothetical protein CICLE_v10023457mg             209   1e-61    
gb|AFK41060.1|  unknown                                                 208   2e-61    
ref|XP_008343395.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       207   8e-61    
ref|XP_006647591.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       209   1e-60    
gb|ADE77110.1|  unknown                                                 206   7e-60    
ref|XP_008368326.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       202   8e-60    
gb|EMS61470.1|  (+)-neomenthol dehydrogenase                            209   1e-59    
gb|KHN31241.1|  (+)-neomenthol dehydrogenase                            196   6e-56    
ref|NP_001077442.1|  Rossmann-fold NAD(P)-binding domain-containi...    195   1e-55    
ref|XP_010474805.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    194   2e-55    
ref|XP_003523181.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       196   2e-55    
gb|KCW78036.1|  hypothetical protein EUGRSUZ_D02259                     193   2e-55    
gb|KHN09697.1|  (+)-neomenthol dehydrogenase                            195   3e-55    
gb|KCW77566.1|  hypothetical protein EUGRSUZ_D01880                     193   6e-55    
emb|CAJ86404.1|  OSIGBa0125M19.7                                        206   7e-55    
ref|XP_003602735.1|  Carbonyl reductase-like protein                    194   7e-55    
ref|XP_003526913.2|  PREDICTED: (+)-neomenthol dehydrogenase-like       194   3e-54    
ref|XP_010052708.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    188   5e-54    
ref|XP_004502132.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...    191   7e-54    
ref|XP_004503819.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       190   3e-53    
ref|XP_010313052.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       184   9e-53    
ref|XP_009116638.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       187   2e-52    
emb|CDY05983.1|  BnaA09g37970D                                          187   2e-52    
ref|XP_009119742.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    186   2e-52    
ref|XP_006386597.1|  hypothetical protein POPTR_0002s15810g             184   3e-52    
ref|XP_004503038.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       187   3e-52    
ref|XP_008464357.1|  PREDICTED: LOW QUALITY PROTEIN: carbonyl red...    187   4e-52    
gb|EYU32086.1|  hypothetical protein MIMGU_mgv1a0112061mg               185   4e-52    
ref|XP_010512245.1|  PREDICTED: salutaridine reductase-like             186   4e-52    
ref|XP_010469284.1|  PREDICTED: salutaridine reductase-like             185   2e-51    
ref|XP_004138015.1|  PREDICTED: short-chain dehydrogenase/reducta...    185   2e-51    
ref|XP_003525167.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       185   2e-51    
ref|XP_007159946.1|  hypothetical protein PHAVU_002G280700g             185   3e-51    



>ref|XP_010326194.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Solanum lycopersicum]
Length=300

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 232/298 (78%), Gaps = 7/298 (2%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVL  878
             A   + +YAVVTG NKGIGFEICRQLA  GV V+L ARNE +G EA+EKL+G GL++NV+
Sbjct  2     AEGRATKYAVVTGANKGIGFEICRQLASNGVLVILGARNEKRGIEALEKLKGFGLAENVV  61

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA------SMGRVLN  716
             FH+LDV D S++ SL  FI T FGRLDILVNNAG+ G++A+  ALRA      + G  +N
Sbjct  62    FHQLDVVDNSSIDSLAEFIKTKFGRLDILVNNAGIAGVSADADALRAKRESSGTGGSQVN  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   +S ++EL+ EC+E NYYG+K+MTEA +PLLQ SKSPRIVNV+S   KL+++ +EWA
Sbjct  122   WNEILSQSFELAKECLETNYYGAKKMTEACIPLLQLSKSPRIVNVSSSMGKLKNLKHEWA  181

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
              GVLN+ E+    K++EV+N++L+D+K  S + KGWP  MSAY+VSKAAMNAY+R+ A K
Sbjct  182   TGVLNDSENLTEEKIEEVINQYLKDFKEDSLQAKGWPSLMSAYIVSKAAMNAYSRVMAKK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +PS+Q+NCV PG VKTDIN+N+G ++ +EGA+S VR+ALQP+DGPSG+FFD   + +F
Sbjct  242   HPSIQINCVCPGFVKTDINFNSGILSIEEGAESPVRLALQPDDGPSGLFFDRNGVSSF  299



>ref|XP_006339532.1| PREDICTED: short-chain dehydrogenase/reductase 2b-like [Solanum 
tuberosum]
Length=300

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 229/298 (77%), Gaps = 7/298 (2%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVL  878
             A   + +YAVVTG NKGIGFEICRQLA  GV V+L AR+E +G EA+EKL+G GL++NV+
Sbjct  2     AEGRATKYAVVTGANKGIGFEICRQLASHGVLVILGARDEKRGIEALEKLKGFGLAENVV  61

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVLN  716
             FH+LDV D S++ SL  FI   FGRLDILVNNAG+ G+ A+  ALRA        G  +N
Sbjct  62    FHQLDVVDNSSIDSLAEFIKIKFGRLDILVNNAGIAGVNADVDALRAKQESSGTGGSQVN  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   ++ ++EL+ EC+E NYYG KRMTEAF+PLLQ SKSPRIVNV+S   KL+++ +EWA
Sbjct  122   WNDILTQSFELAKECLETNYYGVKRMTEAFIPLLQLSKSPRIVNVSSSMGKLKNLKHEWA  181

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
              G+LN+ E+    K++ V+N++L+D+K  + + KGWP  MSAY+VSKAAMNAY+R+   K
Sbjct  182   TGILNDSENLTEEKIEGVINQYLKDFKEDTLQTKGWPSLMSAYIVSKAAMNAYSRVMTKK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +PS+Q+NCV PG VKTDIN+N+G ++ +EGA+S VR+ALQP+DGPSG+FFD K++ +F
Sbjct  242   HPSIQINCVCPGFVKTDINFNSGILSVEEGAESPVRLALQPDDGPSGLFFDRKEVSSF  299



>ref|XP_010326198.1| PREDICTED: uncharacterized protein LOC101260280 isoform X2 [Solanum 
lycopersicum]
Length=605

 Score =   364 bits (935),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 232/294 (79%), Gaps = 7/294 (2%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             S+RYAVVTG NKGIGFEICRQLA  GV V+L ARNE +G EA+EKL+G GL++NV+FH+L
Sbjct  311   SRRYAVVTGANKGIGFEICRQLASNGVLVILGARNEKRGIEALEKLKGFGLAENVVFHQL  370

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA------SMGRVLNFMRA  704
             DV D S++ SL  FI T FGRLDILVNNAG+ G++A+  ALRA      + G  +N+   
Sbjct  371   DVVDNSSIDSLAEFIKTKFGRLDILVNNAGIAGVSADADALRAKRESSGTGGSQVNWNEI  430

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S ++EL+ EC+E NYYG+K+MTEA +PLLQ SKSPRIVNV+S   KL+++ +EWA GVL
Sbjct  431   LSQSFELAKECLETNYYGAKKMTEACIPLLQLSKSPRIVNVSSSMGKLKNLKHEWATGVL  490

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             N+ E+    K++EV+N++L+D+K  S + KGWP  MSAY+VSKAAMNAY+R+ A K+PS+
Sbjct  491   NDSENLTEEKIEEVINQYLKDFKEDSLQAKGWPSLMSAYIVSKAAMNAYSRVMAKKHPSI  550

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             Q+NCV PG VKTDIN+N+G ++ +EGA+S VR+ALQP+DGPSG+FFD   + +F
Sbjct  551   QINCVCPGFVKTDINFNSGILSIEEGAESPVRLALQPDDGPSGLFFDRNGVSSF  604


 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 198/289 (69%), Gaps = 3/289 (1%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             ++R AVV+GGNKGIG EICRQLA +G+ V+LTAR+E KG+EAV  +     + N++FH+L
Sbjct  10    TQRIAVVSGGNKGIGLEICRQLASKGILVILTARDEKKGNEAVINMDEHS-NYNIIFHQL  68

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-LAANESALRASMGRVLNFMRAISHNY  689
             DVT+ S++ +L  FI   FG+LDILVNNA ++G L   +  +       +  M+  +   
Sbjct  69    DVTNISSIVTLRDFIKNRFGKLDILVNNAAILGVLLDKDFIINPQQNLFIEKMKVATQTI  128

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             ++  ECI+ NYYG+K M +  LPLLQ S SPRIVNV+S   KL+ + NEWA GVLN+ ++
Sbjct  129   DIGEECIKTNYYGAKWMIQELLPLLQLSDSPRIVNVSSSTGKLQHVRNEWAIGVLNDCDN  188

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 K+DEV+N FL+D+K    + K WP  +SAY +SKAA+N Y RI A KYP+  +NCV
Sbjct  189   LTEDKVDEVLNVFLKDFKEDLLESKNWPLIVSAYTLSKAALNGYTRILAKKYPNFLINCV  248

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              PG VKTD+ YN+G +T +EGAQS V +AL P+ GPSG F++ K +  F
Sbjct  249   CPGYVKTDLCYNSGILTVEEGAQSPVWLALLPQGGPSGNFYNRKNLSPF  297



>gb|KDP28662.1| hypothetical protein JCGZ_14433 [Jatropha curcas]
Length=294

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 224/294 (76%), Gaps = 5/294 (2%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVL  878
             A +A+KRYAVVTG NKGIGFEICRQL   G+ VVLTAR+E +G +A++KL   GLSD VL
Sbjct  2     AEEATKRYAVVTGANKGIGFEICRQLGSNGIVVVLTARDEKRGLDALQKLNDSGLSDYVL  61

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA--SMGRVLNFMRA  704
             FH+LDV + +++S+L  FI T FG+LDILVNNAG+ G  A+  ALRA    G  +N+ + 
Sbjct  62    FHQLDVANTASISALADFIKTQFGKLDILVNNAGISGNEADADALRAFDREGAGINWHKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
              +  YEL+ EC+ INYYG+KRM EAF+PLLQ S SPRIVNV+S   KL+++ NEWAK VL
Sbjct  122   TTETYELAEECVAINYYGAKRMVEAFVPLLQLSDSPRIVNVSSTMGKLKNVKNEWAKRVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    K+DEV++K+L D+K GS   + WP  +SAY++SKAAMNAY RITA+K+P+ 
Sbjct  182   DDAENLSEEKIDEVLSKYLNDFKEGSL--ESWPSFLSAYILSKAAMNAYTRITANKFPTF  239

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             ++NCV PG VKTDIN NTG ++ +EGA+  VRVAL P+DGPSG FFD K++ +F
Sbjct  240   RINCVCPGFVKTDINLNTGILSLEEGAEIPVRVALLPDDGPSGCFFDRKQVSSF  293



>gb|EYU32078.1| hypothetical protein MIMGU_mgv1a010860mg [Erythranthe guttata]
Length=299

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 222/294 (76%), Gaps = 7/294 (2%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNVLFHR  869
             +K+YAVVTGGNKGIG EICRQLA EG+TV+LTAR+E +G  AVE L+ G GLS++V+FH+
Sbjct  5     TKKYAVVTGGNKGIGLEICRQLASEGITVILTARDEQRGLAAVEYLKLGSGLSNDVVFHQ  64

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG-----RVLNFMRA  704
             LD+ D S++ SL  FIN+ FG+LDILVNNAG++G   +  A RAS G        N+   
Sbjct  65    LDLADLSSIHSLAQFINSQFGKLDILVNNAGILGAVVDGDAWRASTGSGTAGEKTNWRET  124

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YEL+ EC + NYYG+K+ TEA LPLL  S+SPRIVNV+S   KL++I +EW KGVL
Sbjct  125   MSQTYELAVECFQTNYYGAKKTTEALLPLLHLSQSPRIVNVSSTSGKLKNIPSEWVKGVL  184

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             N+ E     ++DEV+N FL+D K+G  + KGWP   +AY++SKAAMNA+ RI A KYPS 
Sbjct  185   NDTEKLTEERIDEVLNIFLKDLKDGVLEGKGWPELFAAYILSKAAMNAHTRILAKKYPSF  244

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             Q+NCV PG VKT+INY+TG +TA+EGA+S V++AL P+DGPSG+FF  K++ +F
Sbjct  245   QINCVCPGYVKTEINYSTGALTAEEGAESPVKLALMPDDGPSGMFFSRKEVASF  298



>gb|EYU32077.1| hypothetical protein MIMGU_mgv1a010747mg [Erythranthe guttata]
Length=303

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 226/300 (75%), Gaps = 10/300 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDN-V  881
             ++ +K+ AVVTG NKGIG EICRQLA EG+TV+LTAR+E +G  AVE L+G  G+SD+ V
Sbjct  2     AEVNKKCAVVTGANKGIGLEICRQLASEGITVILTARDEQRGLAAVETLKGSSGISDDDV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRV  722
             +FH+L VTD++++ SL  FIN+ FG+LDILVNNAG+ G   +  ALRAS        G  
Sbjct  62    IFHQLAVTDSASIDSLAQFINSRFGKLDILVNNAGIGGALVDADALRASTEAASGAGGAK  121

Query  721   LNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE  542
             +N+   +S  YEL+AEC+E NYYG+KR TEA LPLLQ S SPRIVNV+S   KL+++ NE
Sbjct  122   INWNEIMSQTYELAAECLETNYYGAKRTTEALLPLLQLSDSPRIVNVSSSMGKLKNLPNE  181

Query  541   WAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITA  365
             WAKG+LN+VE+    ++DEV+N FL+D+K G  ++K WP + +AY+VSKAAMNAY R+ A
Sbjct  182   WAKGILNDVENLTEERIDEVLNVFLKDFKEGLLEDKKWPRYFAAYIVSKAAMNAYTRVVA  241

Query  364   HKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              K+PS  +NCV PG VKTD+NY TG ++ +EGA+S V++AL P DGPSG+FF  K++ +F
Sbjct  242   KKHPSFHINCVCPGFVKTDMNYGTGVLSVEEGAESPVKLALMPHDGPSGMFFVRKEVSSF  301



>gb|KHG00239.1| Uncharacterized protein F383_18135 [Gossypium arboreum]
Length=322

 Score =   342 bits (877),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 224/287 (78%), Gaps = 5/287 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG EIC+Q+A +G  VVLTAR+E +G EAV+KL+ +GLSDNV+F
Sbjct  28    AEVTKRYAVVTGANKGIGLEICKQMASKGTMVVLTARDEKRGLEAVDKLKDLGLSDNVVF  87

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMR  707
             H+LDV D ++V+SLV FI T FG+LDILVNNAG+ G+ ++  ALRA+     G   N+  
Sbjct  88    HQLDVADPASVASLVDFIKTQFGKLDILVNNAGIGGVKSDLEALRAAGFGKPGAQPNWGS  147

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++ + ELS +C++ NYYG+KRM E+ + LLQ SKSPRIVNV+S   KL+++ NEWAK V
Sbjct  148   LLTQSPELSKQCLQTNYYGAKRMCESLIHLLQLSKSPRIVNVSSSMGKLKNVSNEWAKAV  207

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    K+DE+++++++D+K GS +EKGWP  MSAY++SKAAMNAY RI A KYP+
Sbjct  208   LSDAENLTEDKVDEIMSQYMKDFKEGSLQEKGWPAFMSAYILSKAAMNAYTRILAKKYPN  267

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
               +NCV PG VKTDIN+N+G ++ +EGA+S VR+AL P +GPSG+FF
Sbjct  268   FIINCVCPGFVKTDINFNSGILSVEEGAESPVRLALLPNNGPSGLFF  314



>ref|XP_002301348.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE80621.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=296

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 219/288 (76%), Gaps = 5/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGFEICRQLA +G+ VVLT+RNE +G E+V+KL+  GLSD V+F
Sbjct  2     AEATKSYAVVTGANKGIGFEICRQLASKGIVVVLTSRNEKRGLESVQKLKESGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLNFMR  707
             H+LDV D ++++SL  FI + FG+LDILVNNAGV G+  +  AL+A++    G  +N+  
Sbjct  62    HQLDVADINSIASLADFIKSQFGKLDILVNNAGVGGVKTDGDALKAAISGKEGAKINWSE  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I+  +EL+ EC+ INYYG+KRM EA +PLLQ S SPRIVNV+S    L+ + NEWAKGV
Sbjct  122   FITQTWELAEECLRINYYGAKRMAEALIPLLQLSDSPRIVNVSSSMGNLKGVSNEWAKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L + E+    ++DEV++K+LED+K GS + +GWP  MSAY++SKAAM+A+ R+ A K+P+
Sbjct  182   LGDAENLTEERVDEVLSKYLEDFKEGSLETEGWPAMMSAYILSKAAMSAFTRVLAKKHPT  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
               VNCV PG VKTDIN+NTG    +EGA+++VR+AL P  GPSG FFD
Sbjct  242   FCVNCVCPGYVKTDINFNTGIRPVEEGAENVVRLALLPNGGPSGCFFD  289



>emb|CDP11266.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 220/298 (74%), Gaps = 8/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             S + KRYA+VTG NKGIG+ ICRQLA  G+TVVLTARN  +G EA+E  +G+   DN++F
Sbjct  6     SSSKKRYAIVTGANKGIGYGICRQLASNGITVVLTARNLKRGLEAIESFKGLDFFDNIVF  65

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLN  716
             H+LDV D S+++SL  FI  ++GRLDILVNNAG+ G+  +  ALRAS        G  ++
Sbjct  66    HQLDVVDPSSIASLAEFIRIHYGRLDILVNNAGIGGVDVDVDALRASGYGSGGPDGSHID  125

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   ++  Y+L+ EC++ NYYG+KRM EAFLPLL  S SPRIVNV+S   KL+ I +EWA
Sbjct  126   WNGILTETYDLAVECLQTNYYGAKRMIEAFLPLLYLSDSPRIVNVSSSMGKLKHIPSEWA  185

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGVLN+  +    ++DEVVN+FL+D+K GS K KGWPP +SAY VSKAAMNAY R+ A K
Sbjct  186   KGVLNDSGNLTEERVDEVVNEFLKDFKEGSLKAKGWPPSISAYTVSKAAMNAYTRVLAKK  245

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +P  ++NCV PG VKTD+N+NTG +T +EGA+S VR+AL P+DG SG+FF   ++ +F
Sbjct  246   HPKFRINCVCPGFVKTDVNFNTGHLTVEEGAESPVRLALLPDDGSSGLFFVRNEVSSF  303



>ref|XP_010053674.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 gb|KCW78033.1| hypothetical protein EUGRSUZ_D02258 [Eucalyptus grandis]
 gb|KCW78034.1| hypothetical protein EUGRSUZ_D02258 [Eucalyptus grandis]
Length=298

 Score =   333 bits (854),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 218/289 (75%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG--LSDNV  881
             ++++KRYAVVTG NKGIG EICRQLA  G+ V+LT+R+E +G EAV+KL+     LSD++
Sbjct  2     AESTKRYAVVTGANKGIGLEICRQLASNGIMVILTSRDEKRGLEAVQKLKDSSSDLSDHI  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNF  713
             +FH+LDVTD ++VSSL +FI T FG+LDILVNNAG+ G  A+  AL+AS     G  +N+
Sbjct  62    VFHQLDVTDPASVSSLANFIKTGFGKLDILVNNAGIGGAVADGEALKASGFGKEGAQINW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                ++  YE++  C+E NY+G+KRM EA + LLQ S SPRIVNV+S   KL+ + NEWA+
Sbjct  122   KEVLTQPYEMAEACMETNYFGAKRMIEAHIDLLQLSNSPRIVNVSSSMGKLQRLSNEWAR  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GVL++ E+    K+D VV  FLED+KNGS + KGWP  ++AY+VSKAAMNAY RI A KY
Sbjct  182   GVLSDAENLTEEKVDGVVKAFLEDFKNGSLEAKGWPAVLAAYIVSKAAMNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P++ VNCV PG VKTDIN+NTG ++ +EGA+S V++AL P  GPSG FF
Sbjct  242   PNIIVNCVCPGFVKTDINFNTGILSVEEGAESPVKLALLPNGGPSGCFF  290



>ref|XP_011094700.1| PREDICTED: uncharacterized protein LOC105174332 [Sesamum indicum]
Length=632

 Score =   344 bits (882),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 223/295 (76%), Gaps = 11/295 (4%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVVTG NKGIGFE+CRQLA +G+TVVLTAR+E +G EAVEKL+   LS +V+FH+LDV
Sbjct  339   RYAVVTGSNKGIGFEVCRQLAAQGITVVLTARDEKRGLEAVEKLKASSLSGSVIFHQLDV  398

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV---------LNFMR  707
              D++TV++L  FI + FG+LDILVNNAGV G+  +  +L+AS G           L+ ++
Sbjct  399   ADSATVATLAEFIKSQFGKLDILVNNAGVSGITVDRESLKASPGAASETGGSKTNLSEIK  458

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I   Y+L+AEC++INYYG+KR TEA LPLLQ S SPRIVNVTS   KLE+I +EW KGV
Sbjct  459   MI-QTYDLAAECLQINYYGAKRTTEALLPLLQLSDSPRIVNVTSSLGKLENIPDEWVKGV  517

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    K+D+++N+FL+D+K GS + KGWP +  AY++SKAA+NAY RI A KYPS
Sbjct  518   LSDAENLTEDKIDQLLNEFLKDFKEGSLEAKGWPKYNGAYIISKAALNAYTRILAKKYPS  577

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++N V PG V TDIN+NTG +T +E A+ +V++AL  +DGPSG FF+ K++ +F
Sbjct  578   FRINSVCPGYVNTDINFNTGHMTVEEAAEGLVKLALLADDGPSGCFFERKEVSSF  632


 Score =   337 bits (864),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 222/294 (76%), Gaps = 10/294 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +K+YAVVTG NKGIGFE+CRQLA +G+TVVLTARNE +G EAVEKL+   LS +++F
Sbjct  2     AEVTKKYAVVTGANKGIGFEVCRQLATQGITVVLTARNEKRGLEAVEKLKASSLSGSIIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR------ASMGRVLNF  713
             H+LDVTD ++++SL  FI + FG+LDILVNNAG+ G+  + +A+R         G  +N+
Sbjct  62    HQLDVTDLASIASLAEFIKSQFGKLDILVNNAGIGGVTVDSNAIRAVAGAAGETGAGVNW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                +   Y+ +AEC + NYYG+KR  EA LPLLQ S SPRIVNV+S   KL+++ N WAK
Sbjct  122   TEVVIQTYDSAAECFQTNYYGAKRTAEALLPLLQLSDSPRIVNVSSLLGKLKNLPNVWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GVL++VE+    ++D+V+N+FL+D+K G  + KGW     AY+VSKAAMNAY RI A KY
Sbjct  182   GVLSDVENLTEERIDQVLNEFLKDFKEGCLEAKGWS---GAYMVSKAAMNAYTRILAKKY  238

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             PS Q+N V PG VKTDIN+NTG +T +EGA+S+VR+A+ P+DGPSG+FFD K++
Sbjct  239   PSFQINSVCPGYVKTDINFNTGYLTVEEGAESLVRLAVLPDDGPSGLFFDRKEV  292



>ref|XP_007051877.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOX96034.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=600

 Score =   342 bits (876),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 219/295 (74%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG EIC+QLA +G+TV+LTAR+E +G EAV KL+  GLSDNV+F
Sbjct  2     AEVTKRYAVVTGANKGIGLEICKQLASKGITVLLTARDEKRGLEAVGKLKQCGLSDNVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMR  707
             H+LDV D ++++ LV FI T FG+LDILVNNAG+ G+ A+  A+RA+     G  LN+  
Sbjct  62    HQLDVADPASIAPLVDFIKTQFGKLDILVNNAGISGVEADADAIRAAGFGKPGIQLNWSE  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++   +LS EC+E NYYG+KRM E+ +PLLQ+S SPRIVNV+S   +LE + NEWAK V
Sbjct  122   VMTQTSQLSEECVETNYYGAKRMCESLIPLLQKSDSPRIVNVSSFMGRLEKVSNEWAKAV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              ++ E+    K+DEV++++L+D+K GS + KGWP  MSAY++SKAAMNAY RI A KYP 
Sbjct  182   FSDAENLTEEKVDEVLSQYLKDFKEGSLEAKGWPTFMSAYILSKAAMNAYTRILAKKYPG  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
               +NCV PG VKTDINYN G +T +EGA + VR+AL P  GPSG FF   + + F
Sbjct  242   FCINCVCPGFVKTDINYNCGILTVEEGAGNAVRLALLPNGGPSGRFFHRMQELGF  296


 Score =   310 bits (793),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/289 (55%), Positives = 212/289 (73%), Gaps = 10/289 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIGF I +QLA +G+TV+LTAR+E +G EAVEKL+   LSDNV F
Sbjct  307   AEVTKRYAVVTGANKGIGFGISKQLASKGITVLLTARDEKRGLEAVEKLKQYVLSDNVDF  366

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVI--GLAANESALRAS----MGRVLNF  713
             H+LDV D ++++SLV FI T FG+LDILVNNAG+   G+ A+ +ALRA+     G  LN 
Sbjct  367   HQLDVVDPASIASLVDFIKTQFGKLDILVNNAGIYINGVQADANALRAAGLSKPGAQLNR  426

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                ++   EL   C++ NYYG+KRM E+ +PLLQ S SPRIVNV+S   KL++I N+WAK
Sbjct  427   HELMTQTAEL---CLQTNYYGAKRMCESLIPLLQLSDSPRIVNVSSNMGKLKNIPNKWAK  483

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              +L++ E+    K+DEV++++L+D K GS + KGWP  MSAYV+SKAAMNA+ RI A K 
Sbjct  484   AILSDAENLTEEKVDEVLSEYLKDLKEGSLQAKGWPAFMSAYVLSKAAMNAHTRILAKKN  543

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P   +NCV PG VKTD+N ++G +T +EGA S VR+AL P  GPSG FF
Sbjct  544   PGFYINCVCPGFVKTDMNNHSGFLTVEEGAASPVRLALLPNGGPSGCFF  592



>ref|XP_011023378.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Populus 
euphratica]
Length=296

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 214/288 (74%), Gaps = 5/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGFEICRQLA +G+ VVLT+RNE +G E+V+ L+  GLSD V+F
Sbjct  2     AEATKSYAVVTGANKGIGFEICRQLASKGIVVVLTSRNEKRGLESVQNLKESGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLNFMR  707
             H+LDV D ++++SL  FI + FG+LDILVNNAGV G+  +  AL A +    G  +N+  
Sbjct  62    HQLDVADINSIASLADFIKSRFGKLDILVNNAGVGGVKTDVDALNAFISGNEGAKINWSE  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I+  +EL  EC+ INYYG+KRM EA +PLLQ S SP IVNV+S   KL+ + NEWAKGV
Sbjct  122   FITETWELVEECLRINYYGAKRMAEALIPLLQLSDSPIIVNVSSSMGKLKGVSNEWAKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    ++DEV++K+LED+K GS + +GWP  MSAY++SKAAM+A  RI A KYP+
Sbjct  182   LSDAENLTEERVDEVLSKYLEDFKEGSLETEGWPAMMSAYILSKAAMSASTRILAKKYPT  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
               +NCV PG VKTDIN+NTG    +EGA+++VR+AL P   PSG FFD
Sbjct  242   FCINCVCPGYVKTDINFNTGIRPVEEGAENVVRLALLPNGAPSGCFFD  289



>ref|XP_002267348.2| PREDICTED: (+)-neomenthol dehydrogenase [Vitis vinifera]
 emb|CBI40297.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 222/298 (74%), Gaps = 10/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ RYAVVTG NKGIG EICRQLA  GV VVLTAR+E +G EA+E L+G GLS N++F
Sbjct  2     AEAATRYAVVTGANKGIGLEICRQLAANGVRVVLTARDEKRGLEALESLKGSGLS-NLVF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-LAANESALRA------SMGRVLN  716
             H+LDV D +++SS+  FI   FG+LDILVNNAG+ G +  +  ALR+      ++G+V N
Sbjct  61    HQLDVGDPASISSIADFIKAQFGKLDILVNNAGIGGTVVTDPDALRSRIASAEAVGKV-N  119

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   +   +EL  EC++INYYG KRM EAF+PLLQ S SPRIVNV+S   KL++I NEWA
Sbjct  120   WKEIMIEPFELVEECLKINYYGPKRMIEAFIPLLQLSDSPRIVNVSSSMGKLQNIKNEWA  179

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             K VL++ E+    ++DEV+N+FL+D+K G  + K WP ++SAY VSKAA+NAY RI A K
Sbjct  180   KAVLSDAENLTEERVDEVLNQFLKDFKEGLLEAKSWPSNLSAYTVSKAALNAYTRILARK  239

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             YP+L +NCV PG VKTD+NYN+G +T +EGA+S VR+AL P+ GPSG FF  K++  F
Sbjct  240   YPTLCINCVCPGFVKTDLNYNSGILTIEEGAESPVRLALLPDGGPSGQFFVRKEVSEF  297



>emb|CBI40296.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/299 (55%), Positives = 219/299 (73%), Gaps = 11/299 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ RYAV+TG NKGIG EICRQLA  GV VVLTAR+E +G EA+E L+G GLS NV+F
Sbjct  2     AEATNRYAVITGANKGIGLEICRQLAANGVIVVLTARDEKRGVEALESLKGSGLS-NVVF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANES--------ALRASMGRVL  719
             H+LDV D ++++SL  FI T FG+LDILVNNAG+IG    +         A RA +G++ 
Sbjct  61    HQLDVGDPASIASLADFIKTQFGKLDILVNNAGIIGTLVTDPDGFRLGIPAARAKVGKI-  119

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             N+   +   +EL+ EC++INYYG KRM+E  +PLL+ S SPRIVNV+S   +L++I NEW
Sbjct  120   NWKEIMIEPFELAEECMKINYYGPKRMSEVLIPLLRLSDSPRIVNVSSSMGRLQNIKNEW  179

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AKGVL++ E+    ++DEV+N FL+D+K GS + K WP  +SA  VSK+A+NAY RI A 
Sbjct  180   AKGVLSDAENLTEERVDEVLNVFLKDFKEGSLEAKSWPTFLSANTVSKSALNAYTRIMAK  239

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYP+  +NCV PG VKTDINYN+G +T +EGA+S VR+AL P+ GPSG FF  K++  F
Sbjct  240   KYPTFCINCVCPGFVKTDINYNSGILTVEEGAESPVRLALLPDGGPSGQFFLQKEVSEF  298



>ref|XP_010661731.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Vitis 
vinifera]
Length=304

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/299 (55%), Positives = 219/299 (73%), Gaps = 11/299 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ RYAV+TG NKGIG EICRQLA  GV VVLTAR+E +G EA+E L+G GLS NV+F
Sbjct  8     AEATNRYAVITGANKGIGLEICRQLAANGVIVVLTARDEKRGVEALESLKGSGLS-NVVF  66

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANES--------ALRASMGRVL  719
             H+LDV D ++++SL  FI T FG+LDILVNNAG+IG    +         A RA +G++ 
Sbjct  67    HQLDVGDPASIASLADFIKTQFGKLDILVNNAGIIGTLVTDPDGFRLGIPAARAKVGKI-  125

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             N+   +   +EL+ EC++INYYG KRM+E  +PLL+ S SPRIVNV+S   +L++I NEW
Sbjct  126   NWKEIMIEPFELAEECMKINYYGPKRMSEVLIPLLRLSDSPRIVNVSSSMGRLQNIKNEW  185

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AKGVL++ E+    ++DEV+N FL+D+K GS + K WP  +SA  VSK+A+NAY RI A 
Sbjct  186   AKGVLSDAENLTEERVDEVLNVFLKDFKEGSLEAKSWPTFLSANTVSKSALNAYTRIMAK  245

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYP+  +NCV PG VKTDINYN+G +T +EGA+S VR+AL P+ GPSG FF  K++  F
Sbjct  246   KYPTFCINCVCPGFVKTDINYNSGILTVEEGAESPVRLALLPDGGPSGQFFLQKEVSEF  304



>ref|XP_010661732.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Vitis 
vinifera]
Length=296

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 165/297 (56%), Positives = 217/297 (73%), Gaps = 11/297 (4%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             AS RYAV+TG NKGIG EICRQLA  GV VVLTAR+E +G EA+E L+G GLS NV+FH+
Sbjct  2     ASLRYAVITGANKGIGLEICRQLAANGVIVVLTARDEKRGVEALESLKGSGLS-NVVFHQ  60

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANES--------ALRASMGRVLNF  713
             LDV D ++++SL  FI T FG+LDILVNNAG+IG    +         A RA +G++ N+
Sbjct  61    LDVGDPASIASLADFIKTQFGKLDILVNNAGIIGTLVTDPDGFRLGIPAARAKVGKI-NW  119

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                +   +EL+ EC++INYYG KRM+E  +PLL+ S SPRIVNV+S   +L++I NEWAK
Sbjct  120   KEIMIEPFELAEECMKINYYGPKRMSEVLIPLLRLSDSPRIVNVSSSMGRLQNIKNEWAK  179

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GVL++ E+    ++DEV+N FL+D+K GS + K WP  +SA  VSK+A+NAY RI A KY
Sbjct  180   GVLSDAENLTEERVDEVLNVFLKDFKEGSLEAKSWPTFLSANTVSKSALNAYTRIMAKKY  239

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             P+  +NCV PG VKTDINYN+G +T +EGA+S VR+AL P+ GPSG FF  K++  F
Sbjct  240   PTFCINCVCPGFVKTDINYNSGILTVEEGAESPVRLALLPDGGPSGQFFLQKEVSEF  296



>ref|XP_011094713.1| PREDICTED: uncharacterized protein LOC105174340 [Sesamum indicum]
Length=918

 Score =   347 bits (889),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 223/293 (76%), Gaps = 8/293 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+K+YAVVTG NKGIG EICRQLA EG+TVVLTAR+E +G EAVEKL+  GLSD V+FH+
Sbjct  307   ATKKYAVVTGANKGIGLEICRQLAREGITVVLTARDEKRGLEAVEKLKSSGLSDCVVFHQ  366

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-------LNFM  710
             LDV D ++V SL  F+ + FG+LDILVNNAG+ G   +  + +AS G         +N+ 
Sbjct  367   LDVADLASVVSLAEFVKSQFGKLDILVNNAGIGGAIVDGESFKASAGAASGTGGAKINWS  426

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               ++  Y+L+AEC++INYYG+KR TEA LP LQ S SPRIVNV+S   KLE I NEWAK 
Sbjct  427   EIMTQPYDLAAECLQINYYGAKRTTEALLPQLQLSDSPRIVNVSSSMGKLEYIPNEWAKE  486

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VLN+ E+    ++D+V+N+FL+D+K GS + KGWP ++SAY++SKAAMNAY RI A KYP
Sbjct  487   VLNDAENLTEERIDQVLNEFLKDFKEGSLEAKGWPGYLSAYILSKAAMNAYTRILAKKYP  546

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             + ++NCV PG VKTDIN+NTG +T +EGA+S VR+AL P+DGPSG FF  K++
Sbjct  547   NFRINCVCPGYVKTDINFNTGYLTPEEGAESPVRLALLPDDGPSGEFFVRKEV  599


 Score =   343 bits (880),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 225/300 (75%), Gaps = 11/300 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++  KRYAVVTG NKGIGFE+CRQLA +G+TVVLTAR+E +G EAVEKL+   LS +V+F
Sbjct  2     AETPKRYAVVTGSNKGIGFEVCRQLAAQGITVVLTARDEKRGLEAVEKLKASSLSGSVIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV---------  722
             H+LDV D+++V+SL  FI + FG+LDILVNNAGV G+     +L+AS G           
Sbjct  62    HQLDVADSASVASLAEFIKSQFGKLDILVNNAGVSGVTVEGESLKASPGDASETGGSKSN  121

Query  721   LNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE  542
             L+ ++ ++  Y+L+AEC++INYYG+KR  EA LPLLQ S SPRI+NV+S   KLE+I +E
Sbjct  122   LSEIK-LTQTYDLAAECLQINYYGAKRTIEALLPLLQLSDSPRIINVSSSLGKLENIPDE  180

Query  541   WAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITA  365
             W KGVL++ E+    K+DEV+N+FL+D+K GS + KGWP +  AY++SKAA+ AY RI A
Sbjct  181   WVKGVLSDAENLTEDKIDEVLNEFLKDFKEGSLEAKGWPKYNGAYILSKAALIAYTRILA  240

Query  364   HKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              KYPS Q+N   PG V TDIN++TG +TA+EGA+ +V VAL P+DGPSG FF+ K++ +F
Sbjct  241   KKYPSFQINSACPGYVNTDINFHTGHLTAEEGAERVVWVALLPDDGPSGCFFEKKEVSSF  300


 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 206/291 (71%), Gaps = 11/291 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             S A K+YAVVTG NKGIG EICRQL  +GV+VVLTARNE +G +AVEKL+  GLSD ++F
Sbjct  638   STAIKKYAVVTGANKGIGLEICRQLTSQGVSVVLTARNEKRGLDAVEKLKKSGLSDYIMF  697

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDV D++++ SL  F+ +  G+LDILVNNA  +G   +     A M R          
Sbjct  698   HQLDVMDSASIDSLAVFMKSQIGKLDILVNNA-GVGGTTDGGTGGAKMKRT---------  747

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YEL+ EC+++NYYG+KR TEA LPLLQ S SPRIVNV+S    L  I N+WA+  LN+V
Sbjct  748   AYELAVECLQVNYYGTKRTTEALLPLLQLSDSPRIVNVSSSMGALSGIRNKWARDTLNDV  807

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+     +D+V+N+ L+D+K GS + KGWP +MSAY +SKAA+NAY R+ + KYP + +N
Sbjct  808   ENLTEESIDQVLNECLKDFKEGSVEAKGWPSYMSAYCISKAAVNAYTRLLSKKYPKMLIN  867

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              V PG  KTD++ +TG +T +E A+S VRVAL P+DGPSG FF+  ++ +F
Sbjct  868   AVGPGWTKTDLSNHTGTLTPEEAARSPVRVALLPDDGPSGTFFERMQVSSF  918



>ref|XP_010544713.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Tarenaya hassleriana]
Length=295

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 215/294 (73%), Gaps = 4/294 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NV  881
             +D   R AVVTG N+GIG EICRQLA +G+ VVLT+R+E +G EA EKL+  +G+ D ++
Sbjct  2     TDQVTRLAVVTGANRGIGLEICRQLANKGIAVVLTSRDEKRGLEAAEKLKKELGVPDQDI  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
             +FH+LDV D +++++L  F+ + FG+LDILVNNAGV G+  +  ALRA MG+    +   
Sbjct  62    VFHQLDVADPASITTLAEFVKSRFGKLDILVNNAGVGGIITDVDALRAGMGKEGFKWEEV  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             IS  YEL+ ECI+INYYG KRM EAF+PLLQ S S RIVNV+S   KL+++ NEWAKG+L
Sbjct  122   ISETYELAEECIKINYYGPKRMCEAFIPLLQLSDSSRIVNVSSSMGKLKNVVNEWAKGIL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
              + ++    K+DEV+N+ L+D+K G  K K W   MSAYVVSKAA+NAY  I A KYPS 
Sbjct  182   TDADNLSEEKIDEVLNQLLKDFKEGIDKTKNWAKFMSAYVVSKAALNAYTGILAKKYPSF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             ++N V PG VKTDIN+NTG ++ +EGA S VR+AL P DGPSG FFD K++  F
Sbjct  242   RINAVCPGFVKTDINFNTGVLSVEEGASSPVRLALLPNDGPSGCFFDRKEVSEF  295



>emb|CDP08858.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 215/289 (74%), Gaps = 6/289 (2%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDNVLFHRL  866
             KRYAVVTG NKGIGFEICRQLA +G+TVVLTAR+E +G +A  KL+   GLS ++LFH+L
Sbjct  10    KRYAVVTGANKGIGFEICRQLASQGITVVLTARDEKRGLDAFHKLKATDGLSGDLLFHQL  69

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-MGRVLNFMRAISHNY  689
             DV D S+V+++  F+ T  GRLDILVNNAGV G   +  AL+AS +G   ++ + I+  Y
Sbjct  70    DVADPSSVAAIAEFVKTQLGRLDILVNNAGVGGSIVDSEALKASTVGPDFDWKKIITETY  129

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             ELSAEC++INYYG+KRM EAFLPLLQ S SPRIVNV+S   +L ++ NEWAKG+  +V++
Sbjct  130   ELSAECLQINYYGAKRMIEAFLPLLQLSPSPRIVNVSSSMGRLMNVPNEWAKGIFRDVDN  189

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 ++DEV+N++L+D+K G  +   WP    AY ++KA+MNAY RI A K+P  +VNCV
Sbjct  190   LTEERVDEVLNEYLKDFKEGLLEANDWP---VAYTLAKASMNAYTRIVAGKFPRFKVNCV  246

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              PG VKTDI +N G +T +EGA+S V +AL P+DGPSGVFF  K + +F
Sbjct  247   CPGYVKTDITFNCGILTVEEGAESPVMLALLPDDGPSGVFFFRKGLSSF  295



>gb|KHG00238.1| Uncharacterized protein F383_18135 [Gossypium arboreum]
Length=592

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 221/283 (78%), Gaps = 5/283 (2%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             ++YAVVTG NKGIG EIC+Q+A +G  VVLTAR+E +G EAV+KL+ +GLSDNV+FH+LD
Sbjct  302   QKYAVVTGANKGIGLEICKQMASKGTMVVLTARDEKRGLEAVDKLKDLGLSDNVVFHQLD  361

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMRAISH  695
             V D ++V+SLV FI T FG+LDILVNNAG+ G+ ++  ALRA+     G   N+   ++ 
Sbjct  362   VADPASVASLVDFIKTQFGKLDILVNNAGIGGVKSDLEALRAAGFGKPGAQPNWGSLLTQ  421

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
             + ELS +C++ NYYG+KRM E+ + LLQ SKSPRIVNV+S   KL+++ NEWAK VL++ 
Sbjct  422   SPELSKQCLQTNYYGAKRMCESLIHLLQLSKSPRIVNVSSSMGKLKNVSNEWAKAVLSDA  481

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    K+DE+++++++D+K GS +EKGWP  MSAY++SKAAMNAY RI A KYP+  +N
Sbjct  482   ENLTEDKVDEIMSQYMKDFKEGSLQEKGWPAFMSAYILSKAAMNAYTRILAKKYPNFIIN  541

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             CV PG VKTDIN+N+G ++ +EGA+S VR+AL P +GPSG+FF
Sbjct  542   CVCPGFVKTDINFNSGILSVEEGAESPVRLALLPNNGPSGLFF  584


 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 147/290 (51%), Positives = 196/290 (68%), Gaps = 19/290 (7%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKG+GFEIC+QLA  G+ VVLTAR+E +G EA+E L+  GLSD ++F
Sbjct  2     AEVTKRYAVVTGANKGVGFEICKQLAQNGIMVVLTARDEKRGLEALESLKRSGLSDYLVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLA--------ANESALRASMGRVL  719
             H+LD+TD  +++SL  F+   FG+LDILVNNAG++G+          N S +++ M    
Sbjct  62    HQLDITDPESIASLADFVKKQFGKLDILVNNAGILGVTFLFTPGTEVNSSDIQSKM----  117

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
                     NYEL+ EC++INYYG+KR  EA +PLLQ S  PRIVN+ S    LE    E 
Sbjct  118   -----TDGNYELAEECLKINYYGAKRTAEALIPLLQLSDLPRIVNLASSVVMLEGT-GEK  171

Query  538   AKGVLNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
              KGVL  V +   KL++++ ++L+D+K G    KGWP   SAY VSK A+ AY RI A+K
Sbjct  172   LKGVLTGVTTEE-KLNDLIAEYLKDFKEGLHGSKGWPTFTSAYTVSKVALIAYTRILANK  230

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             YP   +N V PG  KTDIN NTG ITA+EGA + V++AL P+ GPSG+FF
Sbjct  231   YPDFCINSVCPGYAKTDINLNTGIITAEEGAVTPVKLALLPKGGPSGLFF  280



>ref|XP_010661735.1| PREDICTED: (+)-neomenthol dehydrogenase [Vitis vinifera]
 emb|CAN77657.1| hypothetical protein VITISV_002460 [Vitis vinifera]
 emb|CBI40293.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 220/298 (74%), Gaps = 9/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K+YAVVTG NKGIG  ICR+LA  GVTVVLTAR+E +G EA+E L+G GLS NV+F
Sbjct  2     AEATKKYAVVTGANKGIGLGICRELAANGVTVVLTARDEKRGVEALESLKGSGLS-NVIF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE-----SALRASMGRV--LN  716
             H+LDV   ++++SL  FI T FG+LDILVNNAGVIG+   +     SA+ A+ GR+  +N
Sbjct  61    HQLDVGQPASIASLADFIKTQFGKLDILVNNAGVIGMIVTDPDALRSAIAAAQGRIGEVN  120

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   +    E++ EC++INYYG KRM EA +PLLQ S  PRIVNV+S   KL++I NEWA
Sbjct  121   WNEIVIQPLEMAEECLKINYYGPKRMIEALMPLLQLSDLPRIVNVSSSGGKLQNIPNEWA  180

Query  535   KGVLNNVESPPGK-LDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGVL++ E+   + + EV+N+FL+D+K G  + K WP   SAY VSKAA+NAY R+ A K
Sbjct  181   KGVLSDAENLTEETVIEVLNQFLKDFKEGLLEAKSWPTFFSAYRVSKAALNAYTRLLAKK  240

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             YP+  +NCV PG VKTDINYN+G +T +EGA+S VR+AL P+ GPSG+FF  K++  F
Sbjct  241   YPTFCINCVCPGYVKTDINYNSGILTVEEGAESPVRLALLPDGGPSGLFFVRKEVSDF  298



>gb|EYU32079.1| hypothetical protein MIMGU_mgv1a010703mg [Erythranthe guttata]
Length=304

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 225/301 (75%), Gaps = 11/301 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDN-V  881
             ++ +K+ AVVTG NKGIG EICRQLA EG+TV+LTAR+E +G EAVE L+G  G+SD+ V
Sbjct  2     AEITKKCAVVTGANKGIGLEICRQLASEGITVILTARDEQRGLEAVENLKGSSGISDDGV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-------  722
             +FH+LDVTD +++ SL  FI + FG+LDILVNNA ++G   +  A RAS           
Sbjct  62    VFHQLDVTDLASIDSLAEFIKSQFGKLDILVNNAAILGAIVDGDAWRASNAAAAGGDGGA  121

Query  721   -LNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHN  545
              +++   ++ NY+L+ EC++ NYY +KR+TEA LPLL+ S+SPRIVNV+S   KL+ I N
Sbjct  122   KIDWNEIMTENYDLTEECLQTNYYSTKRITEALLPLLKLSESPRIVNVSSSMGKLKHIPN  181

Query  544   EWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARIT  368
             EWAKG+LN+ E+    ++DEVVN FL+D+K GS + KGWP + +AY+VSKAA++AY RI 
Sbjct  182   EWAKGILNDAENLTEERIDEVVNAFLKDFKEGSAEAKGWPQYSAAYIVSKAAVSAYTRIL  241

Query  367   AHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIA  188
             A KYPS ++NCV PG V TD+NY TG ++ +EGA+S V++AL P+DGPSG+FF  K++ +
Sbjct  242   AKKYPSFRINCVCPGYVNTDMNYGTGMLSVEEGAESPVKLALIPDDGPSGMFFFRKEVSS  301

Query  187   F  185
             F
Sbjct  302   F  302



>emb|CBI40298.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   325 bits (834),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 221/298 (74%), Gaps = 10/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ RYAVVTG NKGIG EICRQLA  GV VVLTAR+E +G EA+E L+G GLS N++F
Sbjct  2     AEAATRYAVVTGANKGIGLEICRQLAANGVRVVLTARDEKRGLEALESLKGSGLS-NLVF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-LAANESALRA------SMGRVLN  716
             H+LDV D +++SS+  FI   FG+LDILVNNAG+ G +  +  ALR+      ++G+V N
Sbjct  61    HQLDVGDPASISSIADFIKAQFGKLDILVNNAGIGGTVVTDPDALRSRYASAEAVGKV-N  119

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   +   +EL  EC++INYYG KRM EAF+PLLQ S SPRIVNV+S   KL++I NEWA
Sbjct  120   WKEIMIEPFELVEECLKINYYGPKRMIEAFIPLLQLSDSPRIVNVSSSMGKLQNIKNEWA  179

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             K VL++ E+    ++DEV+N+FL+D+K G  + K WP ++SAY VSKAA+NAY RI A K
Sbjct  180   KAVLSDAENLTEERVDEVLNQFLKDFKEGLLEAKSWPSNVSAYTVSKAALNAYTRILARK  239

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              P+L +NCV PG VKTD+NYN+G +T +EGA+S VR+AL P+ GPSG FF  K++  F
Sbjct  240   CPTLCINCVCPGFVKTDLNYNSGILTIEEGAESPVRLALLPDGGPSGQFFVRKEVSEF  297



>ref|XP_009116784.1| PREDICTED: (+)-neomenthol dehydrogenase [Brassica rapa]
 emb|CDY48937.1| BnaA09g39000D [Brassica napus]
Length=296

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 216/295 (73%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVL  878
             ++ + RYAVVTG N+GIGFEICRQLA  G+ VVLT+RNE +G EAVE LR  +G+SD  L
Sbjct  2     TEETPRYAVVTGANRGIGFEICRQLASNGIRVVLTSRNEKRGQEAVETLRQEIGVSDQTL  61

Query  877   -FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
              FH+LDVTD ++V+SLV F+ T FG+LDIL+NNAGV G   +   L+A  G+V  N+   
Sbjct  62    VFHQLDVTDPASVTSLVEFVKTQFGKLDILINNAGVGGTITDVETLQAGAGKVGFNWEET  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+ NYEL+ EC+ INYYG KRM EAF+PLL+ S SPRIVNV+S   +L++I NEWAKGVL
Sbjct  122   ITENYELAKECMNINYYGPKRMCEAFIPLLKLSDSPRIVNVSSFMGQLKNIFNEWAKGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++DEV+NK LE++K G  K K W   M+AYVVSKA +N Y RI A K+P +
Sbjct  182   SDAENLTEERIDEVINKLLEEFKEGKVKTKDWASVMAAYVVSKAGLNGYTRIIAKKHPEI  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +VN V PG VKTD+NYNTG ++ +EGA S VR+AL P ++  SG FF  K++  F
Sbjct  242   RVNAVCPGFVKTDMNYNTGVLSVEEGASSPVRLALLPHQETTSGCFFYRKQLSEF  296



>ref|XP_009343598.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=296

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 213/295 (72%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KR AVVTG NKGIGF I +QLA +G+TVVLTAR+E +G EAVEKL+  GL   V+F
Sbjct  2     AEATKRCAVVTGANKGIGFGIVKQLASDGITVVLTARDEKRGLEAVEKLKQSGLGGEVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFMR  707
             H+LDV + ST++ L  FI T FG+LDILVNNAGV G   +  A +A +       +++ +
Sbjct  62    HQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDADAFKAEIASGWKETIDWNK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++ NYEL+ EC++INYYG+KR TEA +PLL+ S+SPRIVNV+S    L  I ++  KGV
Sbjct  122   VMTENYELAKECVQINYYGAKRTTEALIPLLRLSESPRIVNVSSSMGNLNKIPSDRVKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              ++VE+    ++DEV+ +FLED+K GS + KGWP HMS+Y++SKAAMNAY RI A KYP 
Sbjct  182   FSDVENLTQEQIDEVLTQFLEDFKEGSLESKGWPSHMSSYILSKAAMNAYTRILAKKYPD  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++NCV PG VKTDIN N+G +  +EGA  +V++A  P DGPSG FF   ++  F
Sbjct  242   FRINCVCPGFVKTDINSNSGVLPVEEGAARVVKLAFLPNDGPSGCFFSQNEVTDF  296



>ref|XP_008232781.1| PREDICTED: short-chain dehydrogenase/reductase 2b-like [Prunus 
mume]
Length=293

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/292 (55%), Positives = 215/292 (74%), Gaps = 2/292 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIGF   RQLA  GVTVVLTAR+E +G EAVE+L+ +GLSD V+F
Sbjct  2     AEATKRYAVVTGANKGIGFGTVRQLASNGVTVVLTARDEKRGLEAVEQLKELGLSDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMR-AIS  698
             H+LDVTD  +++SL  F+ T+ G+LDILVNNAG+IG   N  A R++    +++   + +
Sbjct  62    HQLDVTDPVSIASLADFVKTHHGKLDILVNNAGIIGSQLNPEAFRSAKAEEIDWSEVSTT  121

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
              NYEL+ EC+E NYYG+KR+TEA LP+LQ S SPRIVNV+S ++KL +  N WAK VL+ 
Sbjct  122   LNYELAEECLETNYYGTKRVTEALLPILQLSDSPRIVNVSSRFAKLMNFPNGWAKEVLSE  181

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              ES    ++D+V+  FLED K G  + K WPP    Y VSKAA+NAY RI A+KYP+  +
Sbjct  182   AESLTEVRIDDVLGVFLEDIKQGLAETKSWPPLFPPYSVSKAALNAYTRILANKYPNFYI  241

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NCV+PG VKTDI+YNTG +T  EGA+S+V +AL P  GP+G++F  +++  F
Sbjct  242   NCVSPGFVKTDISYNTGVLTIDEGAESLVWLALLPNGGPTGLYFLRQEVTPF  293



>ref|XP_007224111.1| hypothetical protein PRUPE_ppa015667mg [Prunus persica]
 gb|EMJ25310.1| hypothetical protein PRUPE_ppa015667mg [Prunus persica]
Length=301

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 215/295 (73%), Gaps = 8/295 (3%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             S+RYAVVTG NKG+GF   RQLA  GV VVLTAR+E +G EAV+KL+  GLSD V+FH+L
Sbjct  7     SQRYAVVTGANKGVGFATVRQLASNGVIVVLTARDEKRGLEAVDKLKEFGLSDLVVFHQL  66

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLNFMR  707
             DVTDA++++SL  F+   FG+LDILVNNAGV G   +  A+RA+        G  +N+  
Sbjct  67    DVTDAASIASLADFVKAQFGKLDILVNNAGVGGTIVDPEAMRAAAASGLGKEGVEVNWTE  126

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++  YEL+ EC++ NY+G+K+MT+A LPLLQ S +PRI+N+TS  + L++I NEWAKGV
Sbjct  127   LMTQTYELAEECVKTNYFGAKKMTKALLPLLQLSDTPRIINLTSTVAALKNIPNEWAKGV  186

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E     ++D+V+N+FL+D+K    + KGWPP +SAY++SKA +NAY R  A KYP+
Sbjct  187   LSDAEKLTEERIDDVLNEFLKDFKEEMLETKGWPPSLSAYILSKATLNAYTRFVAKKYPN  246

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
               VNCV PG VKTD+ +N G +T  EGA+S+VR+A+  +  PSG++F  K++ +F
Sbjct  247   FFVNCVCPGFVKTDMTFNAGILTIDEGAESVVRLAMLTKGSPSGLYFLLKEVSSF  301



>ref|XP_011023377.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Populus 
euphratica]
Length=300

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/292 (55%), Positives = 214/292 (73%), Gaps = 9/292 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGFEICRQLA +G+ VVLT+RNE +G E+V+ L+  GLSD V+F
Sbjct  2     AEATKSYAVVTGANKGIGFEICRQLASKGIVVVLTSRNEKRGLESVQNLKESGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDIL----VNNAGVIGLAANESALRASM----GRVL  719
             H+LDV D ++++SL  FI + FG+LDIL    VNNAGV G+  +  AL A +    G  +
Sbjct  62    HQLDVADINSIASLADFIKSRFGKLDILGNSKVNNAGVGGVKTDVDALNAFISGNEGAKI  121

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             N+   I+  +EL  EC+ INYYG+KRM EA +PLLQ S SP IVNV+S   KL+ + NEW
Sbjct  122   NWSEFITETWELVEECLRINYYGAKRMAEALIPLLQLSDSPIIVNVSSSMGKLKGVSNEW  181

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AKGVL++ E+    ++DEV++K+LED+K GS + +GWP  MSAY++SKAAM+A  RI A 
Sbjct  182   AKGVLSDAENLTEERVDEVLSKYLEDFKEGSLETEGWPAMMSAYILSKAAMSASTRILAK  241

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
             KYP+  +NCV PG VKTDIN+NTG    +EGA+++VR+AL P   PSG FFD
Sbjct  242   KYPTFCINCVCPGYVKTDINFNTGIRPVEEGAENVVRLALLPNGAPSGCFFD  293



>ref|XP_008375920.1| PREDICTED: (+)-neomenthol dehydrogenase [Malus domestica]
 ref|XP_008347122.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=296

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 214/295 (73%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG  I +QLA +G+TVVLTAR+E +G EAVEKL+  G++  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLGIVKQLASDGITVVLTARDERRGLEAVEKLKQSGMAGEVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFMR  707
             H+LDV + ST++ L  FI T FG+LDILVNNAGV G   +  A +A++       +++ +
Sbjct  62    HQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDGDAFKAAVASGWKETIDWNK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++ NYEL+ EC++INYYG+KR TEA +PLLQ S+SP IVNV+S    L  I ++  KGV
Sbjct  122   VMTENYELAKECVQINYYGAKRTTEALIPLLQLSESPIIVNVSSSMGMLNRIPSDRVKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              ++VE+    ++DE++ +FLEDYK GS + KGWP HMS+Y++SKAAMNAY R+ A KYP 
Sbjct  182   FSDVENLTEERIDEMLTQFLEDYKEGSLESKGWPSHMSSYILSKAAMNAYTRVLARKYPD  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++NCV PG VKTDIN N+G +  +EGA  +V++A  P DGPSG FF   ++  F
Sbjct  242   FRINCVCPGFVKTDINSNSGVLPVEEGAARVVKLAFVPNDGPSGSFFSQNEVTDF  296



>ref|XP_002511824.1| carbonyl reductase, putative [Ricinus communis]
 gb|EEF50493.1| carbonyl reductase, putative [Ricinus communis]
Length=544

 Score =   331 bits (849),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 207/282 (73%), Gaps = 5/282 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVVTG NKGIGF IC QLA  G+ V+LTAR+E +G EAV+KL+  GLSD V+FH+LDV
Sbjct  255   RYAVVTGANKGIGFGICEQLASNGIVVILTARDERRGLEAVQKLKDSGLSDYVVFHQLDV  314

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLNFMRAISHN  692
              + +T++ L  FI   FG+LDILVNNAG+ G+ A++ ALRAS     G    ++  ++  
Sbjct  315   ANTATIAVLADFIKAQFGKLDILVNNAGIGGVEADDDALRASFSSNEGAQFGWLELLTET  374

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             YEL+  CI +NYYG+KRM EA  PLLQ S SPRIVNV+S   KL+++ NEWA  VL++ +
Sbjct  375   YELAEACITVNYYGAKRMVEALFPLLQLSDSPRIVNVSSSMGKLKNVSNEWATQVLSDAD  434

Query  511   S-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
                  ++DEV+ K+L D+K G+ K  GWP  +SAY++SKAAMNAY RI A  +P+ ++NC
Sbjct  435   KLSEERIDEVLGKYLTDFKEGTRKTNGWPALLSAYILSKAAMNAYTRIIAKNFPTFRINC  494

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             V PG+VKTDIN++TGK+  KEGA+S VR+AL P +GPSG FF
Sbjct  495   VCPGHVKTDINFSTGKLPVKEGAESPVRLALLPNNGPSGCFF  536


 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 175/275 (64%), Gaps = 35/275 (13%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFHR  869
             +KRYAVVTG NKGIGFEICRQLA  G+ VVLT+R+EN+G EAV+KL+  G +D  V+FH+
Sbjct  12    TKRYAVVTGANKGIGFEICRQLASNGIIVVLTSRDENRGLEAVQKLKDSGTADGFVVFHQ  71

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNY  689
             LDV D+ +++SL  FI T FG+LDILVNNAG  G+   +   +        ++++ S NY
Sbjct  72    LDVVDSDSIASLADFIKTQFGKLDILVNNAGASGVELKQDNFKKCFEHGKGWVKS-SINY  130

Query  688   ELSA------ECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              +S       +C++ NYYG++ M EA +PLLQ S S RIVNV+S              GV
Sbjct  131   FVSVLVQTVEQCLKTNYYGARGMVEALVPLLQLSDSARIVNVSS------------MMGV  178

Query  526   LNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             L               +FL+D+K+   + KGWP   SAY+V+KAAMNAY RI A KYPS 
Sbjct  179   L---------------QFLKDFKDEMLETKGWPTEFSAYIVAKAAMNAYTRILAKKYPSF  223

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVAL  242
              VN + PG+ KTD+ +N G ++A EGA+  VR A+
Sbjct  224   LVNALCPGSCKTDMVHNIGLLSAAEGAEYAVRYAV  258



>ref|XP_009338796.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=296

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/295 (53%), Positives = 212/295 (72%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KR AVVTG NKGIGF I +QLA +G+TVVLTAR+E +G EAVEKL+  GL   V+F
Sbjct  2     AEATKRCAVVTGANKGIGFGIVKQLASDGITVVLTARDEKRGLEAVEKLKQSGLGGEVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFMR  707
             H+LDV + ST++ L  FI T FG+LDILVNNAGV G   +  A +A +       +++ +
Sbjct  62    HQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDADAFKAEIASGWKETIDWNK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++  YEL+ EC++INYYG+KR TEA +PLL+ S+SPRIVNV+S    L  I ++  KGV
Sbjct  122   VMTETYELAKECVQINYYGAKRTTEALIPLLRLSESPRIVNVSSSMGNLNKIPSDRVKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              ++VE+    ++DEV+ +FLED+K GS + KGWP HMS+Y++SKAAMNAY RI A KYP 
Sbjct  182   FSDVENLTQEQIDEVLTQFLEDFKEGSLESKGWPSHMSSYILSKAAMNAYTRILAKKYPD  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++NCV PG VKTDIN N+G +  +EGA  +V++A  P DGPSG FF   ++  F
Sbjct  242   FRINCVCPGFVKTDINSNSGVLPVEEGAARVVKLAFLPNDGPSGCFFSQNEVTDF  296



>ref|XP_006491048.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Citrus sinensis]
Length=294

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 215/293 (73%), Gaps = 4/293 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG+E  RQLA  G+ VVLTAR+E +G EAVEKL+  G  D+V+F
Sbjct  2     AEATKRYAVVTGANKGIGYETVRQLASNGIIVVLTARDEKRGLEAVEKLKHSGF-DSVIF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM--GRVLNFMRAI  701
             H+LDV D +T+ SL  F+ + FG+LDILVNNA + G++ +  AL   +  G  + +   +
Sbjct  61    HQLDVADPATIHSLADFVRSQFGKLDILVNNAAIFGVSVDGDALSGFVKDGEPIKWNEIV  120

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  YEL+ +C+  NYYGSKRM E  +PLLQ S  PRIVNV+S   KL+++ NEWAKGV +
Sbjct  121   TPTYELAEKCLRTNYYGSKRMCEVLIPLLQLSDLPRIVNVSSNMGKLKTVSNEWAKGVFS  180

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             +VE+    ++DEV++++L DYK GS + KGWP   +AY++SKAA+NAY RI A KYP+  
Sbjct  181   DVENLTEERVDEVLSQYLNDYKEGSLETKGWPAKAAAYILSKAAINAYTRILAKKYPNFC  240

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +NCV PG VKTD+ YNTGK+TA+EGA++ V +AL P+ GPSG+FF  K+  +F
Sbjct  241   INCVCPGYVKTDMTYNTGKLTAEEGAETPVWLALLPKGGPSGLFFSQKEETSF  293



>ref|XP_010544712.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Tarenaya hassleriana]
Length=296

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/295 (54%), Positives = 215/295 (73%), Gaps = 4/295 (1%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-N  884
             A   + RYAVVTG N+G+GFEICRQLA  G+TVVLTAR+ NKG EAVEKL+  +G+SD N
Sbjct  2     ADQTTTRYAVVTGSNRGLGFEICRQLARNGITVVLTARSVNKGLEAVEKLKKEIGVSDQN  61

Query  883   VLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMR  707
             ++FH+LDVTD S+V++L  F+ T FG+LDILVNNAG+ G+  +  ALRA  G+    +  
Sbjct  62    LVFHQLDVTDTSSVTALAEFVKTRFGKLDILVNNAGIGGMILDGDALRAGKGKEGFKWEE  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I  NYEL+ EC++INYYG K+M EAF+PLL+ S S RIVNV++    L+++ NEWAKG+
Sbjct  122   TIEENYELAEECLKINYYGPKQMCEAFVPLLELSDSARIVNVSALMGSLKNVTNEWAKGI  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    ++D+V+N+FL+D+K G  K + W   MSAYV+SKA +NAY RI A + P 
Sbjct  182   LSDAENLTEERIDQVLNQFLKDFKEGEDKTRNWAKFMSAYVMSKAGLNAYTRIMARERPR  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++N V PG VKTD+N+NTG ++ +EGA   V +AL   DGPSG FFD KK+  F
Sbjct  242   FRINAVCPGFVKTDMNFNTGVVSVEEGASCAVMLALLQIDGPSGCFFDRKKLAEF  296



>emb|CDP08863.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 217/291 (75%), Gaps = 12/291 (4%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLS-DNVLFH  872
             +KRYA+VTG NKGIGFE+CR LA +G+TVVLTAR+E +G +A+ KL+   GLS D +LFH
Sbjct  4     AKRYAIVTGANKGIGFEVCRHLASKGITVVLTARDEKRGLDALHKLKFSDGLSADRLLFH  63

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESA---------LRASMGRVL  719
             +LDV D+S+V+SL  FI T FGRLDILVNNAG+IG   +  A         +       +
Sbjct  64    QLDVADSSSVASLAQFIKTQFGRLDILVNNAGIIGADIDSDAFKAAIAAGAVEEERANKV  123

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             ++  +I+  +EL+ +C + NYYG+KRM EAF+PLLQ S+SPR+VNV+SG  KL++I +EW
Sbjct  124   DWSSSINDTHELAVQCFQTNYYGAKRMIEAFVPLLQLSQSPRVVNVSSGAGKLKNIPSEW  183

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             A+G+  +V++    ++DEV+N++L+D K GS + KGWP  +SAY VSKAAMNAY  + A 
Sbjct  184   ARGIFTDVDNLTDERVDEVLNQYLKDLKEGSKEAKGWPSFLSAYTVSKAAMNAYTIVVAK  243

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             K+P++++N V PG VKTDIN+ +G +T +EGA SIVR+AL P+DGPSG+FF
Sbjct  244   KHPNIKINSVCPGFVKTDINFESGTLTVEEGADSIVRLALLPDDGPSGLFF  294



>ref|XP_010053670.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 gb|KCW78027.1| hypothetical protein EUGRSUZ_D02253 [Eucalyptus grandis]
Length=296

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 209/286 (73%), Gaps = 5/286 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +++KRYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EA++KL+  GLSD ++FH
Sbjct  3     ESTKRYAVVTGANKGIGFEICRQLASNGIVVVLTSRDEKRGLEAIQKLKDSGLSDYLIFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMRA  704
             +LDV++ S++ +L +FI T FG+LDILVNNAGV G+  +  ALRAS     G  +N+   
Sbjct  63    QLDVSNPSSILALANFIKTQFGKLDILVNNAGVPGVIIDGDALRASGFGKEGAQINWNEI  122

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             ++  YE +  C+E NYYG+KRM  A + LLQ S SPRIVNV+S   KLE + NEWA+  L
Sbjct  123   MTQPYEAAEACMETNYYGAKRMVGALIDLLQLSDSPRIVNVSSSMGKLERVSNEWARETL  182

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ +     K+D +V   L D+K+GS++ KGWP  M AY +SKAAMNAY RI A KYPS+
Sbjct  183   SDPKDITEEKVDGIVKALLTDFKDGSSEAKGWPAFMPAYSISKAAMNAYTRILAKKYPSI  242

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              VNCV PG VKTDIN+NTG ++ +EGA+S V++AL P  GPSG FF
Sbjct  243   IVNCVCPGFVKTDINFNTGILSVEEGAESPVKLALLPNGGPSGCFF  288



>gb|KDP28661.1| hypothetical protein JCGZ_14432 [Jatropha curcas]
Length=301

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 210/291 (72%), Gaps = 9/291 (3%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             +KRYAVVTG NKGIGFEICRQLA  G+ VVLTAR+E +G EA++KL+  GLSD VLFH+L
Sbjct  6     TKRYAVVTGANKGIGFEICRQLASNGIVVVLTARDEKRGLEALQKLQDSGLSDYVLFHQL  65

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-MGR------VLNFMR  707
             DV D +++++L  FI T FG+LDILVNNAGV G+  +  ALRAS  G+       L++ +
Sbjct  66    DVADTASIAALADFIKTQFGKLDILVNNAGVGGVILDGDALRASDFGKEGVNVFSLDWDK  125

Query  706   AI-SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
              I S   EL+ ECI INYYG+KR  EA +PLLQ S SPRIVNV+S    L++I NEWAK 
Sbjct  126   IIASQTSELAEECIAINYYGAKRTAEALIPLLQLSDSPRIVNVSSMGGALKNIQNEWAKE  185

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL + ++    ++DEV+NK+L D+K  S + KGWP   SAY +SKAA+NAY RI A K P
Sbjct  186   VLGDADNLSEERIDEVLNKYLNDFKESSPETKGWPEFFSAYELSKAALNAYTRILAKKLP  245

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCK  200
             S ++N V PG VKTD+ +N GK++  EGA+S VR+AL P DGPSG  FD K
Sbjct  246   SFRINSVCPGLVKTDLIFNMGKLSPAEGAESAVRLALLPNDGPSGCLFDRK  296



>ref|XP_007218747.1| hypothetical protein PRUPE_ppa009290mg [Prunus persica]
 gb|EMJ19946.1| hypothetical protein PRUPE_ppa009290mg [Prunus persica]
Length=298

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 207/289 (72%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGR------VLNF  713
             H+LDV D +TV+SL  FI T FG+LDILVNNAGV G   +  A +AS+         ++F
Sbjct  62    HQLDVVDPATVASLADFIKTQFGKLDILVNNAGVGGSIVDGDAFKASVASGATERGGVDF  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SP+IVNV+S    L +I ++WA+
Sbjct  122   SKLVTETYELTEECLQINYYGAKRTAEALIPLLQLSDSPKIVNVSSVMGMLNNIPSDWAR  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + E+    ++DEV+ + L+D+K GS + KGWP  M AY+VSKAA+NAY RI A KY
Sbjct  182   GVFTDAENLTEERVDEVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P+ ++N V PG VKTDINYN G +  +EGA  ++++AL P DGPSG FF
Sbjct  242   PTFRINSVCPGFVKTDINYNVGVLPVEEGAARVMKLALLPNDGPSGSFF  290



>gb|KCW78028.1| hypothetical protein EUGRSUZ_D02253 [Eucalyptus grandis]
Length=296

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 210/286 (73%), Gaps = 5/286 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +++KRYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EA++KL+  GLSD ++FH
Sbjct  3     ESTKRYAVVTGANKGIGFEICRQLASNGIVVVLTSRDEKRGLEAIQKLKDSGLSDYLIFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-MGRV---LNFMRA  704
             +LDV++ S++ +L +FI T FG+LDILVNNAGV G+  +  ALRAS  G+    +N+   
Sbjct  63    QLDVSNPSSILALANFIKTQFGKLDILVNNAGVPGVIIDGDALRASGFGKASAQINWNEI  122

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             ++  YE +  C+E NYYG+KRM  A + LLQ S SPRIVNV+S   KLE + NEWA+  L
Sbjct  123   MTQPYEAAEACMETNYYGAKRMVGALIDLLQLSDSPRIVNVSSSMGKLERVSNEWARETL  182

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ +     K+D +V   L D+K+GS++ KGWP  M AY +SKAAMNAY RI A KYPS+
Sbjct  183   SDPKDITEEKVDGIVKALLTDFKDGSSEAKGWPAFMPAYSISKAAMNAYTRILAKKYPSI  242

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              VNCV PG VKTDIN+NTG ++ +EGA+S V++AL P  GPSG FF
Sbjct  243   IVNCVCPGFVKTDINFNTGILSVEEGAESPVKLALLPNGGPSGCFF  288



>ref|XP_002301344.1| hypothetical protein POPTR_0002s15770g [Populus trichocarpa]
 gb|EEE80617.1| hypothetical protein POPTR_0002s15770g [Populus trichocarpa]
Length=306

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 213/297 (72%), Gaps = 9/297 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VL  878
             S A+KRYAVVTG NKGIG+EICRQLA  G+ VVLTAR+E +G EAV+KL+  G+SD+ V+
Sbjct  7     SLATKRYAVVTGANKGIGYEICRQLASNGILVVLTARDEKRGLEAVQKLKDSGISDDLVI  66

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-----  713
             +H+LDV D  ++ SL  F+  NFG+LDILVNNAG+ G+A    A + +  +   F     
Sbjct  67    YHQLDVVDPDSIVSLAEFVKNNFGKLDILVNNAGIGGVALEADAFQRAFEQAGEFPYGEQ  126

Query  712   --MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
                   + NYE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I NEW
Sbjct  127   VWAEIGTQNYEMAEQCVKTNYYGARGMAEALAPLLQLSDSPRIVNVSSMLGLLKNIPNEW  186

Query  538   AKGVLNNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AKG+LN+VE+    +LDEVVN+FL+D+K      KGWP ++SAY+V+KAAM+AY RI A 
Sbjct  187   AKGLLNDVENLNEDRLDEVVNEFLKDFKEDLLGSKGWPTYLSAYIVAKAAMSAYTRILAK  246

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             KYPS +VNC+ PG  KTDI  NTG  TA EGA++ VR+AL P+ GPSG FF  K+++
Sbjct  247   KYPSFRVNCLCPGYCKTDITTNTGPFTAAEGAENAVRLALLPDGGPSGCFFYQKQML  303



>ref|XP_007135022.1| hypothetical protein PHAVU_010G095300g [Phaseolus vulgaris]
 gb|ESW07016.1| hypothetical protein PHAVU_010G095300g [Phaseolus vulgaris]
Length=293

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 213/291 (73%), Gaps = 2/291 (1%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A+KRYAVVTG NKGIG+ IC++LA  GV VVLTARNE +G EAVE+L+  GLSD V+FH
Sbjct  3     EAAKRYAVVTGANKGIGYGICKKLALNGVVVVLTARNEKRGLEAVERLKEFGLSDFVVFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRVLNFMRAISH  695
             +LDVTD S+V+SL  FI T FG+LDILVNNAGV G   N E+ LR   G +L++   +  
Sbjct  63    QLDVTDPSSVTSLADFIKTRFGKLDILVNNAGVPGGKVNGENYLRRKKGEILDWNLIVYQ  122

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
             NYEL+ EC+E +++G++R+TEA LPLLQ S SPRIVN++     L+ I NEWA+ V  ++
Sbjct  123   NYELAKECVETDFFGAERVTEALLPLLQLSTSPRIVNISGQIGLLKHIPNEWAREVFGDI  182

Query  514   ESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    KL EV+ +FL+DYK GS + K WPP +S   ++KA +NAY R+ A K+P   +N
Sbjct  183   ENLTNEKLYEVLREFLKDYKEGSLESKNWPPVVSGVTMAKAGINAYTRMLAKKFPHFCIN  242

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             C+ PG+VKTDIN+N G ++  EGA++ VR+AL P+ GPSG+FF   ++I F
Sbjct  243   CICPGSVKTDINHNNGLLSIDEGAENPVRLALLPDHGPSGLFFSIDQVIPF  293



>ref|NP_191681.1| (+)-neomenthol dehydrogenase [Arabidopsis thaliana]
 sp|Q9M2E2.1|SDR1_ARATH RecName: Full=(+)-neomenthol dehydrogenase; AltName: Full=Menthone:neomenthol 
reductase; AltName: Full=Short-chain dehydrogenase/reductase 
1; Short=AtSDR1 [Arabidopsis thaliana]
 emb|CAB71052.1| putative protein [Arabidopsis thaliana]
 gb|AAK76558.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14244.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80174.1| (+)-neomenthol dehydrogenase [Arabidopsis thaliana]
Length=296

 Score =   320 bits (821),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 218/295 (74%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NV  881
             ++ + RYAVVTG N+GIGFEICRQLA EG+ VVLT+R+EN+G EAVE L+  + +SD ++
Sbjct  2     AEETPRYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSL  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
             LFH+LDV D ++++SL  F+ T FG+LDILVNNAG+ G+  +  ALRA  G+    +   
Sbjct  62    LFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+  YEL+ ECI+INYYG KRM EAF+PLL+ S SPRIVNV+S   +L+++ NEWAKG+L
Sbjct  122   ITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGIL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++D+V+N+ L D+K G+ KEK W   MSAYVVSKA++N Y R+ A K+P  
Sbjct  182   SDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHPEF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +VN V PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FF  K++  F
Sbjct  242   RVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFFSRKQVSEF  296



>ref|XP_009343607.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=299

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 213/298 (71%), Gaps = 8/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KR AVVTG NKGIGF I +QLA +G+TVVLTAR+E +G EAVEKL+  GL   V+F
Sbjct  2     AEATKRCAVVTGANKGIGFGIVKQLASDGITVVLTARDEKRGLEAVEKLKQSGLGGEVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFMR  707
             H+LDV + ST++ L  FI T FG+LDILVNNAGV G   +  A +A +       +++ +
Sbjct  62    HQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDADAFKAEIASGWKETIDWNK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++ NYEL+ EC++INYYG+KR TEA +PLL+ S+SPRIVNV+S    L  I ++  KGV
Sbjct  122   VMTENYELAKECVQINYYGAKRTTEALIPLLRLSESPRIVNVSSSMGNLNKIPSDRVKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              ++VE+    ++DEV+ +FLED+K GS + KGWP HMS+Y++SKAAMNAY RI A KYP 
Sbjct  182   FSDVENLTQEQIDEVLTQFLEDFKEGSLESKGWPSHMSSYILSKAAMNAYTRILAKKYPD  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRV---ALQPEDGPSGVFFDCKKIIAF  185
              ++NCV PG VKTDIN N+G +  +EGA  +V+V   A  P DGPSG FF   ++  F
Sbjct  242   FRINCVCPGFVKTDINSNSGVLPVEEGAARVVKVLKLAFLPNDGPSGCFFSQNEVTDF  299



>ref|XP_010053669.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 gb|KCW78025.1| hypothetical protein EUGRSUZ_D02252 [Eucalyptus grandis]
Length=296

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 210/285 (74%), Gaps = 5/285 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             ++KR AVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EA++KL+   LSD ++FH+
Sbjct  4     STKRCAVVTGANKGIGFEICRQLASNGIVVVLTSRDEKRGLEAIQKLKDSNLSDYLVFHQ  63

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMRAI  701
             LDV++ S++ +L +FI T FG+LDILVNNAGV G   +  ALRAS     G  +N+   +
Sbjct  64    LDVSNPSSILALANFIETQFGKLDILVNNAGVPGTIIDGDALRASGVGKEGAQINWNEIM  123

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  YE +  CIE NYYG+KRM EA + LLQQS SPRIVNV+S   KLE + NEWA+ +L+
Sbjct  124   TQPYEAAEACIETNYYGAKRMVEAHIHLLQQSDSPRIVNVSSSMGKLERVSNEWAREILS  183

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             + E+    K+D +V  FL D+K+G ++ KGWP +M AY +SKAA+NA+ RI A KYPS+ 
Sbjct  184   DPENITEEKVDGIVKAFLADFKDGLSEAKGWPAYMPAYRISKAAINAFTRILAKKYPSIV  243

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             VNCV PG VKTDIN+NTG ++ +EGA+S V++AL P  GPSG FF
Sbjct  244   VNCVCPGFVKTDINFNTGSMSVEEGAESPVKLALLPNGGPSGCFF  288



>ref|XP_007051880.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96037.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=297

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/288 (54%), Positives = 207/288 (72%), Gaps = 7/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +++ +RYAVVTG NKGIG EICRQLA +GV VVL AR+E +G EA+EKL+  GLSD+++F
Sbjct  2     AESFQRYAVVTGANKGIGLEICRQLASKGVMVVLAARDEKRGLEALEKLKDSGLSDHLVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLN------F  713
             H+LDV D ++++ L  F+   FG+LDILVNNAG+ G   N  ALRAS            +
Sbjct  62    HQLDVADPASITYLADFVKNRFGKLDILVNNAGIGGATVNYDALRASRISATEKDLTTVW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YE   EC+  NYYG+KR  EA +PLLQ S SPRIVNV+S W KL++I +E  K
Sbjct  122   SKVLTQTYEGGEECLHTNYYGAKRTAEALVPLLQLSDSPRIVNVSSLWGKLKNIPSEQLK  181

Query  532   GVLNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             GV  +V++   KLDE++++FL+D+K GS + KGWP  +SAY VSK AMNAY RI A +YP
Sbjct  182   GVFRDVDTEE-KLDELLSEFLKDFKEGSLESKGWPTCVSAYTVSKVAMNAYTRILARRYP  240

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
                +NCV PG VKTD+N+NTGK+T +EGA + V++AL P  GPSG+FF
Sbjct  241   KFSINCVCPGFVKTDLNFNTGKLTVEEGAATPVKLALWPNGGPSGLFF  288



>ref|XP_007051881.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96038.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=297

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 208/288 (72%), Gaps = 7/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +++ +RYAVVTG NKGIG EICRQLA +GV VVL AR+E +G EA+EKL+  GLSD+++F
Sbjct  2     AESFQRYAVVTGANKGIGLEICRQLASKGVMVVLAARDEKRGLEALEKLKDSGLSDHLVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLN------F  713
             H+LDV D ++++ L  F+   FG+LDILVNNAG++G   N  ALRAS            +
Sbjct  62    HQLDVADPASITYLADFLKNRFGKLDILVNNAGILGSIVNYDALRASSISATEKDLTTVW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YE   EC+  NYYG+KR  EA +PLLQ S SPRIVNV+S W KL++I +E  K
Sbjct  122   SKVLTQTYEGGEECLHTNYYGAKRTAEALVPLLQLSDSPRIVNVSSLWGKLKNIPSEQLK  181

Query  532   GVLNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             GV  +V++   KLDE++++FL+D+K GS + KGWP  +SAY VSK AMNAY RI A +YP
Sbjct  182   GVFRDVDTEE-KLDELLSEFLKDFKEGSLESKGWPTCISAYTVSKVAMNAYTRILARRYP  240

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
                +NCV PG VKTD+++NTGK+T +EGA + V++AL P  GPSG+FF
Sbjct  241   KFSINCVCPGFVKTDMSFNTGKLTVEEGAATPVKLALWPNGGPSGLFF  288



>ref|XP_007219267.1| hypothetical protein PRUPE_ppa018232mg [Prunus persica]
 gb|EMJ20466.1| hypothetical protein PRUPE_ppa018232mg [Prunus persica]
Length=298

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 205/289 (71%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGR------VLNF  713
             H+LDV D +TV+SL  FI T FG+LDILVNNAGVIG   +  A +AS+         ++F
Sbjct  62    HQLDVVDPATVASLADFIKTQFGKLDILVNNAGVIGSIVDGDAFKASVASGATERGGVDF  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YEL+ EC++INYYG+KR  EA +PLL  S SPRIVNV+S    L +I ++WA+
Sbjct  122   SKLVTETYELTEECLQINYYGAKRTAEALIPLLLLSDSPRIVNVSSVMGMLNNIPSDWAR  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + E+    ++DEV+ + L+D+K GS + KGWP  M AY+VSKAA+NAY RI   KY
Sbjct  182   GVFTDAENLTEERVDEVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILGKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P+ ++N V PG VKTDIN+N G +  +EG   IV++AL P DGP+G FF
Sbjct  242   PTFRINSVCPGFVKTDINFNAGVLPVEEGGARIVKLALLPNDGPTGSFF  290



>ref|NP_001190151.1| (+)-neomenthol dehydrogenase [Arabidopsis thaliana]
 gb|AEE80175.1| (+)-neomenthol dehydrogenase [Arabidopsis thaliana]
Length=303

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 215/290 (74%), Gaps = 5/290 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NVLFHRL  866
             RYAVVTG N+GIGFEICRQLA EG+ VVLT+R+EN+G EAVE L+  + +SD ++LFH+L
Sbjct  14    RYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQL  73

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRAISHNY  689
             DV D ++++SL  F+ T FG+LDILVNNAG+ G+  +  ALRA  G+    +   I+  Y
Sbjct  74    DVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETY  133

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             EL+ ECI+INYYG KRM EAF+PLL+ S SPRIVNV+S   +L+++ NEWAKG+L++ E+
Sbjct  134   ELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAEN  193

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 ++D+V+N+ L D+K G+ KEK W   MSAYVVSKA++N Y R+ A K+P  +VN V
Sbjct  194   LTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHPEFRVNAV  253

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
              PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FF  K++  F
Sbjct  254   CPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFFSRKQVSEF  303



>ref|XP_011023382.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Populus 
euphratica]
Length=306

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 210/297 (71%), Gaps = 9/297 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VL  878
             S A+KRYAVVTG NKGIG+EICRQLA  G+ VVLTAR+E +G EAV+KL+  G+SD+ V+
Sbjct  7     SLATKRYAVVTGANKGIGYEICRQLASNGILVVLTARDEKRGLEAVQKLKDCGISDDLVI  66

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-----  713
             +H+LD  D  ++ SL  F+  NFG+LDILVNNAG+ G+A    A + +      F     
Sbjct  67    YHQLDAVDPDSIVSLAEFVKNNFGKLDILVNNAGISGVALEADAFQRAFEEAGEFPSGEQ  126

Query  712   --MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
                   + NYE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I NEW
Sbjct  127   VWAEIGTQNYEMAEQCVKTNYYGARGMAEALAPLLQLSDSPRIVNVSSLLGLLKNIPNEW  186

Query  538   AKGVLNNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AKG+LN+VE+    +LDEVVN+FL+D+K      KGWP ++SAY+V+KA M+AY RI A 
Sbjct  187   AKGLLNDVENLNEDRLDEVVNEFLKDFKEDLLGSKGWPTYLSAYIVAKATMSAYTRILAK  246

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             KYPS +VNC+ PG  KTDI  NTG  TA EGA++ VR+AL P+ GPSG FF  K+++
Sbjct  247   KYPSFRVNCLCPGYCKTDITTNTGPFTAAEGAENAVRLALLPDGGPSGCFFYQKQML  303



>ref|XP_007051882.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96039.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=309

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 159/300 (53%), Positives = 211/300 (70%), Gaps = 19/300 (6%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +++ +RYAVVTG NKGIG EICRQLA +GV VVLTAR+E +G EA+EKL+  GLSD+++F
Sbjct  2     AESFQRYAVVTGANKGIGLEICRQLASKGVMVVLTARDEKRGLEALEKLKDSGLSDHLVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGR------VLNF  713
             H+LDV D ++++ L  F+   FG+LDILVNNAG+ G   N  ALRAS         +L F
Sbjct  62    HQLDVADPASITYLADFVKNRFGKLDILVNNAGIGGTTVNYDALRASSISASEDILLLEF  121

Query  712   M------------RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGW  569
             +            + +S  YE   EC++ NYYG+KR  EA +PLLQ S SPRIVNV+S  
Sbjct  122   LLQMQKDLTTVWSKVLSQTYEAGEECLKTNYYGAKRTAEALVPLLQLSNSPRIVNVSSLL  181

Query  568   SKLESIHNEWAKGVLNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAM  389
              KL +I +E  KGVL +V++   KLDE++++FL+D+K GS + KGWP + SAY VSK AM
Sbjct  182   GKLMNIPSEQLKGVLRDVDTEE-KLDELLSEFLKDFKEGSLESKGWPTYCSAYTVSKVAM  240

Query  388   NAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             NAY RI A +YP  ++NCV PG VKTDIN+NTG I+ +EGA + V++AL P  GPSG+FF
Sbjct  241   NAYTRILAKRYPKFRINCVCPGFVKTDINFNTGNISVEEGAATPVKLALWPNGGPSGLFF  300



>ref|XP_006402505.1| hypothetical protein EUTSA_v10006127mg [Eutrema salsugineum]
 gb|ESQ43958.1| hypothetical protein EUTSA_v10006127mg [Eutrema salsugineum]
Length=296

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 213/295 (72%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVL  878
             ++ + RYAVVTG N+GIG EICRQL   G+ VVLT+R+E +G EAVE L+  + +SD  L
Sbjct  2     AEDTPRYAVVTGANRGIGLEICRQLVSNGIRVVLTSRDEKRGLEAVETLKKELEVSDQSL  61

Query  877   -FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
              FHRLDV+D ++++SL  F+ T FG+LDILVNNAG+ G+  +  ALR+  G+    +   
Sbjct  62    VFHRLDVSDLASIASLAGFVKTQFGKLDILVNNAGIGGIITDVDALRSGTGKEGFKWEEV  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+  YEL+ ECI+INYYG KRM EAF+PLLQ S SPRIVNV+S   KL+++ NEWAKG+L
Sbjct  122   ITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIVNVSSSMGKLKNLLNEWAKGIL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++D+V+N+ L D+K G+ K K W   MSAYVVSKA +N Y RI A K+P  
Sbjct  182   SDAENLTEERIDQVINQLLNDFKEGTVKTKSWTKFMSAYVVSKAGLNGYTRILAKKHPEF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +VN V PG VKTD+N+NTG ++ +EGA S VR+AL P +D PSG FFD K++  F
Sbjct  242   RVNSVCPGFVKTDMNFNTGVLSVEEGASSPVRLALLPHQDSPSGCFFDRKQVSEF  296



>ref|XP_007221198.1| hypothetical protein PRUPE_ppa026931mg [Prunus persica]
 gb|EMJ22397.1| hypothetical protein PRUPE_ppa026931mg [Prunus persica]
Length=297

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/288 (55%), Positives = 203/288 (70%), Gaps = 6/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A++RYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEATRRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGRVLNFM  710
             H+LDV D +TV+SL  FI T FG+LDILVNNAG+ G   +  A  A      MGR     
Sbjct  62    HQLDVADPATVASLAEFIKTQFGKLDILVNNAGIGGAIGDADAFTALVKSFDMGRGEIGS  121

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KL  I ++WA+G
Sbjct  122   KLMTETYELTEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSFLGKLMHIPSDWARG  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V  + E+    ++DEV+ + L+D+K GS + KGWP   SAYVVSKAA+NAY RI A KYP
Sbjct  182   VFTDAENLTEERVDEVLTELLKDFKEGSLESKGWPSPSSAYVVSKAALNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             + ++N + PG VKTDINYN G +  K+GA  ++++AL P DGPSG FF
Sbjct  242   TFRINSLCPGFVKTDINYNAGVLPVKDGAARVMKLALLPNDGPSGSFF  289



>gb|KHM99404.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=297

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 205/286 (72%), Gaps = 3/286 (1%)
 Frame = -1

Query  1033  AVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVTD  854
             AVVTG NKGIGF IC+QL   G+TVVLTAR+E +G EAVEKL+  G+SD V+FH+LDVTD
Sbjct  12    AVVTGANKGIGFGICKQLVSNGITVVLTARDEKRGLEAVEKLKEFGVSDQVVFHQLDVTD  71

Query  853   ASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-MRAIS-HNYELS  680
               ++ SL +FI T FG+LDILVNNAG+ G   +  AL A+  +V N   R IS  N+E +
Sbjct  72    PKSIESLANFIKTQFGKLDILVNNAGIHGAYVDRDALAAAGEKVANVDWRKISTENFEAA  131

Query  679   AECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PP  503
                I  NYYG K M EA +PLL+ S +PRIVNV+S   KLE I N WA+G L++ ES   
Sbjct  132   EAGIRTNYYGVKLMCEALIPLLELSGTPRIVNVSSSMGKLEKIPNAWARGALSDAESLTE  191

Query  502   GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPG  323
              K+DEV+N+FL+D+K GS + KGWP   SAY+VSKAA+ AY RI A KYPS  +N V PG
Sbjct  192   EKVDEVLNQFLKDFKEGSLETKGWPHAFSAYIVSKAALTAYTRILAKKYPSFCINAVCPG  251

Query  322   NVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              VKTD+NYNTG ++  EGA+S+VR+AL P  GPSG+FF   ++ +F
Sbjct  252   FVKTDLNYNTGYLSVDEGAESVVRLALLPNGGPSGLFFSRSEVASF  297



>ref|XP_007219247.1| hypothetical protein PRUPE_ppa018029mg [Prunus persica]
 gb|EMJ20446.1| hypothetical protein PRUPE_ppa018029mg [Prunus persica]
Length=298

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 205/289 (71%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVLNF  713
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A +A +      G  ++ 
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIFGSILDGDAFKAVIASGAVEGGEVDL  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YEL+ +C++INYYG+KR  EA +PLLQ S SPRIVNV+SG  KL+ I ++WAK
Sbjct  122   SKLVTETYELTEKCLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGSGKLKKIPSDWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + E+    ++D+V+ + L+D+K GS + KGWP  M AY+VSKAA+NAY RI   KY
Sbjct  182   GVFTDAENLTEERVDKVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILGKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P+ ++N V PG VKTDIN+N G +  +EG   IV++AL P DGP+G FF
Sbjct  242   PTFRINSVCPGFVKTDINFNAGVLPVEEGGARIVKLALLPNDGPTGSFF  290



>ref|XP_006583333.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Glycine 
max]
 gb|KHN04644.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=299

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/297 (52%), Positives = 214/297 (72%), Gaps = 8/297 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A+E ++  GLS  VLFH
Sbjct  3     EATERYAVVTGANKGIGLEIVRQLASAGIKVVLTARNEERGLKALETVKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGR------VLNFM  710
             ++DV DA++V+SL  FI + FG+LDIL+NNAG+ G+  +++ L  ++ +        +  
Sbjct  63    QVDVADATSVASLADFIKSKFGKLDILINNAGISGVVIDDTDLITTVIKNRGAKPEYDGT  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI-HNEWAK  533
             + ++H YEL+ EC++INYYG+K+ TE+ +PLLQ S SPRIVNV+S   +LES+    WA+
Sbjct  123   KGVTHTYELAEECLQINYYGAKKTTESLMPLLQLSDSPRIVNVSSSLGQLESLPKGSWAR  182

Query  532   GVLNNVESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV N+V++   ++ DE++NKFL D+K GS + KGWP ++SAY+VSKAAMNAY RI A KY
Sbjct  183   GVFNDVDNLTAEIVDEILNKFLRDFKEGSLESKGWPKYLSAYIVSKAAMNAYTRILAKKY  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  +N V PG VKTDI  NTG +T +EGA S VR+AL P   PSG F+    + +F
Sbjct  243   PSFCINSVCPGYVKTDITANTGILTVEEGAASPVRLALLPNGSPSGFFYYRSDVASF  299



>ref|XP_002301346.2| hypothetical protein POPTR_0002s15820g [Populus trichocarpa]
 gb|EEE80619.2| hypothetical protein POPTR_0002s15820g [Populus trichocarpa]
Length=306

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 213/299 (71%), Gaps = 9/299 (3%)
 Frame = -1

Query  1060  NASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-  884
             ++S A+KRYAVVTG NKGIG+EICRQLA  G+ VVLTAR+E +G EAV+KL+  G+SD+ 
Sbjct  5     SSSLATKRYAVVTGANKGIGYEICRQLASNGILVVLTARDEKRGLEAVQKLKDSGISDDL  64

Query  883   VLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF---  713
             V++H+LDV D  ++ SL  F+  NFG+LDILVNNAG+ G+A    A + +  +   F   
Sbjct  65    VIYHQLDVVDPDSIVSLAEFVKNNFGKLDILVNNAGIGGVALEADACQRAFEQSGEFPSG  124

Query  712   ----MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHN  545
                     + NYE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I N
Sbjct  125   EQVWAEIGTQNYEMAEQCVKTNYYGARGMAEALAPLLQLSDSPRIVNVSSLLGLLKNIPN  184

Query  544   EWAKGVLNNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARIT  368
             EWAKG+LN+VE+    +LDEVVN FL+D+K      KGWP ++SAY+V+KAAM+AY RI 
Sbjct  185   EWAKGLLNDVENLNEDRLDEVVNGFLKDFKEDLLGSKGWPTYLSAYIVAKAAMSAYTRIL  244

Query  367   AHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             A KYPS  VNC+ PG  KTDI  NTG  TA EGA++ VR+AL P+ GPSG FF  K+++
Sbjct  245   AKKYPSFCVNCLCPGYCKTDITANTGPFTAAEGAENAVRLALLPDGGPSGCFFYQKQML  303



>ref|XP_008246061.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Prunus 
mume]
Length=298

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 209/294 (71%), Gaps = 7/294 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGFEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGR-VLNF  713
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A +A     +M R  ++ 
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIFGSILDGDAFKAVVASGAMERGEVDL  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+SG  KL +I ++WAK
Sbjct  122   SKLVTEAYELAEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGSGKLNNIPSDWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + ++    ++DEV+ + L+D+K GS + KGWP  M AY+VSKAA+NAY RI A KY
Sbjct  182   GVFTDAKNLTEERVDEVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             P+ ++N V PG VKTDIN+N G +  +EG   IV++AL P DGP+G FF   K+
Sbjct  242   PNFRINSVCPGFVKTDINFNAGVLPVEEGGARIVKLALLPNDGPTGSFFVHNKV  295



>ref|XP_002320111.2| hypothetical protein POPTR_0014s07590g [Populus trichocarpa]
 gb|EEE98426.2| hypothetical protein POPTR_0014s07590g [Populus trichocarpa]
Length=302

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 213/289 (74%), Gaps = 5/289 (2%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFHR  869
             +KR+AVVTG  KGIG+EICRQLA  G+ VVLTA +E  G EAV+KL+  G+SD+ V+FH+
Sbjct  10    AKRHAVVTGAEKGIGYEICRQLASNGILVVLTAIDEKMGLEAVQKLKDSGISDDLVVFHQ  69

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAI---S  698
             LDV D ++++SL  F+ T FG+LDILVNNAG+ G+A    A + +  +  +F+      +
Sbjct  70    LDVVDLNSIASLAEFVKTKFGKLDILVNNAGISGVALKADAFKRAFEQAGDFVMWAEIGT  129

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
              +YE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I+NEWAKG+LN+
Sbjct  130   QSYEMAEQCVKTNYYGARGMVEALAPLLQLSDSPRIVNVSSMHGLLKNINNEWAKGLLND  189

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
             +E+    ++DEVVN+FL+D+K    + KGWPP++S+Y+VSKAAM+AY RI A KYPS  V
Sbjct  190   IENLDEDRVDEVVNEFLKDFKEDLLESKGWPPYLSSYIVSKAAMSAYTRILAKKYPSFCV  249

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             NC+ PG  KTDI  NTG  TA EGA++ VR+AL PE GPSG FF  K++
Sbjct  250   NCLCPGYCKTDITTNTGIFTASEGAENAVRLALLPEGGPSGCFFYQKQM  298



>ref|XP_006576352.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Glycine 
max]
 ref|XP_006576353.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X3 [Glycine 
max]
 gb|KHN27307.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=299

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 214/297 (72%), Gaps = 8/297 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A++RYAVVTG NKGIG EI RQLA  G+ V+LTARNE KG +A+E L+  GLS  VLFH
Sbjct  3     EATERYAVVTGANKGIGLEIVRQLASAGIKVLLTARNEKKGLQALETLKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESAL--RASMGRVL----NFM  710
             ++DV DA+ V+SL  F+ + FG+LDIL+NNAG+ G+  +++ L   A M R      N  
Sbjct  63    QVDVADATNVASLADFVKSKFGKLDILINNAGIGGVVIDDTDLITTAIMNRGAIPEDNGT  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE-WAK  533
             + I+H YEL+ EC++INYYG+K+ TE+ +PLLQ S SPRIVNV+S   +LES+  E WA+
Sbjct  123   KGITHTYELAEECLQINYYGAKKTTESLMPLLQLSDSPRIVNVSSTLGQLESLPKESWAR  182

Query  532   GVLNNVESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV N+V++   ++ DE++NKFL D+K GS + KGWP ++SAY+VSKAAMNAY RI + KY
Sbjct  183   GVFNDVDNLTEEIVDEILNKFLRDFKEGSLESKGWPKYLSAYIVSKAAMNAYTRILSKKY  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  +N V PG VKTD+  NTG +T +EGA S VR+AL P   PSG F+    + +F
Sbjct  243   PSFCINSVCPGYVKTDMTANTGFLTVEEGAASPVRLALLPIGSPSGFFYYRSDVASF  299



>ref|XP_007219248.1| hypothetical protein PRUPE_ppa018033mg [Prunus persica]
 gb|EMJ20447.1| hypothetical protein PRUPE_ppa018033mg [Prunus persica]
Length=299

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 213/298 (71%), Gaps = 8/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A KRYAVVTG NKG+GF I RQLA  GV  VLTAR+E KG EAVEKL+  GLSD V+F
Sbjct  2     AEAGKRYAVVTGSNKGVGFGIVRQLASNGVMAVLTARDEKKGIEAVEKLKECGLSDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-------LN  716
             H+LDVTD+S+++SL  F+   FG+LDILVNNAGV G   +  ALRA+           + 
Sbjct  62    HQLDVTDSSSIASLADFVTIQFGKLDILVNNAGVNGTIMDPEALRAAAAAGLGKKDVEVK  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   ++  YEL+ ECI+ NYYG+K+MT+ FLPLLQ S SPR+VN++SG  +L+ I NEWA
Sbjct  122   WSEMLTQTYELTEECIKTNYYGTKKMTKTFLPLLQLSDSPRVVNISSGRGRLKLIPNEWA  181

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGVLN+ E     +++EV+N+FL D+K    + K WPP +SAY++SKAA+NAY RI A K
Sbjct  182   KGVLNDAEKLTEERIEEVLNEFLRDFKEDMLETKCWPPALSAYILSKAALNAYTRIVAKK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             YP+L VNC+ PG VKTD+ +N G  T  E A++++R+A+ P   PSG+FF  +++  F
Sbjct  242   YPNLCVNCICPGFVKTDMTFNAGIFTVDEAAENVMRLAVFPSGIPSGLFFFSQEVTPF  299



>ref|XP_009594774.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=305

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 214/291 (74%), Gaps = 9/291 (3%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLS-DNVLFHRL  866
             +YAVVTG NKGIGFEICRQLA +GV VVLTARNE +G EA+EKL+G +GL+ +NV+F +L
Sbjct  11    KYAVVTGANKGIGFEICRQLASQGVVVVLTARNEKRGVEALEKLKGLIGLAKENVVFQQL  70

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVLNFMRA  704
             DV D ST++SL  FI T FGRLDILVNNA + G+ A+  AL A        G  +N+   
Sbjct  71    DVMDPSTIASLAEFIKTQFGRLDILVNNARIGGVTADADALIAKQESSGTGGSQVNWNNI  130

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             ++ +Y L+ EC++ NYYG KRMTEAF+PLLQ S SPRIVNV+S   +L+++  EWAKGVL
Sbjct  131   LTESYALAEECLQTNYYGVKRMTEAFIPLLQLSNSPRIVNVSSSMGRLKNLKQEWAKGVL  190

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             +  ++    K+ EV+ ++L D K  + + KG P  MSAY++SKAAMNAY+R+ A K+P +
Sbjct  191   SESDNLTEEKIQEVIEQYLRDNKEDTLQAKGCPSLMSAYILSKAAMNAYSRVMAKKHPYI  250

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             Q+NCV PG VKTD+ YN+G ++ ++GA+S V +ALQP+   SG+FF  K++
Sbjct  251   QINCVCPGFVKTDMTYNSGILSIEQGAESPVMLALQPDGAASGLFFVRKRV  301



>ref|XP_007135023.1| hypothetical protein PHAVU_010G095400g [Phaseolus vulgaris]
 gb|ESW07017.1| hypothetical protein PHAVU_010G095400g [Phaseolus vulgaris]
Length=294

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 212/291 (73%), Gaps = 2/291 (1%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIGF IC++L   GV VVLTARNE +G EAVEKL+  GLSD ++FH
Sbjct  3     EEAKRYAVVTGANKGIGFGICKKLTLNGVVVVLTARNEKRGLEAVEKLKEFGLSDLLVFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVI-GLAANESALRASMGRVLNFMRAISH  695
             +LDVTD  +V++L  FI T FGRLDILVNNAGV  GL   E+ LR   G + ++   +  
Sbjct  63    QLDVTDPPSVAALAQFIKTRFGRLDILVNNAGVPGGLVNGENVLRKKRGEISDWNLIVPQ  122

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
             NYEL+ EC+EIN++G++R+TEA LPLLQ+S SPRIVNV+S    L +I N+WA+ VL+++
Sbjct  123   NYELAEECVEINFFGAERVTEALLPLLQRSTSPRIVNVSSRRGILRNIPNDWAREVLSDI  182

Query  514   ESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    K+  V+ +FL+DYK GS + K WPP +S Y +SK A+N+Y R+ A K+P  ++N
Sbjct  183   ENLTNKKIHVVLREFLKDYKVGSLESKNWPPVLSGYTMSKTALNSYTRMLAKKFPRFRIN  242

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             C+ P  VKTD+N N G +T  EGA+   R+AL P++GPSG+FF   ++++F
Sbjct  243   CLCPDFVKTDLNQNVGFLTIDEGAECPARLALLPDNGPSGLFFLKNELLSF  293



>gb|KHN27306.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=332

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 210/287 (73%), Gaps = 2/287 (1%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVVTG NKGIG+ IC++LA  GV VVLTARNE +G +AVE+L+  GLSD ++FH+LDV
Sbjct  45    RYAVVTGANKGIGYGICKKLALNGVVVVLTARNEKRGLDAVERLKEFGLSDLLVFHQLDV  104

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRVLNFMRAISHNYEL  683
             TD  +V+SL  FI T FGRLDILVNNAGV G   N E+ LR   G + ++   +  NYEL
Sbjct  105   TDPPSVASLTQFIKTRFGRLDILVNNAGVPGGIVNGENVLRRKRGEISDWNIIVRQNYEL  164

Query  682   SAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVESPP  503
             + EC+E+N++G++R+TEA LPLLQ S SPRIVNV+S    L++I NEWA+GV  ++E   
Sbjct  165   AEECVEVNFFGAERVTEALLPLLQLSTSPRIVNVSSRIGVLKNIPNEWARGVFGDIEKLT  224

Query  502   G-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNP  326
               KL  V+ +FL+DYK GS + K WPP +S Y +SK A+N+Y R+ A K+P  ++NC+ P
Sbjct  225   NKKLHVVLREFLKDYKEGSLESKNWPPVLSGYTMSKTALNSYTRMLAKKFPRFRINCLCP  284

Query  325   GNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
               VKTDIN+N G +T  EGA+   R+AL P++GPSG+FF  +++++F
Sbjct  285   DFVKTDINHNVGFLTIDEGAECPARLALLPDNGPSGLFFLREEVLSF  331



>ref|XP_002267820.2| PREDICTED: uncharacterized protein LOC100243097 [Vitis vinifera]
Length=602

 Score =   326 bits (835),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 14/311 (5%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ RYAVVTG NKGIG EICRQLA  GV VVLTAR+E +G EA+E L+G GLS N++F
Sbjct  2     AEAATRYAVVTGANKGIGLEICRQLAANGVRVVLTARDEKRGLEALESLKGSGLS-NLVF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-LAANESALRA------SMGRVLN  716
             H+LDV D +++SS+  FI   FG+LDILVNNAG+ G +  +  ALR+      ++G+V N
Sbjct  61    HQLDVGDPASISSIADFIKAQFGKLDILVNNAGIGGTVVTDPDALRSRYASAEAVGKV-N  119

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   +   +EL  EC++INYYG KRM EAF+PLLQ S SPRIVNV+S   KL++I NEWA
Sbjct  120   WKEIMIEPFELVEECLKINYYGPKRMIEAFIPLLQLSDSPRIVNVSSSMGKLQNIKNEWA  179

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             K VL++ E+    ++DEV+N+FL+D+K G  + K WP ++SAY VSKAA+NAY RI A K
Sbjct  180   KAVLSDAENLTEERVDEVLNQFLKDFKEGLLEAKSWPSNVSAYTVSKAALNAYTRILARK  239

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF**  179
              P+L +NCV PG VKTD+NYN+G +T +EGA+S VR+AL P+ GPSG FF  K++  F  
Sbjct  240   CPTLCINCVCPGFVKTDLNYNSGILTIEEGAESPVRLALLPDGGPSGQFFVRKEVSEF--  297

Query  178   ELVSFMVSQLL  146
                +F +SQ +
Sbjct  298   --SNFTISQTM  306


 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/297 (53%), Positives = 209/297 (70%), Gaps = 8/297 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  R AVVTG NKG+G EICRQLA  GV VVLTAR+E +G EA++ L G GLS N++F
Sbjct  307   AEAITRSAVVTGANKGMGLEICRQLAASGVRVVLTARDEKRGVEALQSLNGSGLS-NLVF  365

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-----LAANESALRAS-MGRVLNF  713
             H+LDV D ++++S   FI T FG+LDILVNNAG+ G       A ES + A+  G  +N+
Sbjct  366   HQLDVGDPASIASFADFIKTQFGKLDILVNNAGMSGSIVKDPVALESGVAATEAGEQVNW  425

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                ++   EL+ EC++INYYG KRM EAF+PLLQ S SPRIVNV+S   KL+++ NEWAK
Sbjct  426   HGIMTQPLELAEECVKINYYGPKRMAEAFIPLLQLSDSPRIVNVSSSLGKLQNVTNEWAK  485

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL++ E+    ++DEV+N+FL+D++ G  + K W    +AY VSKAA+NAY RI A KY
Sbjct  486   AVLSDAENLTEERVDEVLNQFLKDFEEGLLEAKNWSAFYAAYTVSKAALNAYTRILATKY  545

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             P+  +NCV PG VKTD N N G +T +EGA+  V++AL P+ GPSG FF  K++  F
Sbjct  546   PAFCINCVCPGYVKTDFNDNIGILTVEEGAECPVKLALLPDGGPSGHFFSRKEVTEF  602



>ref|NP_001276230.1| (+)-neomenthol dehydrogenase-like [Glycine max]
 gb|ACU17980.1| unknown [Glycine max]
Length=299

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 214/297 (72%), Gaps = 8/297 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A++RYAVVTG NKGIG EI RQLA  G+ V+LTARNE KG +A+E L+  GLS  VLFH
Sbjct  3     EATERYAVVTGANKGIGLEIVRQLASAGIKVLLTARNEKKGLQALETLKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESAL--RASMGRVL----NFM  710
             ++DV DA+ V+SL  F+ + FG+LDIL+NNAG+ G+  +++ L   A M R      N  
Sbjct  63    QVDVADATNVASLADFVKSKFGKLDILINNAGIGGVVIDDTDLITTAIMNRGAIPEDNGT  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE-WAK  533
             + I+H YEL+ EC++INYYG+K+ TE+ +PLLQ S SPRIVNV+S   +LES+  E WA+
Sbjct  123   KGITHTYELAEECLQINYYGAKKTTESLMPLLQLSDSPRIVNVSSTLGQLESLPKESWAR  182

Query  532   GVLNNVESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV N+V++   ++ DE++NKFL D++ GS + KGWP ++SAY+VSKAAMNAY RI + KY
Sbjct  183   GVFNDVDNLTEEIVDEILNKFLRDFREGSLESKGWPKYLSAYIVSKAAMNAYTRILSKKY  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  +N V PG VKTD+  NTG +T +EGA S VR+AL P   PSG F+    + +F
Sbjct  243   PSFCINSVCPGYVKTDMTANTGFLTVEEGAASPVRLALLPIGSPSGFFYYRSDVASF  299



>emb|CDX71758.1| BnaC08g31160D [Brassica napus]
Length=296

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/295 (55%), Positives = 215/295 (73%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NV  881
             ++ + RYAVVTG N+GIG EICRQLA  G+ VVLT+R+  +G EAVE LR  +G+SD ++
Sbjct  2     TEETPRYAVVTGANRGIGLEICRQLASNGIRVVLTSRDVKRGLEAVETLRQEIGVSDQSL  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
             LFH+LDVTD ++V+SL  F+ T FG+LDIL+NNAGV G   +   L+A  G+V  N+   
Sbjct  62    LFHQLDVTDPASVTSLAEFVKTQFGKLDILINNAGVGGTITDVETLQAGAGKVGFNWEET  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+ NYEL+ EC+ INYYG KRM EAF+PLL+ S SPRIVNV+S   +L++I NEWAKGVL
Sbjct  122   ITENYELAKECMNINYYGPKRMCEAFIPLLKLSDSPRIVNVSSFMGQLKNIFNEWAKGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++DEV+NK LE++K G  K K W   M+AYVVSKA +N Y RI A K+P +
Sbjct  182   SDAENLTEERIDEVINKLLEEFKEGKVKTKDWASVMAAYVVSKAGLNGYTRIIAKKHPEI  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +VN V PG VKTD+NYNTG ++ +EGA S VR+AL P ++  SG FF  K++  F
Sbjct  242   RVNAVCPGFVKTDMNYNTGVLSVEEGASSPVRLALLPHQETNSGCFFYRKQLSEF  296



>ref|XP_008232775.1| PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase-like 
[Prunus mume]
Length=297

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 206/296 (70%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGRVLNFM  710
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A  A      MGR     
Sbjct  62    HQLDVANPATVASLAEFIKTQFGKLDILVNNAGISGAIGDADAFIALLNSLEMGRGEVGS  121

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KL  I + WAKG
Sbjct  122   KLMTETYELTEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSSLGKLMHIPSHWAKG  181

Query  529   VLNNVESPPGK-LDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V  + E+   + ++EV+ + L+D+K GS + KGWP  +SAYVVSKAA+NAY RI A KYP
Sbjct  182   VFTDAENLTEEXINEVLTELLKDFKEGSLESKGWPSRLSAYVVSKAALNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             + ++N + PG VKTDI YNTG +  ++GA  ++++AL P DGPSG FF   ++  F
Sbjct  242   TFRINSLCPGFVKTDITYNTGVLPVEDGAARVMKLALLPNDGPSGSFFAHNEVSDF  297



>ref|XP_002301343.2| hypothetical protein POPTR_0002s15800g [Populus trichocarpa]
 gb|EEE80616.2| hypothetical protein POPTR_0002s15800g [Populus trichocarpa]
Length=306

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/299 (53%), Positives = 211/299 (71%), Gaps = 9/299 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VL  878
             S A+KRYAVVTG NKGIG+EICRQLA  G+ VVLTAR+E +G EAV+ L+  G+SD+ V+
Sbjct  7     SLATKRYAVVTGANKGIGYEICRQLASNGILVVLTARDEKRGLEAVQNLKDSGISDDLVI  66

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-----  713
             +H+LDV D  ++ SL  F+  NFG+LDILVNNAG+ G+A    A + +  +   F     
Sbjct  67    YHQLDVVDPDSIVSLAEFVKNNFGKLDILVNNAGIGGVALEADAFQRAFEQAGEFPYGEQ  126

Query  712   --MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
                   + NYE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I NEW
Sbjct  127   VWAEIGTQNYEMAEQCVKTNYYGARGMAEALAPLLQLSDSPRIVNVSSMLGLLKNIPNEW  186

Query  538   AKGVLNNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AK +LN+VE+    +LDEVVN FL+D+K      KGWP ++SAY+V+KAAM+AY RI A 
Sbjct  187   AKELLNDVENLNEDRLDEVVNGFLKDFKEDLLGSKGWPTYLSAYIVAKAAMSAYTRILAK  246

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYPS  VNC+ PG+ KTDI  NTG  TA EGA++ VR+AL P+ GPSG FF  K+++ +
Sbjct  247   KYPSFCVNCLCPGHCKTDITTNTGPFTAAEGAENAVRLALLPDGGPSGFFFYQKEMLPY  305



>ref|XP_007218752.1| hypothetical protein PRUPE_ppa009330mg [Prunus persica]
 gb|EMJ19951.1| hypothetical protein PRUPE_ppa009330mg [Prunus persica]
Length=297

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 209/296 (71%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIGF   +QLA  GVTVVLTAR+E +G EAVEKL+  GLSD V+F
Sbjct  2     AEATKRYAVVTGANKGIGFGTVKQLASNGVTVVLTARDEKRGLEAVEKLKEFGLSDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-GRVLNFMR---  707
             H+LDVT+ S+++SL  F+ T FG+LDILVNNAG+IG        R+ + G+    +R   
Sbjct  62    HQLDVTEPSSITSLADFVKTQFGKLDILVNNAGMIGNQIKPEDFRSVVSGKKPEEIRWNA  121

Query  706   -AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
                + NY+L+ E ++ NYYG+KR+TEA LPLLQ S SPRIVNV+SG SKL    N WAK 
Sbjct  122   IPTTPNYKLAEEGLKTNYYGTKRVTEALLPLLQLSDSPRIVNVSSGVSKLVIFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ ES    ++D V+ + LED+K G  + K WP     Y VSKAA+NAY RI A KYP
Sbjct  182   VLSDAESLTEERIDAVLAELLEDFKQGLVENKSWPTIFPPYTVSKAAVNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NCV PG VKTDI +NTG +T +EGA+S+VR+AL P  GP+G FF CK+   F
Sbjct  242   NFYINCVCPGFVKTDITFNTGTLTIEEGAESLVRLALLPNGGPTGHFFLCKEATPF  297



>gb|AES80102.2| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=286

 Score =   313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 214/291 (74%), Gaps = 7/291 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  RYAVVTG NKGIGFE  + LA  GV VVLTAR+E KG+EA++KL+  GLSD V+F
Sbjct  2     AEAKLRYAVVTGSNKGIGFETVKMLASNGVKVVLTARDEKKGNEAIQKLKQFGLSDQVMF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVTD+++++SLV F  T FGRLDILVNNAGV G+   E+     +G  +++ + ++ 
Sbjct  62    HQLDVTDSASITSLVQFFKTQFGRLDILVNNAGVSGVNPYET-----VGSTVDWEK-LTQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
               +++  C+  NYYG K  T+AFLPLL+ S S +IVNV+S  + L++I N+WAK V +++
Sbjct  116   TSDMAENCLRTNYYGVKETTDAFLPLLKLSNSSKIVNVSSQAALLKNIPNQWAKRVFDDI  175

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    K+DEV+ +F++D+K GS + KGWP  MSAY++SKAAMN+Y RI A KYP++ +N
Sbjct  176   ENLTEEKIDEVLKEFIKDFKEGSLENKGWPTIMSAYIISKAAMNSYTRILAKKYPNMCIN  235

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CV PG VKTDIN NTG +   +GA S+VR+AL P+D PSG+FF  ++I  F
Sbjct  236   CVCPGFVKTDINKNTGMLPVDQGAASVVRLALLPDDSPSGLFFIREEISNF  286



>ref|XP_011023384.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Populus euphratica]
Length=306

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/295 (53%), Positives = 208/295 (71%), Gaps = 9/295 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFH  872
             A KR AVVTG NKGIG+EICRQLA  G+ VVLTAR+E +G EAV+KL+  G+SD+ V++H
Sbjct  9     AKKRCAVVTGANKGIGYEICRQLASNGILVVLTARDEKRGLEAVQKLKDCGISDDLVIYH  68

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-------  713
             +LDV D  ++ SL  F+  NFG+LDILVNNAG+ G+     A + +  +   F       
Sbjct  69    QLDVVDPDSIVSLAEFVKNNFGKLDILVNNAGISGVVLEADAFQRAFEQAGEFPSGEQVW  128

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                 + NYE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I NEWAK
Sbjct  129   AEIGTQNYEMAEQCVKTNYYGARGMAEALAPLLQLSDSPRIVNVSSLLGLLKNIPNEWAK  188

Query  532   GVLNNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             G+LN+VE+    +LDEVVN+FL+D+K      KGWP ++SAY+V+KA M+AY RI A KY
Sbjct  189   GLLNDVENLNEDRLDEVVNEFLKDFKEDLLGSKGWPTYLSAYIVAKATMSAYTRILAKKY  248

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             PS +VNC+ PG  KTDI  NTG  TA EGA++ VR+AL P+ GPSG FF  K+++
Sbjct  249   PSFRVNCLCPGYCKTDITTNTGPFTAAEGAENAVRLALLPDGGPSGCFFYQKQML  303



>gb|KDP28664.1| hypothetical protein JCGZ_14435 [Jatropha curcas]
Length=299

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 161/298 (54%), Positives = 212/298 (71%), Gaps = 10/298 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSD-NVLFH  872
             A  RYAVVTGGNKGIGFEICR+LA  G+ VVLTAR+EN+G EAV++L+  GLSD N++FH
Sbjct  2     ADLRYAVVTGGNKGIGFEICRRLASNGIVVVLTARDENRGLEAVKRLKDSGLSDDNLVFH  61

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESAL-RASM-------GRVLN  716
             +LDVTD  +V+SL  F+   FG+LDILVNNAG+ G+  +     RAS        G+ + 
Sbjct  62    QLDVTDPRSVASLADFVKIQFGKLDILVNNAGISGVTIDHDVFQRASELSGGWPDGKQVT  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +    + + EL+ +C++ NYYG+K M EA  PLLQ SK+ RIVNV+S    L+ I +EWA
Sbjct  122   WDEIQTPSLELAEQCLKTNYYGAKLMVEALTPLLQLSKAARIVNVSSALGLLQFIPSEWA  181

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KG+L++VE+    K+DEV+N+FL+D+K+G  + KGWP  +SAY V+KA+MNAY RI A K
Sbjct  182   KGLLSDVENLTEEKVDEVLNQFLKDFKDGLVETKGWPTSLSAYTVAKASMNAYTRILAKK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             YPS  VN V PG  KTDI  N G +T+ EGA+  VR+AL PEDGPSG FF  K++  F
Sbjct  242   YPSFGVNSVCPGFCKTDITTNVGLLTSAEGAEHAVRLALFPEDGPSGCFFLRKQMSCF  299



>gb|AET02077.2| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/296 (53%), Positives = 211/296 (71%), Gaps = 7/296 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIGFEI RQLA +G+ VVLTAR+E +G  A+E L+  GLSD VLFH
Sbjct  3     EPTKRYAVVTGSNKGIGFEIVRQLASDGIKVVLTARDEKRGLHALETLKASGLSDFVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN--FM  710
             +LDV DAS+V+SL  F+ ++FG+LDILVNNAG+ G+   +  L  S     G + +    
Sbjct  63    QLDVADASSVASLADFVKSHFGKLDILVNNAGISGVEVKDRDLFTSAIMTSGALPDEELR  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             RA++  YE + ECI+INYYG+KR  E  LPLLQ S SPR+VNV+S   K+E + NEWAKG
Sbjct  123   RAVTQTYESAKECIQINYYGAKRAFEYLLPLLQLSDSPRVVNVSSFLGKIELVSNEWAKG  182

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V ++VE+    ++DEV+ +F++D++ GS + KGWP   +AY V+KA+MNAY  I A KYP
Sbjct  183   VFSDVENLTEERIDEVLEEFIKDFEEGSLESKGWPRFAAAYTVAKASMNAYTIILAKKYP  242

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NCV PG VKTD+  NTG +T +EGA + VR+AL P+  PSG+F+    I +F
Sbjct  243   NFCINCVCPGYVKTDMTTNTGILTVEEGATNPVRLALLPKGSPSGLFYSQNGIASF  298



>ref|XP_002876599.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52858.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=296

 Score =   313 bits (801),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 214/295 (73%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVL  878
             ++ + RYAVVTG N+GIGFEICRQLA +G+ VVLT+R+E +G EAVE L+  + +SD  L
Sbjct  2     AEETPRYAVVTGANRGIGFEICRQLASQGIRVVLTSRDEKRGLEAVETLKKELQISDQSL  61

Query  877   -FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
              FH+LDV+D ++ +SL  F+ T FG+LDILVNNAGV G+  +  ALRA  G+    +   
Sbjct  62    VFHQLDVSDPASSTSLAEFVKTLFGKLDILVNNAGVGGIITDADALRAGAGKEGFKWDEI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+  YEL+ ECI+INYYG KRM EAF+PLL+ S SPRIVNV+S    L+++ NEWAKG+L
Sbjct  122   ITETYELAEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGLLKNVLNEWAKGIL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++D+V+N+ L D+K G+ KEK W   MSAYVVSKA++N Y RI A K+P  
Sbjct  182   SDAENLTDERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRILAKKHPEF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +VN V PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FF  K++  F
Sbjct  242   RVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFFSRKQVSEF  296



>ref|XP_003521915.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=293

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 206/283 (73%), Gaps = 2/283 (1%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIG+ IC++LA  GV VVLTARNE +G +AVE+L+  GLSD ++FH
Sbjct  3     EEAKRYAVVTGANKGIGYGICKKLALNGVVVVLTARNEKRGLDAVERLKEFGLSDLLVFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRVLNFMRAISH  695
             +LDVTD  +V+SL  FI T FGRLDILVNNAGV G   N E+ LR   G + ++   +  
Sbjct  63    QLDVTDPPSVASLTQFIKTRFGRLDILVNNAGVPGGIVNGENVLRRKRGEISDWNIIVRQ  122

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
             NYEL+ EC+E+N++G++R+TEA LPLLQ S SPRIVNV+S    L++I NEWA+GV  ++
Sbjct  123   NYELAEECVEVNFFGAERVTEALLPLLQLSTSPRIVNVSSRIGVLKNIPNEWARGVFGDI  182

Query  514   ESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E     KL  V+ +FL+DYK GS + K WPP +S Y +SK A+N+Y R+ A  +P++ +N
Sbjct  183   EKLTNKKLHVVLREFLKDYKEGSLESKNWPPVLSGYTMSKTALNSYTRMLAKNFPTIPIN  242

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              + PG VKTDIN NTG +T  EGA++ VR+AL P+  PSG FF
Sbjct  243   ALCPGYVKTDINCNTGFLTPDEGAEAAVRLALLPDGSPSGHFF  285



>ref|XP_002511821.1| carbonyl reductase, putative [Ricinus communis]
 gb|EEF50490.1| carbonyl reductase, putative [Ricinus communis]
Length=306

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 216/302 (72%), Gaps = 10/302 (3%)
 Frame = -1

Query  1060  NASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-  884
             +A+  +KRYAVVTG N+GIGFE+CRQLA  G+ VVLTAR+EN+G EAV+KL+  G+SD+ 
Sbjct  5     SANTTTKRYAVVTGANRGIGFEVCRQLASNGIVVVLTARDENRGLEAVKKLKDSGVSDDL  64

Query  883   VLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM--------G  728
             V+FH+LD+ D  ++SSL  FI   FGRLDILVNNAG+ G+  +    R           G
Sbjct  65    VVFHQLDMADPDSISSLADFIKIQFGRLDILVNNAGIGGIVYHPDNFRRGFEHCGGWPDG  124

Query  727   RVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIH  548
             + +++    + +++L+ +C++ NYYG+K M EA  PLLQ S S  IVNV+S    L++I 
Sbjct  125   KQVSWTEMATQSFDLAGKCVKTNYYGAKGMVEALAPLLQSSDSAMIVNVSSLLGLLQNIP  184

Query  547   NEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARI  371
              EWAK VL+++E+    ++DEVVN+FL+D+K+G  + KGWP  +S Y+V+KAA+NAY RI
Sbjct  185   GEWAKAVLSDIENLTEERVDEVVNQFLKDFKDGFLEAKGWPMQLSGYIVAKAALNAYTRI  244

Query  370   TAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
              A KYPSL+VN + PG  +TD+  N G +TA EGA+++VR+AL P+DGPSG FF+ K+I 
Sbjct  245   LAKKYPSLRVNALCPGFCRTDMTINIGLLTAPEGAENVVRLALLPKDGPSGCFFNMKEIH  304

Query  190   AF  185
              F
Sbjct  305   CF  306



>ref|XP_003627602.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02078.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 209/294 (71%), Gaps = 9/294 (3%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             +RYAVVTG NKGIG EI RQLA  G+ VVLTAR+E +G  A+E L+  GLSD V+FH+LD
Sbjct  6     ERYAVVTGSNKGIGLEIVRQLASAGIKVVLTARDEKRGLHALETLKASGLSDFVVFHQLD  65

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLN-------FMRA  704
             V DA++V+SL  FI + FG+LDILVNNAG+ G+   +S L + +  + N         R 
Sbjct  66    VADAASVASLADFIKSQFGKLDILVNNAGINGIEIKDSDLYSQV-LITNGAQSDEELRRT  124

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +++ +E + ECIEINYYG+KR  E  LPLLQ S SP++VNV+SG  K+E + NEWAKGV 
Sbjct  125   MTYTFESAKECIEINYYGAKRTFEYLLPLLQLSDSPKVVNVSSGLGKIEFVSNEWAKGVF  184

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++VE+    ++DEV+ +F++D++ GS + KGWP +++AY V+KA+MNAY RITA KYP+ 
Sbjct  185   SDVENLTEERIDEVIKEFIKDFEEGSLERKGWPRYLAAYTVAKASMNAYTRITAKKYPNF  244

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +NCV PG VKTDI  NTG  T +EGA   VR+AL P   PSGV++   ++  F
Sbjct  245   CINCVCPGYVKTDITANTGFFTVEEGAAHPVRLALLPNGSPSGVYYIRNEVYPF  298



>gb|KDP28663.1| hypothetical protein JCGZ_14434 [Jatropha curcas]
Length=298

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 209/297 (70%), Gaps = 7/297 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++++ RYAVVTGGNKG+G+ I + LA  G+TV+LTAR+EN+G EA+EKL+  GLSD V+F
Sbjct  2     AESTSRYAVVTGGNKGLGWGIVQLLASNGITVILTARDENRGLEAIEKLKESGLSDGVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANES-----ALRASMGRVLN-F  713
             H+LDV D ++++SL  FI T FG+LDILVNNAGV G   + S      L  +   V+N +
Sbjct  62    HQLDVLDPASIASLAEFIKTQFGKLDILVNNAGVGGNIIDSSKLDSMTLTGTEDDVINVW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++ NYEL+ EC+  NYYG+KR  EA +PLLQQS SP+I+N++S  +  + + NEWAK
Sbjct  122   SKVLTENYELAEECVNTNYYGAKRTAEALIPLLQQSDSPKIINISSTMATFKYLTNEWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              V +NVE     ++DEVVN FL DYK  S + KGWP  +SAY VSKAAMNA+ R+ A  Y
Sbjct  182   EVFSNVEMLSEERIDEVVNVFLRDYKENSLETKGWPSFLSAYSVSKAAMNAHTRLLARNY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             P+  +NCVNPG++KTDI  N G  T +E A   V++AL P  GPSG+FF   ++ +F
Sbjct  242   PNFSINCVNPGSIKTDITCNRGVFTVEEAAVYPVKLALLPHGGPSGLFFLLDQVTSF  298



>emb|CDP08861.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/293 (55%), Positives = 214/293 (73%), Gaps = 7/293 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG-LSDNVLF  875
             ++ KR AVVTG N+GIG EICRQLA +G+TVVLTAR+E +G +A+ +LR  G LS N+LF
Sbjct  8     NSPKRCAVVTGANRGIGLEICRQLASQGITVVLTARDEKRGLDALHRLRDSGGLSGNLLF  67

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM--GRVLNFMRAI  701
             H+LDV D+S+V+SL  FINT  GRLDILVNNAG+ G   +E+A+RA+   G  +NF    
Sbjct  68    HQLDVGDSSSVASLAEFINTELGRLDILVNNAGIGGALVDEAAIRAAAAAGTEINFEEIA  127

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  YEL+ EC++ NYYG+KRM EA +PLLQ S+SPRIV+V+S   KLE I   WAK  L 
Sbjct  128   TQTYELAVECLQTNYYGAKRMVEACVPLLQLSESPRIVSVSSSMGKLECIKYGWAKRTLG  187

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             + E+    ++D+VV +FL+D+  G  + KGWP    AYV+SKAA+NAY RI A ++P+ +
Sbjct  188   DAENLTEERVDKVVKEFLQDFNEGYQEAKGWP---LAYVISKAALNAYTRILAKRFPNFK  244

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             VNCV PG VKTDINYNTG +  +EGA+S V++AL   DGPSG+FF   ++ +F
Sbjct  245   VNCVCPGFVKTDINYNTGTLPVEEGAESPVKLALLSNDGPSGLFFSSNQVTSF  297



>ref|XP_007139902.1| hypothetical protein PHAVU_008G068200g [Phaseolus vulgaris]
 gb|ESW11896.1| hypothetical protein PHAVU_008G068200g [Phaseolus vulgaris]
Length=294

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 205/283 (72%), Gaps = 3/283 (1%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+ RYAVVTG NKGIGF IC+QL   G+TVVLTAR+E +G EAVEKL+  G SD V+FH+
Sbjct  4     ATIRYAVVTGANKGIGFGICKQLISNGITVVLTARDEKRGIEAVEKLKEFGASDQVVFHQ  63

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV--LNFMRAISH  695
             LDVTD  ++ SL +FI T FG+LDILVNNAGV G + +  A+ A+  ++  +++ +    
Sbjct  64    LDVTDPKSIESLANFIKTQFGKLDILVNNAGVSGTSVDHDAIAAAGEKLGSVDWRKFAHE  123

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YE +   I  NYYG+K M EAF+PLL+ S SPRIVNV+S   KLE I NE A+GVL++V
Sbjct  124   TYESAESSIRTNYYGAKLMCEAFIPLLELSDSPRIVNVSSVMGKLEKIPNESARGVLSDV  183

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             ES    K++EV+N+FL  +K GS +  GWP  +SAY+VSKAA+ AY R+ A KYPS  +N
Sbjct  184   ESLTEEKVEEVLNQFLNGFKEGSLQTNGWPDVLSAYIVSKAALTAYTRVLAKKYPSFCIN  243

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              V PG VKTD+N+N G  + +EGA+S+VR+AL P  GPSG+FF
Sbjct  244   AVCPGFVKTDLNFNIGYFSIEEGAESVVRLALLPNGGPSGLFF  286



>ref|NP_179996.1| Short-chain dehydrogenase/reductase 2 [Arabidopsis thaliana]
 sp|Q9ZUH5.1|SDR2B_ARATH RecName: Full=Short-chain dehydrogenase/reductase 2b; Short=AtSDR2b 
[Arabidopsis thaliana]
 gb|AAD03380.1| putative carbonyl reductase [Arabidopsis thaliana]
 gb|AEC07537.1| Short-chain dehydrogenase/reductase 2 [Arabidopsis thaliana]
Length=296

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 218/295 (74%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NV  881
             ++ S RYA+VTGGN+GIGFEICRQLA +G+ V+LT+R+E +G EAVE L+  + +SD ++
Sbjct  2     AEESPRYAIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSI  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
             +FH+LDV+D  +V+SL  F+ T+FG+LDIL+NNAGV G+  +  ALRA  G+    +   
Sbjct  62    VFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEET  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+  YEL+ ECI+INYYG KRM EAF+PLLQ S SPRI+NV+S   +++++ NEWAKG+L
Sbjct  122   ITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGIL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++D+V+N+ L D K  + K K W   MSAYVVSKA +NAY RI A K+P +
Sbjct  182   SDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHPEI  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +VN V PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FFD K++  F
Sbjct  242   RVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFFDRKQVSEF  296



>ref|XP_007051884.1| NAD(P)-binding Rossmann-fold superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX96041.1| NAD(P)-binding Rossmann-fold superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=307

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/299 (54%), Positives = 208/299 (70%), Gaps = 11/299 (4%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+KRYAVVTG NKGIG EICRQLA +GV VVLTAR+EN+G EAVEKL+  G+SDNV+FH+
Sbjct  9     AAKRYAVVTGANKGIGLEICRQLASKGVMVVLTARDENRGLEAVEKLKESGVSDNVVFHQ  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRA-----  704
             LDVTD  +++SL  FI T FG+LDILVNNA + G+  N  +   ++ R  ++        
Sbjct  69    LDVTDPVSIASLADFIGTQFGKLDILVNNAAIPGVIMNYDSFARAVERFGDWPTGDQVWN  128

Query  703   ---ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                 +  YEL+ EC++ NYYG KRM EA  P L+ S S RIVNVTS    L+ + NEWAK
Sbjct  129   EIITAQTYELAEECLKTNYYGMKRMVEALAPFLRLSDSARIVNVTSYLGLLQLMSNEWAK  188

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHM--SAYVVSKAAMNAYARITAH  362
             GVL++VES    +++EV+N FL+D+K G  K KGWP ++  +AY VSKAAMNAY R+ A 
Sbjct  189   GVLSDVESLTEERVEEVLNVFLKDFKEGRMKSKGWPTYIGPTAYSVSKAAMNAYTRVLAK  248

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYPS  V CV PG  KTDI   TG  TA EGA+++VR AL P  G SG+FF+ +++  F
Sbjct  249   KYPSFWVICVAPGFAKTDITGGTGYSTAAEGAENVVRPALLPTAGSSGLFFNRQEVSDF  307



>ref|XP_010661730.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Vitis 
vinifera]
Length=298

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/299 (53%), Positives = 213/299 (71%), Gaps = 11/299 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG N+GIG EICRQLA  GV VVLTARNE  G EA+E L+G GLS NV F
Sbjct  2     AEATKRYAVVTGANRGIGLEICRQLAANGVIVVLTARNEKMGVEALENLKGSGLS-NVGF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE--------SALRASMGRVL  719
             H+LDV D ++++SL   I T FG+LDILVNNAG+ G    +        +A +A +G++ 
Sbjct  61    HQLDVGDPASIASLADSIKTQFGKLDILVNNAGIAGTIVTDPNGFRSAVAADQAGLGKI-  119

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             N+   +   +E + EC+++NYYG KR+ EA  PLLQ S SPRIVNV+S   KL+++ NEW
Sbjct  120   NWKEIMIEPFEQAEECLKVNYYGPKRIIEALTPLLQLSDSPRIVNVSSSAGKLKNVINEW  179

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AKGVLN+ ++    ++DEV+ +FL+D+K G  +   WP ++SAY+VSKAA+NA  RI A 
Sbjct  180   AKGVLNDAQNLTEERVDEVLKEFLKDFKEGLLEAHSWPSYLSAYIVSKAALNACTRILAR  239

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYP+  +NCV PG VKTD+NYN G +T +EGA+S V +AL P+ GPSG FF  K++  F
Sbjct  240   KYPTFCINCVCPGFVKTDMNYNNGILTVEEGAESPVSLALLPDGGPSGQFFVRKELFEF  298



>ref|XP_011091821.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Sesamum indicum]
Length=350

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 207/281 (74%), Gaps = 5/281 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVV+G NKGIGFEICRQLA  G+TVVLTAR+ENKG +A+ +L+G  LSD+V+FH+LDV
Sbjct  61    RYAVVSGANKGIGFEICRQLASHGITVVLTARDENKGLQAINQLKGSALSDHVIFHQLDV  120

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV----LNFMRAISHN  692
             TD  ++ SL  FI + FG+LDILVNNAG+ G   +   + A    +    +N+   ++  
Sbjct  121   TDLESIFSLAEFIKSQFGKLDILVNNAGISGAIFHVEKIEAVGPFIREANVNWDDIVTQT  180

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             YE +AE ++ NYYG+KR++EA LPLL+ S SPRIVNV+S   KL+ I NEWAK VL + E
Sbjct  181   YEAAAEGLQTNYYGAKRLSEALLPLLRLSDSPRIVNVSSASGKLKYITNEWAKKVLTDAE  240

Query  511   SPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
             +    LD+V+N+FL+D+K G+   +G P  ++AY +SKAAMNA+ RI A K+P  ++N V
Sbjct  241   NQES-LDQVLNEFLKDFKEGNLYVEGQPGVLAAYTISKAAMNAHTRILAKKHPGFRINSV  299

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              PG VKTDIN NTG +T +EGA+S+VR+AL P DGPSG+FF
Sbjct  300   CPGYVKTDINCNTGILTVQEGAESVVRLALLPVDGPSGLFF  340



>ref|XP_002511823.1| carbonyl reductase, putative [Ricinus communis]
 gb|EEF50492.1| carbonyl reductase, putative [Ricinus communis]
Length=306

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 215/297 (72%), Gaps = 10/297 (3%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFHR  869
             +KRYAVVTG NKGIGFEICRQLA  G+ VVLTARNEN+G E+V+KL+  G+SD+ ++FH+
Sbjct  10    TKRYAVVTGANKGIGFEICRQLASNGIVVVLTARNENRGLESVKKLKNAGISDDHLVFHQ  69

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS--MGRVLNFMRAISH  695
             L+V  + +V SL  FI T FG+LDILVNNAG+ G+  N   L+ +  +G  L++    + 
Sbjct  70    LNVLHSESVGSLADFIRTKFGKLDILVNNAGIGGVVLNPDNLQRTFELGGGLSYENQATW  129

Query  694   N------YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
             N      +E++  C+E NYYG +RM EA  PLLQ S S RIVNV+S    L++I +EWAK
Sbjct  130   NGLSTQTFEMAELCLETNYYGGRRMVEALAPLLQLSDSARIVNVSSMLGLLQNIPSEWAK  189

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GVL +VES    ++DEVVN+FLED+++G  +  GWP ++SAY+V+KAA+NAY R+ A+KY
Sbjct  190   GVLGDVESLNEDRVDEVVNEFLEDFQDGLLESNGWPTNLSAYIVAKAAVNAYTRVVANKY  249

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  VN V PG+ KTD  +N G ++A EGA+S VR+AL P+DGPSG FF  K+I  F
Sbjct  250   PSFLVNAVCPGSCKTDFAHNVGLLSAAEGAESPVRLALLPKDGPSGCFFYRKEISRF  306



>ref|XP_008232812.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Prunus mume]
Length=526

 Score =   318 bits (816),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 217/310 (70%), Gaps = 8/310 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++  KRY+VVTG NKG+GF I RQLA  GV  VLTAR+E KG EAVEKL+  GLSD V+F
Sbjct  2     AEEGKRYSVVTGSNKGVGFGIVRQLASNGVMTVLTARDEKKGIEAVEKLKECGLSDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-------LN  716
             HRLDVTD S+++SL  F+ T FG+LDILVNNAGV G   +  ALRA+           + 
Sbjct  62    HRLDVTDPSSIASLADFVTTQFGKLDILVNNAGVNGTIMDPEALRAAAAAGLGKKDVEVK  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   ++  YEL+ ECI+ NYYG+K+MT+AFLPLLQ S SPR+VN++SG  +L+ I NEWA
Sbjct  122   WSEMLTQTYELAEECIKTNYYGTKKMTKAFLPLLQLSDSPRVVNISSGRGRLKLIPNEWA  181

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGVLN+ E     +++EV+N+FL D+K    + K WPP +SAY++SKAA+NAY RI A K
Sbjct  182   KGVLNDAEKLTEERIEEVLNEFLRDFKEDMLETKCWPPALSAYILSKAALNAYTRIVAKK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF**  179
             YP+  VNC+ PG VKTD+ +N G  T  E A++++R+A+ P   PSG+FF  +++  F  
Sbjct  242   YPNFCVNCICPGFVKTDMTFNAGIFTVDEAAENVMRLAVLPSGIPSGLFFFSQEVTPFIA  301

Query  178   ELVSFMVSQL  149
              L  F+ +Q 
Sbjct  302   SLADFVKTQF  311


 Score =   229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 166/238 (70%), Gaps = 10/238 (4%)
 Frame = -1

Query  898  GLSDNVLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----  731
            G+   + F   +VT    ++SL  F+ T FG+LDILVNNAGV G   +  ++RA+     
Sbjct  284  GIPSGLFFFSQEVT--PFIASLADFVKTQFGKLDILVNNAGVSGTIVDPESMRAAAAAGI  341

Query  730  ---GRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKL  560
               G  +N+   ++  YEL+  C++ NYYG+K+MT+A LPLLQ S SPR+V+++SG   L
Sbjct  342  DKDGVGVNWSEIMTQTYELAEVCVKTNYYGAKKMTKALLPLLQLSDSPRVVSLSSGMGSL  401

Query  559  ESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNA  383
            + I NEWAKG+L++ E     ++D+V+N+FL+D+K    + KGWP  +SAY++SKAA+NA
Sbjct  402  KHIPNEWAKGMLSDAEKLTEQRIDDVLNEFLKDFKEDILETKGWPTSLSAYILSKAAVNA  461

Query  382  YARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
            + R+ A+KYP++ +N VNPG VKTD+N+NTG +T  EGA+S+VR+A+ P   PSG++F
Sbjct  462  FTRMMANKYPNICINSVNPGFVKTDMNFNTGMLTIDEGAESVVRLAMVPNGSPSGLYF  519



>ref|XP_011035794.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Populus euphratica]
 ref|XP_011015325.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Populus euphratica]
Length=305

 Score =   311 bits (796),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/294 (53%), Positives = 211/294 (72%), Gaps = 9/294 (3%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFHR  869
             +KR+AVVTG  KGIG+EICRQLA  G+ VVLTA +E  G EAV+KL+  G+SD+ V+FH+
Sbjct  9     AKRHAVVTGAEKGIGYEICRQLASNGILVVLTAIDEKIGLEAVQKLKDSGISDDLVVFHQ  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-------M  710
             LDV D ++++SL  F+ T FG+LDILVNNAG+ G+A    A + +  +  +F        
Sbjct  69    LDVVDLNSIASLAEFVKTKFGKLDILVNNAGISGVALKVDAFKRAFEQAGDFPTGKQVWA  128

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
                + +YE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I+NEWAKG
Sbjct  129   EIGTQSYEMAEQCVKTNYYGARGMVEALAPLLQLSDSPRIVNVSSKLGLLKNINNEWAKG  188

Query  529   VLNNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             +LN+VE+    ++DEVVN+FL+D+K    + KGWP ++ AY+VSKAAM+AY RI A KYP
Sbjct  189   LLNDVENLNEDRVDEVVNEFLKDFKEDLLESKGWPTYLPAYIVSKAAMSAYTRILAKKYP  248

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             S  VNC+ PG  KTDI  NTG  TA EGA++ VR+AL PE GPSG FF  K+++
Sbjct  249   SFCVNCLCPGYCKTDITTNTGIFTASEGAENAVRLALLPEGGPSGCFFYQKQML  302



>ref|XP_002880558.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56817.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=301

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 212/290 (73%), Gaps = 5/290 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NVLFHRL  866
             RYA+VTGGN+GIGFEICRQLA +G+ VVLT+R+E +G EAVE L+  +G+SD +++FH+L
Sbjct  12    RYAIVTGGNRGIGFEICRQLANQGIRVVLTSRDERRGLEAVEILKKELGISDQSIVFHQL  71

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRAISHNY  689
             DV+D +++SSL  F+ T FG+LDIL+NNAGV G+  +  ALRA  G+    +   I+  Y
Sbjct  72    DVSDPASISSLAEFVKTQFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETY  131

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             EL+ ECI+INYYG KRM E+F+PLL+ S SPRIVNV+S   +L ++ NEWAKG+L++ E+
Sbjct  132   ELAEECIKINYYGPKRMCESFIPLLRLSDSPRIVNVSSFMGQLTNLLNEWAKGILSDAEN  191

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 ++D+V+N+ L D K  + K K W   MSAYVVSKA +N Y RI A K+P  +VN V
Sbjct  192   LTVERIDQVINQLLNDLKEDTVKTKDWAKVMSAYVVSKAGLNGYTRILAKKHPEFRVNSV  251

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
              PG VKTD+N+ TG ++ +EGA S VR+AL P  + PSG FFD K++  F
Sbjct  252   CPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHRESPSGCFFDRKQVSEF  301



>ref|XP_003627593.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02069.1| short chain dehydrogenase/reductase [Medicago truncatula]
 gb|AFK45507.1| unknown [Medicago truncatula]
Length=293

 Score =   310 bits (794),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 213/292 (73%), Gaps = 2/292 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ASKRYA+VTG NKGIG+ IC++LA  GV VVLTARNE +G +AVE L+ +GLSD V+F
Sbjct  2     TEASKRYALVTGANKGIGYGICKKLASSGVMVVLTARNEKRGLDAVESLKELGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRVLNFMRAIS  698
             H+LDVTD ++VSSLV FI   FG+LDILVNNAGV G   N E+ ++   G + ++  A+ 
Sbjct  62    HQLDVTDPTSVSSLVEFIKIQFGKLDILVNNAGVAGGIVNGENVVKQVRGEISDWNLALR  121

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YEL+ EC+EIN++G++R+TEA +PLLQ S SPRIVNV+S   K + + NEWA+GV ++
Sbjct  122   QTYELAEECVEINFFGAERVTEALIPLLQLSTSPRIVNVSSRRGKFKFMPNEWARGVFDD  181

Query  517   VESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
             + +    KL EV+ +FL+DYK G+ + K WP  +S Y ++KAA+N+Y R+ A K P  ++
Sbjct  182   INNVTNEKLGEVLREFLKDYKEGALETKNWPTFVSGYTMAKAALNSYTRLLALKLPRFRI  241

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NC+ P  VKTDIN   G ++  EGA+  V +AL P+DGPSG+FF   ++I++
Sbjct  242   NCLCPDFVKTDINEMKGFLSIDEGAECPVNLALLPDDGPSGLFFLHDEVISY  293



>ref|XP_011023381.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Populus 
euphratica]
Length=356

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/292 (53%), Positives = 206/292 (71%), Gaps = 9/292 (3%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFHRLD  863
             RYAVVTG NKGIG+EICRQLA  G+ VVLTAR+E +G EAV+KL+  G+SD+ V++H+LD
Sbjct  62    RYAVVTGANKGIGYEICRQLASNGILVVLTARDEKRGLEAVQKLKDCGISDDLVIYHQLD  121

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-------MRA  704
               D  ++ SL  F+  NFG+LDILVNNAG+ G+A    A + +      F          
Sbjct  122   AVDPDSIVSLAEFVKNNFGKLDILVNNAGISGVALEADAFQRAFEEAGEFPSGEQVWAEI  181

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
              + NYE++ +C++ NYYG++ M EA  PLLQ S SPRIVNV+S    L++I NEWAKG+L
Sbjct  182   GTQNYEMAEQCVKTNYYGARGMAEALAPLLQLSDSPRIVNVSSLLGLLKNIPNEWAKGLL  241

Query  523   NNVESP-PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             N+VE+    +LDEVVN+FL+D+K      KGWP ++SAY+V+KA M+AY RI A KYPS 
Sbjct  242   NDVENLNEDRLDEVVNEFLKDFKEDLLGSKGWPTYLSAYIVAKATMSAYTRILAKKYPSF  301

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             +VNC+ PG  KTDI  NTG  TA EGA++ VR+AL P+ GPSG FF  K+++
Sbjct  302   RVNCLCPGYCKTDITTNTGPFTAAEGAENAVRLALLPDGGPSGCFFYQKQML  353



>gb|KEH23344.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=287

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 211/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             +YAVVTG NKGIGFE  + LA  GV VVLTAR+E KG+EA++KL+  GLSD V+FH+LDV
Sbjct  8     KYAVVTGSNKGIGFETVKMLASNGVKVVLTARDEKKGNEAIQKLKQFGLSDQVMFHQLDV  67

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYELS  680
             TD+++++SLV F  T FGRLDILVNNAGV G+   E+     +G  +++ + ++   +++
Sbjct  68    TDSASITSLVQFFKTQFGRLDILVNNAGVSGVNPYET-----VGSTVDWEK-LTQTSDMA  121

Query  679   AECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PP  503
               C+  NYYG K  T+AFLPLL+ S S +IVNV+S  + L++I N+WAK V +++E+   
Sbjct  122   ENCLRTNYYGVKETTDAFLPLLKLSNSSKIVNVSSQAALLKNIPNQWAKRVFDDIENLTE  181

Query  502   GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPG  323
              K+DEV+ +F++D+K GS + KGWP  MSAY++SKAAMN+Y RI A KYP++ +NCV PG
Sbjct  182   EKIDEVLKEFIKDFKEGSLENKGWPTIMSAYIISKAAMNSYTRILAKKYPNMCINCVCPG  241

Query  322   NVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              VKTDIN NTG +   +GA S+VR+AL P+D PSG+FF  ++I  F
Sbjct  242   FVKTDINKNTGMLPVDQGAASVVRLALLPDDSPSGLFFIREEISNF  287



>ref|XP_010053680.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
Length=293

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 211/292 (72%), Gaps = 4/292 (1%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR--GVGLSDNVL  878
             +A++R AVVTG NKGIG E  +QLA  G+ V+LTAR+E +G EA++KL+      S+ V+
Sbjct  3     EAARRLAVVTGANKGIGLETVKQLASNGIRVILTARDEKRGLEALDKLKESDCLFSELVV  62

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAIS  698
             FH+LDVTD ++++SL +FI TNFG+LDILVNNAG++G+  +  AL A+  R  ++ +  S
Sbjct  63    FHQLDVTDLASITSLANFIRTNFGKLDILVNNAGIVGVRVDTDALYANGVRT-HWTKLRS  121

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               Y+L+ +CI  NYYG++R  EA +PLLQ S SP+IVNV+S   KLE+I NEWA  +L++
Sbjct  122   ETYDLAVDCITTNYYGARRTAEALMPLLQLSDSPKIVNVSSFMGKLENIQNEWANAILSD  181

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              ES    ++DEV+N+FL D+K GS + KGWP  +SA  +SKAAMNA+ RI A KYP   +
Sbjct  182   AESLTEEQIDEVLNQFLRDFKEGSLQTKGWPTFLSANTMSKAAMNAFTRILARKYPRFCI  241

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             N V PG V+TDINYN+G +T +EGA+S VR+AL P  GPSG+F+   K+  F
Sbjct  242   NSVCPGFVQTDINYNSGILTVEEGAKSAVRLALLPNGGPSGLFYIRSKLSMF  293



>ref|XP_011023379.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X3 [Populus 
euphratica]
Length=273

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 201/284 (71%), Gaps = 20/284 (7%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGFEICRQLA +G+ VVLT+RNE +G E+V+ L+  GLSD V+F
Sbjct  2     AEATKSYAVVTGANKGIGFEICRQLASKGIVVVLTSRNEKRGLESVQNLKESGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDV D ++++SL  FI + FG+LDIL                    G  +N+   I+ 
Sbjct  62    HQLDVADINSIASLADFIKSRFGKLDIL-------------------EGAKINWSEFITE  102

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              +EL  EC+ INYYG+KRM EA +PLLQ S SP IVNV+S   KL+ + NEWAKGVL++ 
Sbjct  103   TWELVEECLRINYYGAKRMAEALIPLLQLSDSPIIVNVSSSMGKLKGVSNEWAKGVLSDA  162

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV++K+LED+K GS + +GWP  MSAY++SKAAM+A  RI A KYP+  +N
Sbjct  163   ENLTEERVDEVLSKYLEDFKEGSLETEGWPAMMSAYILSKAAMSASTRILAKKYPTFCIN  222

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
             CV PG VKTDIN+NTG    +EGA+++VR+AL P   PSG FFD
Sbjct  223   CVCPGYVKTDINFNTGIRPVEEGAENVVRLALLPNGAPSGCFFD  266



>ref|XP_009347861.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=300

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 209/299 (70%), Gaps = 9/299 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSD-NV  881
             ++A KRYAVVTG NKGIG  +  QLA +G+TVVLTAR+E +G EAVEKL+   GL++  V
Sbjct  2     AEAKKRYAVVTGANKGIGLGVVEQLALDGITVVLTARDEKRGLEAVEKLKESAGLAEGQV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVL  719
             +FH+LDVT  +T++ L  FI T FG+LDILVNNAG+ G   +  A RAS+      G  +
Sbjct  62    VFHQLDVTKPATIAPLAEFIKTQFGKLDILVNNAGIGGAIVDADAFRASIVSGAAEGGTV  121

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             +  + ++  YEL+ EC++ NYYG+KR  EA +PLLQ S SP+++NV+S   KL  I N+W
Sbjct  122   DSNKVMTQTYELAEECLQTNYYGAKRTAEALIPLLQLSDSPKVINVSSSLGKLNCIRNDW  181

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
              KGV ++ E+    ++DEV+ +FL+D+K GS + KGWP  MSAY +SKAA+NAY R+ A 
Sbjct  182   VKGVFSDAENLTEERVDEVLTEFLKDFKEGSLESKGWPSFMSAYTLSKAALNAYTRLLAK  241

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYP+L VN V PG VKTDIN+N G +  +EGA  +V++AL P D PSG FF   K+  F
Sbjct  242   KYPNLCVNSVCPGFVKTDINFNAGILPVEEGAARVVKLALLPNDCPSGSFFAHFKVTDF  300



>ref|XP_008246060.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Prunus 
mume]
Length=307

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/303 (52%), Positives = 209/303 (69%), Gaps = 16/303 (5%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGFEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDIL---------VNNAGVIGLAANESALRA-----  737
             H+LDV + +TV+SL  FI T FG+LDIL         VNNAG+ G   +  A +A     
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILKVKQLDSAQVNNAGIFGSILDGDAFKAVVASG  121

Query  736   SMGR-VLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKL  560
             +M R  ++  + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+SG  KL
Sbjct  122   AMERGEVDLSKLVTEAYELAEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGSGKL  181

Query  559   ESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNA  383
              +I ++WAKGV  + ++    ++DEV+ + L+D+K GS + KGWP  M AY+VSKAA+NA
Sbjct  182   NNIPSDWAKGVFTDAKNLTEERVDEVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNA  241

Query  382   YARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDC  203
             Y RI A KYP+ ++N V PG VKTDIN+N G +  +EG   IV++AL P DGP+G FF  
Sbjct  242   YTRILAKKYPNFRINSVCPGFVKTDINFNAGVLPVEEGGARIVKLALLPNDGPTGSFFVH  301

Query  202   KKI  194
              K+
Sbjct  302   NKV  304



>ref|XP_007221124.1| hypothetical protein PRUPE_ppa018330mg [Prunus persica]
 gb|EMJ22323.1| hypothetical protein PRUPE_ppa018330mg [Prunus persica]
Length=298

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 206/290 (71%), Gaps = 9/290 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG E  RQLA +G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEVTKRYAVVTGANKGIGLETVRQLASKGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLN  716
             H+LDV + +TV+SL +FI   FG+LDILVNNAG+ G   +  AL+A++       G V +
Sbjct  62    HQLDVANPATVASLANFIKIQFGKLDILVNNAGIGGSIVDGDALKAAVASGAMERGEV-D  120

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
               + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KLE I ++ A
Sbjct  121   LSKLMTETYELTEECLQINYYGAKRTAEALIPLLQFSDSPRIVNVSSSMGKLEKIPSDRA  180

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             +GV  + E+    ++DEV+ + L+D+K GS + KGWP  M AY VSKAA+NAY RI A K
Sbjct  181   RGVFTDAENLTEERVDEVLTELLKDFKEGSLERKGWPSSMPAYTVSKAALNAYTRILAKK  240

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             Y + ++N V PG VKTDINYN G +  +EGA  ++++AL P DGP+G FF
Sbjct  241   YLNFRINSVCPGFVKTDINYNVGVLPVEEGAARVMKLALLPNDGPTGSFF  290



>ref|XP_008232780.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Prunus mume]
Length=297

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 210/297 (71%), Gaps = 8/297 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+GF   +QLA  GVTVVL AR+E +G EAVEKL+  GLSD V+F
Sbjct  2     AEATKRYAVVTGANKGVGFGTVKQLASNGVTVVLAARDEKRGLEAVEKLKEFGLSDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLA----ANESALRASMGRVLNFMR  707
             H+LDV D+ ++ S   F+ T FG+LDILVNNA + G      A +SA   S    +++  
Sbjct  62    HQLDVADSISIVSFADFVKTQFGKLDILVNNAAINGSTVTPEAFKSAASGSKAEEIDW-S  120

Query  706   AISH--NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
             AIS   N+EL+ EC++ NYYG+K +T A LPLLQ S SPRIVNV+SG SKL +  N WAK
Sbjct  121   AISTTPNFELAEECLKTNYYGTKSVTAALLPLLQLSNSPRIVNVSSGVSKLTNFPNAWAK  180

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL++ ES    ++D VV++FLED+K GS   K WPP    Y VSKAA+NAY RI A+KY
Sbjct  181   EVLSDAESLTEERIDAVVSRFLEDFKQGSLDSKSWPPIFPPYSVSKAAVNAYTRILANKY  240

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  +N V+PG VKTD+++NTG +T  EGA+S+VR+AL P  GP+G +F  K++  F
Sbjct  241   PSFCINAVSPGFVKTDLSFNTGILTINEGAESLVRLALLPNGGPTGHYFSRKEVTPF  297



>ref|NP_001077951.1| Short-chain dehydrogenase/reductase 2 [Arabidopsis thaliana]
 gb|AEC07538.1| Short-chain dehydrogenase/reductase 2 [Arabidopsis thaliana]
Length=301

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 215/290 (74%), Gaps = 5/290 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NVLFHRL  866
             RYA+VTGGN+GIGFEICRQLA +G+ V+LT+R+E +G EAVE L+  + +SD +++FH+L
Sbjct  12    RYAIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQL  71

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRAISHNY  689
             DV+D  +V+SL  F+ T+FG+LDIL+NNAGV G+  +  ALRA  G+    +   I+  Y
Sbjct  72    DVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETY  131

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             EL+ ECI+INYYG KRM EAF+PLLQ S SPRI+NV+S   +++++ NEWAKG+L++ E+
Sbjct  132   ELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGILSDAEN  191

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 ++D+V+N+ L D K  + K K W   MSAYVVSKA +NAY RI A K+P ++VN V
Sbjct  192   LTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHPEIRVNSV  251

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
              PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FFD K++  F
Sbjct  252   CPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFFDRKQVSEF  301



>ref|XP_003627601.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
Length=380

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/296 (53%), Positives = 211/296 (71%), Gaps = 7/296 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIGFEI RQLA +G+ VVLTAR+E +G  A+E L+  GLSD VLFH
Sbjct  85    EPTKRYAVVTGSNKGIGFEIVRQLASDGIKVVLTARDEKRGLHALETLKASGLSDFVLFH  144

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN--FM  710
             +LDV DAS+V+SL  F+ ++FG+LDILVNNAG+ G+   +  L  S     G + +    
Sbjct  145   QLDVADASSVASLADFVKSHFGKLDILVNNAGISGVEVKDRDLFTSAIMTSGALPDEELR  204

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             RA++  YE + ECI+INYYG+KR  E  LPLLQ S SPR+VNV+S   K+E + NEWAKG
Sbjct  205   RAVTQTYESAKECIQINYYGAKRAFEYLLPLLQLSDSPRVVNVSSFLGKIELVSNEWAKG  264

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V ++VE+    ++DEV+ +F++D++ GS + KGWP   +AY V+KA+MNAY  I A KYP
Sbjct  265   VFSDVENLTEERIDEVLEEFIKDFEEGSLESKGWPRFAAAYTVAKASMNAYTIILAKKYP  324

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NCV PG VKTD+  NTG +T +EGA + VR+AL P+  PSG+F+    I +F
Sbjct  325   NFCINCVCPGYVKTDMTTNTGILTVEEGATNPVRLALLPKGSPSGLFYSQNGIASF  380



>ref|XP_008337474.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Malus 
domestica]
Length=296

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 211/295 (72%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYA+VTG NKG+GF   +QLA  G+ VVLTAR+E +G EAVEKL+ +G+SD V+F
Sbjct  2     AEATKRYAIVTGANKGVGFGTVKQLASNGIMVVLTARDEKRGLEAVEKLKELGVSDQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLNFMR  707
             H+LDVTD++++ SL  F+ T FG+LDILVNNAG+ G   N  + R+++    G +     
Sbjct  62    HQLDVTDSASIVSLADFVKTQFGKLDILVNNAGITGXIVNPESFRSAVIGKPGEINWSEI  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I+ +YEL+ EC++ NYYG K +TEA LPLLQ S SPRIVNV+S  +KL +  N WAK V
Sbjct  122   LITPSYELAEECLKTNYYGPKSVTEALLPLLQLSDSPRIVNVSSXAAKLMNFPNGWAKEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ +S    ++D V+++FLED+K G    K WPP   AY VSKAA+NAY RI A KYP+
Sbjct  182   LSDAKSLTEVRIDAVLSEFLEDHKQGLLGTKSWPPLSPAYSVSKAALNAYTRILAXKYPN  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             + +NCV PG VKTD+ +N G +T  EGA+S+ R+AL P  GP+G++F  K++  +
Sbjct  242   IYINCVCPGFVKTDLTFNAGFLTIDEGAESVARLALLPSGGPTGLYFIRKEMTPY  296



>gb|ACN87275.1| short chain dehydrogenase/reductase [Nandina domestica]
Length=314

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 209/297 (70%), Gaps = 6/297 (2%)
 Frame = -1

Query  1060  NASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNV  881
             N +  +KRYAVVTG NKGIG EICRQLAC GV VVLTAR+  +G EAVEKL+  G+SD V
Sbjct  19    NKNPTTKRYAVVTGSNKGIGLEICRQLACHGVFVVLTARDPKRGIEAVEKLKESGVSD-V  77

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLN----F  713
             +FH+LDVTD  +++SL  FI   FG+LDILVNNAG+ G   +  A  A++G   +    +
Sbjct  78    VFHQLDVTDPISIASLASFIKAQFGKLDILVNNAGISGAIVDWDAFSATLGEPKDEKPHY  137

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                +   YEL+ EC++ NYYG+K++TEA +P L+ S SPRIVNV+S    L++I NE  K
Sbjct  138   KEMMEEPYELAEECLKTNYYGAKKVTEALVPFLKLSDSPRIVNVSSSMGLLKNIPNEEVK  197

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL++ +S    K+D +++ FL D+K    + KGWP  +SAY VSKAA+NAY RI A K+
Sbjct  198   KVLSDADSLTEEKMDTLLHAFLNDFKEDLLEPKGWPIFVSAYTVSKAALNAYTRILAKKF  257

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             P+ +VN V PG VKTDIN NTG +T +EGA+S VR+A  P DGPSGVFFD K+  +F
Sbjct  258   PTSRVNSVCPGFVKTDINCNTGTVTVEEGAESPVRLAFLPNDGPSGVFFDRKEESSF  314



>emb|CDP01393.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 212/289 (73%), Gaps = 10/289 (3%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG-LSDNVLFHRLD  863
             RYAVVTG NKGIG  IC+QLA  G+TVVLTAR+E++G +A+ +L+  G LS  +LFH+LD
Sbjct  21    RYAVVTGANKGIGLGICKQLASHGITVVLTARDESRGLDALHQLKETGGLSGYLLFHKLD  80

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM--GRVLNFMRAISHNY  689
             VTD+S+V SL  FI T FGRLDILVNNAG+ G   +  ALRA++  G + +F    +  Y
Sbjct  81    VTDSSSVDSLAEFIKTQFGRLDILVNNAGIAGAIEDVDALRAALVSGGLTDFKAFCTETY  140

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             +LS  C+E NYYG KRM EAFLPLLQ   SPRIVNV+S   KL+   N WAKG+L++ ++
Sbjct  141   DLSVACLETNYYGPKRMVEAFLPLLQ---SPRIVNVSSILGKLQFTPNAWAKGILSDADN  197

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 ++DEV+N++L+ +K G+   +GWP    AY +SKA++NAY RI A K+PS++VNCV
Sbjct  198   LTEERVDEVLNEYLKVFKAGTHDAQGWP---MAYTISKASLNAYTRILAKKWPSVKVNCV  254

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              PG+VKTD+ ++ G +T +EGA+S VR+AL P+DGPSG+FF  K+ I +
Sbjct  255   CPGHVKTDLGHDFGALTVEEGAESPVRLALLPDDGPSGLFFSRKEAIFY  303



>ref|XP_003600313.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
Length=293

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 212/292 (73%), Gaps = 2/292 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ASKRYA+VTG NKGIG+ IC++LA  GV VVLTARNE +G +AVE L+ +GLSD V+F
Sbjct  2     TEASKRYALVTGANKGIGYGICKKLASSGVMVVLTARNEKRGLDAVESLKELGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRVLNFMRAIS  698
             H+LDVTD  +VSSLV FI   FG+LDILVNNAGV G   N E+ ++   G + ++  A+ 
Sbjct  62    HQLDVTDPISVSSLVEFIKIQFGKLDILVNNAGVAGGIVNGENVVKQVRGEISDWNLALR  121

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YEL+ EC+EIN++G++R+TEA +PLLQ S SPRIVNV+S   K + + NEWA+GV ++
Sbjct  122   QTYELAEECVEINFFGAERVTEALIPLLQLSTSPRIVNVSSRRGKFKFMPNEWARGVFDD  181

Query  517   VESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
             + +    KL EV+ +FL+DYK G+ + K WP  +S Y ++KAA+N+Y R+ A K P  ++
Sbjct  182   INNVTNEKLGEVLREFLKDYKEGALETKNWPTFVSGYTMAKAALNSYTRLLALKLPRFRI  241

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NC+ P  VKTDIN   G ++  EGA+  V +AL P+DGPSG+FF   ++I++
Sbjct  242   NCLCPDFVKTDINEMKGFLSIDEGAECPVNLALLPDDGPSGLFFLHDEVISY  293



>ref|XP_008227552.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Prunus mume]
Length=298

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 205/289 (71%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G+TVVLT+R+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGLTVVLTSRDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM--GRV----LNF  713
             H+LDV D +TV+SL  FI T FG+LDILVNNAG+ G   +  A +A +  G V    ++ 
Sbjct  62    HQLDVADPATVASLADFIKTQFGKLDILVNNAGIFGSILDGDAFKAVIASGAVERGEVDL  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YE + EC++INYYG+KR  E  +PLLQ S SPRIVNV+S   KL +I ++WAK
Sbjct  122   SKLVNETYEFAEECLQINYYGAKRTAEGLIPLLQLSDSPRIVNVSSVAGKLNNIPSDWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + ++    ++DEV+ +FL+D+K GS + KGWP  M AY+VSKAA+NAY RI A KY
Sbjct  182   GVFTDAKNLIEERVDEVLTEFLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              + ++N V PG VKTDIN N G +  +EG   IV++AL P DGP+G FF
Sbjct  242   LNFRINSVCPGFVKTDINCNVGVLPVEEGGARIVKLALLPNDGPTGSFF  290



>ref|XP_009350263.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009350264.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=300

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 209/299 (70%), Gaps = 9/299 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSD-NV  881
             ++A KRYAVVTG NKGIG  +  QLA +G+TVVLTAR+E +G EAVEKL+   GL++  V
Sbjct  2     AEAKKRYAVVTGANKGIGLGVVEQLALDGITVVLTARDEKRGLEAVEKLKESAGLAEGQV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVL  719
             +FH+LDVT  +T++ L  FI T FG+LDILVNNAG+ G   +  A RAS+      G  +
Sbjct  62    VFHQLDVTKPATIAPLAEFIKTRFGKLDILVNNAGIGGAIVDADAFRASIVSGAAEGGTV  121

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             +  + ++ NYEL+ EC++ NYYG+KR  EA +PLLQ S SP+++NV+S   KL  I N+W
Sbjct  122   DSNKVMTQNYELAEECLQTNYYGAKRTAEALIPLLQLSDSPKVINVSSSLGKLNCIRNDW  181

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
              KGV ++ E+    ++DE++ +FL+D+K GS + KGWP  MSAY +SK A+NAY R+ A 
Sbjct  182   VKGVFSDAENLTEERVDELLTEFLKDFKEGSLESKGWPSFMSAYTLSKTALNAYTRLLAK  241

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYP+L VN V PG VKTDIN+N G +  +EGA  +V++AL P D PSG FF   K+  F
Sbjct  242   KYPNLCVNSVCPGFVKTDINFNAGILPVEEGAARVVKLALLPNDCPSGSFFAHFKVTDF  300



>gb|KHG24616.1| Uncharacterized protein F383_06242 [Gossypium arboreum]
Length=305

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 209/297 (70%), Gaps = 9/297 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+KR AVVTG NKGIGFE+CR LA +G+ VVLT+R+E +G EA  KL+  GLS +++FH+
Sbjct  9     AAKRVAVVTGANKGIGFELCRNLASKGIMVVLTSRDEKRGLEAFAKLKDSGLSHHLVFHQ  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF--------  713
             LDVT  S+++SLV ++ + FG+LD+LVNNAG  G   ++ A   +      F        
Sbjct  69    LDVTVPSSIASLVDYVKSKFGKLDLLVNNAGTFGAILHQQAFVKATELAGYFPSEEQASE  128

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                 +  +EL+ EC+E NYYG+KRM EAF+PLL  S SPRIVNV+S    L++I ++WAK
Sbjct  129   YEIATQTFELAQECLETNYYGAKRMVEAFVPLLHLSDSPRIVNVSSIMGLLKNIPSQWAK  188

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL++ ES    ++DEV+ +FL+D+K GS K++GWP + SAY +SKAAMNAY RI A+KY
Sbjct  189   EVLSDAESVTEEQVDEVLKQFLKDFKEGSLKDQGWPIYFSAYTLSKAAMNAYTRIVANKY  248

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  VN + PG VKTDI  NTG +TA EGA+++ R+AL   DGPSG FF  K++ +F
Sbjct  249   PSFLVNSIGPGFVKTDITCNTGVLTAAEGAENVARLALLSNDGPSGHFFLRKEVSSF  305



>ref|XP_010052706.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW76776.1| hypothetical protein EUGRSUZ_D01132 [Eucalyptus grandis]
Length=296

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 208/295 (71%), Gaps = 4/295 (1%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNV  881
             A    +RYAVVTG NKGIGF +C+ LA +G+ VVLTAR+E +G EA++KL+    LSD+V
Sbjct  2     ADSKPERYAVVTGANKGIGFAVCKLLASKGIVVVLTARDEKRGLEAIDKLKLEYNLSDHV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-MGR-VLNFMR  707
             +FH+LDV+D ++VSSL  F+   FG+LDILVNNAGV G   +  ALRAS +G+  ++  +
Sbjct  62    IFHQLDVSDPASVSSLADFVKHKFGKLDILVNNAGVTGAIVDADALRASSIGKKQVDLSK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++  YEL+ EC+ INYYG+KRM +AF+ LLQ S SP IVNV+S  +KLE++    A  V
Sbjct  122   IMTETYELTEECLNINYYGAKRMVDAFIGLLQTSDSPTIVNVSSSMAKLENLPEGLATEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              +N ES    K+DEV+ +FL D++ GS K KGWP H+SAY VSKAA+NAY RI A  YP+
Sbjct  182   FSNAESLTEEKVDEVLKEFLSDFEEGSVKTKGWPVHLSAYTVSKAALNAYTRILAANYPT  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++NCV PG VKTDIN NTG +T +EGA+  + +AL    GPSG FF   K   F
Sbjct  242   FRINCVCPGFVKTDINCNTGSLTPEEGAEGPMSLALLLSGGPSGRFFQGTKEATF  296



>ref|XP_008337412.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Malus 
domestica]
Length=297

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 211/296 (71%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYA+VTG NKG+GF   +QLA  G+ VVLTAR+E +G EAVEKL+ +G+SD V+F
Sbjct  2     AEATKRYAIVTGANKGVGFGTVKQLASNGIMVVLTARDEKRGLEAVEKLKELGVSDQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-----GRVLNFM  710
             H+LDVTD++++ SL  F+ T FG+LDILVNNAG+ G   N  + R+++     G +    
Sbjct  62    HQLDVTDSASIVSLADFVKTQFGKLDILVNNAGITGXIVNPESFRSAVIGKKPGEINWSE  121

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               I+ +YEL+ EC++ NYYG K +TEA LPLLQ S SPRIVNV+S  +KL +  N WAK 
Sbjct  122   ILITPSYELAEECLKTNYYGPKSVTEALLPLLQLSDSPRIVNVSSXAAKLMNFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ +S    ++D V+++FLED+K G    K WPP   AY VSKAA+NAY RI A KYP
Sbjct  182   VLSDAKSLTEVRIDAVLSEFLEDHKQGLLGTKSWPPLSPAYSVSKAALNAYTRILAXKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             ++ +NCV PG VKTD+ +N G +T  EGA+S+ R+AL P  GP+G++F  K++  +
Sbjct  242   NIYINCVCPGFVKTDLTFNAGFLTIDEGAESVARLALLPSGGPTGLYFIRKEMTPY  297



>gb|KDO86074.1| hypothetical protein CISIN_1g021246mg [Citrus sinensis]
Length=315

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 214/314 (68%), Gaps = 25/314 (8%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ ++AVVTG NKGIG+EI RQLA  GVT VLTAR+E +G EAVEKL+  G  DNV+F
Sbjct  2     AEAATKHAVVTGANKGIGYEIVRQLASNGVTTVLTARDEKRGLEAVEKLKESGF-DNVIF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------------  731
             H+LDV D + + SL +FI ++FG+LDILVNNAG+ G+  + + L   +            
Sbjct  61    HQLDVADPAAIHSLANFIRSHFGKLDILVNNAGISGVCMDGNDLSGVVKVNRSGTSGVIL  120

Query  730   -----------GRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVN  584
                        G  + +    +  +E + +C++ N+YG+KRM EA +P LQ S SPRIVN
Sbjct  121   EGDNFSGFVKDGTPVKWYELTTQTHESTEKCLQTNFYGTKRMCEALIPFLQLSDSPRIVN  180

Query  583   VTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYV  407
             V+S W KL+ + NEWAKGVL++VE+    ++DEV+ ++L D+K GS + KGWP  MSAYV
Sbjct  181   VSSSWGKLKYVTNEWAKGVLSDVENLTEERVDEVLREYLNDFKLGSLETKGWPVSMSAYV  240

Query  406   VSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDG  227
             VSK A+NAY RI   K+P+L +NC+ PG VKTD+NYN GK+T +EGA+S V +AL P  G
Sbjct  241   VSKVAINAYTRILVKKFPNLHINCICPGYVKTDMNYNNGKLTTEEGAESPVWLALLPNGG  300

Query  226   PSGVFFDCKKIIAF  185
             PSG+FF  K+  +F
Sbjct  301   PSGLFFSRKEETSF  314



>ref|XP_008369757.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=297

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 213/296 (72%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+GF   +QL   G+ VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     AEATKRYAVVTGANKGVGFGTVKQLVSNGIMVVLTARDEKRGLEALEKLKEFGVSDRVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR-ASMGRV---LNFMR  707
             H+LDVT+++ ++SL  F+ T FG+LDILVNNAG+ G   N  + R A +G+    +N+  
Sbjct  62    HQLDVTNSADIASLADFVKTQFGKLDILVNNAGINGSIVNPESFRSAVIGKKPDEINWSE  121

Query  706   -AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
              +++ NYEL+ EC++ NYYGSK +TEA LPLLQ S SPRI+NV+SG +KL +  N WAK 
Sbjct  122   ISMTPNYELAEECLKTNYYGSKSVTEALLPLLQLSDSPRIINVSSGAAKLMNFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ ES    ++D V+++FLEDYK G  + K WP    AY VSKAA+NAY R  A KYP
Sbjct  182   VLSDAESLTEERIDAVLSEFLEDYKQGLLETKSWPLIFPAYKVSKAALNAYTRTLAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
                VNC +PG+VKTD+ +N G +T  EGA+SIVR+AL P  GP+G++F  K++  F
Sbjct  242   KFCVNCGSPGSVKTDMTFNYGILTIDEGAESIVRLALLPNGGPTGLYFVRKEVTPF  297



>ref|XP_010671895.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Beta vulgaris subsp. 
vulgaris]
Length=304

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 212/293 (72%), Gaps = 7/293 (2%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGL--SDNVLFHR  869
             KRYAVVTG NKGIG +ICRQLA +GV VVLT+R+  +G EA++ L   GL  SDN+ FH+
Sbjct  11    KRYAVVTGANKGIGLDICRQLASQGVVVVLTSRDGKRGLEAIDNLIKSGLISSDNLHFHQ  70

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR----ASMGRVLNFMRAI  701
             LDVT+ ++++SLV FIN+ FG+LDILVNNA + G   +  AL+     + G  +N+   +
Sbjct  71    LDVTNTTSIASLVGFINSKFGKLDILVNNAAIRGQIVDFDALKVAGFGTPGIQINYAEMM  130

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  YEL+ EC++INYYG+K +TEA LPLLQ S SPRI+NV+S   KL +I NE  KGVL 
Sbjct  131   TQTYELAEECLKINYYGAKSITEALLPLLQLSDSPRIINVSSSIGKLRNIPNERIKGVLG  190

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             + E+    K+DE++N+FL D+K+G  +EKGWP  M+AY+VSKAA++AY RI A  YPS+ 
Sbjct  191   DAENLAEEKVDEILNEFLRDFKDGLLEEKGWPSPMAAYIVSKAALSAYTRILAKNYPSII  250

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +NCV PG V+TD+  N G ++ +EGA+S V++AL P   PSG+FF   ++ +F
Sbjct  251   INCVCPGFVRTDLTGNMGYLSIEEGAESPVKLALMPHGSPSGLFFLRNEVSSF  303



>ref|XP_009377413.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus 
x bretschneideri]
Length=297

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 214/296 (72%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+GF   +QLA  G+ VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     AEATKRYAVVTGANKGVGFGTVKQLASNGIMVVLTARDEKRGLEALEKLKEFGVSDRVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR-ASMGRVLNFMR---  707
             H+LDVT++++++SL  F+ T FG+LDILVNNAG+ G   N  + R A +G++ + +    
Sbjct  62    HQLDVTNSASIASLADFVKTQFGKLDILVNNAGINGSIVNPESFRSAVIGKMPDEINWNE  121

Query  706   -AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
              +++ NYEL+ EC++ NYYG K +TEA LPLL+ S SPRI+NV+SG +KL +  N WAK 
Sbjct  122   ISMTPNYELAEECLKTNYYGPKSVTEALLPLLKLSDSPRIINVSSGAAKLMNFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ ES    ++D V+++FLEDYK G  + K WP    AY VSKAA+NAY R  A KYP
Sbjct  182   VLSDAESLTEERIDAVLSEFLEDYKQGLLETKSWPLIFPAYKVSKAALNAYTRTLAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
                +NC +PG+VKTD+ +N G +T  EGA+SIVR+AL P  GP+G++F  K++  F
Sbjct  242   KFCINCGSPGSVKTDMTFNFGILTIDEGAESIVRLALLPNGGPTGLYFVRKEVTPF  297



>ref|XP_003627600.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02076.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 203/285 (71%), Gaps = 7/285 (2%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             +RYAVVTG NKGIG EI +QLA   + VVLT+R+E +G  A+E L+  GLSD V+FH+LD
Sbjct  6     ERYAVVTGANKGIGLEIVKQLASAVIKVVLTSRDEKRGLHALETLKASGLSDFVVFHQLD  65

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN--FMRAI  701
             V DAS+V+SL  F+ + FG+LDILVNNAG+ G+   +S L  S     G + +    RA+
Sbjct  66    VADASSVASLADFVKSQFGKLDILVNNAGIGGVEIKDSDLFTSAIITNGALPDEELRRAV  125

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  YE + ECI+INYYG+KR  E  LPLLQ S SPR+VNV+SG  K+ES+ NEWAKGV +
Sbjct  126   TQTYESAKECIQINYYGAKRTFEYLLPLLQLSDSPRVVNVSSGAGKIESVSNEWAKGVFS  185

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             +VE+    ++DEV+ +F++D++ GS + KGWP  ++ Y ++KA+MNAY RITA KYP+  
Sbjct  186   DVENLTDERIDEVIKEFIKDFEQGSLERKGWPRFIAPYTIAKASMNAYTRITAKKYPNFC  245

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             +NCV PG VKTDI  NTG  T +EGA   VR+AL P   PSG F+
Sbjct  246   INCVCPGYVKTDITANTGFFTVEEGAAHPVRLALLPSGSPSGHFY  290



>sp|B2X050.1|MNR1_CAPAN RecName: Full=(+)-neomenthol dehydrogenase; AltName: Full=Menthone:neomenthol 
reductase 1; Short=CaMNR1 [Capsicum annuum]
 gb|ABU54321.1| menthone:neomenthol reductase 1 [Capsicum annuum]
Length=314

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/309 (51%), Positives = 212/309 (69%), Gaps = 21/309 (7%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG--LSDNVLF  875
              S RYAVVTGGNKGIG+E CRQLA +GV VVLT+R+E KG EA+E+L+       +++LF
Sbjct  6     TSTRYAVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILF  65

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLA--ANESALRASMGRVLNFMRAI  701
             H+LD+ D +++SSLV+ I T FGRLDIL+NNAG+ G+    +   L+  + R ++ +   
Sbjct  66    HQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE  125

Query  700   SHN----------------YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGW  569
               N                YEL+ ECIE NYYG+KRMTEAF+PLLQ S SPRIVNV S  
Sbjct  126   DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSM  185

Query  568   SKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAA  392
              KL+ + N+WA  VL + +S    K+D+VVN+FL+D+   ST+ KGWP + +AY VSKA+
Sbjct  186   GKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKAS  245

Query  391   MNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVF  212
             + AY R+ A KYP+ ++N V PG  KTD+N NTG +TA EGA+S+V +AL P DGPSG+F
Sbjct  246   LIAYTRVLATKYPNFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDGPSGLF  305

Query  211   FDCKKIIAF  185
             F  K++  F
Sbjct  306   FYRKEVTFF  314



>gb|KHM99407.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=286

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 209/291 (72%), Gaps = 7/291 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             + A  RYAVVTG NKGIG E   QLA  GV VVLTAR+E++G EA+E+L+  GLSD V+F
Sbjct  2     TQAKLRYAVVTGANKGIGLETVNQLASNGVKVVLTARDEDRGHEAIERLKECGLSDFVIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVTD++++ SLV F+ T FGRLDILVNNAG+ G+   E+      G  +N+ + ++ 
Sbjct  62    HQLDVTDSASIVSLVEFVKTQFGRLDILVNNAGISGVNPYETE-----GSTINW-KELAQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
               E++ +C+  NYYG+K  TEAFLPLLQ S SPRIVNV+S    L+ I NE AKGV ++ 
Sbjct  116   TCEMAEKCLTTNYYGAKETTEAFLPLLQLSNSPRIVNVSSQAGLLKGIANELAKGVFDDA  175

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV+ +F++D+K GS K+KGWP  +SAY+VSKAAMN+Y RI A K+ +  +N
Sbjct  176   ENLTEDRIDEVLKEFIKDFKEGSLKKKGWPTFLSAYMVSKAAMNSYTRILAKKHQNFCIN  235

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CV PG VKTDIN NTG ++  +GA S+VR+AL P   PSG+F+  +++  F
Sbjct  236   CVCPGFVKTDINRNTGFLSVDQGAASVVRLALLPNASPSGLFYSRQELSNF  286



>ref|XP_002320110.2| hypothetical protein POPTR_0014s07580g [Populus trichocarpa]
 gb|EEE98425.2| hypothetical protein POPTR_0014s07580g [Populus trichocarpa]
Length=300

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 207/297 (70%), Gaps = 9/297 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VL  878
             S A+KRYAVVTG NKGIG EICRQL   G+ VVLTAR+E +G EAV+K++  G+SD+ V+
Sbjct  5     STATKRYAVVTGANKGIGLEICRQLTSHGIVVVLTARDEKRGLEAVQKMKDSGISDDLVV  64

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG-----RVLNF  713
             FH+LDV D  +++SLV F+ T FG+LDILVNNA + G+  N  A + +        V N 
Sbjct  65    FHQLDVVDPDSIASLVEFVKTKFGKLDILVNNAAISGVVLNADAFKRAFELSDGEEVWNE  124

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
             +   + ++EL+ +CI+ NYYG + M EA  PLLQ S S RI+NVTS    L++I N   K
Sbjct  125   IE--TQSFELAEQCIKTNYYGVRGMVEALTPLLQLSDSARIINVTSKLGLLKNIPNGRVK  182

Query  532   GVLNNVESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             G+LN+VES  G ++DE++ +FL+D+K G  K KGWP  +SAY V+KAAMNAY RI A +Y
Sbjct  183   GLLNDVESLTGDRIDEILKEFLKDFKEGLLKTKGWPTQLSAYTVAKAAMNAYTRILAKRY  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             P+   NCV+PG  KTD++ NTG  TA EGA+  VR+AL P+ GPSG  F  K+++ +
Sbjct  243   PNFHANCVSPGYCKTDLSTNTGYFTAAEGAEGAVRLALLPDGGPSGFCFLQKEMLTY  299



>ref|XP_007051886.1| Neomenthol dehydrogenase, putative [Theobroma cacao]
 gb|EOX96043.1| Neomenthol dehydrogenase, putative [Theobroma cacao]
Length=307

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/297 (52%), Positives = 206/297 (69%), Gaps = 9/297 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+KR+AVVTG NKGIGFE+CR LA +G+ VVLT+R+E +G EAV KL+  GLS +V+FH+
Sbjct  11    AAKRHAVVTGANKGIGFELCRNLASKGIMVVLTSRDEKRGLEAVAKLKDSGLSAHVVFHQ  70

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF--------  713
             LDVTD S+++SL  F+   FG+LDILVNNAG+ G   +  A   +      F        
Sbjct  71    LDVTDPSSIASLADFVKAKFGKLDILVNNAGIFGAILHPQAFATATELAGYFPTEEQAKE  130

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                 +  +EL+ EC++ NYYG++RM EAF+PLLQ S SPRIVNV+S    L++I ++WAK
Sbjct  131   YEIGTQTFELAEECLKTNYYGARRMVEAFVPLLQLSDSPRIVNVSSIMGLLKNIPSQWAK  190

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
               L++VES    ++DEV+ +FL+D+K GS K KGWP + SAY +SKAAMNA  RI A KY
Sbjct  191   EGLSDVESLTEDRVDEVLKQFLKDFKEGSLKAKGWPTYFSAYTLSKAAMNACTRILAKKY  250

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  VN + PG VKTDI  N G +TA EGA+++ R+AL   DGPSG+ F  K++  F
Sbjct  251   PSFLVNSIGPGFVKTDITCNIGVLTAAEGAENVARLALLSNDGPSGLLFIRKEVSCF  307



>ref|XP_006339531.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Solanum tuberosum]
Length=315

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 209/306 (68%), Gaps = 19/306 (6%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG--LSDNVLFH  872
             S RYAVV+GGNKG+G+E C+QLA +GV VVLT+R+E +G EA+E+L+      +D VLFH
Sbjct  10    STRYAVVSGGNKGLGYETCKQLASKGVIVVLTSRDEKRGIEAIERLKKESNFTNDQVLFH  69

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESAL----------------R  740
             +LD+ D +++SSLV FINT FGRLDIL+NNAGV GL      L                 
Sbjct  70    QLDIMDPTSISSLVDFINTKFGRLDILINNAGVGGLMVEGDVLVLKEIIEGDFLTISTEN  129

Query  739   ASMGRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKL  560
                G  +     I  NYEL+ +C+E NYYG+KRM EAF PLLQ S SPRIVNV S   KL
Sbjct  130   GKDGGTMKSYPEIVTNYELTKQCVETNYYGAKRMIEAFAPLLQLSNSPRIVNVASFLGKL  189

Query  559   ESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNA  383
             + + NEWAK VL++ +S    K+++V+N+FL+D+   S + KGWP + +AY VSKAA+ A
Sbjct  190   KLLRNEWAKKVLSDEKSLTEEKVEQVLNEFLKDFTENSIESKGWPTNFTAYRVSKAALVA  249

Query  382   YARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDC  203
             Y RI A KYP+ +VN V PG  KTD+N NTG +TA++GA+S V++AL P DGPSG+FF  
Sbjct  250   YTRILATKYPNFRVNSVCPGYCKTDVNANTGNLTAEKGAESFVKLALLPNDGPSGLFFYR  309

Query  202   KKIIAF  185
             +++  F
Sbjct  310   QEVTFF  315



>ref|XP_007220894.1| hypothetical protein PRUPE_ppa014652mg [Prunus persica]
 gb|EMJ22093.1| hypothetical protein PRUPE_ppa014652mg [Prunus persica]
Length=297

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 203/288 (70%), Gaps = 6/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEAPKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGV---IGLAANESALRAS--MGRVLNFM  710
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+   IG A    AL  S  MGR     
Sbjct  62    HQLDVANPATVASLAEFIKTQFGKLDILVNNAGIGGAIGDADGYIALVKSLEMGRGEVGS  121

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             +  +  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KL  I +  AKG
Sbjct  122   KLWTETYELTEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSFLGKLMHIPSHCAKG  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V  + E+    ++D+V+++ L+D+K GS + KGWP  +SAYVVSKAA+NAY RI A KYP
Sbjct  182   VFTDAENLTEERIDDVLSELLKDFKEGSLESKGWPSSLSAYVVSKAALNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             + ++N + PG+VKTDI YN G +  +EGA  ++++AL P DGPSG FF
Sbjct  242   TFRINSLCPGSVKTDITYNAGFLPVEEGAARVMKLALLPNDGPSGSFF  289



>ref|XP_010429384.1| PREDICTED: short-chain dehydrogenase/reductase 2b isoform X2 
[Camelina sativa]
Length=297

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 216/296 (73%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDN--  884
             ++ + +YA+VTGGN+GIG EICRQLA +G+ VVLT+R++ +G EAVE L+  VG+SD+  
Sbjct  2     AEETPKYAIVTGGNRGIGLEICRQLANKGIRVVLTSRDDTRGLEAVETLKKEVGVSDHQS  61

Query  883   VLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMR  707
             ++FH+LDV+D ++V+SL  F+ T FG+LDIL+NNAGV G+  +  ALRA  G+    +  
Sbjct  62    IVFHQLDVSDPASVTSLAEFVKTQFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEE  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I+  YEL+ ECI+INYYGSKRM EAF+PLL+ S SPRIVNV+S   +++++ NEWAKG+
Sbjct  122   TITETYELAEECIKINYYGSKRMCEAFIPLLRLSDSPRIVNVSSFMGQVKNVLNEWAKGI  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++VE+    ++DEV+N+ L D K  + K K     MSAYVVSKA +N Y RI A K+P 
Sbjct  182   LSDVENLTEERVDEVINQLLSDMKEDTVKIKDLAKVMSAYVVSKAGLNGYTRILAKKHPE  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
              +VN V PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FFD  ++  F
Sbjct  242   FRVNSVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQESPSGCFFDRHQVSEF  297



>ref|XP_009377415.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus 
x bretschneideri]
Length=296

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 214/295 (73%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+GF   +QLA  G+ VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     AEATKRYAVVTGANKGVGFGTVKQLASNGIMVVLTARDEKRGLEALEKLKEFGVSDRVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR-ASMGRV--LNFMR-  707
             H+LDVT++++++SL  F+ T FG+LDILVNNAG+ G   N  + R A +G+   +N+   
Sbjct  62    HQLDVTNSASIASLADFVKTQFGKLDILVNNAGINGSIVNPESFRSAVIGKPDEINWNEI  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
             +++ NYEL+ EC++ NYYG K +TEA LPLL+ S SPRI+NV+SG +KL +  N WAK V
Sbjct  122   SMTPNYELAEECLKTNYYGPKSVTEALLPLLKLSDSPRIINVSSGAAKLMNFPNGWAKEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ ES    ++D V+++FLEDYK G  + K WP    AY VSKAA+NAY R  A KYP 
Sbjct  182   LSDAESLTEERIDAVLSEFLEDYKQGLLETKSWPLIFPAYKVSKAALNAYTRTLAKKYPK  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
               +NC +PG+VKTD+ +N G +T  EGA+SIVR+AL P  GP+G++F  K++  F
Sbjct  242   FCINCGSPGSVKTDMTFNFGILTIDEGAESIVRLALLPNGGPTGLYFVRKEVTPF  296



>ref|XP_010429382.1| PREDICTED: short-chain dehydrogenase/reductase 2b isoform X1 
[Camelina sativa]
Length=302

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 213/291 (73%), Gaps = 6/291 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDN--VLFHR  869
             RYA+VTGGN+GIG EICRQLA +G+ VVLT+R++ +G EAVE L+  VG+SD+  ++FH+
Sbjct  12    RYAIVTGGNRGIGLEICRQLANKGIRVVLTSRDDTRGLEAVETLKKEVGVSDHQSIVFHQ  71

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRAISHN  692
             LDV+D ++V+SL  F+ T FG+LDIL+NNAGV G+  +  ALRA  G+    +   I+  
Sbjct  72    LDVSDPASVTSLAEFVKTQFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITET  131

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             YEL+ ECI+INYYGSKRM EAF+PLL+ S SPRIVNV+S   +++++ NEWAKG+L++VE
Sbjct  132   YELAEECIKINYYGSKRMCEAFIPLLRLSDSPRIVNVSSFMGQVKNVLNEWAKGILSDVE  191

Query  511   S-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
             +    ++DEV+N+ L D K  + K K     MSAYVVSKA +N Y RI A K+P  +VN 
Sbjct  192   NLTEERVDEVINQLLSDMKEDTVKIKDLAKVMSAYVVSKAGLNGYTRILAKKHPEFRVNS  251

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             V PG VKTD+N+ TG ++ +EGA S VR+AL P ++ PSG FFD  ++  F
Sbjct  252   VCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQESPSGCFFDRHQVSEF  302



>ref|XP_007220474.1| hypothetical protein PRUPE_ppa008632mg [Prunus persica]
 gb|EMJ21673.1| hypothetical protein PRUPE_ppa008632mg [Prunus persica]
Length=324

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 205/286 (72%), Gaps = 8/286 (3%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             S RYAVVTG NKGIG E  RQLA  G+TVVLTAR+E +G EA +KL+  GL+  V+FH+L
Sbjct  32    SFRYAVVTGANKGIGLETVRQLASNGITVVLTARDEKRGLEAFDKLKESGLTGQVVFHQL  91

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS------MGRVLNFMRA  704
             DV D ++V+SL  FI T  G+LDILVNNAG+ G+  +  A +AS       G  +++ + 
Sbjct  92    DVADPASVASLADFIKTQLGKLDILVNNAGIGGVGLDSDAFKASENSGSGEGANIDWTKF  151

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             ++  Y L+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KLE+I ++W KGV 
Sbjct  152   LTETYPLTEECLQINYYGTKRTAEALIPLLQLSDSPRIVNVSSSAGKLENIPSDWVKGVF  211

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E     ++DEV+ + L+D+K GS + KGWP +  AY VSKAA+NAY RI A KYP+ 
Sbjct  212   SDSEYLTEDRVDEVLTQLLKDFKEGSIESKGWPVY-PAYRVSKAAINAYTRILAKKYPNF  270

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             ++N V PG VKTDI +NTG ++ +EGA S++++AL P DGPSG+FF
Sbjct  271   RINSVCPGYVKTDITFNTGILSVEEGAASVLKLALLPSDGPSGLFF  316



>ref|XP_007218749.1| hypothetical protein PRUPE_ppa009309mg [Prunus persica]
 gb|EMJ19948.1| hypothetical protein PRUPE_ppa009309mg [Prunus persica]
Length=298

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 205/290 (71%), Gaps = 9/290 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA +G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASKGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLN  716
             H+LDV + +TV+SL +FI   FG+LDILVNNAG+ G   +  AL+A++       G V +
Sbjct  62    HQLDVANPATVASLANFIKIQFGKLDILVNNAGIGGSIVDGDALKAAVASGAMERGEV-D  120

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
               + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KLE I +  A
Sbjct  121   LSKLMTETYELTEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSSMGKLEKIPSHRA  180

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             + V  + E+    ++DEV+ + L+D+K GS + KGWP  MSA  VSKAA+NAY RI A K
Sbjct  181   RRVFTDAENLTEERVDEVLTELLKDFKEGSLERKGWPSSMSASTVSKAALNAYTRILAKK  240

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             Y + ++N V PG VKTDINYN G +  +EGA  ++++AL P DGP+G FF
Sbjct  241   YLNFRINSVCPGFVKTDINYNVGVLPVEEGAARVMKLALLPNDGPTGSFF  290



>ref|XP_007218746.1| hypothetical protein PRUPE_ppa009281mg [Prunus persica]
 gb|EMJ19945.1| hypothetical protein PRUPE_ppa009281mg [Prunus persica]
Length=298

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/289 (51%), Positives = 204/289 (71%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYA+VTG NKG+G E  RQLA  G  VVLTAR+  +G EAVEKL+  GLS  V+F
Sbjct  2     AEVTKRYAIVTGANKGVGLETVRQLASNGFIVVLTARDGKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGR-VLNF  713
             H+LDV + ++V+SL  FI T FG+LDILVNNAG+ G   +  A +A     +M R  ++ 
Sbjct  62    HQLDVANPASVASLADFIKTQFGKLDILVNNAGIFGSIIDVDASKAAVASGAMARGEVDL  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV++G   L +I ++WA+
Sbjct  122   SKLVTETYELTEECLQINYYGAKRTAEALIPLLQFSDSPRIVNVSAGLGMLNNIPSDWAR  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + E+    ++DEV+ + L+D+K GS + KGWP  M AY+VSKAA+NAY RI A KY
Sbjct  182   GVFTDAENLTEERVDEVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P+ ++N V PG VKTD+N+N G +  +EG   +V++AL P DGP+G FF
Sbjct  242   PNFRINSVCPGYVKTDMNFNAGLLPVEEGGARVVKLALLPNDGPTGSFF  290



>ref|XP_006587860.1| PREDICTED: (+)-neomenthol dehydrogenase [Glycine max]
Length=297

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 210/290 (72%), Gaps = 10/290 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  RYAVVTG NKGIGFE  ++LA  GV VVLTAR+E KG EA E+L+  G SD V+F
Sbjct  2     AEAKLRYAVVTGANKGIGFETVKELASNGVKVVLTARDEKKGHEAFERLKECGFSDLVIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESA-------LRASMGRVLN  716
             H+LDVT+++++SSLV F+ TNFG+LDILVNNAG+ G   +E         L  +  + L+
Sbjct  62    HQLDVTESASISSLVEFVKTNFGKLDILVNNAGISGANLDEVVRMCVIYDLCGASNKALS  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             F+  ++   E++ +C+  NYYG+K+ TEAFL LLQ S SPRIVNV+S    L++I NEWA
Sbjct  122   FL--MTQTNEMTEKCLTTNYYGAKKTTEAFLTLLQLSNSPRIVNVSSQAGLLKNISNEWA  179

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGVL++ ++    ++DEV+ +F++D+K GS   KGWP  +SAY+VSKAAMN+Y RI A K
Sbjct  180   KGVLDDADNLTEERIDEVLKEFIKDFKEGSLATKGWPTFLSAYIVSKAAMNSYTRILAKK  239

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             + ++ +N V PG VKTDIN NTG +T  +GA S+V++AL P+  PSG+F+
Sbjct  240   HQNMCINSVCPGFVKTDINKNTGILTVDQGAASVVKLALLPDGSPSGLFY  289



>gb|ACJ84918.1| unknown [Medicago truncatula]
 gb|AFK44877.1| unknown [Medicago truncatula]
Length=298

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 202/285 (71%), Gaps = 7/285 (2%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             +RYAVVTG NKGIG EI +QLA   + VVLT+R+E +G  A+E L+  GLSD V+FH+LD
Sbjct  6     ERYAVVTGANKGIGLEIVKQLASAVIKVVLTSRDEKRGLHALETLKASGLSDFVVFHQLD  65

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN--FMRAI  701
             V DAS+V+SL  F+ + FG+LDILVNNAG+ G+   +S L  S     G + +    R +
Sbjct  66    VADASSVASLADFVKSQFGKLDILVNNAGIGGVEIKDSDLFTSAIITNGALPDEELRRTV  125

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  YE + ECI+INYYG+KR  E  LPLLQ S SPR+VNV+SG  K+ES+ NEWAKGV +
Sbjct  126   TQTYESAKECIQINYYGAKRTFEYLLPLLQLSDSPRVVNVSSGAGKIESVSNEWAKGVFS  185

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             +VE+    ++DEV+ +F++D++ GS + KGWP  ++ Y ++KA+MNAY RITA KYP+  
Sbjct  186   DVENLTDERIDEVIKEFIKDFEQGSLERKGWPRFIAPYTIAKASMNAYTRITAKKYPNFC  245

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             +NCV PG VKTDI  NTG  T +EGA   VR+AL P   PSG F+
Sbjct  246   INCVCPGYVKTDITANTGFFTVEEGAAHPVRLALLPSGSPSGHFY  290



>ref|XP_010053677.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 ref|XP_010053678.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 ref|XP_010053679.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 gb|KCW78037.1| hypothetical protein EUGRSUZ_D02260 [Eucalyptus grandis]
 gb|KCW78038.1| hypothetical protein EUGRSUZ_D02260 [Eucalyptus grandis]
 gb|KCW78039.1| hypothetical protein EUGRSUZ_D02260 [Eucalyptus grandis]
Length=296

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/295 (53%), Positives = 207/295 (70%), Gaps = 4/295 (1%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNV  881
             A   S+R AVVTG NKGIGF +C+ LA +G+ VV TAR+E +G EA++KL+   GLSD+V
Sbjct  2     ADSKSERCAVVTGANKGIGFAVCKLLASKGIVVVFTARDEKRGLEAIDKLKLECGLSDHV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-MGR-VLNFMR  707
             +FH+LDV+D ++VSSL  F+   FG+LDILVNNAGV G   +  ALR S +G+  +++  
Sbjct  62    IFHQLDVSDPASVSSLADFVKRKFGKLDILVNNAGVSGSIFDADALRVSGIGKKQVDWSN  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
               +  YEL+ EC+ INYYG+KRM + F+ LLQ S  P IVNV+S   KLE +   WAK V
Sbjct  122   IATETYELTEECLNINYYGAKRMVDTFIGLLQPSDLPTIVNVSSSEGKLEHLPEGWAKEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              +N E+    K+DEV+ +FLED+K GS K +GWP  +SAY VSK A+NAY RI A  YP+
Sbjct  182   FSNAENLTEEKMDEVLKEFLEDFKKGSLKTRGWPTQLSAYAVSKVALNAYTRIIAANYPT  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              ++NCV PG VKTDIN N+G +T +EGA+  V +AL P+ GPSG FF   K +AF
Sbjct  242   FRINCVCPGFVKTDINCNSGFLTPEEGAEGPVSLALLPKGGPSGRFFQGTKEVAF  296



>ref|XP_006294712.1| hypothetical protein CARUB_v10023750mg [Capsella rubella]
 gb|EOA27610.1| hypothetical protein CARUB_v10023750mg [Capsella rubella]
Length=296

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 214/295 (73%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSD-NV  881
             ++ + R+A+VTGGN+GIGFEICRQLA +G+ VVLT+R++  G EAVE L+   G+SD ++
Sbjct  2     AEETPRFAIVTGGNRGIGFEICRQLANQGIRVVLTSRDDRLGLEAVETLKTEFGISDQSI  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
             +FH+LDV+D ++V+SLV F+ T FG+LDIL+NNAGV G+  +  ALRA  G+    +   
Sbjct  62    VFHQLDVSDPASVTSLVEFVKTQFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEET  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             I+  YEL+ ECI+INYYGSKRM  AF+PLL+ S SPRIVNV+S   +++++ NEWAKG+L
Sbjct  122   ITETYELAEECIKINYYGSKRMCGAFIPLLRLSDSPRIVNVSSFMGQVKNLLNEWAKGIL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    ++DEV+NK L D K+ + K K W   MSAYVVSKA +N Y RI A K+P  
Sbjct  182   SDAENLTEERIDEVINKLLSDLKDDTVKAKDWAYVMSAYVVSKAGLNGYTRILAKKHPEF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             +V  V PG VKTDIN+ TG ++ +EGA S V +AL P ++ PSG FFD  ++  F
Sbjct  242   RVTSVCPGFVKTDINFKTGVLSVEEGASSPVMLALLPHKESPSGCFFDRHQVSEF  296



>ref|XP_007051878.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96035.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=297

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 204/286 (71%), Gaps = 4/286 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG EIC+QLA +G+TV+LTAR+E +G EAVEKL+  GLSD V+F
Sbjct  2     AEVTKRYAVVTGANKGIGLEICKQLASKGITVLLTARDEKRGLEAVEKLKQYGLSDTVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA---SMGRVLNFMRA  704
             H+LDV D ++++SLV FI   FG+LDILVNNAG+ G+ A+  ALRA   +          
Sbjct  62    HQLDVADPASIASLVDFIKKQFGKLDILVNNAGINGVEADADALRAAGFAQEGSSTIWSK  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE + EC++INYYG+K   EA  PLLQ S  PRIVNV+S    ++ +  E  KG+L
Sbjct  122   VSQTYEAAEECLKINYYGAKNTAEALAPLLQLSDLPRIVNVSSSVVMVKRMTGERLKGIL  181

Query  523   NNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
                 +   KLD++V ++L+D+K GS   KGWP  +SAY VSK AMNA+ RI A KYP+  
Sbjct  182   TGFTTEE-KLDDLVAEYLKDFKEGSLDSKGWPTALSAYTVSKVAMNAHTRILAKKYPNFC  240

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
             +NCV PG+VKTDIN+NTGK+T +EGA S V +AL P  GPSG+FF+
Sbjct  241   INCVCPGHVKTDINFNTGKLTVEEGAASPVMLALLPSGGPSGLFFN  286



>ref|XP_007219208.1| hypothetical protein PRUPE_ppa017299mg [Prunus persica]
 ref|XP_007220528.1| hypothetical protein PRUPE_ppa009297mg [Prunus persica]
 gb|EMJ20407.1| hypothetical protein PRUPE_ppa017299mg [Prunus persica]
 gb|EMJ21727.1| hypothetical protein PRUPE_ppa009297mg [Prunus persica]
Length=298

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 205/289 (71%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A KRYAVVTG NKGIG E  RQLA +G TVVLTAR+E +G EAVEK +  GLS  V+F
Sbjct  2     AEARKRYAVVTGANKGIGLETVRQLASKGFTVVLTARDEKRGLEAVEKFKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGR-VLNF  713
             H+LDV + ++++ L  FI T FG+LDILVNNAG+ G  A+  A RA     + GR  +++
Sbjct  62    HQLDVANPASLAPLADFIKTQFGKLDILVNNAGIGGSTADPDAFRAVVESGAFGRGEVDW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              +  +  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KL +I + WAK
Sbjct  122   SKLSTETYELAEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSFMGKLNNIPSGWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              V  + E+    +LDEV+ + L+ +K GS + KG+P  +SAY+VSKAA+NAY RI A KY
Sbjct  182   VVFTDAENLTEERLDEVLTELLKAFKEGSLESKGFPSSLSAYIVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P+ ++N + PG VKTDINYN G +  +EGA  ++++AL P DGPSG FF
Sbjct  242   PTFRINSLCPGFVKTDINYNVGVLPVEEGAARVMKLALLPNDGPSGSFF  290



>ref|XP_003627603.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02079.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=300

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/293 (52%), Positives = 206/293 (70%), Gaps = 8/293 (3%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVVTG NKGIG EI +QLA   + VVLT+R+E +G  A+E L+  GLSD V+FH+LDV
Sbjct  8     RYAVVTGANKGIGLEIVKQLASARIKVVLTSRDEKRGLHALETLKASGLSDFVVFHQLDV  67

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN---FMRAI  701
              DA++V+SL  F+ + FG+LDILVNNAG+ G+  N++ L +S     G+ L+      A+
Sbjct  68    ADAASVASLADFVKSRFGKLDILVNNAGISGVEVNDTDLFSSAIITNGQALSDEELKTAV  127

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  +E + ECI+INY+G+KR  E  LPLLQ S SPR+VNV+S   K+E + NEWAKGV +
Sbjct  128   TQKFESAKECIQINYHGAKRTFEYLLPLLQLSDSPRVVNVSSFLGKIECVSNEWAKGVFS  187

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             +VE+    ++DEV+N+F++D++ GS + K WP   +AYVV KA+MNAY RI A KYP   
Sbjct  188   DVENLTEERIDEVINEFIKDFEEGSLERKCWPRFAAAYVVGKASMNAYTRIIAKKYPGFC  247

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +NCV PG VKTDI  NTG  T +EGA   VR+AL P   PSG+F+  K++ +F
Sbjct  248   INCVCPGYVKTDITANTGLFTVEEGAADPVRLALLPNGSPSGLFYSQKEVSSF  300



>gb|KHN29385.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=286

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 206/283 (73%), Gaps = 7/283 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  RYAVVTG NKGIGFE  ++LA  GV VVLTAR+E KG EA E+L+  G SD V+F
Sbjct  2     AEAKLRYAVVTGANKGIGFETVKELASNGVKVVLTARDEKKGHEAFERLKECGFSDLVIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVT+++++SSLV F+ TNFG+LDILVNNAG+ G  AN   +  S  +       ++ 
Sbjct  62    HQLDVTESASISSLVEFVKTNFGKLDILVNNAGISG--ANLDEVEGSTFK----WEELTQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
               E++ +C+  NYYG+K+ TEAFL LLQ S SPRIVNV+S    L++I NEWAKGVL++ 
Sbjct  116   TNEMTEKCLTTNYYGAKKTTEAFLTLLQLSNSPRIVNVSSQAGLLKNISNEWAKGVLDDA  175

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             ++    ++DEV+ +F++D+K GS   KGWP  +SAY+VSKAAMN+Y RI A K+ ++ +N
Sbjct  176   DNLTEERIDEVLKEFIKDFKEGSLATKGWPTFLSAYIVSKAAMNSYTRILAKKHQNMCIN  235

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              V PG VKTDIN NTG +T  +GA S+V++AL P+  PSG+F+
Sbjct  236   SVCPGFVKTDINKNTGILTVDQGAASVVKLALLPDGSPSGLFY  278



>gb|KCW78041.1| hypothetical protein EUGRSUZ_D02263 [Eucalyptus grandis]
Length=317

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/295 (54%), Positives = 207/295 (70%), Gaps = 4/295 (1%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNV  881
             A   SKR AVVTG NKGIGF IC+ LA EG+ VVLTAR+E +G EAV+KL+   GLSD+V
Sbjct  2     ADSKSKRCAVVTGSNKGIGFAICKLLASEGIVVVLTARDEKRGLEAVDKLKLESGLSDHV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-MGRV-LNFMR  707
              FH+LDV++ ++VSSL  FI   FG+LDILVNNAGV+G   +   LRA+ +G+    +  
Sbjct  62    FFHQLDVSNPASVSSLADFIKRQFGKLDILVNNAGVLGCIVDYDGLRAAGVGKKRFKWSE  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
               +  YEL+ ECI INYYG+KRM +A + LLQ S SPRIVNV+S   KL    + WAK V
Sbjct  122   ISTSTYELTEECININYYGAKRMVDALIGLLQLSDSPRIVNVSSTSGKLALFPDGWAKNV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
              ++ E     K+DEV+ +FL+D + GS   KGWP   SAY+VSKAA+NAY RI A KYP+
Sbjct  182   FSDAECLTEEKVDEVLKEFLKDLRQGSHGTKGWPASHSAYIVSKAALNAYTRILAAKYPT  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +VNCV PG VKTDI +NTG +T +EGA+  V ++L P+DGP+G FF   K ++F
Sbjct  242   FRVNCVCPGFVKTDILHNTGVLTPEEGAKGPVSLSLLPDDGPTGRFFQGTKELSF  296



>ref|XP_010661729.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Vitis 
vinifera]
Length=328

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 208/294 (71%), Gaps = 11/294 (4%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVVTG N+GIG EICRQLA  GV VVLTARNE  G EA+E L+G GLS NV FH+LDV
Sbjct  37    RYAVVTGANRGIGLEICRQLAANGVIVVLTARNEKMGVEALENLKGSGLS-NVGFHQLDV  95

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE--------SALRASMGRVLNFMRA  704
              D ++++SL   I T FG+LDILVNNAG+ G    +        +A +A +G++ N+   
Sbjct  96    GDPASIASLADSIKTQFGKLDILVNNAGIAGTIVTDPNGFRSAVAADQAGLGKI-NWKEI  154

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +   +E + EC+++NYYG KR+ EA  PLLQ S SPRIVNV+S   KL+++ NEWAKGVL
Sbjct  155   MIEPFEQAEECLKVNYYGPKRIIEALTPLLQLSDSPRIVNVSSSAGKLKNVINEWAKGVL  214

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             N+ ++    ++DEV+ +FL+D+K G  +   WP ++SAY+VSKAA+NA  RI A KYP+ 
Sbjct  215   NDAQNLTEERVDEVLKEFLKDFKEGLLEAHSWPSYLSAYIVSKAALNACTRILARKYPTF  274

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +NCV PG VKTD+NYN G +T +EGA+S V +AL P+ GPSG FF  K++  F
Sbjct  275   CINCVCPGFVKTDMNYNNGILTVEEGAESPVSLALLPDGGPSGQFFVRKELFEF  328



>ref|XP_008232776.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Prunus mume]
Length=298

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 202/289 (70%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+G E  RQLA  G TVVLTAR++ +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGMGLETVRQLASNGFTVVLTARDDKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGR------VLNF  713
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A +A +         ++ 
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIYGSILDGDAFKAVIASGALERGEVDL  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YE + EC++INYYG+KR  EA +PLLQ S SPRIVNV+S   KL +I ++WAK
Sbjct  122   SKLVTETYEFAEECVQINYYGAKRTAEALIPLLQLSDSPRIVNVSSSAGKLNNIPSDWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + E+    ++DEV+ +FL+D+K GS + KGWP    AY VSKAA+NAY RI A KY
Sbjct  182   GVFTDAENLTEERVDEVLIEFLKDFKEGSLESKGWPSSTPAYTVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              + ++N V PG VK++IN NTG +  +EG   IV++AL P DGP+G FF
Sbjct  242   LNFRINSVCPGFVKSEINVNTGVLPVEEGGARIVKLALLPNDGPTGSFF  290



>ref|XP_009803547.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Nicotiana sylvestris]
Length=299

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 205/291 (70%), Gaps = 3/291 (1%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A++R AVV+G N+GIG EICRQLA +G+ V+LTAR+E KG+EA++ L+  GLS+ V+FH+
Sbjct  9     ATQRIAVVSGANRGIGLEICRQLASKGIVVILTARDEKKGAEAIDMLKECGLSNYVIFHK  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF--MRAISH  695
             LDVTD S+++ L  FI   FG+LDILVNNA V+G+  ++     S  + L    ++  + 
Sbjct  69    LDVTDLSSIAQLKDFIKARFGKLDILVNNAAVVGVHMDKDVTIKSPEQDLFIEKLKVATQ  128

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              Y+++ EC++ NYYG+K+M +  LPLLQ S SPRIVNV+S   KLE I NEWA GVL++ 
Sbjct  129   TYDVAEECLKTNYYGAKQMIQELLPLLQFSDSPRIVNVSSLAGKLEHIRNEWAVGVLSDA  188

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV+N FL+D K G  + K W     AY +SKAAMNAY RI A KYPS  +N
Sbjct  189   ENITEDRVDEVLNAFLQDLKEGLMETKKWSLIFPAYTLSKAAMNAYTRILAKKYPSFLIN  248

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CV PG VKTD+  N GK++ +EGA+S V +AL PE GPSG +F+ K++  F
Sbjct  249   CVCPGYVKTDMTINCGKLSVEEGAESPVWLALLPEGGPSGKYFNRKEVTPF  299



>ref|XP_008343393.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=295

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 204/286 (71%), Gaps = 4/286 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIGF   RQLA  G  VVLTAR+E +G EAVEKL+  G+SD V+F
Sbjct  2     AEATKRYAVVTGANKGIGFATVRQLASNGTJVVLTARDEKRGLEAVEKLKQFGVSDRVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVL---NFMRA  704
             H+LD+TD+++++SL  F+ T FG+LDILVNNAGVIG   N  A RA  G+ L   ++   
Sbjct  62    HQLDITDSASIASLADFVKTQFGKLDILVNNAGVIGSILNGEAFRAIPGKKLEDIDWSEI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
              + NYEL  +C+E NY+G+KR+ EA LPLLQ S SPR+V V+S   +L    +  A GVL
Sbjct  122   ATPNYELGEKCLETNYHGTKRVXEALLPLLQLSDSPRLVIVSSYVGQLMFFSDGRANGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ ES    ++D V+++FLED+K G  + K WPP + AY VSKAA+NAY RI A ++P+ 
Sbjct  182   SBSESLTEERIDGVLSEFLEDFKQGLVEAKSWPPILPAYSVSKAALNAYTRILAKRWPNF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              +NCV PG VKTDI  N+G +T  EGA+S+VR+AL P  GP+G +F
Sbjct  242   CINCVCPGFVKTDITCNSGILTIDEGAESVVRLALLPNGGPTGQYF  287



>ref|XP_006583334.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Glycine 
max]
Length=286

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 203/276 (74%), Gaps = 8/276 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A+E ++  GLS  VLFH
Sbjct  3     EATERYAVVTGANKGIGLEIVRQLASAGIKVVLTARNEERGLKALETVKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGR------VLNFM  710
             ++DV DA++V+SL  FI + FG+LDIL+NNAG+ G+  +++ L  ++ +        +  
Sbjct  63    QVDVADATSVASLADFIKSKFGKLDILINNAGISGVVIDDTDLITTVIKNRGAKPEYDGT  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI-HNEWAK  533
             + ++H YEL+ EC++INYYG+K+ TE+ +PLLQ S SPRIVNV+S   +LES+    WA+
Sbjct  123   KGVTHTYELAEECLQINYYGAKKTTESLMPLLQLSDSPRIVNVSSSLGQLESLPKGSWAR  182

Query  532   GVLNNVESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV N+V++   ++ DE++NKFL D+K GS + KGWP ++SAY+VSKAAMNAY RI A KY
Sbjct  183   GVFNDVDNLTAEIVDEILNKFLRDFKEGSLESKGWPKYLSAYIVSKAAMNAYTRILAKKY  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRV  248
             PS  +N V PG VKTDI  NTG +T +EGA S VR+
Sbjct  243   PSFCINSVCPGYVKTDITANTGILTVEEGAASPVRL  278



>gb|EYU32087.1| hypothetical protein MIMGU_mgv1a010340mg [Erythranthe guttata]
Length=315

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 208/307 (68%), Gaps = 19/307 (6%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A++RYA+VTGGNKGIGFEICRQLA EGVTV+LTAR+E +G EA E+L+  GLSDN++FH+
Sbjct  9     ATQRYALVTGGNKGIGFEICRQLASEGVTVLLTARSEKRGIEAQERLKEYGLSDNIVFHQ  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG--LAANESALRASMGRVLNFMR----  707
             LDV + S+V+++V F+ T FGRLDILVNNAGV G  L  + S L+  + R  + +     
Sbjct  69    LDVLEPSSVAAVVEFVQTKFGRLDILVNNAGVFGIKLEGDVSILQEVIERDASVLYEAAG  128

Query  706   ------------AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSK  563
                          I+  +E    C+  NYYG KR+TEA + LLQ S SPRIVNV+S    
Sbjct  129   GTSEEVEFKSSGTITQTFEDGEHCVRTNYYGPKRITEALIHLLQLSDSPRIVNVSSTMGN  188

Query  562   LESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMN  386
             L+ + NEWAKGVL++ ES    K+DEVV +FL  +K G+ + K WP  +S+Y VSKAA+N
Sbjct  189   LKILSNEWAKGVLSDEESLTEDKVDEVVQEFLNSFKEGTLESKQWPTRLSSYKVSKAALN  248

Query  385   AYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              Y R  A KYPS  +N V PG  +TDI  N G ++A+E A+S VR+AL P+ GPSG+FF 
Sbjct  249   GYTRCVAKKYPSFFINSVCPGFARTDITCNLGPLSAEEAAESPVRLALLPDGGPSGLFFY  308

Query  205   CKKIIAF  185
              K++  +
Sbjct  309   RKEVFYY  315



>ref|XP_007051876.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96033.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=337

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 211/328 (64%), Gaps = 46/328 (14%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +++SK YAVVTG N+GIGFEIC+QLA +G TVVLTAR+  +G EAVEKL+  GLS+ V+F
Sbjct  2     AESSKGYAVVTGANRGIGFEICKQLATKGTTVVLTARDAKRGLEAVEKLKESGLSETVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDIL--------------------------------  791
             H+LDVT+ +++S L  F+ T FGRLDIL                                
Sbjct  62    HQLDVTEPASISCLADFLKTQFGRLDILIKTNVACYIMIISSYSYMIENPSSKPNGYLSR  121

Query  790   ---------VNNAGVIGLAANESALRASM----GRVLNFMRAISHNYELSAECIEINYYG  650
                      VNNAG+ G+ A++  +RAS+    G  +N+   +    EL+ EC++ NYYG
Sbjct  122   DEGCWNSVQVNNAGIGGVTADQDVVRASVLGKPGAQINWSEILIETNELAEECLKTNYYG  181

Query  649   SKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKF  473
              KRM E  LPLL  S SPRI+NV++   +L++I N WAK VL +VE+    K+DEV++ F
Sbjct  182   VKRMCETLLPLLHLSDSPRIINVSTSMGQLKNISNPWAKAVLGDVENLTEKKVDEVLSVF  241

Query  472   LEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNT  293
             L+D + GS +  GWP  ++AY +SKAAMNAYARI A KYPS  + CV PG+VKTDINYNT
Sbjct  242   LKDLEAGSLQANGWPTLLAAYSISKAAMNAYARILAKKYPSFHIICVCPGSVKTDINYNT  301

Query  292   GKITAKEGAQSIVRVALQPEDGPSGVFF  209
             G +T +EGA+S VR+AL P  GP G FF
Sbjct  302   GLLTVEEGAESAVRLALLPNAGPYGQFF  329



>gb|ABM54181.1| short-chain dehydrogenase/reductase [Capsicum annuum]
Length=314

 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 210/309 (68%), Gaps = 21/309 (7%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG--LSDNVLF  875
              S RYAVVTGGNKGIG+E CRQLA +GV VVLT+R++ KG EA+E+L+       +++LF
Sbjct  6     TSTRYAVVTGGNKGIGYETCRQLASKGVVVVLTSRDKKKGIEAIERLKEESNFTDEHILF  65

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLA--ANESALRASMGRVLNFMRAI  701
             H+LD+ D +++SSLV+ I T FGRLDIL+NNAG+ G+    +   L+  + R ++ +   
Sbjct  66    HQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE  125

Query  700   SHN----------------YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGW  569
               N                YEL+ ECIE NYYG+KRMTEAF+PLLQ S SPRIVNV S  
Sbjct  126   DENGEEGGWTKSVPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSM  185

Query  568   SKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAA  392
              KL+ + N+WA  VL + +S    K+D+VVN+FL D+   ST+ KGWP + +AY VSKA+
Sbjct  186   GKLKLLCNKWATEVLRDADSLTEEKVDQVVNEFLXDFTEKSTESKGWPSYFTAYKVSKAS  245

Query  391   MNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVF  212
             + AY R+ A KY + ++N V PG  KTD+N NTG +TA EGA+S+V +AL P DGPSG+F
Sbjct  246   LIAYTRVLATKYSNFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDGPSGLF  305

Query  211   FDCKKIIAF  185
             F  K++  F
Sbjct  306   FYRKEVTFF  314



>gb|KHN04648.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=296

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 207/288 (72%), Gaps = 7/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGF IC+QLA  G+TVVLTAR+E +G +AVEKL+ +GLS +V F
Sbjct  2     AEATKGYAVVTGANKGIGFAICKQLASNGITVVLTARDEKRGLQAVEKLQELGLSGHVGF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-----MGRVLNFM  710
             H+LDVTD + + SL  FI   FG+LDILVNNAG+ G   +  AL A+      GR+ ++ 
Sbjct  62    HQLDVTDPAGIRSLADFIRNKFGKLDILVNNAGIPGAQLDGEALAAAGIMENAGRI-DWS  120

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             + ++  YEL+   ++ NYYG+K +T+A +PLLQ S SP+IVNV+S   +LE I N W K 
Sbjct  121   KIVTDTYELAEAGVKTNYYGAKELTKALIPLLQFSDSPKIVNVSSSMGRLEHIPNGWPKE  180

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++VE+    K+D+++N+FL+D+K GS + KGWP  M AY VSKAA+NA+ RI A  YP
Sbjct  181   VLSDVENLTEEKIDDILNEFLKDFKEGSLETKGWPLAMPAYSVSKAALNAFTRILAKNYP  240

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             S  +N + PG VKTDIN NTG +T  EGA++ VR+AL P+  PSG FF
Sbjct  241   SFYINALCPGYVKTDINSNTGFLTPDEGAEAAVRLALLPDGSPSGQFF  288



>ref|XP_010098430.1| (+)-neomenthol dehydrogenase [Morus notabilis]
 gb|EXB75021.1| (+)-neomenthol dehydrogenase [Morus notabilis]
Length=558

 Score =   311 bits (796),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 204/296 (69%), Gaps = 21/296 (7%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             RYAVVTG NKGIGFE  R+LA  GVTV+LTAR+E +G EAVEKL+  GLSD VLFH+LDV
Sbjct  10    RYAVVTGANKGIGFETVRKLASNGVTVILTARDEKRGLEAVEKLKENGLSDKVLFHQLDV  69

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-----------  713
             TD ++++SL  F+ T FG+LDILVNNAG  G+A      RA +  VL F           
Sbjct  70    TDPTSIASLADFVKTRFGKLDILVNNAGT-GVA------RADIDAVLAFSRNSSGAQEQT  122

Query  712   --MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
                R ++  YE + EC++ NYYG+KR  EA  PLLQ S SPRIVNV+SG  KLE I N+W
Sbjct  123   DVSRTVTPTYESAEECLQTNYYGAKRTAEALFPLLQLSDSPRIVNVSSGAGKLERISNDW  182

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             AK VL++ ES    K+ E +  FL+D K  S + KGWP  ++AY VSKAAMNAY RI A 
Sbjct  183   AKEVLSDAESLTEDKIGEFLTDFLKDVKEASLESKGWPTLLTAYSVSKAAMNAYTRILAK  242

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             K+P+  +NCV PG VKTDIN+NTG +  +EGA S+VR+AL P DGPS +   C+++
Sbjct  243   KHPNFLINCVCPGFVKTDINFNTGILPVEEGAASLVRLALLPNDGPSDIPHFCRQL  298



>ref|XP_007218748.1| hypothetical protein PRUPE_ppa009292mg [Prunus persica]
 gb|EMJ19947.1| hypothetical protein PRUPE_ppa009292mg [Prunus persica]
Length=298

 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 204/289 (71%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEVTKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGR-VLNF  713
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  AL+A     +M R  +++
Sbjct  62    HQLDVANPATVASLAEFIKTQFGKLDILVNNAGISGRQVDGDALKAVVDSGAMERGEVDW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              +     YEL+ EC++INYYG+K+  EA +PLLQ S SPRIVNV+S   KL++I ++WAK
Sbjct  122   NKLKIETYELAEECLQINYYGAKKTAEALIPLLQLSDSPRIVNVSSSLGKLKNIPSDWAK  181

Query  532   GVLNNVESPPGK-LDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + ++   + + EV+ + L+ +K GS + KGWP  +SAY+VSKAA+NAY RI A KY
Sbjct  182   GVFTDADNLTEEGVVEVLTELLKAFKEGSLESKGWPSSLSAYIVSKAALNAYTRILAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P +++N V PG VKTD+N N G +  +EG   +V +AL P DGPSG FF
Sbjct  242   PDIRINSVCPGFVKTDLNSNAGVLPVEEGGARVVSIALLPNDGPSGSFF  290



>ref|XP_010326206.1| PREDICTED: (+)-neomenthol dehydrogenase [Solanum lycopersicum]
Length=622

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 208/288 (72%), Gaps = 5/288 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG--LSDNVLFHRL  866
             RYAVV+GGNKG+G+E C+QLA +GV VVLT+R+E +G EA+E+L+      +D VLFH+L
Sbjct  337   RYAVVSGGNKGLGYETCKQLASKGVVVVLTSRDEKRGIEAIERLKKESNFTNDQVLFHQL  396

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYE  686
             D+ D +++SSLV FINT FGRLDIL+NNAG+ GL      L    G  +     I+ NYE
Sbjct  397   DIMDPASISSLVDFINTKFGRLDILINNAGIGGLMVEGDVLED--GGTMKSYPEITTNYE  454

Query  685   LSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-  509
             L+ +C+E NYYG+KR  EAF PLLQ S SPRIVNV S   KL+ + NEWAK VL++ +S 
Sbjct  455   LTKQCVETNYYGAKRTIEAFAPLLQLSNSPRIVNVASFLGKLKLLRNEWAKKVLSDAKSL  514

Query  508   PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVN  329
                K+++V+N+FL+D+   + + KGWP + +AY VSKAA+ AY RI A KYP+ +VN V 
Sbjct  515   TEDKVEQVLNEFLKDFTENAIESKGWPTNFTAYRVSKAALIAYTRILATKYPNFRVNSVC  574

Query  328   PGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PG  KTD+N NTG +TA+EGA+S V++AL P DGPSG+FF  +++  F
Sbjct  575   PGYCKTDVNANTGNLTAEEGAESFVKLALLPNDGPSGLFFYRQEVTLF  622


 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 211/316 (67%), Gaps = 40/316 (13%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG----VGLSDNVL  878
             SKRYAVVTGGNKGIG+E C+QLA +G+ VVLT+R+E +G EA+E+L+        +D++L
Sbjct  10    SKRYAVVTGGNKGIGYETCKQLASKGLVVVLTSRDEKRGIEAIERLKKELNITNNNDHIL  69

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAA--------------------  758
             FH+LDV D +++SSLV FI T FGRLDILVNNAGV GL                      
Sbjct  70    FHQLDVMDPASISSLVDFIKTKFGRLDILVNNAGVGGLMVEGNLVILKNLIEGDFETIST  129

Query  757   -----NESALRASMGRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPR  593
                  +ES +  S+         I  NYEL+ +CIE N+YG+KRM+EAF+PLLQ S SP 
Sbjct  130   ENEVEDESVVEKSI-------EGIVTNYELTKQCIETNFYGAKRMSEAFIPLLQLSNSPT  182

Query  592   IVNVTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMS  416
             IVNV S   KL+ + NEWAK VL++ +S    ++++V+N+FL+D+   S + KGWP + +
Sbjct  183   IVNVASFLGKLKLLCNEWAKKVLSDAKSLTEERIEQVLNEFLKDFIENSVESKGWPTYFA  242

Query  415   AYVVSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP  236
             AY VSKA++ AY R+   KYP+ +VN V PG   TD+   TG +TA+EGA+S+V++AL P
Sbjct  243   AYKVSKASLIAYTRVLGSKYPNFRVNSVCPGYCGTDMTAYTGSLTAEEGAESLVKLALLP  302

Query  235   EDGPSGVFF---DCKK  197
              DGPSG+FF   DC+K
Sbjct  303   NDGPSGLFFYRKDCRK  318



>ref|XP_009796277.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Nicotiana sylvestris]
Length=299

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 205/292 (70%), Gaps = 5/292 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A++R AVV+G  +GIG EICRQLA +G+ V+LTAR+E KG+EA++ L+  GLS+ V+FH+
Sbjct  9     ATQRIAVVSGAYRGIGLEICRQLASKGIVVILTARDEKKGAEAIDMLKECGLSNYVIFHK  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAI---S  698
             LDVTD S+V+ L  FI   F +LDILVNNA V+GL  +E     S  + L F+  I   +
Sbjct  69    LDVTDPSSVAQLKDFIKARFSKLDILVNNAAVLGLLMDEDVTITSPEQDL-FVEKINVAT  127

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               Y+++ EC++ NYYG+K+M +  LPLLQ S SPRIVNV+S   KLE + NEWA GVL++
Sbjct  128   QTYDVAEECLKTNYYGAKQMIQELLPLLQFSDSPRIVNVSSIAGKLEYVRNEWAVGVLSD  187

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              E+    ++DEV+N FL+D K G  + K WP  + AY +SKAA+NAY RI A KYPS  +
Sbjct  188   AENLTEERVDEVLNTFLQDLKEGLLESKNWPLILPAYTLSKAAVNAYTRILAKKYPSFLI  247

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NCV PG VKTD+  N GK++ +EGA+S V +AL PE GPSG +F  K++  F
Sbjct  248   NCVCPGYVKTDMTINCGKLSVEEGAESPVWLALLPEGGPSGKYFSRKEVSPF  299



>ref|XP_008338485.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=495

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 199/279 (71%), Gaps = 10/279 (4%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             ++YAVVTG NKG+G  I +QLA +G+TVVLTAR+E +G EAVEKL+  GL+  V+FH+LD
Sbjct  113   RQYAVVTGANKGLGLGIVKQLASDGITVVLTARDEKRGLEAVEKLKQSGLAGQVVFHQLD  172

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYEL  683
             V + +T+  L  FI T FG+LDILVNNAG++G A  ++           F  A +    L
Sbjct  173   VANPATILPLAEFIKTQFGKLDILVNNAGIMGAAIVDTD---------AFKAAXASGIXL  223

Query  682   SAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-P  506
             + EC++INYYG+KR TEA +PLLQ S SPRIVN++S W KL +I ++WAKGV ++ E+  
Sbjct  224   AEECVQINYYGAKRTTEALIPLLQLSDSPRIVNISSSWGKLNNIPSDWAKGVFSDAENGT  283

Query  505   PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNP  326
               ++DEV+ +FL+D+K GS + KGWP  M+ Y++SKAAMNA  R+ A KYP  ++NC+ P
Sbjct  284   EERIDEVLTQFLKDFKEGSIESKGWPSFMAGYILSKAAMNAXTRVLAKKYPDFRINCLCP  343

Query  325   GNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             G VKTDIN+N G +  +E A  ++++A  P+DGPSG FF
Sbjct  344   GIVKTDINFNAGNVPVEESAARVLKLAFLPDDGPSGFFF  382



>ref|XP_007139906.1| hypothetical protein PHAVU_008G068600g [Phaseolus vulgaris]
 gb|ESW11900.1| hypothetical protein PHAVU_008G068600g [Phaseolus vulgaris]
Length=286

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 203/283 (72%), Gaps = 7/283 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++   RYAVVTG NKGIG E   QLA  GV VVL AR+E +G EA+E L+  GLS+ V+F
Sbjct  2     TEPKPRYAVVTGANKGIGLETVNQLASNGVKVVLAARDEKRGHEAIETLKECGLSELVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVT ++++ SLV F+NT FGRLDILVNNAG+ G+   E       G ++N+ R ++ 
Sbjct  62    HQLDVTLSASIHSLVEFVNTQFGRLDILVNNAGISGVNPYEME-----GSIINW-RELTQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YE++ +C+  NYYG+K  TEAFLPLL+ S SPRIVNV+S    L+ I N+ AKGV ++ 
Sbjct  116   TYEMAEKCLRTNYYGAKETTEAFLPLLKLSNSPRIVNVSSQAGLLKGIANKLAKGVFDDA  175

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV+ +F++D+K GS   KGWP  +S+Y+VSKAAMN+Y RI A KYP+  +N
Sbjct  176   ENLTEDRIDEVLKEFMKDFKEGSFGNKGWPTFLSSYMVSKAAMNSYTRILAKKYPNFCIN  235

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             CV PG VKTDIN NTG ++ ++GA S+VR+AL P   PSG+F+
Sbjct  236   CVCPGFVKTDINRNTGFLSVEQGAASVVRLALLPNGSPSGLFY  278



>ref|XP_008355449.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=300

 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 206/299 (69%), Gaps = 9/299 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSD-NV  881
             ++A+KRYAVVTG NKGIG  +  QLA +G+TVVLT R+E +G EAVEKL+   GL++  V
Sbjct  2     AEATKRYAVVTGANKGIGLGVVEQLALDGITVVLTXRDEKRGLEAVEKLKESAGLAEGQV  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVL  719
             +FH+LDVT  +T++ L  FI T FG+LDILVNNAG+ G   +  A RAS+      G  +
Sbjct  62    VFHQLDVTKPATIAPLAEFIKTQFGKLDILVNNAGIGGAIVDADAFRASIVSGAAEGGTV  121

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
             +    ++ NYE + EC++ NY G+KR  EA +PLLQ S SP+I+NV+S   KL  I N+W
Sbjct  122   DSNXVMTQNYEQAEECLQTNYXGAKRTAEALIPLLQLSDSPKIINVSSSLGKLNCIRNDW  181

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
              KGV ++ E+    ++DEV+ +FL+D+K GS + KGWP  MSAY +SK A+NAY R+ A 
Sbjct  182   VKGVFSDAENLTEERVDEVLTEFLKDFKXGSLESKGWPSFMSAYTLSKTALNAYTRLLAK  241

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             KYP+L VN V PG VKTDIN+ +G +  +EGA  +V++AL P D PSG FF   K+  F
Sbjct  242   KYPNLCVNSVCPGFVKTDINFKSGILPVEEGAARVVKLALLPNDCPSGSFFAHFKVTDF  300



>ref|NP_001242019.1| uncharacterized protein LOC100803877 [Glycine max]
 gb|ACU20340.1| unknown [Glycine max]
Length=296

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/288 (53%), Positives = 207/288 (72%), Gaps = 7/288 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGF IC+QLA  G+TVVLTAR+E +G +AVEKL+ +GLS +V F
Sbjct  2     AEATKGYAVVTGANKGIGFAICKQLASNGITVVLTARDEKRGLQAVEKLQELGLSGHVGF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-----MGRVLNFM  710
             H+LDVTD + + SL  FI   FG+LDILVNNAG+ G   +  AL A+      GR+ ++ 
Sbjct  62    HQLDVTDPAGIRSLADFIRNKFGKLDILVNNAGIPGAQWDGEALAAAGIMENAGRI-DWS  120

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             + ++  Y+L+   ++ NYYG+K +T+A +PLLQ S SP+IVNV+S   +LE I N W K 
Sbjct  121   KIVTDTYKLAEAGVKTNYYGAKELTKALIPLLQFSDSPKIVNVSSSMGRLEHIPNGWPKE  180

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++VE+    K+D+++N+FL+D+K GS + KGWP  M AY VSKAA+NA+ RI A  YP
Sbjct  181   VLSDVENLTEEKIDDILNEFLKDFKEGSLETKGWPLAMPAYSVSKAALNAFTRILAKNYP  240

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             S  +N + PG VKTDIN NTG +T  EGA++ VR+AL P+  PSG FF
Sbjct  241   SFYINALCPGYVKTDINSNTGFLTPDEGAEAAVRLALLPDGSPSGQFF  288



>emb|CBI40299.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/292 (53%), Positives = 206/292 (71%), Gaps = 8/292 (3%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             R AVVTG NKG+G EICRQLA  GV VVLTAR+E +G EA++ L G GLS N++FH+LDV
Sbjct  12    RSAVVTGANKGMGLEICRQLAASGVRVVLTARDEKRGVEALQSLNGSGLS-NLVFHQLDV  70

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGL-----AANESALRASMGR-VLNFMRAIS  698
              D ++++S   FI T FG+LDILVNNAG+ G       A ES + A+  R  +N+   ++
Sbjct  71    GDPASIASFADFIKTQFGKLDILVNNAGMSGSIVKDPVALESGVAATEIREQVNWHGIMT  130

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
                EL+ EC++INYYG KRM EAF+PLLQ S SPRIVNV+S   KL+++ NEWAK VL++
Sbjct  131   QPLELAEECVKINYYGPKRMAEAFIPLLQLSDSPRIVNVSSSLGKLQNVTNEWAKAVLSD  190

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              E+    ++DEV+N+FL+D++ G  + K W    +AY VSKAA+NAY RI A KYP+  +
Sbjct  191   AENLTEERVDEVLNQFLKDFEEGLLEAKNWSAFYAAYTVSKAALNAYTRILATKYPAFCI  250

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NCV PG VKTD N N G +T +EGA+  V++AL P+ GPSG FF  K++  F
Sbjct  251   NCVCPGYVKTDFNDNIGILTVEEGAECPVKLALLPDGGPSGHFFSRKEVTEF  302



>ref|XP_011094727.1| PREDICTED: uncharacterized protein LOC105174344 [Sesamum indicum]
Length=646

 Score =   311 bits (798),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 162/306 (53%), Positives = 208/306 (68%), Gaps = 18/306 (6%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVLFH  872
             A++RYAVVTG NKGIGFEICRQLA EG+ V+ TAR+E +G EA E+L+   GLSDNV+FH
Sbjct  10    ATQRYAVVTGANKGIGFEICRQLASEGIMVISTARSEKRGIEAQERLKEEFGLSDNVVFH  69

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGV--IGLAANESALRASMGRVLNFMR---  707
             +LDV D +T++SLV FI   +GRLDILVNNAG+  IGL  +   L+ +  R  N +    
Sbjct  70    QLDVLDPATIASLVEFIKAKYGRLDILVNNAGISGIGLDGDILILQETFERDANSLLLGG  129

Query  706   -----------AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKL  560
                         I    E + +C+E NYYG+KR+TEA +PLL+ S +PRIVNV+S    L
Sbjct  130   KPEPIQPKASGTIFETLEDAEQCVETNYYGTKRVTEALIPLLKLSDAPRIVNVSSTLGNL  189

Query  559   ESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNA  383
               + NEWAKGVL+N ES    K+DEVV KFL+++K GS +   WPPH +AY VSKAA+NA
Sbjct  190   RLLSNEWAKGVLSNQESLTEEKVDEVVQKFLKNFKEGSVQANEWPPHFAAYKVSKAALNA  249

Query  382   YARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDC  203
             Y RI A KYPS  +N V PG  +TDI YN G ++A E A+S V++AL P  GPSG FF  
Sbjct  250   YTRIIARKYPSFCINSVCPGFARTDITYNLGPLSASEAAESPVKLALLPNGGPSGFFFSR  309

Query  202   KKIIAF  185
              +I +F
Sbjct  310   NQISSF  315


 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 211/305 (69%), Gaps = 17/305 (6%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A++RYAVVTG NKGIGFEICRQLA +G+ V+ TARNE +G EA E+L+ +GLSD+V+FH+
Sbjct  342   AAQRYAVVTGANKGIGFEICRQLASKGIIVISTARNEKRGIEAQERLKELGLSDHVVFHQ  401

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGV--IGLAANESALRASM-GRV--------  722
             LDV D +++++LV FI T +GRLDILVNNAG+  IGL  +   L+  + G V        
Sbjct  402   LDVLDPASIAALVEFIKTKYGRLDILVNNAGISGIGLDGDIMILQEIIDGDVSSVFAGGK  461

Query  721   -----LNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLE  557
                  L     +    + + ECI+ NYYG+KR+TEA +PLLQ S SPRIVNV+S    L 
Sbjct  462   PEPVQLKASGTLRETLQGAEECIQTNYYGAKRVTEALIPLLQLSDSPRIVNVSSALGNLR  521

Query  556   SIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAY  380
              + NEWAKGVL+N ES    K+DEVV +FL+++K G+ +   WP  ++AY VSKAA+NAY
Sbjct  522   LLCNEWAKGVLSNQESLTEEKVDEVVQEFLKNFKEGALRANDWPSQIAAYKVSKAALNAY  581

Query  379   ARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCK  200
              RI A KYPS  +NCV PG  +TDI  N G ++A E A+S V++AL P+ GPSG +F+  
Sbjct  582   TRIMARKYPSFCINCVCPGFARTDITCNLGPLSASEAAESPVKLALLPDGGPSGFYFNRS  641

Query  199   KIIAF  185
             +I +F
Sbjct  642   EISSF  646



>ref|XP_006583329.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=298

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 203/296 (69%), Gaps = 7/296 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + ++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A++ L+  GLS  VLFH
Sbjct  3     ETTERYAVVTGANKGIGLEIVRQLASAGIKVVLTARNEERGIQALQTLKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-----GRVLNFMR  707
             ++DV DA++V+SL  FI + FG+LDILVNNAG++G    ++    S+         +  +
Sbjct  63    QVDVADATSVASLADFIKSKFGKLDILVNNAGILGAVIKDTDSFTSLLLKRGAAPEDGTK  122

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI-HNEWAKG  530
             AI+ +YEL+ EC++INYYG+K   E+ LPLLQ S SPRIVNV+S   +LES+    WA+ 
Sbjct  123   AITQSYELAKECLQINYYGAKTTVESLLPLLQLSDSPRIVNVSSTMGQLESLPKGSWARE  182

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V ++       K+DE++ KFL D++ GS +  GWP H+ AY+VSKAAMNAY RI A KYP
Sbjct  183   VFSDANIITEEKVDEILKKFLRDFQEGSLESNGWPRHLGAYIVSKAAMNAYTRILAKKYP  242

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             S  +N V PG VKTDI  NTG +T +EGA S VR+AL P   PSG+F+    + +F
Sbjct  243   SFCINSVCPGYVKTDITSNTGLLTVEEGAASPVRLALLPNGSPSGLFYYRSDVASF  298



>dbj|BAO45879.1| neomenthol dehydrogenase-like protein [Acacia mangium]
Length=305

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 207/304 (68%), Gaps = 14/304 (5%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVL  878
             ++A+KRYAVVTGGNKG+GF+IC+QLA  G+TVVLTAR+E +G EA+EKL+   G+S  VL
Sbjct  2     AEATKRYAVVTGGNKGMGFQICKQLASNGITVVLTARDEKRGLEAIEKLKSESGISGEVL  61

Query  877   FHRLDVTDAST-VSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----------  731
             FH+LDVTD +  + SL +FI TNFG+LD LVNNAG+ GL  ++ AL A+           
Sbjct  62    FHQLDVTDPTANILSLANFIKTNFGKLDYLVNNAGINGLIVDQDALMAATSQGDFAARIE  121

Query  730   -GRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLES  554
              G  ++  + +  NYEL+ EC ++NYYG K + E  + LLQ S SPRIVNV++ +  LE 
Sbjct  122   RGENVDLSKILKENYELAEECFKVNYYGPKSLCEGLIHLLQLSDSPRIVNVSTSYGSLEK  181

Query  553   IHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYA  377
               + W K VL+  ++    K++EV+ +FL D+K G  + KGWP   SAY VSKA +NAY 
Sbjct  182   FPSGWGKEVLSGADNLTEEKVEEVLKQFLTDFKEGLLEIKGWPTVTSAYTVSKACLNAYT  241

Query  376   RITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKK  197
             RI A KYPS  +N V PG VKTD+ +N G  T +EGA+SIV+VAL P+   SG+FF   +
Sbjct  242   RILAKKYPSFYINSVCPGYVKTDMTFNAGIYTVEEGAESIVKVALLPDGNQSGLFFRRSE  301

Query  196   IIAF  185
             II F
Sbjct  302   IIPF  305



>gb|KHN04649.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=298

 Score =   300 bits (768),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 202/296 (68%), Gaps = 7/296 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + ++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A++ L+  GLS  VLFH
Sbjct  3     ETTERYAVVTGANKGIGLEIVRQLASAGIKVVLTARNEERGIQALQTLKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE-----SALRASMGRVLNFMR  707
             ++DV DA++V+SL  FI + FG+LDILVNNAG++G    +     S L        +  +
Sbjct  63    QVDVADATSVASLADFIKSKFGKLDILVNNAGILGAVIKDTDSFTSFLLKRGAAPEDGTK  122

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI-HNEWAKG  530
             AI+ +YEL+ EC++INYYG+K   E+ LPLLQ S SPRIVNV+S   +LES+    WA+ 
Sbjct  123   AITQSYELAEECLQINYYGAKTTVESLLPLLQLSDSPRIVNVSSTMGQLESLPKGSWARE  182

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V ++       K+DE++ KFL D++ GS +  GWP H+ AY+VSKAAMNAY RI A KYP
Sbjct  183   VFSDANIITEEKVDEILKKFLRDFQEGSLESNGWPRHLGAYIVSKAAMNAYTRILAKKYP  242

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             S  +N V PG VKTDI  NTG +T +EGA S VR+AL P   PSG+F+    + +F
Sbjct  243   SFCINSVCPGYVKTDITSNTGLLTVEEGAASPVRLALLPNGSPSGLFYYRSDVASF  298



>ref|XP_006583331.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Glycine 
max]
 ref|XP_006583332.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Glycine 
max]
Length=299

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 202/297 (68%), Gaps = 8/297 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + ++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A++ L+  GLS  VLFH
Sbjct  3     ETTERYAVVTGANKGIGLEIVRQLASAGIKVVLTARNEERGIQALQTLKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANES------ALRASMGRVLNFM  710
             ++DV DA++V+SL  FI + FG+LDILVNNAG+ G    ++       L+       +  
Sbjct  63    QVDVADATSVASLADFIKSKFGKLDILVNNAGIGGAVIKDTDSFTSLLLKRGAAPEEDVT  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI-HNEWAK  533
             +AI+ +YEL+ EC++INYYG+K   E+ LPLLQ S SPRIVNV+S   +LES+    WA+
Sbjct  123   KAITQSYELAEECLQINYYGAKTTVESLLPLLQLSDSPRIVNVSSTMGQLESLPKGSWAR  182

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              V ++       K+DE++ KFL D++ GS +  GWP H+ AY+VSKAAMNAY RI A KY
Sbjct  183   EVFSDANIITEEKVDEILKKFLRDFQEGSLESNGWPRHLGAYIVSKAAMNAYTRILAKKY  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  +N V PG VKTDI  NTG +T +EGA S VR+AL P   PSG+F+    + +F
Sbjct  243   PSFCINSVCPGYVKTDITANTGLLTVEEGAASPVRLALLPNGSPSGLFYYRSDVASF  299



>ref|XP_003623885.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
Length=607

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 211/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             +YAVVTG NKGIGFE  + LA  GV VVLTAR+E KG+EA++KL+  GLSD V+FH+LDV
Sbjct  328   KYAVVTGSNKGIGFETVKMLASNGVKVVLTARDEKKGNEAIQKLKQFGLSDQVMFHQLDV  387

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYELS  680
             TD+++++SLV F  T FGRLDILVNNAGV G+   E+     +G  +++ + ++   +++
Sbjct  388   TDSASITSLVQFFKTQFGRLDILVNNAGVSGVNPYET-----VGSTVDWEK-LTQTSDMA  441

Query  679   AECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PP  503
               C+  NYYG K  T+AFLPLL+ S S +IVNV+S  + L++I N+WAK V +++E+   
Sbjct  442   ENCLRTNYYGVKETTDAFLPLLKLSNSSKIVNVSSQAALLKNIPNQWAKRVFDDIENLTE  501

Query  502   GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPG  323
              K+DEV+ +F++D+K GS + KGWP  MSAY++SKAAMN+Y RI A KYP++ +NCV PG
Sbjct  502   EKIDEVLKEFIKDFKEGSLENKGWPTIMSAYIISKAAMNSYTRILAKKYPNMCINCVCPG  561

Query  322   NVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              VKTDIN NTG +   +GA S+VR+AL P+D PSG+FF  ++I  F
Sbjct  562   FVKTDINKNTGMLPVDQGAASVVRLALLPDDSPSGLFFIREEISNF  607


 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 207/289 (72%), Gaps = 12/289 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  R AVVTG NKGIGFE  + LA  GV V+LTAR+E KG+EA++KL+  GLSD V+F
Sbjct  2     AEAKLRNAVVTGSNKGIGFETVKMLASNGVKVMLTARDEKKGNEAIQKLKQFGLSDQVMF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVTD ++++SLV F+ T FGRLDILVNNAGV G+   E     ++G  +++ + ++ 
Sbjct  62    HQLDVTDPASITSLVEFVKTQFGRLDILVNNAGVSGVNPYE-----TVGSTVDWEK-LTQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
               +++  C+  NYYG K  TEAFL LL+ S SP+I+NV+S     ++I N+WAK V +++
Sbjct  116   TSDMAENCLRTNYYGVKETTEAFLSLLKLSNSPKIINVSS-----QNIPNQWAKRVFDDI  170

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++D+V+ +F++D+K GS + KGWP  +S Y+VSKAA N+Y RI A KYP++ +N
Sbjct  171   ENLTEERIDKVLIEFIKDFKEGSLENKGWPTFLSTYIVSKAATNSYTRILAKKYPNMCIN  230

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             CV PG VKTD+  N G ++  +GA S+VR+AL P+  PSG+FF  ++II
Sbjct  231   CVCPGYVKTDLTKNIGMLSVDQGAASVVRLALLPDGSPSGLFFIREEII  279



>ref|XP_003600294.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=356

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 206/284 (73%), Gaps = 2/284 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ASKRYA+VTG NKGIG+ IC++LA  GV VVLTARNE +G +AVE L+ +GLSD V+F
Sbjct  2     TEASKRYALVTGANKGIGYGICKKLASSGVMVVLTARNEKRGLDAVESLKELGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRVLNFMRAIS  698
             H+LDVTD  +VSSLV FI   FG+LDILVNNAGV G   N E+ ++   G + ++  A+ 
Sbjct  62    HQLDVTDPISVSSLVEFIKIQFGKLDILVNNAGVAGGIVNGENVVKQVRGEISDWNLALR  121

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YEL+ EC+EIN++G++R+TEA +PLLQ S SPRIVNV+S   K + + NEWA+GV ++
Sbjct  122   QTYELAEECVEINFFGAERVTEALIPLLQLSTSPRIVNVSSRRGKFKFMPNEWARGVFDD  181

Query  517   VESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
             +++    KL EV+ +FL+DYK G+ + K WP  +S Y ++KAA+N+Y R+ A K P  ++
Sbjct  182   IKNVTNEKLGEVLREFLKDYKEGALETKNWPTFVSGYTMAKAALNSYTRLLALKLPRFRI  241

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             NC+ P  VKTDIN   G ++  EGA+  V +AL P+DGPSG  +
Sbjct  242   NCLCPDFVKTDINEMKGFLSIDEGAECPVNLALLPDDGPSGFVY  285



>ref|XP_008232811.1| PREDICTED: uncharacterized protein LOC103331916 [Prunus mume]
Length=610

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 207/289 (72%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  314   AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  373

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGR-VLNF  713
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  AL+A     +M R  +++
Sbjct  374   HQLDVANPATVASLAEFIKTQFGKLDILVNNAGISGRQVDGDALKAVVDSGAMERGEVDW  433

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              +     YEL+ EC++INY+G+KR  EA +PLLQ S SPRIVNV+S   KL++I ++WAK
Sbjct  434   SKLKIGTYELAEECLQINYHGAKRTAEALIPLLQLSDSPRIVNVSSSLGKLKNIPSDWAK  493

Query  532   GVLNNVESPPGK-LDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + ++   + + EV+ + L+D+K GS + KGWP  +SAY+VSKAA+NAY RI A KY
Sbjct  494   GVFTDADNLTEEGVGEVLTELLKDFKEGSLESKGWPSSLSAYIVSKAALNAYTRILAKKY  553

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P +++N V PG VKTD+N N G +  +EG   +VR+AL P DGPSG FF
Sbjct  554   PDIRINSVCPGFVKTDLNSNAGVLPVEEGGARVVRIALLPNDGPSGSFF  602


 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/290 (51%), Positives = 200/290 (69%), Gaps = 9/290 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKG+G E  RQLA  G  VVLTAR+  +G EAVEKL+  GLS  V+F
Sbjct  2     AEVTKRYAVVTGANKGLGLETVRQLASNGFIVVLTARDGKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLN  716
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +    +A++       G V +
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIFGSIIDVDTSKAAVASGAMERGEV-D  120

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
               + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV++G   L +I + WA
Sbjct  121   LNKLVTDTYELTEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSAGLGMLNNIPSGWA  180

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             +GV  + E+    ++DEV+ + L+D+K GS + KGWP  M AY+VSKAA+NAY RI A K
Sbjct  181   RGVFTDAENLTEERVDEVLTELLKDFKEGSLESKGWPSSMPAYIVSKAALNAYTRILAKK  240

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             YP+ ++N V PG VKTD+N N G +  +EG   +V++AL P DGP+  FF
Sbjct  241   YPNFRINSVCPGFVKTDMNLNAGLLPVEEGGAKVVKLALLPNDGPTSSFF  290



>ref|XP_003600307.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 ref|XP_003627599.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02075.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/294 (51%), Positives = 206/294 (70%), Gaps = 7/294 (2%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             ++R AVVTG NKGIGFEI +QLA  G+ VVLTAR+E +G  A+E L+  GLSD V+F+++
Sbjct  5     AERIAVVTGANKGIGFEIVKQLASAGIKVVLTARDEKRGLHALETLKASGLSDFVVFYQV  64

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN--FMRA  704
             DV +A++V++L  F+ + FG+LDILVNNAG+ G   N+  L   +    G +      +A
Sbjct  65    DVANAASVATLADFVKSQFGKLDILVNNAGISGTVINDKDLATLLISNPGALTEDEKKKA  124

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             ++  YEL+ EC++INYYG+K  TE+ LPLL+ S SPRIVNV+S   KLE I NEW K V 
Sbjct  125   VTQTYELAEECLQINYYGAKITTESLLPLLKLSDSPRIVNVSSTLGKLEGIQNEWTKKVF  184

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ ++    K+DEV+ KFLED+K GS + KGWP    AYV+SKAAMNAY RI A  +P+L
Sbjct  185   SDADNLTEEKVDEVLKKFLEDFKEGSLESKGWPKTGGAYVLSKAAMNAYTRILAKNFPTL  244

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +N + PG V TDI  NTG +TA+EGA S+V++AL P   PSG F++  ++ AF
Sbjct  245   CINSICPGYVITDITGNTGLLTAEEGAASVVKLALLPNGSPSGRFYNRTEVSAF  298



>ref|XP_007139905.1| hypothetical protein PHAVU_008G068500g [Phaseolus vulgaris]
 gb|ESW11899.1| hypothetical protein PHAVU_008G068500g [Phaseolus vulgaris]
Length=309

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 202/277 (73%), Gaps = 6/277 (2%)
 Frame = -1

Query  1036  YAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVT  857
             YAVVTG NKGIGFE  +QLA  GV VVLTAR+E +G EA+ +L+  GLSD V FH+LDVT
Sbjct  30    YAVVTGANKGIGFETVKQLASNGVKVVLTARDEIRGQEAIGRLKEYGLSDLVTFHQLDVT  89

Query  856   DASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYELSA  677
              +++++SL  F+ T FG+LDILVNNAG+ G+  +E       G   N+ + ++    +  
Sbjct  90    HSASINSLAEFVKTQFGKLDILVNNAGISGVNLDE----VDEGSAFNWEK-LTQTCAMVE  144

Query  676   ECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PPG  500
             EC+  NYYG+K+ TEAFLPLLQ SKSPRIVNV+S    L++I NEWAKGVLN+ E+    
Sbjct  145   ECLTTNYYGAKKATEAFLPLLQLSKSPRIVNVSSQAGFLKNIANEWAKGVLNDAENLTEE  204

Query  499   KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPGN  320
             K+DEV+ + ++D+K  S + KGWP  +SAYVVSKAAMN+Y RI A K+P++ +N V PG 
Sbjct  205   KIDEVLKELIKDFKENSLETKGWPTFLSAYVVSKAAMNSYTRILAKKHPNMYINSVCPGF  264

Query  319   VKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             VKTDIN N+G ++ +EGA S+VR+AL P+  PSG+F+
Sbjct  265   VKTDINKNSGILSIEEGAASVVRLALLPDGSPSGLFY  301



>ref|XP_011035784.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Populus euphratica]
Length=304

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 206/301 (68%), Gaps = 13/301 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VL  878
             S A+KRYAVVTG NKGIG EICRQL   G+ VVLTAR+E +G EAV+K++  G+SD+ V+
Sbjct  5     STATKRYAVVTGANKGIGLEICRQLTFHGIVVVLTARDEKRGLEAVQKMKESGISDDLVV  64

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG---------R  725
             FH+LDV D  +++SLV F+   FG++DILVNNA + G+  N  A + +            
Sbjct  65    FHQLDVVDPDSIASLVEFVKIKFGKIDILVNNAAISGVVLNADAFQRAFELSGCWPDGEE  124

Query  724   VLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHN  545
             V N +   + ++EL+ +CI+ NYYG + M EA  PLLQ S S RI+NVTS    L++I N
Sbjct  125   VWNEIE--TQSFELAEQCIKTNYYGVRGMVEALTPLLQLSDSARIINVTSKLGLLKNIPN  182

Query  544   EWAKGVLNNVESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARIT  368
                KG+LN+VES  G ++DE++ +FL+D+K G  K KGWP  +SAY V+KAAMNAY RI 
Sbjct  183   GRVKGLLNDVESLTGDRIDEILKEFLKDFKEGLLKTKGWPTQLSAYTVAKAAMNAYTRIL  242

Query  367   AHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIA  188
             A +YP+   NCV+PG  KTD++ NTG  TA EGA+  VR+AL P+ GPSG  F  K+++ 
Sbjct  243   AKRYPNFHANCVSPGYCKTDLSKNTGYFTAAEGAEGAVRLALLPDGGPSGFCFLQKEMLT  302

Query  187   F  185
             +
Sbjct  303   Y  303



>ref|XP_008232796.1| PREDICTED: uncharacterized protein LOC103331896 [Prunus mume]
Length=647

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 202/290 (70%), Gaps = 9/290 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA  G TVVLTAR+E +G EA EKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASNGFTVVLTARDEKRGLEAAEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLN  716
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A +A +       G V +
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIFGSILDGDAFKAVIASGATERGEV-D  120

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
               + ++  YEL+ EC++INYYG+KR  EA +PLLQ S SPRIVNV+SG   L +I + WA
Sbjct  121   LNKLVTDTYELTEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGLGMLNNIPSGWA  180

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             +GV  + E+    ++DEV+ +FL+D+K GS + KGWP  M AY VSKAA+NAY RI A K
Sbjct  181   RGVFTDAENLTEERVDEVLTEFLKDFKEGSFESKGWPSSMPAYTVSKAALNAYTRILAKK  240

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             YP+ ++N V PG VKTD+N N G +  +EG   +V+ AL P DGP+G FF
Sbjct  241   YPNFRINSVCPGFVKTDMNLNAGLLPVEEGGAKVVKFALLPNDGPTGSFF  290


 Score =   301 bits (771),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 206/299 (69%), Gaps = 19/299 (6%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+G E  RQLA +G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  343   AEATKRYAVVTGANKGMGLETVRQLASKGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  402

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDIL---------VNNAGVIGLAANESALRASM---  731
             H+LDV + +TV+SL  FI T FG+LDIL         VNNAG+ G   +  A +A++   
Sbjct  403   HQLDVANPATVASLADFIKTQFGKLDILKVKQLDSAQVNNAGIFGSILDGDAFKAAIASG  462

Query  730   ----GRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSK  563
                 G V +  + ++  YE + EC++INYYG+KR  EA +PLLQ S SPRIVNV+SG  K
Sbjct  463   AAERGEV-DLSKLVTETYEFAEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGAGK  521

Query  562   LESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMN  386
             L++I N+WAKGV  + E+    ++DEV+ + L+D+K GS + KGW P M AY+VSKAA+N
Sbjct  522   LKNIPNDWAKGVFTDAENLTEERVDEVLTELLKDFKEGSLESKGW-PSMPAYIVSKAALN  580

Query  385   AYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             AY RI A KY + ++N V PG VKTD+N N G +  +EG   +V+ AL P DGP+G FF
Sbjct  581   AYTRILAKKYLNFRINSVCPGFVKTDMNCNVGVLPVEEGGARVVKFALLPNDGPTGSFF  639



>ref|XP_006418460.1| hypothetical protein EUTSA_v10008335mg [Eutrema salsugineum]
 gb|ESQ36813.1| hypothetical protein EUTSA_v10008335mg [Eutrema salsugineum]
Length=295

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 202/287 (70%), Gaps = 6/287 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDNVL-F  875
             A  R AVVTG NKGIGFEICRQLA  G+TV+LTAR+E KG EAVEKL+   G SD  L F
Sbjct  2     AESRVAVVTGSNKGIGFEICRQLANNGITVILTARDEKKGLEAVEKLKAENGFSDQALAF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRA  704
             H+LDV++  +++SL  FI T+FG+LDILVNNAGV G   N   L+A +   G   +  + 
Sbjct  62    HQLDVSNPDSIASLAGFIKTHFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  ECI+ NYYG KRM +A +PLL+ S SPRIV++ S   KLE++ NEWAKGVL
Sbjct  122   MSDTYEIVEECIKTNYYGVKRMCQAMIPLLESSHSPRIVSIASTMGKLENVSNEWAKGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    K+D+V+N++L+DY+ GS + KGWP  MS Y++SKAA+ A  R+   +  S 
Sbjct  182   SDAENLTEEKIDQVINEYLKDYREGSLQVKGWPTVMSGYILSKAAVIALTRVLGKQKKSF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +NCV PG V T+IN+NTG ++ +EGA S VR+AL P   PS +FFD
Sbjct  242   IINCVCPGFVNTEINFNTGILSVEEGAASPVRLALVPNGHPSALFFD  288



>ref|NP_563635.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK44158.1|AF370343_1 putative carbonyl reductase [Arabidopsis thaliana]
 gb|AAM91730.1| putative carbonyl reductase [Arabidopsis thaliana]
 dbj|BAH19833.1| AT1G01800 [Arabidopsis thaliana]
 gb|AEE27336.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=295

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 202/287 (70%), Gaps = 6/287 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDNVL-F  875
             A  R AVVTG NKGIGFEICRQLA  G+TVVLTAR+ENKG  AV+KL+   G SD  + F
Sbjct  2     ADPRVAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRA  704
             H LDV++  T++SL  F+ T FG+LDILVNNAGV G   N   L+A +   G   +  + 
Sbjct  62    HPLDVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  EC++ NYYG KRM EA +PLLQ S SPRIV++ S   KLE++ NEWAKGVL
Sbjct  122   MSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    K+DEV+N++L+DYK G+ + KGWP  MS Y++SKAA+ A  R+ A ++ S 
Sbjct  182   SDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRHKSF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +N V PG V T+IN+NTG ++ +EGA S V++AL P   PSG+FFD
Sbjct  242   IINSVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGDPSGLFFD  288



>gb|AFK37109.1| unknown [Lotus japonicus]
Length=294

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 209/288 (73%), Gaps = 9/288 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ RYAVVTG NKGIGF IC+QL+  G+TVVLTAR+E +G EAVE+L+G+G   +V+F
Sbjct  2     AEATARYAVVTGANKGIGFAICKQLSSNGITVVLTARDEKRGLEAVEELKGLG---HVVF  58

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLNFMR  707
             H+LDVTD +++ S  +FI T+FG+LDILVNNAG  G   +  AL A+     G  +++ +
Sbjct  59    HQLDVTDPASIGSFANFIQTHFGKLDILVNNAGASGAHVDGEALAAANIVENGGQIDWRK  118

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              ++ NYEL+  C++ NYYG K +T+A +PLLQ S SP+IVNV+S   +LE+I +   K V
Sbjct  119   IVTENYELTEACLKTNYYGVKELTKALIPLLQISGSPKIVNVSSSMGRLENIPDGRPKQV  178

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             + +VE+    K+DE +N++L+D+K GS + KGWP  M AY +SK A+NAY RI A KYPS
Sbjct  179   IVDVENLTEEKIDEFLNEYLKDFKEGSLEAKGWPHIMYAYTISKVALNAYTRILAKKYPS  238

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPE-DGPSGVFF  209
               +N V PG VKTDINYNTG +T  EGA++ VR+AL P+   PSG+FF
Sbjct  239   FCINAVCPGYVKTDINYNTGLLTPDEGAEAAVRLALLPDGSSPSGLFF  286



>ref|XP_011091833.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Sesamum 
indicum]
Length=304

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 205/287 (71%), Gaps = 11/287 (4%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             K+YAVVTG NKGIG EICRQLA +GV VVLTARNE +G +AVE L+  GLSD ++FH+LD
Sbjct  28    KKYAVVTGANKGIGLEICRQLASQGVCVVLTARNEKRGLDAVEMLKKSGLSDYIMFHQLD  87

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYEL  683
             V D+++++ L  FI +  G+LDILVNNAGV G+   ES    + G+         + YEL
Sbjct  88    VMDSASINYLAGFIKSEIGKLDILVNNAGVNGI--TESGTGGAKGK--------GNAYEL  137

Query  682   SAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-P  506
             + EC++INY+G+KR TEA LPLL  S SPRIVNV+S    L  I N+ A+  LN+VE+  
Sbjct  138   AVECMQINYFGTKRTTEALLPLLHLSDSPRIVNVSSTMGALSGIRNKSARETLNDVENLT  197

Query  505   PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNP  326
               ++D+V+N++L+D K GS + KGWP +   Y VSKAA+ AY R+ A KYP + +NCV P
Sbjct  198   KERIDQVLNEYLKDIKEGSAEAKGWPSYWGVYCVSKAAVTAYTRLLAKKYPKMLINCVCP  257

Query  325   GNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             G VKTD++ ++G +  +EGA+S VR+AL P+DGPSG+FF+  ++ +F
Sbjct  258   GWVKTDLSNHSGPLRPEEGAKSPVRLALLPDDGPSGLFFNRMQVSSF  304



>ref|XP_006582932.1| PREDICTED: uncharacterized protein LOC100803877 isoform X1 [Glycine 
max]
Length=288

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 205/285 (72%), Gaps = 7/285 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGF IC+QLA  G+TVVLTAR+E +G +AVEKL+ +GLS +V F
Sbjct  2     AEATKGYAVVTGANKGIGFAICKQLASNGITVVLTARDEKRGLQAVEKLQELGLSGHVGF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS-----MGRVLNFM  710
             H+LDVTD + + SL  FI   FG+LDILVNNAG+ G   +  AL A+      GR+ ++ 
Sbjct  62    HQLDVTDPAGIRSLADFIRNKFGKLDILVNNAGIPGAQWDGEALAAAGIMENAGRI-DWS  120

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             + ++  YEL+   ++ NYYG+K +T+A +PLLQ S SP+IVNV+S   +LE I N W K 
Sbjct  121   KIVTDTYELAEAGVKTNYYGAKELTKALIPLLQFSDSPKIVNVSSSMGRLEHIPNGWPKE  180

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++VE+    K+D+++N+FL+D+K GS + KGWP  M AY VSKAA+NA+ RI A  YP
Sbjct  181   VLSDVENLTEEKIDDILNEFLKDFKEGSLETKGWPLAMPAYSVSKAALNAFTRILAKNYP  240

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSG  218
             S  +N + PG VKTDIN NTG +T  EGA++ VR+AL P+  PSG
Sbjct  241   SFYINALCPGYVKTDINSNTGFLTPDEGAEAAVRLALLPDGSPSG  285



>emb|CDP08857.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 214/304 (70%), Gaps = 14/304 (5%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             S A KR AVVTGGNKGIGFEIC+QLA +G+ VVLTAR+  KG+EA EKL+  GLS+NV+F
Sbjct  7     SHAQKRCAVVTGGNKGIGFEICKQLASQGILVVLTARDVKKGNEAFEKLKDSGLSENVVF  66

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLA--ANESALRASM--------GR  725
             H+LDV + ++++SLV FI ++FG+LDILVNNAG  GL    + S ++  +        G+
Sbjct  67    HQLDVVEPASIASLVDFIESHFGKLDILVNNAGAAGLMVEGDVSIIKEIIMADDLKVAGQ  126

Query  724   VLNFMRA---ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLES  554
              +  ++A   +   Y+L+   ++ NYYG K+M EAF+PLLQ S SPRIVNV+S   +LE 
Sbjct  127   EVPEIKADAKLIQTYDLAEGSLQTNYYGVKQMIEAFIPLLQLSSSPRIVNVSSLLGRLEL  186

Query  553   IHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYA  377
             + ++WA  VL + ES    ++D+VV +FL+D+K+G+ + K WP   +AY VSKAA+NAY 
Sbjct  187   LSHQWAVEVLGDGESLTEERVDKVVTEFLKDFKDGTAEAKCWPATFTAYKVSKAAINAYT  246

Query  376   RITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKK  197
             RI A KYP++ +NCV PG  KTDI  NTG  TA EGA+  V++AL P+ GPSG+FF  K+
Sbjct  247   RILAKKYPTICINCVCPGYCKTDITCNTGFSTAAEGAEGPVKLALLPDGGPSGLFFSRKE  306

Query  196   IIAF  185
             +  +
Sbjct  307   VTTY  310



>ref|XP_006491047.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Citrus sinensis]
Length=290

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 207/291 (71%), Gaps = 3/291 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG+E+ RQLA  GV  VLTAR+E  G EAVEKL+  G  DNV+F
Sbjct  2     AETAKRYAVVTGANKGIGYEVVRQLALNGVITVLTARDEKGGLEAVEKLKHSGF-DNVIF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDV D + + S+  FI ++FG+LDILVNNAG+ G++++   L   +   +   + ++ 
Sbjct  61    HQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGK-MTQ  119

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YE + +C++ NY G+KRM EA +PLLQ S S RIVNV+S   KL  + +EWAKGV ++ 
Sbjct  120   TYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMYVTHEWAKGVFSDA  179

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV++++L DYK GS + KGWP + +AY++SKAAMNAY RI A KYP+  +N
Sbjct  180   ENLTEERVDEVLSQYLNDYKEGSPETKGWPANAAAYILSKAAMNAYTRILAKKYPNFCIN  239

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CV PG VKT++ YN G++T +EGA+S V +AL  + GPSG+FF  K+   F
Sbjct  240   CVCPGYVKTEMTYNAGRLTVEEGAESPVWLALLHKGGPSGLFFSRKEETLF  290



>ref|XP_010054778.1| PREDICTED: LOW QUALITY PROTEIN: salutaridine reductase-like [Eucalyptus 
grandis]
Length=291

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/290 (53%), Positives = 201/290 (69%), Gaps = 6/290 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             R AVVTG NKGIGFEIC+QLA  GV VVLTAR+ NKG +A+EKL  +G+S NV+FH LDV
Sbjct  3     RIAVVTGANKGIGFEICKQLASNGVFVVLTARDVNKGDDAIEKLASIGIS-NVVFHPLDV  61

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA----SMGRVLNFMRAISHN  692
              D ++V SL  FI   FG+LDILVNNAGV G+  + + L+A     +G +L +   I   
Sbjct  62    VDGTSVYSLADFIKARFGKLDILVNNAGVTGVTTDGNVLKALLTGQLGLMLGWSEFIEET  121

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             YEL+ +C+  NYYG K++T A LPLLQQS S R++NV+S   KL+ I  E  K  LN+V+
Sbjct  122   YELAEKCLRTNYYGVKQVTXALLPLLQQSNSARVINVSSSVGKLQFIPGENIKEELNDVD  181

Query  511   S-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
             S    K+D +V +FL+D K G+ +  GWP   SAY+VSKA +NAY R+ A KYP + +N 
Sbjct  182   SLTEEKVDGLVMRFLKDMKEGTVETGGWPIISSAYIVSKATLNAYTRVLAKKYPGIAINA  241

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             V+PG VKTD+N+NTG +  +EGA+  V VAL P++GPSGVFFD   +  F
Sbjct  242   VSPGFVKTDLNHNTGFLPVEEGARGPVTVALMPKEGPSGVFFDRTVVSTF  291



>ref|XP_006445104.1| hypothetical protein CICLE_v10023386mg, partial [Citrus clementina]
 gb|ESR58344.1| hypothetical protein CICLE_v10023386mg, partial [Citrus clementina]
Length=300

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 207/291 (71%), Gaps = 3/291 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG+E+ RQLA  GV  VLTAR+E  G EAVEKL+  G  DNV+F
Sbjct  12    AETAKRYAVVTGANKGIGYEVVRQLALNGVITVLTARDEKGGLEAVEKLKHSGF-DNVIF  70

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDV D + + S+  FI ++FG+LDILVNNAG+ G++++   L   +   +   + ++ 
Sbjct  71    HQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGK-MTQ  129

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YE + +C++ NY G+KRM EA +PLLQ S S RIVNV+S   KL  + +EWAKGV ++ 
Sbjct  130   TYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMYVTHEWAKGVFSDA  189

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV++++L DYK GS + KGWP + +AY++SKAAMNAY RI A KYP+  +N
Sbjct  190   ENLTEERVDEVLSQYLNDYKEGSPETKGWPANAAAYILSKAAMNAYTRILAKKYPNFCIN  249

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CV PG VKT++ YN G++T +EGA+S V +AL  + GPSG+FF  K+   F
Sbjct  250   CVCPGYVKTEMTYNAGRLTVEEGAESPVWLALLHKGGPSGLFFSRKEETLF  300



>ref|XP_007214062.1| hypothetical protein PRUPE_ppa017566mg [Prunus persica]
 gb|EMJ15261.1| hypothetical protein PRUPE_ppa017566mg [Prunus persica]
Length=299

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 213/298 (71%), Gaps = 8/298 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +K+YAVVTG N+GIGF   R+LA  G+ VVLTA +   G EA+EKL+  G+SD V+F
Sbjct  2     AEVAKKYAVVTGSNQGIGFGTVRKLASNGIMVVLTALDNKMGLEAIEKLKECGISDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-------GRVLN  716
             H+LDVT+ ++++SL  F+ T FG+LDILV NAGV G   +  A+RA+        G  +N
Sbjct  62    HQLDVTNTASIASLADFVKTQFGKLDILVKNAGVSGTIVDPEAMRAAAAAGIGKDGVGVN  121

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
             +   ++  YEL+  C++ NYYG+K+MT+A LPLLQ S SPR+V+++S    L+ I NEWA
Sbjct  122   WSEIMTQTYELAEVCVKTNYYGAKKMTKALLPLLQLSDSPRVVSLSSSMGSLKHIPNEWA  181

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGVL++ E     ++D+++N+FL+D+K    + KGWP  +SAY++SKAA+NA+ R+ A K
Sbjct  182   KGVLSDAEKLTEERIDDILNEFLKDFKEDILETKGWPTSLSAYILSKAAVNAFTRMMARK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +P++ +N V+PG VKTD+N+NTG +T  EGA+S+VR+A+ P   PSG++F  +++  F
Sbjct  242   HPNICINSVDPGFVKTDMNFNTGMLTIDEGAESVVRLAVVPNGSPSGLYFHLQEVSPF  299



>gb|KDO86072.1| hypothetical protein CISIN_1g039097mg [Citrus sinensis]
Length=290

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 207/291 (71%), Gaps = 3/291 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ +KRYAVVTG NKGIG+E+ RQLA  G+  VLTAR+E  G EAVEKL+  G  DNV+F
Sbjct  2     AETAKRYAVVTGANKGIGYEVVRQLALNGIITVLTARDEKGGLEAVEKLKHSGF-DNVIF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDV D + + S+  FI ++FG+LDILVNNAG+ G++++   L   +   +   + ++ 
Sbjct  61    HQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGK-MTQ  119

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YE + +C++ NY G+KRM EA +PLLQ S S RIVNV+S   KL  + +EWAKGV ++ 
Sbjct  120   TYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMYVTHEWAKGVFSDA  179

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++DEV++++L DYK GS + KGWP + +AY++SKAAMNAY RI A KYP+  +N
Sbjct  180   ENLTEERVDEVLSQYLNDYKEGSPETKGWPANAAAYILSKAAMNAYTRILAKKYPNFCIN  239

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CV PG VKT++ YN G++T +EGA+S V +AL  + GPSG+FF  K+   F
Sbjct  240   CVCPGYVKTEMTYNAGRLTVEEGAESPVWLALLHKGGPSGLFFSRKEETLF  290



>ref|XP_007051879.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96036.1| NAD(P)-binding Rossmann-fold superfamily protein, putative [Theobroma 
cacao]
Length=313

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/287 (52%), Positives = 199/287 (69%), Gaps = 4/287 (1%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVL  878
             +S  S RYAVVTG NKGIG EIC+QLAC+G+TVVLTAR+E +G EA+E L+  GLSD+++
Sbjct  17    SSFPSVRYAVVTGANKGIGLEICKQLACKGITVVLTARDEKRGLEALENLKHSGLSDHLV  76

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGL---AANESALRASMGRVLNFMR  707
             FH+LDV D ++++SL  F+   FG+LDILVNNAG++G+   A N S +  +         
Sbjct  77    FHQLDVADPASIASLADFVKKQFGKLDILVNNAGIVGVNIDALNASDISGAQEGWNTIWS  136

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              +S  YE + EC++ NYYG+ R  EA +PLLQ S  PRIVNV+S    L+    E  KG+
Sbjct  137   KLSATYEAAEECLKTNYYGAIRTAEALIPLLQLSDLPRIVNVSSSVVMLKHTTGERLKGI  196

Query  526   LNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             L    +   KL++ + ++L+D+K G  + KGWP   SAY VSK AMNA+ RI A KYP+ 
Sbjct  197   LTGFTTEE-KLNDFLTEYLKDFKEGLLESKGWPTAFSAYTVSKVAMNAHTRILAKKYPNF  255

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +NCV PG VKTDIN+NTGK+T +EGA S V++AL P  GPSG+FF+
Sbjct  256   CINCVCPGFVKTDINFNTGKLTVEEGAASPVKIALLPNGGPSGLFFN  302



>ref|XP_007135024.1| hypothetical protein PHAVU_010G095500g [Phaseolus vulgaris]
 gb|ESW07018.1| hypothetical protein PHAVU_010G095500g [Phaseolus vulgaris]
Length=294

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/288 (54%), Positives = 203/288 (70%), Gaps = 9/288 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+K YAVVTG NKGIGF IC+QLA  GV+VVLTAR+E +G EAVEKL+ +G    V+F
Sbjct  2     AEATKGYAVVTGANKGIGFAICKQLASNGVSVVLTARDEKRGVEAVEKLKELG--HPVVF  59

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRA---  704
             H+LDVTD  +++SL  FI   FG+LDILVNNA + G   N  A+ A+ G V N  RA   
Sbjct  60    HQLDVTDPKSITSLADFIRNQFGKLDILVNNAAIPGAHVNGEAM-AAAGIVENAGRADWS  118

Query  703   --ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               ++  YEL+   ++ NYYG K +T+A +PLLQ S SP+IVNV+S   +LE + N W K 
Sbjct  119   KIVTETYELAEAGLKTNYYGVKELTKALIPLLQFSSSPKIVNVSSSMGRLEHMRNGWPKE  178

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V N+VE+    K+D+++++FL+D+K GS   KGW   MSAY VSKA++NAY RI A KYP
Sbjct  179   VFNDVENLTEAKIDDILDEFLKDFKEGSLDTKGWLLAMSAYSVSKASLNAYTRILAKKYP  238

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             S  +N V PG VKTDIN NTG +T  EGA++ VR+AL PE  PSG+FF
Sbjct  239   SFCINAVCPGYVKTDINCNTGFLTPDEGAEAAVRLALLPEGSPSGLFF  286



>ref|XP_002892041.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68300.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=295

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 203/294 (69%), Gaps = 6/294 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDNVL-F  875
             A+ R AVVTG NKGIGFE CRQLA  G+TV+LTAR+ENKG  AV+KL+   G SD  + F
Sbjct  2     ANTRVAVVTGSNKGIGFETCRQLARNGITVILTARDENKGLAAVQKLKTENGFSDQAISF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRA  704
             H LDV+D  T++SL  F+ T FG+LDILVNNAGV G   N   L+A +   G   +  + 
Sbjct  62    HPLDVSDPDTIASLAAFLKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  ECI+ NYYG KRM EA +PLLQ S SPRIV++ S   KLE++ NEWAKGVL
Sbjct  122   MSDTYEIVEECIKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    K+DEV+N++L+DYK G+ + KGWP  MS Y++SKAA+ A  R+ A +  S 
Sbjct  182   SDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRNKSF  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +N V PG V T+IN+NTG ++ +EGA S V +AL P   PSG+FFD   + +F
Sbjct  242   IINSVCPGFVNTEINFNTGILSIEEGAASPVNLALVPNGDPSGLFFDRANVSSF  295



>gb|KEH18924.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=297

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 209/289 (72%), Gaps = 8/289 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIGF +C+QLA +G+TVVLTAR+E +G EAVEKL+ + L   V+F
Sbjct  2     AEATKRYAVVTGANKGIGFAVCKQLASKGITVVLTARDEKRGLEAVEKLKQLSLPGLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMR  707
             H+LDV D +++ S V FI   FG LD+LVNNAG+ G   +  AL A+     G  +++ +
Sbjct  62    HQLDVIDHASIRSFVDFIKNQFGNLDLLVNNAGIPGAQVDGEALAAANTAENGGQIDWSK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I+  YE +   I+ NYYG+K +TEA +PLLQ S SP++VNV+S   KLE + N W K V
Sbjct  122   IITQTYEETELGIKTNYYGAKDLTEALIPLLQLSSSPKVVNVSSSMGKLEKLPNGWPKEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKE-KGWPPH-MSAYVVSKAAMNAYARITAHKY  356
             L+++E+    K+DEV+N+FL+D+K GS  E KGWP + MS Y++SKA+++AY R+ A KY
Sbjct  182   LSDIENLTEEKIDEVLNQFLKDFKEGSLVENKGWPINSMSTYIISKASLSAYTRVAAKKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             PS+ +N V PG VKTDINYNTG +T  EGA+SI+R+AL   DG SG FF
Sbjct  242   PSICINAVCPGFVKTDINYNTGYLTPDEGAESILRLALL-SDGSSGHFF  289



>gb|AAF78417.1|AC009273_23 Contains similarity to a retinal short-chain dehydrogenase/reductase 
retSDR4 from Homo sapiens gb|AF126782. It contains a 
short chain dehydrogenase PF|00106 domain [Arabidopsis thaliana]
Length=325

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/284 (54%), Positives = 201/284 (71%), Gaps = 6/284 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSDNVL-FHRL  866
             R AVVTG NKGIGFEICRQLA  G+TVVLTAR+ENKG  AV+KL+   G SD  + FH L
Sbjct  35    RVAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISFHPL  94

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRAISH  695
             DV++  T++SL  F+ T FG+LDILVNNAGV G   N   L+A +   G   +  + +S 
Sbjct  95    DVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSD  154

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YE+  EC++ NYYG KRM EA +PLLQ S SPRIV++ S   KLE++ NEWAKGVL++ 
Sbjct  155   TYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVLSDA  214

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    K+DEV+N++L+DYK G+ + KGWP  MS Y++SKAA+ A  R+ A ++ S  +N
Sbjct  215   ENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRHKSFIIN  274

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              V PG V T+IN+NTG ++ +EGA S V++AL P   PSG+FFD
Sbjct  275   SVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGDPSGLFFD  318



>ref|XP_010523034.1| PREDICTED: (+)-neomenthol dehydrogenase [Tarenaya hassleriana]
Length=298

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/297 (53%), Positives = 206/297 (69%), Gaps = 7/297 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGV-GLSD-NV  881
             ++ +KR AVVTG N+ IGFEICRQLA  GVTVVLTAR++ KG EAVE L+   G SD ++
Sbjct  2     AETTKRVAVVTGSNRWIGFEICRQLANNGVTVVLTARDKRKGLEAVETLKKENGFSDQDI  61

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFM  710
             +F RLDV+D  +++SL  F+ T FG+LDILVNNAGV G   N  AL+A +   G   N  
Sbjct  62    VFDRLDVSDPHSIASLADFVKTQFGKLDILVNNAGVGGANVNVDALKAQVAESGAPTNIA  121

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               +S  YE+  ECI INYYG K M EA  PLLQ S SPRIV++ S   KLE++ NEWAKG
Sbjct  122   EIMSDTYEIVEECIRINYYGVKGMCEAMAPLLQSSDSPRIVSIASSMGKLENVSNEWAKG  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             V+++ E+    K+DEV+ ++L+DY+ GS +EKGWP  MS Y++SKA + A  RI A K P
Sbjct  182   VMSDAENLTEEKVDEVLREYLKDYREGSLQEKGWPTVMSGYILSKAGVIALTRILAKKCP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDG-PSGVFFDCKKIIAF  185
             S  +N V PG V TDIN++TG +  +EGA S VR+AL P+   PSG+FFD  ++ +F
Sbjct  242   SFCINSVCPGFVNTDINFHTGILPVEEGAASPVRLALLPQGSCPSGLFFDRSQVSSF  298



>gb|ACJ84741.1| unknown [Medicago truncatula]
Length=298

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 205/294 (70%), Gaps = 7/294 (2%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             ++R AVVTG NKGIGFEI +QLA  G+ VVLTAR+E +G  A+E L+  GLSD V+F+++
Sbjct  5     AERIAVVTGANKGIGFEIVKQLAPAGIKVVLTARDEKRGLHALETLKASGLSDFVVFYQV  64

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLN--FMRA  704
             DV +A++V++L  F+ + FG+LDILVNNAG+ G   N+  L   +    G +      +A
Sbjct  65    DVANAASVATLADFVKSQFGKLDILVNNAGISGTVINDKDLATLLISNPGALTEDEKKKA  124

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             ++  YEL+ EC++INYYG+K  TE+ LPLL+ S SPRIVNV+S   KLE I NEW K V 
Sbjct  125   VTQTYELAEECLQINYYGAKITTESLLPLLKLSDSPRIVNVSSTLGKLEGIQNEWTKKVF  184

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ ++    K+DEV+ KFLED+K  S + KGWP    AYV+SKAAMNAY RI A  +P+L
Sbjct  185   SDADNLTEEKVDEVLKKFLEDFKESSLESKGWPKTGGAYVLSKAAMNAYTRILAKNFPTL  244

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +N + PG V TDI  NTG +TA+EGA S+V++AL P   PSG F++  ++ AF
Sbjct  245   CINSICPGYVITDITGNTGLLTAEEGAASVVKLALLPNGSPSGRFYNRTEVSAF  298



>ref|XP_006588341.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=296

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 205/294 (70%), Gaps = 5/294 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIGF +C++LA  G+ VVLTAR+E  G +AVEKL+  GLSD ++FH
Sbjct  3     EEAKRYAVVTGANKGIGFGMCKKLASSGIVVVLTARDEKNGFKAVEKLKEFGLSDLLVFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG--LAANESALR--ASMGRVLNFMRA  704
             +LDV D ++VS+L  FI T FG+LDILVNNA V G  L   ++ LR     G  +++   
Sbjct  63    QLDVDDPASVSALADFIKTEFGKLDILVNNAAVTGGKLLDADAFLRKVGLNGEQIDWNEV  122

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
                 YEL+ +C+E N+YG KR+TEA LPLLQ S SPRIVN++S     ++I NEWA+ +L
Sbjct  123   GYETYELAEQCVETNFYGVKRVTEALLPLLQLSTSPRIVNISSRAGLFKNIPNEWARTML  182

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             +++E+    K+D V+ +F +D+K GS + KGWP   SAY +SKAA+NAY RI A KYP  
Sbjct  183   SDIENLTREKIDGVLEEFQKDFKEGSLEIKGWPAFASAYTMSKAALNAYTRIMAKKYPRF  242

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              +N V PG VKTD+N NTG+++  EGA++ V +AL P  GPSG FF   ++I F
Sbjct  243   HINSVCPGFVKTDMNNNTGQLSIDEGAETPVLLALLPNGGPSGCFFHQGEVIPF  296



>ref|XP_003600308.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 ref|XP_003627598.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02074.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=300

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 205/291 (70%), Gaps = 7/291 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             R AVVTG NKGIG EI RQLA  G+ VVLTAR+E +G  A+E L+  GLSD V+FH+LDV
Sbjct  8     RIAVVTGSNKGIGLEIVRQLASAGIKVVLTARDEKRGLHALETLKASGLSDFVVFHQLDV  67

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE---SALRASMGRVLN---FMRAIS  698
              +A++V++L  F+ + FG+LDILVNNAG+ G   ++   ++L  S  R L+     +A++
Sbjct  68    ANAASVATLADFVKSQFGKLDILVNNAGISGALIDDKDLASLLISNPRALSEDEKKKAVT  127

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YEL+ EC++INYYG+K  TE+ LPLL+ S SPRIVNV+S   KL+ I NEW + V  +
Sbjct  128   QTYELAEECLQINYYGAKITTESLLPLLKLSDSPRIVNVSSTTGKLKRIKNEWTREVFGD  187

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
             V++    K+DEV+ KFLED+K GS + KGWP    AYV+SKAAMNAY RI A  +P+L +
Sbjct  188   VDNLTEEKVDEVLKKFLEDFKEGSMESKGWPKTGGAYVLSKAAMNAYTRILAKNFPTLCI  247

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIA  188
             N + PG V TDI  NTG +TA+EGA S+V++AL P   PSG F+   ++++
Sbjct  248   NSICPGYVITDITGNTGLLTAEEGAASVVKLALLPNGSPSGQFYHRTEVMS  298



>gb|KHN29382.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=396

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 201/284 (71%), Gaps = 3/284 (1%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIGF +C++LA  G+ VVLTAR+E  G +AVEKL+  GLSD ++FH
Sbjct  3     EEAKRYAVVTGANKGIGFGMCKKLASSGIVVVLTARDEKNGFKAVEKLKEFGLSDLLVFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG--LAANESALRASMGRVLNFMRAIS  698
             +LDV D ++VS+L  FI T FG+LDILVNNA V G  L   ++ LR   G  +++     
Sbjct  63    QLDVDDPASVSALADFIKTEFGKLDILVNNAAVTGGKLLDADAFLRKRNGEQIDWNEVGY  122

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YEL+ +C+E N+YG KR+TEA LPLLQ S SPRIVN++S     ++I NEWA+ +L++
Sbjct  123   ETYELAEQCVETNFYGVKRVTEALLPLLQLSTSPRIVNISSRAGLFKNIPNEWARTMLSD  182

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
             +E+    K+D V+ +F +D+K GS + KGWP   SAY +SKAA+NAY RI A KYP   +
Sbjct  183   IENLTREKIDGVLEEFQKDFKEGSLEIKGWPAFASAYTMSKAALNAYTRIMAKKYPRFHI  242

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             N V PG VKTD+N NTG+++  EGA++ V +AL P  GPSG FF
Sbjct  243   NSVCPGFVKTDMNNNTGQLSIDEGAETPVLLALLPNGGPSGCFF  286


 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = -1

Query  1036  YAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN-VLFHRLDV  860
             + VVTG NKGIGF IC+QL   G+TVVLTAR+E +G EAVEKL+  G+SD+ V+FH+LDV
Sbjct  287   HQVVTGANKGIGFGICKQLVSSGITVVLTARDEKRGLEAVEKLKEFGVSDDQVVFHQLDV  346

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS  734
             TD  ++ SL +FI T FG+LDILVNNAG+ G   +  AL A+
Sbjct  347   TDPKSIESLANFIKTQFGKLDILVNNAGIHGAYVDRDALAAA  388



>ref|XP_008337732.1| PREDICTED: short-chain dehydrogenase/reductase 2b-like [Malus 
domestica]
 ref|XP_008353988.1| PREDICTED: short-chain dehydrogenase/reductase 2b-like [Malus 
domestica]
Length=295

 Score =   295 bits (755),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 204/296 (69%), Gaps = 8/296 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +D  KRYAVVTG NKGIGF   +QLA  G+ VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     ADTVKRYAVVTGANKGIGFGTVKQLASNGIVVVLTARDEKRGLEALEKLKDFGISDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-LAANESALRASMGR---VLNFMR  707
             H+LDVTD+ + + L  F+ T FG+LDILVNNA V+G +   E    AS G+    +N+  
Sbjct  62    HQLDVTDSVSAARLADFVKTQFGKLDILVNNAAVVGSIVTPEDFKSASSGKRXEEINWSE  121

Query  706   AIS-HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               +  N E++ +C++ NYYG+K +TEA LPLLQ S SPRIVNV+SG  KL +  N WAK 
Sbjct  122   IPTIPNDEVAEQCLKTNYYGTKSVTEALLPLLQLSDSPRIVNVSSGVGKLMNFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E     K+D V+ +FLED K G TK   W P    Y VSKAA+NAY RI A KYP
Sbjct  182   VLSDAERLTEEKIDSVLIRFLEDLKKGDTKI--WSPIFPPYTVSKAALNAYTRILAKKYP  239

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NCV+PG VKTDI +N G +T  EGA+S+VR+AL P  GP+G+ FD K++ +F
Sbjct  240   NFCINCVSPGFVKTDITFNVGILTIDEGAESLVRLALLPNGGPTGLCFDQKEVASF  295



>ref|XP_008353984.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Malus 
domestica]
 ref|XP_008353986.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Malus 
domestica]
Length=297

 Score =   295 bits (754),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 205/296 (69%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A +RYAVVTG NKG+GF   +QLA +GV VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     AEAVRRYAVVTGANKGVGFGTVKQLASKGVVVVLTARDEKRGLEALEKLKDFGISDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE----SALRASMGRVLNFMR  707
             H+LDVTD+++ + L  F+ T FG+LDILVNNA + G   N     SA  A     +N+  
Sbjct  62    HQLDVTDSASAAVLADFVKTQFGKLDILVNNAAINGSVVNPEAFISAATAKKPEEINWNE  121

Query  706   AIS-HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               +  NYEL+ EC++ NYYG+KR+TEA LPLLQ S SPRIVNV++G +KL +  N W K 
Sbjct  122   IPTIPNYELAEECLKTNYYGTKRVTEALLPLLQLSDSPRIVNVSTGAAKLMNFPNGWPKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E+    ++D V++ FLED K G    K WPP    Y VSKAA+NAY RI A KYP
Sbjct  182   VLSDAETLTEERIDSVLSGFLEDSKRGLQDIKIWPPVFPPYTVSKAALNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NC +PG VKTD+++N G +T  EGA+SIVR+AL P  G +G++F  K++  F
Sbjct  242   NFCINCGSPGFVKTDMSFNAGILTIDEGAESIVRLALLPNGGSTGLYFSRKEVAPF  297



>ref|XP_004229931.2| PREDICTED: uncharacterized protein LOC101261456 [Solanum lycopersicum]
Length=639

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 214/309 (69%), Gaps = 22/309 (7%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVLFHR  869
             S RYAVVTGGNKGIG+E C+QLA  GV VVLT+R+E +G EA+E+L+  + ++D +LFH+
Sbjct  10    STRYAVVTGGNKGIGYETCKQLASNGVVVVLTSRDEKRGIEAMERLKKELDITDQILFHQ  69

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVL--NF------  713
             LDV D  ++SSLV+FINT FGRLDILVNNAGV G    E+    ++  ++  +F      
Sbjct  70    LDVMDTLSISSLVNFINTKFGRLDILVNNAGVGGSMMEENCNILTIKDLIEGDFVTISTK  129

Query  712   ------------MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGW  569
                         +  I+ NYEL+ +C+E NYYG+KRM EAF PLLQ S SPRIVNV S  
Sbjct  130   NEVVDESVVEKSIEGIATNYELTKQCVETNYYGAKRMIEAFAPLLQLSNSPRIVNVASSL  189

Query  568   SKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAA  392
              KL+ + NEWAK VL++ +S    ++++V+N+FL+D++  S + KGWP + +AY VSKA+
Sbjct  190   GKLKLLCNEWAKNVLSDAKSLTEERIEQVLNEFLKDFRENSVESKGWPTYFAAYKVSKAS  249

Query  391   MNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVF  212
             + AY R+   KYP+ +VN V PG   TD+   TG +TA+EGA+S+V++AL P DGPSG+F
Sbjct  250   LIAYTRVLGSKYPNFRVNSVCPGYCGTDMTAYTGSLTAEEGAESLVKLALLPNDGPSGLF  309

Query  211   FDCKKIIAF  185
             F  K + +F
Sbjct  310   FYRKNVTSF  318


 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 213/317 (67%), Gaps = 37/317 (12%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG----VGLSDNVL  878
             SKRYAVVTGGNKGIG+E C+QLA +G+ VVLT+R+E +G EA+E+L+        +D++L
Sbjct  330   SKRYAVVTGGNKGIGYETCKQLASKGLVVVLTSRDEKRGIEAIERLKKELNITNNNDHIL  389

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAA--------------------  758
             FH+LDV D +++SSLV FINTNFGRLDILVNNAGV GL                      
Sbjct  390   FHQLDVMDPASISSLVDFINTNFGRLDILVNNAGVSGLMVEGNLVILKNLIEGDFETIST  449

Query  757   -----NESALRASMGRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPR  593
                  +ES +  S+         I  NYEL+ +CIE N+YG+KRM+EAF+PLLQ S SP 
Sbjct  450   ENQVEDESVVEKSI-------EGIVTNYELTKQCIETNFYGAKRMSEAFIPLLQLSNSPT  502

Query  592   IVNVTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMS  416
             IVNV S   KL+ + NEWAK VL++ +S    ++++V+N+FL+D+   S + KGWP + +
Sbjct  503   IVNVASFLGKLKLLCNEWAKKVLSDAKSLTEERIEQVLNEFLKDFIENSVESKGWPTYFA  562

Query  415   AYVVSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP  236
             AY VSKA++ AY R+   KYP+ +VN V PG   TD+   TG +TA+EGA+S+V++AL P
Sbjct  563   AYKVSKASLIAYTRVLGSKYPNFRVNSVCPGYCGTDMTAYTGSLTAEEGAESLVKLALLP  622

Query  235   EDGPSGVFFDCKKIIAF  185
              DGPSG+FF  K + +F
Sbjct  623   NDGPSGLFFYRKDVTSF  639



>gb|KHG16333.1| (+)-neomenthol dehydrogenase -like protein [Gossypium arboreum]
Length=297

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 195/282 (69%), Gaps = 3/282 (1%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +D  +RYAVVTG NKGIG EIC+QLA  G  V+LTAR+  +G EA++ L+  GLSD + F
Sbjct  2     TDTMQRYAVVTGANKGIGLEICKQLAQNGTIVILTARDAKRGVEALQSLKHSGLSDRLAF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVT   +++SL  FI   FG+LDILVNNAG+ G+  + ++         N     + 
Sbjct  62    HQLDVTKPKSIASLADFIKEQFGKLDILVNNAGISGVTFSMASGTEEYSS--NIWSKATE  119

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              YEL+ EC++ NYYG+KR TEA +PLLQ S+SPRIVN++S    L+ +  E  KGVL   
Sbjct  120   TYELAEECLKTNYYGAKRTTEALIPLLQISESPRIVNISSSIVMLKDMVGEQLKGVLTGF  179

Query  514   ESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
              +   KL ++++++L+D+K G  + KGWP  +SAY VSK AMNAY RI A+KYP   +NC
Sbjct  180   TTEE-KLSDLISEYLKDFKQGLLQTKGWPTCLSAYTVSKVAMNAYTRIVANKYPDFCINC  238

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             V PG VKTDIN NTGK+T +EGA + V++A+ P+ GPSG+FF
Sbjct  239   VCPGFVKTDINLNTGKLTVEEGAATPVKLAVLPKGGPSGLFF  280



>ref|XP_010053671.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Eucalyptus grandis]
 gb|KCW78029.1| hypothetical protein EUGRSUZ_D02254 [Eucalyptus grandis]
Length=319

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 204/299 (68%), Gaps = 11/299 (4%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDN-VLF  875
             A+KRYAVVTG NKGIGFEICRQLA  GVTVV TAR+E +G +A  +L+    LS   V+F
Sbjct  9     ANKRYAVVTGSNKGIGFEICRQLASTGVTVVFTARDEKRGLQAARELQNNASLSAGAVVF  68

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV--------L  719
             H+LDV D ++VSSLV F+ T FG+LDILVNNAG+ G   + +A+  ++ R          
Sbjct  69    HQLDVADPASVSSLVGFVATQFGKLDILVNNAGIGGYIMDHNAMSEAVERAGGDFPFGEE  128

Query  718   NFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
              + + ++ +Y ++ EC++ NYYG+K +TEA LPLL  S SPRIVNV+S    LE I  EW
Sbjct  129   EWEKILTEDYGMAEECVKTNYYGAKSVTEALLPLLHLSDSPRIVNVSSTLGTLELIPGEW  188

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
              K VL +VE+    ++DEV+  FL+D+K G   ++GWP H+SAY VSKAA+NAY RI A 
Sbjct  189   PKQVLGDVETLTEERVDEVLASFLQDFKEGDFGKRGWPTHISAYKVSKAALNAYTRIMAK  248

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             K PS  VN V PG VKTDI  NTG  T   GA+S V +AL P+ GPSG+FF  K++ +F
Sbjct  249   KLPSFLVNSVCPGFVKTDITGNTGLRTPSHGAESPVWLALLPKGGPSGLFFATKQVSSF  307



>ref|XP_008353985.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Malus 
domestica]
 ref|XP_008353987.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Malus 
domestica]
Length=296

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/295 (51%), Positives = 208/295 (71%), Gaps = 5/295 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A +RYAVVTG NKG+GF   +QLA +GV VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     AEAVRRYAVVTGANKGVGFGTVKQLASKGVVVVLTARDEKRGLEALEKLKDFGISDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN-ESALRASMGRV--LNFMRA  704
             H+LDVTD+++ + L  F+ T FG+LDILVNNA + G   N E+ + A+  +   +N+   
Sbjct  62    HQLDVTDSASAAVLADFVKTQFGKLDILVNNAAINGSVVNPEAFISAATAKPEEINWNEI  121

Query  703   IS-HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              +  NYEL+ EC++ NYYG+KR+TEA LPLLQ S SPRIVNV++G +KL +  N W K V
Sbjct  122   PTIPNYELAEECLKTNYYGTKRVTEALLPLLQLSDSPRIVNVSTGAAKLMNFPNGWPKEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    ++D V++ FLED K G    K WPP    Y VSKAA+NAY RI A KYP+
Sbjct  182   LSDAETLTEERIDSVLSGFLEDSKRGLQDIKIWPPVFPPYTVSKAALNAYTRILAKKYPN  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
               +NC +PG VKTD+++N G +T  EGA+SIVR+AL P  G +G++F  K++  F
Sbjct  242   FCINCGSPGFVKTDMSFNAGILTIDEGAESIVRLALLPNGGSTGLYFSRKEVAPF  296



>gb|KEH23343.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=286

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 205/283 (72%), Gaps = 7/283 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  R AVVTG NKGIGFE  + LA  GV V+LTAR+E KG+EA++KL+  GLSD V+F
Sbjct  2     AEAKLRNAVVTGSNKGIGFETVKMLASNGVKVMLTARDEKKGNEAIQKLKQFGLSDQVMF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVTD ++++SLV F+ T FGRLDILVNNAGV G+   E     ++G  +++ + ++ 
Sbjct  62    HQLDVTDPASITSLVEFVKTQFGRLDILVNNAGVSGVNPYE-----TVGSTVDWEK-LTQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
               +++  C+  NYYG K  TEAFL LL+ S SP+I+NV+S  + L++I N+WAK V +++
Sbjct  116   TSDMAENCLRTNYYGVKETTEAFLSLLKLSNSPKIINVSSQAALLQNIPNQWAKRVFDDI  175

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++D+V+ +F++D+K GS + KGWP  +S Y+VSKAA N+Y RI A KYP++ +N
Sbjct  176   ENLTEERIDKVLIEFIKDFKEGSLENKGWPTFLSTYIVSKAATNSYTRILAKKYPNMCIN  235

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             CV PG VKTD+  N G ++  +GA S+VR+AL P+  PSG+FF
Sbjct  236   CVCPGYVKTDLTKNIGMLSVDQGAASVVRLALLPDGSPSGLFF  278



>ref|XP_009138784.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Brassica 
rapa]
Length=297

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 210/296 (71%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNVL  878
             ++ + RYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EAVE LR    +S+  L
Sbjct  2     TEETPRYAVVTGANKGIGFEICRQLANNGIRVVLTSRDEKRGLEAVETLRRETEVSEQTL  61

Query  877   -FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRA  704
              FH+LDVTD ++++SL  F+   FG+LDIL+NNAGV G+  +  A+RA   +V  N+   
Sbjct  62    VFHQLDVTDPASITSLAQFVKAQFGKLDILINNAGVSGVIIDIDAMRAGKEKVDFNWEEN  121

Query  703   ISHN-YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
             I  N Y+L+ EC+ INYYG KRM EA +PLL+ S SPRI+NV+S   +L+++ NEWAKG+
Sbjct  122   IPENDYDLAKECLNINYYGPKRMCEALIPLLELSDSPRIINVSSFMGQLKNLLNEWAKGI  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    ++DEV++K L ++K+G  K K W   M+AYVVSKA++N Y RI A K+P 
Sbjct  182   LSDAENLTEERIDEVIDKLLNEFKDGVIKTKDWSKVMAAYVVSKASLNGYTRILAKKHPE  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             ++VN V PG V+TD+ +N G  + +EGA   VR+AL P ++ PSG FF+ K++  F
Sbjct  242   IRVNSVCPGVVRTDMTFNIGDFSVEEGASCPVRLALLPYQETPSGCFFNRKQLSEF  297



>gb|ACN87274.1| short chain dehydrogenase/reductase [Chelidonium majus]
Length=299

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/285 (51%), Positives = 204/285 (72%), Gaps = 8/285 (3%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             KR AVVTG NKGIGFEICRQLA   V VVLT+R+  +G++AV+ L+  G+S  V++H+LD
Sbjct  8     KRCAVVTGANKGIGFEICRQLASNDVLVVLTSRDTKRGTDAVQSLKDSGVS-GVVYHQLD  66

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLN---FMRAI  701
             VTD +TV+SL  FI T FG+LDILVNNAG+ G+  +   L A     G + +   F   +
Sbjct  67    VTDPTTVASLADFIKTQFGKLDILVNNAGIGGIEVDYDGLIALTRGDGELEDNPKFKEVM  126

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  +EL+ EC++ NYYG K +TE+ +P LQ S S R+VNV+S   ++++I NE A  +L+
Sbjct  127   TQTFELAEECLKTNYYGVKAVTESLIPFLQLSDSARVVNVSSSMGQMKNISNEKAIEILS  186

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             +V      +++E++N++L+D+K    + KGWP  +SAY +SKAA+NAY RI A K+P+ +
Sbjct  187   DVAGLTEERIEELMNEYLKDFKEDLIETKGWPTKLSAYAISKAALNAYTRILAKKFPTYR  246

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             +NCV PG VKTDINYNTG +T +EGA S VR+AL P+DGPSG+FF
Sbjct  247   INCVCPGFVKTDINYNTGVLTVEEGAASPVRLALLPDDGPSGLFF  291



>ref|XP_008343394.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=293

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 207/292 (71%), Gaps = 6/292 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ASKRYAVVTG NKG+GF I +QLA  GV VVLTAR+E +G EAVEKL+  GLS+ V+F
Sbjct  2     AEASKRYAVVTGANKGVGFGIVKQLASNGVIVVLTARDEKRGLEAVEKLKDFGLSELVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFMR  707
             H+LDVTD+++ SSL  F+ T F +LDILVNNAG+ G   +  + R+++       ++F  
Sbjct  62    HQLDVTDSASNSSLAGFVKTQFAKLDILVNNAGINGSIVDPESFRSAVSGKKPEEIDFSE  121

Query  706   -AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
              + + NYEL+ EC++ NYYG+K +TEA LPLLQ S SPRIVNV+S  +KL +  N   K 
Sbjct  122   ISTTPNYELAEECLKTNYYGAKSVTEALLPLLQLSDSPRIVNVSSLLAKLTNFPNGRTKE  181

Query  529   VLNNVE-SPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E     +++ V+++FLEDYK+   + KGW     AY VSKAA+NAY RI A KYP
Sbjct  182   VLSDAEIITEERIEAVLSEFLEDYKHDLLETKGWSHIFPAYKVSKAALNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKK  197
             +  +NC +PG VKTD+++N G +T  EGA+SIVR+AL P  GP+G++   KK
Sbjct  242   NFCINCGSPGLVKTDMSFNLGVLTIDEGAESIVRLALLPNGGPTGLYLSAKK  293



>ref|XP_010053676.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Eucalyptus 
grandis]
Length=290

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 206/287 (72%), Gaps = 11/287 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++++KRYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EAV+KL+  GLSD ++F
Sbjct  2     AESTKRYAVVTGANKGIGFEICRQLASSGIVVVLTSRDEKRGLEAVQKLKDSGLSDYIIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMR  707
             H+LDVT+ S+V SL +FI T F +LDILVNNAGVIG   NE A RAS        +++ +
Sbjct  62    HQLDVTNLSSVLSLANFIETQFRKLDILVNNAGVIGATINEEAFRASNYLKDAAKVDWSK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              +  +YE +  CI+ NYYG+KRM EA + LLQ+S SPRIVNV+S   KL+ + +E A+ V
Sbjct  122   ILVPSYEAAEVCIDTNYYGAKRMVEAHISLLQRSDSPRIVNVSSIIGKLQYVSSECAEEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L+++E+    K+DEVV  +LED+K  ++      P   AY++SKAA+NAY RI A K+P 
Sbjct  182   LSDIENLTEEKVDEVVQIYLEDFKKDTS---AVTP---AYIMSKAALNAYTRILARKFPG  235

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
               +NCV PGNV+TDIN + G ++ +EGA+S V++AL P  G +G FF
Sbjct  236   FCINCVCPGNVRTDINQHIGVLSVEEGAESPVKLALLPSGGVTGCFF  282



>ref|XP_007135015.1| hypothetical protein PHAVU_010G094800g [Phaseolus vulgaris]
 ref|XP_007135016.1| hypothetical protein PHAVU_010G094800g [Phaseolus vulgaris]
 gb|ESW07009.1| hypothetical protein PHAVU_010G094800g [Phaseolus vulgaris]
 gb|ESW07010.1| hypothetical protein PHAVU_010G094800g [Phaseolus vulgaris]
Length=299

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 204/297 (69%), Gaps = 8/297 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A+E L+   LS  VLFH
Sbjct  3     EATQRYAVVTGANKGIGLEIVRQLASTGIKVVLTARNEERGLQALETLKASALSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVL---NFM  710
             +LDV DA+TV+SL  FI + FG+LDIL+NNAG+ G    +S L + +   G V+   +  
Sbjct  63    QLDVADAATVASLADFIKSKFGKLDILINNAGISGGVIKDSDLISKVIMNGGVVSEEDGT  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE-WAK  533
              A++  YEL+ EC++INYYG+K   EA  PLLQ S SP IVNV+S   +L++   E WA+
Sbjct  123   NAMTQTYELAEECLQINYYGTKITVEALKPLLQLSDSPTIVNVSSSMGQLKNFPEESWAR  182

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GVL++ ++    K+DE+V KFL D+K GS + +GWP +  AY+VSKAAMN Y RI A K+
Sbjct  183   GVLSDGDNLTEEKVDEIVKKFLRDFKEGSLESEGWPRYPGAYIVSKAAMNGYTRILAKKH  242

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PS  +N V PG VKTDI  NTG +T +EGA S V++AL P   PSG F+    + +F
Sbjct  243   PSFCINSVCPGYVKTDITSNTGLLTVEEGAASPVKLALLPNGTPSGFFYYRTHVASF  299



>ref|XP_007212966.1| hypothetical protein PRUPE_ppa021111mg, partial [Prunus persica]
 gb|EMJ14165.1| hypothetical protein PRUPE_ppa021111mg, partial [Prunus persica]
Length=290

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/290 (53%), Positives = 198/290 (68%), Gaps = 6/290 (2%)
 Frame = -1

Query  1036  YAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVT  857
             YAVVTG NKG+GF   +QLA  GVTVVLTAR+E +G EAV+KL+  GLSD V+FH+LDVT
Sbjct  1     YAVVTGANKGVGFGTVKQLASNGVTVVLTARDEKRGLEAVDKLKEFGLSDLVVFHQLDVT  60

Query  856   DASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-GRVLNFMR----AISHN  692
             D S+++SL  F+ T FG+LDILVNNA + G   N    R+++ G+    +R        N
Sbjct  61    DPSSITSLADFVKTQFGKLDILVNNAAIAGSQVNPEDFRSAVSGKKPEEIRWREIPTIPN  120

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             Y+L+ E ++ NYYG+K +TEA LPLLQ S SPRIVNV+SG SKL +  N WAK VL++ E
Sbjct  121   YKLAEESLKTNYYGTKGVTEALLPLLQLSDSPRIVNVSSGVSKLMNFPNGWAKEVLSDAE  180

Query  511   S-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
             S    ++D V+ + LED K G  + K WP     Y VSKAA+NAY RI A KY +  +NC
Sbjct  181   SLTEERIDAVLAEHLEDLKQGLVENKSWPTIFPPYTVSKAAVNAYTRILAKKYTNFYINC  240

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             VNPG V TDI +NTG +T +EGA+S+V +AL P  GP+G FF  K+   F
Sbjct  241   VNPGFVNTDITFNTGTLTIEEGAESLVWLALLPNGGPTGHFFSRKEATPF  290



>gb|KEH18922.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 203/289 (70%), Gaps = 7/289 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+  YAVVTG NKGIGF +C QLA +G+TVVLTAR+E +G EAVEKL+ + L   V+F
Sbjct  2     AEATTTYAVVTGANKGIGFAVCNQLASKGITVVLTARDEKRGLEAVEKLKHLSLPGLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMR  707
             H+LDV DA+++ S V FI   FG+LDILVNNAG+ G   +  AL A+     G  +++ +
Sbjct  62    HQLDVIDAASIRSFVDFIKNQFGKLDILVNNAGITGAEVDGEALVAANIEENGGQIDWSK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              I+  YE +   I+ NYYG+K +TEAF+PLLQ S SP++VNV+S   KLE++ N W K V
Sbjct  122   IITQTYEQTELGIKTNYYGAKDLTEAFIPLLQLSSSPKVVNVSSSMGKLENLPNGWPKEV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPH--MSAYVVSKAAMNAYARITAHKY  356
              ++VE+    K+DEV+NKFL D+  GS +  GWP +  MS Y++SKA++ AY  + A KY
Sbjct  182   FSDVENLIEEKIDEVLNKFLNDFNEGSLENNGWPINNDMSTYIISKASLIAYTSVVAIKY  241

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             PS+ +N V PG VKTDINYNTG +T  EGA+SIV +AL  +  PSG FF
Sbjct  242   PSICINVVCPGFVKTDINYNTGYLTPDEGAESIVNLALLHDGSPSGHFF  290



>ref|XP_010053675.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Eucalyptus 
grandis]
Length=292

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 206/289 (71%), Gaps = 13/289 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++++KRYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EAV+KL+  GLSD ++F
Sbjct  2     AESTKRYAVVTGANKGIGFEICRQLASSGIVVVLTSRDEKRGLEAVQKLKDSGLSDYIIF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS------MGRVLNF  713
             H+LDVT+ S+V SL +FI T F +LDILVNNAGVIG   NE A RAS          +++
Sbjct  62    HQLDVTNLSSVLSLANFIETQFRKLDILVNNAGVIGATINEEAFRASNYLKEQDAAKVDW  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + +  +YE +  CI+ NYYG+KRM EA + LLQ+S SPRIVNV+S   KL+ + +E A+
Sbjct  122   SKILVPSYEAAEVCIDTNYYGAKRMVEAHISLLQRSDSPRIVNVSSIIGKLQYVSSECAE  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL+++E+    K+DEVV  +LED+K  ++      P   AY++SKAA+NAY RI A K+
Sbjct  182   EVLSDIENLTEEKVDEVVQIYLEDFKKDTS---AVTP---AYIMSKAALNAYTRILARKF  235

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P   +NCV PGNV+TDIN + G ++ +EGA+S V++AL P  G +G FF
Sbjct  236   PGFCINCVCPGNVRTDINQHIGVLSVEEGAESPVKLALLPSGGVTGCFF  284



>ref|XP_009138783.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Brassica 
rapa]
Length=298

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 210/297 (71%), Gaps = 7/297 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNVL  878
             ++ + RYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EAVE LR    +S+  L
Sbjct  2     TEETPRYAVVTGANKGIGFEICRQLANNGIRVVLTSRDEKRGLEAVETLRRETEVSEQTL  61

Query  877   -FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF---M  710
              FH+LDVTD ++++SL  F+   FG+LDIL+NNAGV G+  +  A+RA   + ++F    
Sbjct  62    VFHQLDVTDPASITSLAQFVKAQFGKLDILINNAGVSGVIIDIDAMRAGKEKQVDFNWEE  121

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
                 ++Y+L+ EC+ INYYG KRM EA +PLL+ S SPRI+NV+S   +L+++ NEWAKG
Sbjct  122   NIPENDYDLAKECLNINYYGPKRMCEALIPLLELSDSPRIINVSSFMGQLKNLLNEWAKG  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             +L++ E+    ++DEV++K L ++K+G  K K W   M+AYVVSKA++N Y RI A K+P
Sbjct  182   ILSDAENLTEERIDEVIDKLLNEFKDGVIKTKDWSKVMAAYVVSKASLNGYTRILAKKHP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
              ++VN V PG V+TD+ +N G  + +EGA   VR+AL P ++ PSG FF+ K++  F
Sbjct  242   EIRVNSVCPGVVRTDMTFNIGDFSVEEGASCPVRLALLPYQETPSGCFFNRKQLSEF  298



>ref|XP_007135017.1| hypothetical protein PHAVU_010G094900g [Phaseolus vulgaris]
 ref|XP_007135018.1| hypothetical protein PHAVU_010G094900g [Phaseolus vulgaris]
 gb|ESW07011.1| hypothetical protein PHAVU_010G094900g [Phaseolus vulgaris]
 gb|ESW07012.1| hypothetical protein PHAVU_010G094900g [Phaseolus vulgaris]
Length=299

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 202/299 (68%), Gaps = 12/299 (4%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +AS+RYAVVTG NKGIG EI +QLA  G+ VVLTARNE +G  A+E ++   LS  V+FH
Sbjct  3     EASERYAVVTGANKGIGLEIVKQLASAGIKVVLTARNEERGLHAMETIKASALSHLVMFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-------  713
              LDV DA+TV+SL  FI + FG+LDILVNNAG+ G    +  +  S+  +LN        
Sbjct  63    HLDVADATTVASLADFIKSKFGKLDILVNNAGIGGAVIKDIDIFPSV--LLNRGIVSEED  120

Query  712   -MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE-W  539
               +A++  YEL+ EC++INYYG+K   EA +PLLQ S SP IVNV+S   +LES   E W
Sbjct  121   GTKAMTQTYELAEECLQINYYGTKITVEALMPLLQLSDSPTIVNVSSTMGQLESFPKESW  180

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
             A+GVL++ ++    K+DE+V KFL D+K GS + +GWP +  AY+VSKAAMN Y RI A 
Sbjct  181   ARGVLSDGDNLTEEKVDEIVKKFLRDFKEGSLESEGWPRYPGAYIVSKAAMNGYTRILAK  240

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             K+PS  +N V PG VKTDI  NTG +T +EGA S V++AL P   PSG F+    + +F
Sbjct  241   KHPSFCINSVCPGYVKTDITSNTGLLTVEEGAASPVKLALLPNGTPSGFFYYRTHVASF  299



>ref|XP_008232813.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Prunus mume]
Length=346

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 195/274 (71%), Gaps = 6/274 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIGF   +QLA  GVTVVLTAR+E +G EAV+KL+  GLSD V+F
Sbjct  2     AEATKRYAVVTGANKGIGFGTVKQLASNGVTVVLTARDEKRGVEAVDKLKEFGLSDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM-GRVLNFMR---  707
             H+LDVTD S+++SL  F+ T FG+LDILVNNAG+IG        R+++ G+    +R   
Sbjct  62    HQLDVTDPSSITSLADFVKTQFGKLDILVNNAGMIGNQIKPEDFRSAVSGKKPEEIRWNA  121

Query  706   -AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
                + NY+L+ E ++ NYYG+KR+TEA LPLLQ S SPRIVNV+SG SKL    N WAK 
Sbjct  122   IPTAPNYKLAEEGLKTNYYGTKRVTEALLPLLQLSDSPRIVNVSSGISKLVIFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ ES    ++D V+ + LED K G  + K WP     Y VSKAA+NAY RI A KYP
Sbjct  182   VLSDAESLTEERIDAVLAELLEDLKQGLVENKSWPTIFPPYTVSKAAVNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVR  251
             +  +NCV PG VKTDI +NTG +T +EGA+S+VR
Sbjct  242   NFYINCVCPGFVKTDITFNTGTLTIEEGAESLVR  275



>gb|KHG24614.1| hypothetical protein F383_06242 [Gossypium arboreum]
Length=713

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 208/295 (71%), Gaps = 9/295 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+KR AVVTG NKGIGFE+CR LA +G+ VVLT+R+E +G EA  KL+  GLS +++FH+
Sbjct  9     AAKRVAVVTGANKGIGFELCRNLASKGIMVVLTSRDEKRGLEAFAKLKDSGLSHHLVFHQ  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF--------  713
             LDVT  S+++SLV ++ + FG+LD+LVNNAG  G   ++ A   +      F        
Sbjct  69    LDVTVPSSIASLVDYVKSKFGKLDLLVNNAGTFGAILHQQAFVKATELAGYFPSEEQASE  128

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                 +  +EL+ EC+E NYYG+KRM EAF+PLL  S SPRIVNV+S    L++I ++WAK
Sbjct  129   YEIATQTFELAQECLETNYYGAKRMVEAFVPLLHLSDSPRIVNVSSIMGLLKNIPSQWAK  188

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL++ ES    ++DEV+ +FL+D+K GS K++GWP + SAY +SKAAMNAY RI A+KY
Sbjct  189   EVLSDAESVTEEQVDEVLKQFLKDFKEGSLKDQGWPIYFSAYTLSKAAMNAYTRIVANKY  248

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             PS  VN + PG VKTDI  NTG +TA EGA+++ R+AL   DGPSG FF  K+++
Sbjct  249   PSFLVNSIGPGFVKTDITCNTGVLTAAEGAENVARLALLSNDGPSGHFFLRKELM  303



>emb|CDX90062.1| BnaA10g00200D [Brassica napus]
Length=295

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 200/287 (70%), Gaps = 6/287 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL-RGVGLSDN-VLF  875
             A  R AVV+G NKGIGFEICRQLA  G+TV+LTAR+E KG EAVEKL R  G SD  +LF
Sbjct  2     AESRVAVVSGSNKGIGFEICRQLAKNGMTVILTARDEKKGLEAVEKLKRENGFSDQAILF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRA  704
             H LDV++  +++SL  F+ T FG+LD+LVNNAGV G   N   L+A +   G   +  + 
Sbjct  62    HLLDVSNPDSIASLASFVKTRFGKLDVLVNNAGVGGANVNVDVLKAQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  E I  NYYG KRM EA +PLL+ S SPRIV++ S    L+++ NEWAKGVL
Sbjct  122   MSDTYEIVEEAIRTNYYGVKRMCEAMIPLLEASDSPRIVSIASTMGMLQNVSNEWAKGVL  181

Query  523   NNVESPP-GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
              + E+    K+DEV+N++L+DY+ GS ++KGWP  MS Y++SKA + A  R+ A +  S+
Sbjct  182   GDAENLTLEKIDEVMNEYLKDYREGSLQDKGWPTVMSGYILSKAGVIALTRVLAKQNKSI  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +NCV PG V T+IN+NTG +T +EGA S V++AL  +  PSG+FFD
Sbjct  242   IINCVCPGFVNTEINFNTGILTVEEGAASPVKLALVADGHPSGLFFD  288



>ref|XP_008353983.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=295

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 202/296 (68%), Gaps = 8/296 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             +D  KRYAVVTG NKGIGF   +QLA  G+ VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     ADTVKRYAVVTGANKGIGFGTVKQLASNGIVVVLTARDEKRGLEALEKLKDFGISDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG-LAANESALRASMGR---VLNFMR  707
             H+LDVTD+ + + L  F+ T FG+LDILVNNA V+G +   E    AS G+    +N+  
Sbjct  62    HQLDVTDSVSAARLADFVKTQFGKLDILVNNAAVVGSIVTPEDFKSASSGKRXEEINWSE  121

Query  706   AIS-HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               +  N E++ +C++ NYYG+K +TEA LPLLQ S SPRIVNV+SG  KL +  N WAK 
Sbjct  122   IPTIPNDEVAEQCLKTNYYGTKSVTEALLPLLQLSDSPRIVNVSSGVGKLMNFPNGWAKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E     K+D V+ +FLED K G TK   W P    Y VSKAA+NAY RI A KYP
Sbjct  182   VLSDAERLTEEKIDSVLIRFLEDLKKGDTKI--WSPIFPPYTVSKAALNAYTRILAKKYP  239

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NCV+PG VKTDI +N G +T  EGA+S+VR+ L P  GP+G+ F  K++ +F
Sbjct  240   NFCINCVSPGFVKTDITFNVGILTIDEGAESLVRLXLLPNGGPTGLXFXQKEVASF  295



>gb|KCW78035.1| hypothetical protein EUGRSUZ_D02259 [Eucalyptus grandis]
Length=337

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 206/289 (71%), Gaps = 13/289 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++++KRYAVVTG NKGIGFEICRQLA  G+ VVLT+R+E +G EAV+KL+  GLSD ++F
Sbjct  47    AESTKRYAVVTGANKGIGFEICRQLASSGIVVVLTSRDEKRGLEAVQKLKDSGLSDYIIF  106

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS------MGRVLNF  713
             H+LDVT+ S+V SL +FI T F +LDILVNNAGVIG   NE A RAS          +++
Sbjct  107   HQLDVTNLSSVLSLANFIETQFRKLDILVNNAGVIGATINEEAFRASNYLKEQDAAKVDW  166

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + +  +YE +  CI+ NYYG+KRM EA + LLQ+S SPRIVNV+S   KL+ + +E A+
Sbjct  167   SKILVPSYEAAEVCIDTNYYGAKRMVEAHISLLQRSDSPRIVNVSSIIGKLQYVSSECAE  226

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL+++E+    K+DEVV  +LED+K  ++      P   AY++SKAA+NAY RI A K+
Sbjct  227   EVLSDIENLTEEKVDEVVQIYLEDFKKDTS---AVTP---AYIMSKAALNAYTRILARKF  280

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             P   +NCV PGNV+TDIN + G ++ +EGA+S V++AL P  G +G FF
Sbjct  281   PGFCINCVCPGNVRTDINQHIGVLSVEEGAESPVKLALLPSGGVTGCFF  329



>ref|XP_003600309.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02072.2| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=299

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/298 (50%), Positives = 202/298 (68%), Gaps = 10/298 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + +KRYAVVTG NKGIGFEI +QLA  G+ VVLTAR+E +G  A++ L+  GLSD V FH
Sbjct  3     ETAKRYAVVTGANKGIGFEIVKQLASAGIKVVLTARDEKRGLHALQTLKAYGLSDFVAFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESAL-------RASMGRVLNF  713
             +LDV D ++V+SL  F+ + FG+LDILVNNAG+IG    +  L       R ++    N 
Sbjct  63    QLDVADDASVASLADFVKSQFGKLDILVNNAGIIGTIIKDKELINLAIYNRGALSND-NR  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              +A++  YEL+ EC++ NYYG+K  TE+ LPLLQ S SPRIVNV+S   +LESI + W K
Sbjct  122   RKAMTQTYELAEECLQTNYYGAKITTESLLPLLQLSDSPRIVNVSSTLGQLESIPDGWPK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTK-EKGWPPHMSAYVVSKAAMNAYARITAHK  359
                +  ++    K+DEV+ KFLED+KNG    + GWP  + AY++SKAAMNAY RI A K
Sbjct  182   RFFSEADNLTEEKVDEVLKKFLEDFKNGLLDYDNGWPKTLGAYIISKAAMNAYTRILAKK  241

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +P++ +N V PG   TDI  N G +T +EGA S+V++AL P  G SG+FF   ++ +F
Sbjct  242   FPTICINSVCPGYTITDITANNGLLTVEEGAVSVVKLALIPNGGTSGMFFYRTEVSSF  299



>ref|XP_010053672.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW78031.1| hypothetical protein EUGRSUZ_D02256 [Eucalyptus grandis]
Length=318

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 202/296 (68%), Gaps = 11/296 (4%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDN-VLF  875
             ASKRYAVVTG NKGIGFEICRQLA  GVTVV TAR+E +G +A  +L+   GLS   V+F
Sbjct  8     ASKRYAVVTGSNKGIGFEICRQLASTGVTVVFTARDEKRGLQAARELQNNAGLSAGAVVF  67

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLN-------  716
             H+LDV D ++VSSLV F+ T FG+LDILVNNAG+ G   + +A+  ++ R          
Sbjct  68    HQLDVADPASVSSLVGFVATQFGKLDILVNNAGIGGHIMDRNAMSEAVERAGGDFPFGEE  127

Query  715   -FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEW  539
              + +  + +Y ++ EC+  NYYG+K +TEA LPLL+ S SPRIVNV+S    LE I  EW
Sbjct  128   VWKKISTEDYGMAEECVRTNYYGAKLVTEALLPLLRLSDSPRIVNVSSTLGTLELIPGEW  187

Query  538   AKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAH  362
              K VL +VE+    ++DEV+  FL+D+K G   ++GWP H+SAY VSKAA+NAY RI A 
Sbjct  188   PKQVLGDVETLTEERVDEVLESFLQDFKEGDFGKRGWPTHISAYKVSKAALNAYTRIMAK  247

Query  361   KYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             K PS  VN V PG V TDI  NTG +T  +GA+S V +AL P+ G SG+FF  K++
Sbjct  248   KLPSFLVNSVCPGFVNTDITCNTGPLTPPQGAESPVWLALLPQGGLSGLFFHRKQV  303



>ref|XP_009119740.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Brassica 
rapa]
Length=295

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 199/287 (69%), Gaps = 6/287 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL-RGVGLSDN-VLF  875
             A  R AVV+G NKGIGFEICRQLA  G+TV+LTAR+E KG EAVEKL R  G SD  +LF
Sbjct  2     AESRVAVVSGSNKGIGFEICRQLAKNGMTVILTARDEKKGLEAVEKLKRENGFSDQAILF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR---ASMGRVLNFMRA  704
             H LDV++  +++SL  F+ T FG+LD+LVNNAGV G   N   L+   A  G   +  + 
Sbjct  62    HLLDVSNPDSIASLASFVKTRFGKLDVLVNNAGVGGANVNVDVLKSQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  E I  NYYG KRM EA +PLL+ S SPRIV++ S    L+++ NEWAKGVL
Sbjct  122   MSDTYEIVEEAIRTNYYGVKRMCEAMIPLLEASDSPRIVSIASTMGMLQNVSNEWAKGVL  181

Query  523   NNVESPP-GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
              + E+    K+DEV+N++L+DY+ GS ++KGWP  MS Y++SKA + A  R+ A +  S+
Sbjct  182   GDGENLTLEKIDEVMNEYLKDYREGSLQDKGWPTVMSGYILSKAGVIALTRVLAKQNKSI  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +NCV PG V T+IN+NTG +T +EGA S V++AL P   PSG+FFD
Sbjct  242   IINCVCPGFVNTEINFNTGILTVEEGAASPVKLALVPNGHPSGLFFD  288



>ref|XP_007218771.1| hypothetical protein PRUPE_ppa009526mg [Prunus persica]
 gb|EMJ19970.1| hypothetical protein PRUPE_ppa009526mg [Prunus persica]
Length=288

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 196/289 (68%), Gaps = 17/289 (6%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+G E  RQLA  G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGMGLETVRQLASNGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA-----SMGR-VLNF  713
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A +A     +M R  ++ 
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIYGSILDGDAFKAVIASGAMERGEVDL  121

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
              + ++  YE + EC++INYYG+KR  EA +PLLQ S SPRIVNV+SG  KL +I ++WAK
Sbjct  122   SKLVTETYEFAEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGAGKLNNIPSDWAK  181

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
             GV  + ++    ++DE           GS + KGWP  M AY VSKAA+NAY RI A KY
Sbjct  182   GVFTDAKNLTEERVDE----------EGSLESKGWPSSMPAYTVSKAALNAYTRILAKKY  231

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              + ++N V PG VKTDIN N G +  +EG   IV++AL P DGP+G FF
Sbjct  232   LNFRINSVCPGFVKTDINCNAGVLPVEEGGARIVKLALLPSDGPTGSFF  280



>emb|CDY15148.1| BnaC05g00270D [Brassica napus]
Length=295

 Score =   290 bits (741),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 200/287 (70%), Gaps = 6/287 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL-RGVGLSDN-VLF  875
             A  R AVV+G NKGIGFEICRQLA  G+TV+LTAR+E KG EAVEKL R  G SD  +LF
Sbjct  2     ADSRVAVVSGSNKGIGFEICRQLAKNGMTVILTARDEKKGLEAVEKLKRENGFSDQAILF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR---ASMGRVLNFMRA  704
             H LDV++  +++SL  F+ ++FG+LDILVNNAGV G   N   L+   A  G   +  + 
Sbjct  62    HLLDVSNPDSIASLASFVKSHFGKLDILVNNAGVGGANVNVDVLKSQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  E I  NYYG KRM EA +PLL+ S SPRIV++ S    L+++ NEWAKGVL
Sbjct  122   MSDTYEIVEEAIRTNYYGVKRMCEAMIPLLEASDSPRIVSIASTMGMLQNVSNEWAKGVL  181

Query  523   NNVESPP-GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
              + E+    K+DEV+N++L+DY+ GS ++KGWP  MS Y++SKA + A  R+ A +  ++
Sbjct  182   GDAENLTLEKIDEVMNEYLKDYREGSLQDKGWPTVMSGYILSKAGVIALTRVLAKQNKTI  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +NCV PG V T+IN+NTG +T +EGA S V++AL P   PSG+FFD
Sbjct  242   IINCVCPGFVNTEINFNTGILTVEEGAASPVKLALVPNGHPSGLFFD  288



>gb|KCW78042.1| hypothetical protein EUGRSUZ_D02266, partial [Eucalyptus grandis]
Length=270

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 196/269 (73%), Gaps = 4/269 (1%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR--GVGLSDNVL  878
             +A++R AVVTG NKGIG E  +QLA  G+ V+LTAR+E +G EA++KL+      S+ V+
Sbjct  3     EAARRLAVVTGANKGIGLETVKQLASNGIRVILTARDEKRGLEALDKLKESDCLFSELVV  62

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAIS  698
             FH+LDVTD ++++SL +FI TNFG+LDILVNNAG++G+  +  AL A+  R  ++ +  S
Sbjct  63    FHQLDVTDLASITSLANFIRTNFGKLDILVNNAGIVGVRVDTDALYANGVRT-HWTKLRS  121

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               Y+L+ +CI  NYYG++R  EA +PLLQ S SP+IVNV+S   KLE+I NEWA  +L++
Sbjct  122   ETYDLAVDCITTNYYGARRTAEALMPLLQLSDSPKIVNVSSFMGKLENIQNEWANAILSD  181

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              ES    ++DEV+N+FL D+K GS + KGWP  +SA  +SKAAMNA+ RI A KYP   +
Sbjct  182   AESLTEEQIDEVLNQFLRDFKEGSLQTKGWPTFLSANTMSKAAMNAFTRILARKYPRFCI  241

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIV  254
             N V PG V+TDINYN+G +T +EGA+S V
Sbjct  242   NSVCPGFVQTDINYNSGILTVEEGAKSAV  270



>ref|XP_010474804.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Camelina 
sativa]
Length=295

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 197/287 (69%), Gaps = 6/287 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVG-LSDNVL-F  875
             A  R AVVTG NKGIG EICRQLA  G+ V+LTAR+E KG  AVEKL+     SD  + F
Sbjct  2     ADTRVAVVTGSNKGIGLEICRQLAKNGINVILTARDEKKGIAAVEKLKAENCFSDQAISF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRA  704
             H LDV+   T++SL  F+ T FG+LDILVNNAGV G   N   L+A +   G   +  + 
Sbjct  62    HLLDVSIPDTIASLALFLKTRFGKLDILVNNAGVGGANVNVHVLKAQIAEAGAPTDISKI  121

Query  703   ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVL  524
             +S  YE+  EC+  NYYG KRM EA +PLLQ S SPRIV + S   KLE++ NEWAKGVL
Sbjct  122   MSDTYEIVEECVTTNYYGVKRMCEAMIPLLQSSASPRIVTIASTMGKLENVSNEWAKGVL  181

Query  523   NNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             ++ E+    K+DEV++++L+DY+ GS + KGWP  MSAY++SKAA+ A  R+ A +  S+
Sbjct  182   SDAENLTEEKIDEVMDEYLKDYRQGSLEAKGWPKVMSAYILSKAAVMALTRVLAKRNKSM  241

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              +N V PG VKTDIN+NTG ++ ++GA S V++AL P   PSG+F+D
Sbjct  242   IINSVCPGFVKTDINFNTGILSVEQGAASPVKLALVPNGDPSGLFYD  288



>ref|XP_008778203.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Phoenix dactylifera]
Length=307

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/303 (50%), Positives = 208/303 (69%), Gaps = 13/303 (4%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVL  878
             +S   KR AVVTGGNKGIG EICRQLA  GVTV+LTAR+E +G EAVEK++  GL D VL
Sbjct  6     SSPTEKRIAVVTGGNKGIGLEICRQLALNGVTVILTARDEKRGQEAVEKIKECGLYD-VL  64

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----------MG  728
             FH+LD+TD+++++SL  F+ T FG+LDILVNNAG+ GL  +  AL+AS          + 
Sbjct  65    FHQLDMTDSTSIASLADFVETEFGKLDILVNNAGIGGLTMDVEALKASKQSNNVEAKDVR  124

Query  727   RVLNFMRA-ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI  551
              + ++ +  +    E + EC + NYYG++ +TEA +PLL+QS S R+VNV+S   +L  I
Sbjct  125   DIPDWWKPHMRETLERAEECFKTNYYGTRDVTEALIPLLRQSISGRVVNVSSIVGQLRVI  184

Query  550   HNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYAR  374
              NE  K  L+NV++    +L E++N F++D+K G     GWP   SAY +SK  +NAY R
Sbjct  185   SNEKLKQDLSNVDALTEERLVELLNLFIKDFKEGLLDAHGWPTVTSAYKLSKVLINAYTR  244

Query  373   ITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             I A KYP+L +NCV+PG VKTD+N+NTG ++ KEGA+  V +ALQ   GPSG+FFD  ++
Sbjct  245   ILAKKYPALCINCVSPGFVKTDLNWNTGILSTKEGAEGPVMLALQTGTGPSGLFFDQTEV  304

Query  193   IAF  185
               F
Sbjct  305   STF  307



>ref|XP_003521180.2| PREDICTED: (+)-neomenthol dehydrogenase-like isoform 2 [Glycine 
max]
Length=298

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/296 (50%), Positives = 208/296 (70%), Gaps = 7/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL-RGVGLSDNVL  878
             +DA +RYAVVTG NKGIG E  + LA  G+ VVLTAR+  +G +AVE+L R  G SD V+
Sbjct  4     ADAKQRYAVVTGANKGIGLETVKGLASNGIKVVLTARDVKRGYQAVEELKREFGFSDLVV  63

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFM  710
             FH+LDVTD S+V+SLV F+   FGRLDILVNNAG+ G+  N+     + G      +N+ 
Sbjct  64    FHQLDVTDPSSVASLVEFVKIKFGRLDILVNNAGIRGILKNDLGFLFTPGFGCHPKINW-  122

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
             + +   YE++ +C+  NYYG+K  TEAF+PLLQ S  P IVNV+S    L+ I NEWA+ 
Sbjct  123   KELPQTYEMAEKCLTTNYYGAKETTEAFIPLLQLSNLPMIVNVSSEAGLLKYISNEWARS  182

Query  529   VLNNVESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E+   +L DEV+ ++++D  +G  ++KGWP ++SAY+VSKAAMN+Y R+ A+++ 
Sbjct  183   VLDDTENLTEELIDEVLKEYMKDLDDGLLEKKGWPTYLSAYMVSKAAMNSYTRLLAYRHQ  242

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              L +NCV PG+VKTDIN NTG ++ + GA S+VR+AL P   PSG FF  +++ +F
Sbjct  243   KLCINCVCPGSVKTDINRNTGILSVENGAASVVRLALLPNGSPSGHFFTRQEVSSF  298



>gb|KHG17192.1| (+)-neomenthol dehydrogenase -like protein [Gossypium arboreum]
Length=290

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 197/286 (69%), Gaps = 11/286 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKG+G EIC+QLA  G+ VVLTAR+E +G EA+E L+  GLSD ++F
Sbjct  2     TEATKRYAVVTGANKGVGLEICKQLAQNGIMVVLTARDEKRGLEALESLKHSGLSDYLVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLN----FMR  707
             H+LDV D  +++SL  F+   FG+LDILVNNA ++G     +    + G  +N    + +
Sbjct  62    HQLDVADPKSIASLADFLKKQFGKLDILVNNAAILG-----ATFSIAPGTEVNSRDIWSK  116

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
             A   NYEL+ EC++ NYYG+KR  EA +PLLQ S  PRIVNV+S    L+    E  KGV
Sbjct  117   ATDDNYELAEECLKTNYYGAKRTAEALIPLLQLSDLPRIVNVSSSVVMLKG-KGEKLKGV  175

Query  526   LNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSL  347
             L  V +   KL++++ ++L+D+K G    KGWP  +SAY VSK A+NAY RI A+KYP  
Sbjct  176   LTGVTTDE-KLNDLITEYLKDFKEGLHGSKGWPTFISAYTVSKVALNAYTRILANKYPDF  234

Query  346   QVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              +N V PG  KTDIN NTG ITA+EGA + V++AL P+ GPSG+FF
Sbjct  235   CINSVCPGYAKTDINLNTGTITAEEGAVTPVKLALLPKGGPSGLFF  280



>gb|ABC88670.1| (-)-menthone:(+)-neomenthol reductase [Mentha x piperita]
Length=320

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 198/301 (66%), Gaps = 21/301 (7%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL---RGVGLSDNVL  878
             A+KRYAVVTG NKGIGFEIC+QLA +G+TV+L +R+E +G EA E+L    G    D V+
Sbjct  11    ATKRYAVVTGANKGIGFEICKQLASKGITVILASRDEKRGIEARERLIKELGSEFGDYVV  70

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG--LAANESALRASMGRVLNFMRA  704
               +LDV D ++V++LV FI T FG LDILVNNAG+ G  +  + S L   +       ++
Sbjct  71    SQQLDVADPASVAALVDFIKTKFGSLDILVNNAGLNGTYMEGDASVLNDYVEAEFKTFQS  130

Query  703   ---------------ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGW  569
                            +    E + ECIE NYYGSKR+TEA +PLLQQS SPRIVNV+S  
Sbjct  131   GAAKTEPYHPKATGRLVETVEHAKECIETNYYGSKRVTEALIPLLQQSDSPRIVNVSSTL  190

Query  568   SKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAA  392
             S L    NEWAKGV ++ E     KL+EV+ +FL+D+ +G  +EK WPPH SAY VSKAA
Sbjct  191   SSLVFQTNEWAKGVFSSEEGLTEEKLEEVLAEFLKDFIDGKQQEKQWPPHFSAYKVSKAA  250

Query  391   MNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVF  212
             +NAY RI A KYPS ++N V PG  KTD++Y  G+ T  E A++ V++AL P+ GPSG F
Sbjct  251   LNAYTRIIAKKYPSFRINAVCPGYTKTDLSYGHGQFTDAEAAEAPVKLALLPQGGPSGCF  310

Query  211   F  209
             F
Sbjct  311   F  311



>gb|KEH18923.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=294

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/282 (52%), Positives = 198/282 (70%), Gaps = 7/282 (2%)
 Frame = -1

Query  1036  YAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVT  857
             YAVVTG NKGIGF +C QLA +G+TVVLTAR+E +G EAVEKL+ + L   V+F +LDV 
Sbjct  6     YAVVTGANKGIGFAVCNQLASKGITVVLTARDEKRGLEAVEKLKQLSLPGLVVFQQLDVI  65

Query  856   DASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM----GRVLNFMRAISHNY  689
             D +++ S V FI   FG+LDILVNNAG+ G   +  AL A+     G  +++ + I+  Y
Sbjct  66    DHASIRSFVDFIKNQFGKLDILVNNAGIPGAQVDGEALAAAKIVENGGQIDWSKIITQTY  125

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             E +   I+ NYYG+K +TEA +P LQ S SP++VNV++   KLE + N W K VL++VE 
Sbjct  126   EQTELGIKTNYYGAKDLTEALIPFLQLSSSPKVVNVSASMGKLEKLPNGWPKEVLSDVEE  185

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPP-HMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
                 K+DEV+N+FL+D+K GS + KGWP  ++S Y++SK A+NAY R+ A KYPS+ +N 
Sbjct  186   LTEEKIDEVLNQFLKDFKEGSLENKGWPDNNLSTYIISKVALNAYTRVVARKYPSICINV  245

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             V PG VKTDI YNTG +T  EGA+SI+R+AL   DG SG FF
Sbjct  246   VCPGFVKTDIIYNTGYLTPDEGAESILRLALL-SDGSSGHFF  286



>gb|KHG24615.1| hypothetical protein F383_06242 [Gossypium arboreum]
Length=686

 Score =   299 bits (766),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 202/287 (70%), Gaps = 9/287 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+KR AVVTG NKGIGFE+CR LA +G+ VVLT+R+E +G EA  KL+  GLS +++FH+
Sbjct  9     AAKRVAVVTGANKGIGFELCRNLASKGIMVVLTSRDEKRGLEAFAKLKDSGLSHHLVFHQ  68

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF--------  713
             LDVT  S+++SLV ++ + FG+LD+LVNNAG  G   ++ A   +      F        
Sbjct  69    LDVTVPSSIASLVDYVKSKFGKLDLLVNNAGTFGAILHQQAFVKATELAGYFPSEEQASE  128

Query  712   MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
                 +  +EL+ EC+E NYYG+KRM EAF+PLL  S SPRIVNV+S    L++I ++WAK
Sbjct  129   YEIATQTFELAQECLETNYYGAKRMVEAFVPLLHLSDSPRIVNVSSIMGLLKNIPSQWAK  188

Query  532   GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
              VL++ ES    ++DEV+ +FL+D+K GS K++GWP + SAY +SKAAMNAY RI A+KY
Sbjct  189   EVLSDAESVTEEQVDEVLKQFLKDFKEGSLKDQGWPIYFSAYTLSKAAMNAYTRIVANKY  248

Query  355   PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGV  215
             PS  VN + PG VKTDI  NTG +TA EGA+++ R+AL   DGPS V
Sbjct  249   PSFLVNSIGPGFVKTDITCNTGVLTAAEGAENVARLALLSNDGPSAV  295



>ref|XP_007218773.1| hypothetical protein PRUPE_ppa009560mg [Prunus persica]
 gb|EMJ19972.1| hypothetical protein PRUPE_ppa009560mg [Prunus persica]
Length=287

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/290 (52%), Positives = 195/290 (67%), Gaps = 20/290 (7%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+KRYAVVTG NKGIG E  RQLA +G TVVLTAR+E +G EAVEKL+  GLS  V+F
Sbjct  2     AEATKRYAVVTGANKGIGLETVRQLASKGFTVVLTARDEKRGLEAVEKLKESGLSGQVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALR-------ASMGRVLN  716
             H+LDV + +TV+SL  FI T FG+LDILVNNAG+ G   +  A +       A  G V +
Sbjct  62    HQLDVANPATVASLADFIKTQFGKLDILVNNAGIFGSILDGDAFKDVIASGAAERGGV-D  120

Query  715   FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWA  536
               + ++  YE + EC++INYYG+KR  EA +PLLQ S SPRIVNV+SG  KL++I N+WA
Sbjct  121   LSKLVTETYEFAEECLQINYYGAKRTAEALIPLLQLSDSPRIVNVSSGAGKLKNIPNDWA  180

Query  535   KGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHK  359
             KGV  + E+    ++DE           GS + KGW P M AY+VSKAA+NAY RI A K
Sbjct  181   KGVFTDAENLTEERVDE----------EGSLESKGW-PSMPAYIVSKAALNAYTRILAKK  229

Query  358   YPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             Y + ++N V PG VKTD+N N G +  +EG   + + AL P DGP+G FF
Sbjct  230   YLNFRINSVCPGFVKTDMNCNVGVLPVEEGGARVAKFALLPNDGPTGSFF  279



>ref|XP_009400275.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Musa acuminata 
subsp. malaccensis]
Length=305

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 198/291 (68%), Gaps = 5/291 (2%)
 Frame = -1

Query  1045  SKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRL  866
             S R A+VTG NKGIG E CRQL  +G TV+LTAR+E +G  AV  L+  G SD VLFH+L
Sbjct  15    SFRIALVTGANKGIGLETCRQLLSKGATVILTARDEQRGLAAVRNLQASGASD-VLFHQL  73

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMRAISH  695
             DV D+++VSSL  FI+  FG+LD+LVNNA V G+  +   L +S+     + +   AI  
Sbjct  74    DVADSASVSSLAGFIHDQFGKLDVLVNNAAVHGVGLDPQILGSSVQVPNNLTDLRNAIIE  133

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
              Y+++ EC+ INYYG+KR+TEA LPLLQ S+SPRIVN++S + KL  I +   K  + NV
Sbjct  134   TYDMAEECLNINYYGTKRVTEALLPLLQSSQSPRIVNLSSLYGKLRYIPDSKIKEEMRNV  193

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             +     +LDE++  FL D+K G  +E GWP   SAY+VSK A++AY RI A KYP   +N
Sbjct  194   DVLSEDRLDELLQSFLNDFKGGKLQENGWPTRTSAYMVSKVAVSAYTRILAKKYPKYCIN  253

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             CVNPG VKTDINYN G++  + GAQ  V +A+ P+  PSG F+D +++ +F
Sbjct  254   CVNPGFVKTDINYNFGELPVEVGAQGPVFLAMLPDGSPSGHFYDLEEMSSF  304



>gb|KHN04645.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=274

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 194/291 (67%), Gaps = 21/291 (7%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             + ++RYAVVTG NKGIG EI RQLA  G+ VVLTARNE +G +A++ L+  GLS  VLFH
Sbjct  3     ETTERYAVVTGANKGIGLEIVRQLASAGIKVVLTARNEERGIQALQTLKDSGLSHLVLFH  62

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHN  692
             ++DV DA++V+SL  FI + FG+LDIL         AA E           +  +AI+ +
Sbjct  63    QVDVADATSVASLADFIKSKFGKLDIL---------AAPEE----------DVTKAITQS  103

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI-HNEWAKGVLNNV  515
             YEL+ EC++INYYG+K   E+ LPLLQ S SPRIVNV+S   +LES+    WA+ V ++ 
Sbjct  104   YELAEECLQINYYGAKTTVESLLPLLQLSDSPRIVNVSSTMGQLESLPKGSWAREVFSDA  163

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
                   K+DE++ KFL D++ GS +  GWP H+ AY+VSKAAMNAY RI A KYPS  +N
Sbjct  164   NIITEEKVDEILKKFLRDFQEGSLESNGWPRHLGAYIVSKAAMNAYTRILAKKYPSFCIN  223

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              V PG VKTDI  NTG +T +EGA S VR+AL P   PSG+F+    + +F
Sbjct  224   SVCPGYVKTDITANTGLLTVEEGAASPVRLALLPNGSPSGLFYYRSDVASF  274



>ref|XP_003627589.1| Carbonyl reductase [Medicago truncatula]
Length=277

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 201/291 (69%), Gaps = 16/291 (5%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++AS+RYA+VTG NKGIG+ IC++LA  GV VVLTARNE +G +AVE L+ +GLSD V+F
Sbjct  2     TEASRRYALVTGANKGIGYGICKKLASSGVMVVLTARNEKRGLDAVESLKELGLSDFVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVTD  +VSSLV FI   FG+LDILVNNAGV G   N        G  +  MR    
Sbjct  62    HQLDVTDPISVSSLVEFIKIQFGKLDILVNNAGVAGGIVN--------GENVVKMRE---  110

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
                   EC+EIN++G++R+TEA +PLLQ S SPRIVNV+S   K + + NEW +GV +++
Sbjct  111   ----PKECVEINFFGAERVTEALIPLLQLSTSPRIVNVSSRRGKFKFMPNEWVRGVFDDI  166

Query  514   ESPPG-KLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             ++    KL EV+ +FL+DYK G+ + K WP  +S Y ++KAA+N+Y R+ A K P  ++N
Sbjct  167   KNVTNEKLGEVLREFLKDYKEGALETKNWPTFVSGYTMAKAALNSYTRLLALKLPRFRIN  226

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             C+ P  VKTDIN   G ++  EGA+  V +AL P+DGPSG FF   ++I++
Sbjct  227   CLCPDFVKTDINEMKGFLSIDEGAECPVNLALLPDDGPSGQFFLHDEVISY  277



>ref|XP_004510824.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cicer arietinum]
Length=288

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/284 (51%), Positives = 202/284 (71%), Gaps = 9/284 (3%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDN--VL  878
             +A +RYAVVTG NKGIG E  + LA  GV V+LTARNE +G +A+EKL+  G  DN  V+
Sbjct  3     NAKERYAVVTGSNKGIGLETVKGLASNGVKVILTARNEKRGLQAIEKLKEFGFWDNNLVV  62

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAIS  698
             FH+LDVTD  +++SLV F+   FGRLDILVNNAG+ G   ++      +  ++N+ R ++
Sbjct  63    FHQLDVTDPYSIASLVEFVKNQFGRLDILVNNAGINGFNTDDM-----VAPIINW-RELT  116

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YE++ +CI  NYYG+K   EAFLPLLQ S SP IVNV+S   +L+ I N+WA  VL++
Sbjct  117   QTYEMAEKCIITNYYGAKETIEAFLPLLQLSDSPVIVNVSSTAGQLKHISNDWAHSVLDD  176

Query  517   VESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              E+   +L D+V+ +F++D+K GS + KGWP  +SAY +SKAA+N+Y R+ A+++ +L +
Sbjct  177   TENLNEELIDKVLKEFMKDFKQGSLENKGWPIFLSAYKLSKAAVNSYTRLLAYRHKNLCI  236

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             NCV PG VKTD+N NTGK++ + GA S+VR+AL P   PSG FF
Sbjct  237   NCVCPGFVKTDMNRNTGKLSVENGAASVVRLALLPSGSPSGHFF  280



>ref|XP_010457077.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Camelina sativa]
Length=296

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 197/288 (68%), Gaps = 7/288 (2%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL---RGVGLSDNVL  878
             A  R AVVTG NKGIG EICRQLA  G+TV+LTAR+E KG  AVEKL   + V    ++ 
Sbjct  2     ADTRVAVVTGSNKGIGLEICRQLAKNGITVILTARDEKKGLAAVEKLMTEKNVFSDQSIS  61

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM---GRVLNFMR  707
             FH LDV+   T++SL  F+ T F +LDILVNNAGV G   N   L+A +   G   +  +
Sbjct  62    FHLLDVSIPDTIASLALFLKTRFRKLDILVNNAGVGGANVNVHVLKAQIAEAGAPTDISK  121

Query  706   AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGV  527
              +S  Y++  EC+  NYYG KRM EA +PLLQ S SPRIV + S   KLE++ NEWAKGV
Sbjct  122   IMSDTYDIVEECVTTNYYGVKRMCEAMIPLLQSSASPRIVTIASTMGKLENVSNEWAKGV  181

Query  526   LNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPS  350
             L++ E+    K+DEV++++L+DY+ GS ++KGWP  MS Y++SKAA+ A  ++ A +  S
Sbjct  182   LSDAENLTEEKIDEVMDEYLKDYRQGSLQDKGWPTVMSGYILSKAAVMALTQVLAKRNKS  241

Query  349   LQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
             + +N V PG VKTDIN+NTG ++ +EGA S V++AL P   PSG+F+D
Sbjct  242   MIINSVCPGFVKTDINFNTGILSVEEGAASPVKLALVPNGDPSGLFYD  289



>ref|XP_010910358.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Elaeis guineensis]
Length=307

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 203/303 (67%), Gaps = 13/303 (4%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVL  878
             +S   KR AVVTGGNKGIG EICRQLA  GV V+LTAR+E +G EAVEKLR  GLSD VL
Sbjct  6     SSPTEKRIAVVTGGNKGIGLEICRQLALNGVRVILTARDEKRGQEAVEKLREYGLSD-VL  64

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM------GRVLN  716
             FH+LDVTD+ +++SL  F+ T FG+LDILVNNAG+ G   N   L AS       G+ +N
Sbjct  65    FHQLDVTDSPSIASLADFVRTEFGKLDILVNNAGIGGTTVNFETLNASKPSNNLEGKGIN  124

Query  715   -----FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESI  551
                  +   +  +   + EC++ NYYG++ +TEA +PLL+ S S R+VNV+S   +L  I
Sbjct  125   GIPDWWKPHMQESLGRAEECLKTNYYGTRDVTEALIPLLESSISGRVVNVSSTLGQLRVI  184

Query  550   HNEWAKGVLNNVESPPGK-LDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYAR  374
              NE  K  L+N++    K L E++N F+ED+K G     GWP   SAY VSK   NAY R
Sbjct  185   SNEKLKQELSNIDDLAEKRLVELLNLFIEDFKEGLLNAYGWPTVYSAYKVSKVLTNAYTR  244

Query  373   ITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             + A +YP+L +NCV+PG VKTD+N+NTG +T +EGA+  V +ALQ + GPSG+FFD  ++
Sbjct  245   VLAKQYPNLCINCVSPGFVKTDLNWNTGILTTEEGAKGPVMLALQTDAGPSGLFFDQTEV  304

Query  193   IAF  185
               F
Sbjct  305   STF  307



>pdb|3O26|A Chain A, The Structure Of Salutaridine Reductase From Papaver 
Somniferum.
 gb|ABC47654.1| salutaridine reductase [Papaver somniferum]
Length=311

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 198/301 (66%), Gaps = 16/301 (5%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             +R AVVTGGNKGIGFEIC+QL+  G+ VVLT R+  KG EAVEKL+     +NV+FH+LD
Sbjct  12    RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSN-HENVVFHQLD  70

Query  862   VTDA-STVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV------------  722
             VTD  +T+SSL  FI T+FG+LDILVNNAGV G + +    +A +  +            
Sbjct  71    VTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYE  130

Query  721   -LNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHN  545
                    +S  YEL+ EC++INY G K +TE  +PLLQ S SPRIVNV+S    L+ + N
Sbjct  131   KPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSN  190

Query  544   EWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARIT  368
             E A  +L + ++    ++D VVN  L+D+K    +  GWP   +AY  SKA +NAY R+ 
Sbjct  191   ETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVL  250

Query  367   AHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIA  188
             A+K P  QVNCV PG VKT++NY  G  TA+EGA+ +VR+AL P+DGPSG F+DC ++ A
Sbjct  251   ANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDCSELSA  310

Query  187   F  185
             F
Sbjct  311   F  311



>ref|XP_008337634.1| PREDICTED: uncharacterized protein LOC103400719 [Malus domestica]
Length=603

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 205/296 (69%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A +RYAVVTG NKG+GF   +QLA +GV VVLTAR+E +G EA+EKL+  G+SD V+F
Sbjct  2     AEAVRRYAVVTGANKGVGFGTVKQLASKGVVVVLTARDEKRGLEALEKLKDFGISDLVVF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANE----SALRASMGRVLNFMR  707
             H+LDVTD+++ + L  F+ T FG+LDILVNNA + G   N     SA  A     +N+  
Sbjct  62    HQLDVTDSASAAVLADFVKTQFGKLDILVNNAAINGSVVNPEAFISAATAKKPEEINWNE  121

Query  706   AIS-HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
               +  NYEL+ EC++ NYYG+KR+TEA LPLLQ S SPRIVNV++G +KL +  N W K 
Sbjct  122   IPTIPNYELAEECLKTNYYGTKRVTEALLPLLQLSDSPRIVNVSTGAAKLMNFPNGWPKE  181

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E+    ++D V++ FLED K G    K WPP    Y VSKAA+NAY RI A KYP
Sbjct  182   VLSDAETLTEERIDSVLSGFLEDSKRGLQDIKIWPPVFPPYTVSKAALNAYTRILAKKYP  241

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NC +PG VKTD+++N G +T  EGA+SIVR+AL P  G +G++F  K++  F
Sbjct  242   NFCINCGSPGFVKTDMSFNAGILTIDEGAESIVRLALLPNGGSTGLYFSRKEVAPF  297


 Score =   289 bits (740),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 208/296 (70%), Gaps = 6/296 (2%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++ASKRYAVVTG NKG+GF I +QLA  GV VVLTAR+E +G EAVEKL+  GLS+ V+F
Sbjct  308   AEASKRYAVVTGANKGVGFGIVKQLASNGVIVVLTARDEKRGLEAVEKLKDFGLSELVVF  367

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMG----RVLNFMR  707
             H+LDVTD+++  SL   + T F +LDILVNNAG+ G   +  + R+++       ++F  
Sbjct  368   HQLDVTDSASXXSLAGXVKTQFAKLDILVNNAGINGSMVDPESFRSAVSGKKPEEIDFSE  427

Query  706   -AISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
              + + NYEL+ EC++ NYYG+K +TEA LPLLQ S SPRIVNV+S  +KL +  N   K 
Sbjct  428   ISTTPNYELAEECLKTNYYGAKSVTEALLPLLQLSDSPRIVNVSSLLAKLTNFPNGRTKE  487

Query  529   VLNNVE-SPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++ E     +++ V+++FLEDYK+   + KGW     AY VSKAA+NAY RI A KYP
Sbjct  488   VLSDAEIITEERIEAVLSEFLEDYKHDLLETKGWSHIFPAYKVSKAALNAYTRILAKKYP  547

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +  +NC +PG VKTD+++N G +T  EGA+SIVR+AL P  GP+G++F  K++  F
Sbjct  548   NFCINCGSPGLVKTDMSFNLGVLTIDEGAESIVRLALLPNGGPTGLYFVRKEMTPF  603



>sp|A4UHT7.1|SALR_PAPBR RecName: Full=Salutaridine reductase [Papaver bracteatum]
 gb|ABO93462.1| salutaridine reductase [Papaver bracteatum]
Length=311

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 194/300 (65%), Gaps = 16/300 (5%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             R AVVTGGNKGIGFEIC+QL+  G+ VVLT R+  +G EAVEKL+     +NV+FH+LDV
Sbjct  13    RCAVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSN-HENVVFHQLDV  71

Query  859   TDA-STVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-------------  722
             TD  +T+SSL  FI   FG+LDILVNNAGV G + +    +A +  +             
Sbjct  72    TDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEK  131

Query  721   LNFMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE  542
                   +S  YEL+ EC++INYYG K +TE  LPLLQ S SPRIVNV+S    L+ + NE
Sbjct  132   PEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDSPRIVNVSSSTGSLKYVSNE  191

Query  541   WAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITA  365
              A  +L + ++    ++D VVN  L+D+K    +  GWP   +AY  SKA +NAY R+ A
Sbjct  192   TALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLA  251

Query  364   HKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              K P  QVNCV PG VKT++NY  G  TA EGA+ +VR+AL P+DGPSG F+DC ++ AF
Sbjct  252   KKIPKFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDGPSGFFYDCSELSAF  311



>ref|XP_004510823.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cicer arietinum]
Length=274

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 206/288 (72%), Gaps = 29/288 (10%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-----GVGLS  890
             ++A+K YAVVTG NKGIGFEIC+QLA +G+TV++TAR+E +G EA++KL+      +  +
Sbjct  2     AEATKWYAVVTGANKGIGFEICKQLASKGITVIVTARDERRGIEALDKLKQHIDLNLSHN  61

Query  889   DNVLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFM  710
             +NVLFH+LDVTD ++++SL +FI T+FG+LDILVNNAG++                    
Sbjct  62    NNVLFHQLDVTDPNSIASLENFIRTHFGKLDILVNNAGLL--------------------  101

Query  709   RAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKG  530
                +   EL+  CI+ NYYG+K +T+A +PLLQ S SP+IVNV+S   +LE+I N W K 
Sbjct  102   ---TEKEELTEACIKTNYYGAKGLTKALIPLLQFSSSPKIVNVSSSMGRLENIPNGWPKE  158

Query  529   VLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYP  353
             VL++VE+    K+D+V+N+FL+D+K GS + KGWP ++SAY VSK A++AY RI A KYP
Sbjct  159   VLSDVENLTEEKIDQVLNEFLKDFKEGSLESKGWPLNVSAYSVSKVALSAYTRILAKKYP  218

Query  352   SLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             S+ +N + PG +KTDIN +TG +T  EGA+ IVR+AL  +  PSG+FF
Sbjct  219   SICINAICPGYIKTDINDHTGSLTPYEGAEPIVRLALLNDGSPSGLFF  266



>gb|KCW78026.1| hypothetical protein EUGRSUZ_D02253 [Eucalyptus grandis]
Length=279

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 189/265 (71%), Gaps = 5/265 (2%)
 Frame = -1

Query  988  RQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVTDASTVSSLVHFINTNF  809
            RQLA  G+ VVLT+R+E +G EA++KL+  GLSD ++FH+LDV++ S++ +L +FI T F
Sbjct  7    RQLASNGIVVVLTSRDEKRGLEAIQKLKDSGLSDYLIFHQLDVSNPSSILALANFIKTQF  66

Query  808  GRLDILVNNAGVIGLAANESALRAS----MGRVLNFMRAISHNYELSAECIEINYYGSKR  641
            G+LDILVNNAGV G+  +  ALRAS     G  +N+   ++  YE +  C+E NYYG+KR
Sbjct  67   GKLDILVNNAGVPGVIIDGDALRASGFGKEGAQINWNEIMTQPYEAAEACMETNYYGAKR  126

Query  640  MTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLED  464
            M  A + LLQ S SPRIVNV+S   KLE + NEWA+  L++ +     K+D +V   L D
Sbjct  127  MVGALIDLLQLSDSPRIVNVSSSMGKLERVSNEWARETLSDPKDITEEKVDGIVKALLTD  186

Query  463  YKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKI  284
            +K+GS++ KGWP  M AY +SKAAMNAY RI A KYPS+ VNCV PG VKTDIN+NTG +
Sbjct  187  FKDGSSEAKGWPAFMPAYSISKAAMNAYTRILAKKYPSIIVNCVCPGFVKTDINFNTGIL  246

Query  283  TAKEGAQSIVRVALQPEDGPSGVFF  209
            + +EGA+S V++AL P  GPSG FF
Sbjct  247  SVEEGAESPVKLALLPNGGPSGCFF  271



>ref|XP_003528868.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
 gb|KHN04646.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=289

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 207/292 (71%), Gaps = 8/292 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL-RGVGLSDNVL  878
             +DA +RYAVVTG NKGIG E  + LA  G+ VVLTAR+  +G +AVE+L R  G SD V+
Sbjct  4     ADAKQRYAVVTGANKGIGLETVKGLASNGIKVVLTARDVKRGYQAVEELKREFGFSDLVV  63

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAIS  698
             FH+LDVTD S+++SLV F+ T+FGRLDILVNNAG+ G   N   +  S    +N+ + + 
Sbjct  64    FHQLDVTDPSSIASLVEFVKTHFGRLDILVNNAGISGF--NTDGMVPSK---INW-KELP  117

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YE++ +C+  NYYG+K  TEAFLPLL+ S  P IVNV+S    L+ I NEWA+ VL++
Sbjct  118   QTYEMAEKCLTTNYYGAKETTEAFLPLLRLSNLPMIVNVSSEAGLLKYISNEWARSVLDD  177

Query  517   VESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              E+   +L DEV+ +++ D ++G  ++KGWP ++SAY+VSKAA+N+Y R+ A+++  L +
Sbjct  178   TENLTEELIDEVLKEYMTDLEDGLLEKKGWPTYLSAYMVSKAAINSYTRLLAYRHQKLCI  237

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NCV PG VKTDIN NTG ++ + GA S+VR+AL P   PSG FF  +++ +F
Sbjct  238   NCVCPGFVKTDINRNTGILSVENGAASVVRLALLPNGSPSGHFFTRQEVSSF  289



>emb|CDY56927.1| BnaAnng14460D [Brassica napus]
Length=306

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/291 (51%), Positives = 206/291 (71%), Gaps = 7/291 (2%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLR-GVGLSDNVL-FHRL  866
             RYAVVTG NKGIGFEICRQLA  GV VVLT+R+E +G EAVE LR   G+S+  L FH+L
Sbjct  17    RYAVVTGANKGIGFEICRQLANSGVRVVLTSRDEKRGLEAVETLRRETGVSEQTLVFHQL  76

Query  865   DVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRV-LNFMRAISHN-  692
             DVTD ++++SL  F+   FG+LDIL+NNAGV G+  +  A+RA   +V  N+   I  N 
Sbjct  77    DVTDPASITSLAQFVKAQFGKLDILINNAGVSGVIIDIDAIRAGKEKVDFNWEENIPEND  136

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             Y+++ EC+ INYYG KRM EA +PLLQ S SPRI++V+S   +L+++ NEWAKG+L++ E
Sbjct  137   YDIAKECLNINYYGPKRMCEALIPLLQLSDSPRIISVSSFMGQLKNLLNEWAKGILSDAE  196

Query  511   S-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
             +    ++DEV+++ L ++K+G  K K W   M+AYVV KA++N Y RI A K+P ++VN 
Sbjct  197   NLTEERIDEVIDQLLNEFKDGVIKTKDWSKVMAAYVVFKASLNGYTRILAKKHPEIRVNS  256

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQP-EDGPSGVFFDCKKIIAF  185
             V PG V+TD+ +N G  +  EGA   VR+AL P ++ PSG FF+ K++  F
Sbjct  257   VCPGVVRTDMTFNIGDFSV-EGASCPVRLALLPYQETPSGCFFNRKQLSEF  306



>gb|EYU32080.1| hypothetical protein MIMGU_mgv11b021529mg [Erythranthe guttata]
Length=277

 Score =   284 bits (726),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 202/293 (69%), Gaps = 31/293 (11%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             R AVVTG NKGIG EICRQLA EG+T+ +                  GL  +        
Sbjct  6     RCAVVTGANKGIGLEICRQLASEGITLEMNKE---------------GLQAH--------  42

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASM--GRV-----LNFMRAI  701
             +D ++++SL  FI+++FG+LDILV+NAGV+G   +  A RAS    RV     +N+   +
Sbjct  43    SDLASIASLAQFIDSHFGKLDILVHNAGVLGALVDGDAWRASQQDARVKGSEKMNWGTIM  102

Query  700   SHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLN  521
             +  Y+L+AEC++ NYYG+KR+TEA LPLL  SKSPRIVNV+S   +L+ I +EWAKGVLN
Sbjct  103   TQTYDLAAECLQTNYYGAKRITEALLPLLHLSKSPRIVNVSSSMGQLKYIPSEWAKGVLN  162

Query  520   NVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQ  344
             ++E+    ++DEV+N FL+D+K G  ++KGWP   +AYV+SKAAMN+  RI A KYPS +
Sbjct  163   DIENLTEERIDEVINVFLKDFKEGCLEDKGWPEIFAAYVISKAAMNSGTRILAKKYPSFR  222

Query  343   VNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             +NCV PG VKTDINYN+G +T +EGA+  V++AL P+DGPSG+FF  K++ +F
Sbjct  223   INCVCPGYVKTDINYNSGVLTVEEGAEGPVKLALLPDDGPSGMFFLQKEVSSF  275



>ref|XP_003623884.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
Length=919

 Score =   301 bits (771),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 217/308 (70%), Gaps = 21/308 (7%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDV  860
             +YAVVTG NKGIGFE  + LA  GV VVLTAR+E KG+EA++KL+  GLSD V+FH+LDV
Sbjct  328   KYAVVTGSNKGIGFETVKMLASNGVKVVLTARDEKKGNEAIQKLKQFGLSDQVMFHQLDV  387

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYELS  680
             TD+++++SLV F  T FGRLDILVNNAGV G+   E     ++G  +++ + ++   +++
Sbjct  388   TDSASITSLVQFFKTQFGRLDILVNNAGVSGVNPYE-----TVGSTVDWEK-LTQTSDMA  441

Query  679   AECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PP  503
               C+  NYYG K  T+AFLPLL+ S S +IVNV+S  + L++I N+WAK V +++E+   
Sbjct  442   ENCLRTNYYGVKETTDAFLPLLKLSNSSKIVNVSSQAALLKNIPNQWAKRVFDDIENLTE  501

Query  502   GKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPG  323
              K+DEV+ +F++D+K GS + KGWP  MSAY++SKAAMN+Y RI A KYP++ +NCV PG
Sbjct  502   EKIDEVLKEFIKDFKEGSLENKGWPTIMSAYIISKAAMNSYTRILAKKYPNMCINCVCPG  561

Query  322   NVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF**ELVSFMVSQLLC  143
              VKTDIN NTG +   +GA S+VR+AL P+D PS V+++             + +  LL 
Sbjct  562   FVKTDINKNTGMLPVDQGAASVVRLALLPDDSPS-VYYN-------------YRMCLLLI  607

Query  142   FFSLIFMF  119
             F +L+ +F
Sbjct  608   FCTLVKLF  615


 Score =   288 bits (737),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 207/289 (72%), Gaps = 12/289 (4%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A  R AVVTG NKGIGFE  + LA  GV V+LTAR+E KG+EA++KL+  GLSD V+F
Sbjct  2     AEAKLRNAVVTGSNKGIGFETVKMLASNGVKVMLTARDEKKGNEAIQKLKQFGLSDQVMF  61

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISH  695
             H+LDVTD ++++SLV F+ T FGRLDILVNNAGV G+   E     ++G  +++ + ++ 
Sbjct  62    HQLDVTDPASITSLVEFVKTQFGRLDILVNNAGVSGVNPYE-----TVGSTVDWEK-LTQ  115

Query  694   NYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNV  515
               +++  C+  NYYG K  TEAFL LL+ S SP+I+NV+S     ++I N+WAK V +++
Sbjct  116   TSDMAENCLRTNYYGVKETTEAFLSLLKLSNSPKIINVSS-----QNIPNQWAKRVFDDI  170

Query  514   ES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVN  338
             E+    ++D+V+ +F++D+K GS + KGWP  +S Y+VSKAA N+Y RI A KYP++ +N
Sbjct  171   ENLTEERIDKVLIEFIKDFKEGSLENKGWPTFLSTYIVSKAATNSYTRILAKKYPNMCIN  230

Query  337   CVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKII  191
             CV PG VKTD+  N G ++  +GA S+VR+AL P+  PSG+FF  ++II
Sbjct  231   CVCPGYVKTDLTKNIGMLSVDQGAASVVRLALLPDGSPSGLFFIREEII  279


 Score =   283 bits (723),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 198/288 (69%), Gaps = 4/288 (1%)
 Frame = -1

Query  1036  YAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVLFHRLDV  860
             YAVVTG NKGIG+ IC++LA  GV VVLTARNE +G EAVE+L+     SD V+FH+LDV
Sbjct  632   YAVVTGANKGIGYGICKKLASSGVVVVLTARNEERGLEAVERLKNEFDFSDFVVFHQLDV  691

Query  859   TDASTVSSLVHFINTNFGRLDILVNNAGVIG--LAANESALRASMGRVLNFMRAISHNYE  686
              D ++V+SL  FI T FG+LDILVNNAGV G  L   ++ LR   G  ++        YE
Sbjct  692   DDPASVASLASFIKTMFGKLDILVNNAGVPGGKLIDGDALLRKRNGAEIDTKEIGYETYE  751

Query  685   LSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-  509
             L+ +C++ N+YG +R+TEA +PLLQ S SP IVNV+S    L++I NEWA+ V N++E+ 
Sbjct  752   LAEKCLKTNFYGVERVTEALVPLLQLSTSPTIVNVSSRAGLLKNISNEWARIVFNDIENL  811

Query  508   PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVN  329
                K+DEV+ +F +DYK GS + K WP   SAY +SKAA+NAY RI A KYP   +N V 
Sbjct  812   TKEKIDEVLKEFEKDYKEGSLEIKDWPTFASAYTMSKAALNAYTRIMAKKYPHFHINSVC  871

Query  328   PGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             PG VKTD+N N G ++  EG ++ + +AL   +GPSG FF+  ++I+F
Sbjct  872   PGFVKTDMNNNIGNLSIDEGVETPLMLALWSNNGPSGCFFNKGEVISF  919



>ref|XP_010918528.1| PREDICTED: salutaridine reductase-like [Elaeis guineensis]
Length=312

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 200/307 (65%), Gaps = 19/307 (6%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             S A KR AVVTGGNKGIG EICRQLA  GV V+LTAR+E +G  AVEKLR  G+SD V+F
Sbjct  8     SPAEKRIAVVTGGNKGIGLEICRQLALNGVKVILTARDEKRGMAAVEKLRDSGVSD-VVF  66

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLA---------------ANESALR  740
             H+LDVTD+S+++SL HFI   FG+LDILVNNAGV G+A                NE  + 
Sbjct  67    HQLDVTDSSSIASLAHFIGVQFGKLDILVNNAGVAGVAIDLEKLSEFLKASKSTNEEKVE  126

Query  739   ASMGRVLNFMRA-ISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSK  563
              + G V N+M+      YE++ EC++ NY+G K +TEA LP LQ S    IVNV+S   +
Sbjct  127   DTDG-VRNWMKENFQRTYEMAEECMKTNYHGVKNVTEALLPHLQSSYFGTIVNVSSTLGQ  185

Query  562   LESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMN  386
             L+ I NE  +  LNN++     +L ++ N FL+D+K G      WP  +SAY VSK  +N
Sbjct  186   LQCIPNEGLRQELNNIDGLSEDRLTDLSNLFLKDFKEGLLDANNWPTFLSAYTVSKVLVN  245

Query  385   AYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFD  206
              Y RI A +YPSL +NC +PG VKTDINYNTG +T +EGA+  V +AL P+   SG+F+D
Sbjct  246   CYTRILAKRYPSLCINCNSPGFVKTDINYNTGILTTEEGAKGPVMLALLPKGSSSGLFYD  305

Query  205   CKKIIAF  185
               KI  F
Sbjct  306   QTKISPF  312



>ref|XP_004976337.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Setaria italica]
Length=311

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/303 (50%), Positives = 197/303 (65%), Gaps = 16/303 (5%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHR  869
             A+ R AVVTGGNKGIG E+CRQLA  G+TVVLTAR+E +G+ AVEKLR  GLSD V+FH+
Sbjct  9     ANARIAVVTGGNKGIGLEVCRQLAGAGITVVLTARDEKRGAAAVEKLREAGLSD-VIFHQ  67

Query  868   LDVTDASTVSSLVHFINTNFGRLDILVNNAGVIG------------LAANESALRASMGR  725
             L++ DA +V+ L  F+   FG+LDILVNNA VIG            L + E        R
Sbjct  68    LEIADAPSVARLADFLKIRFGKLDILVNNAAVIGAVEHVQDPADNSLTSKEKISGMDKRR  127

Query  724   VLN-FMRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIH  548
              L  F  A+   Y+ + E ++INYYG+K + EA LPLLQ S   RIVNV+S W  L  I+
Sbjct  128   RLEWFANAVRETYDAAREAVQINYYGTKHVIEALLPLLQASSDGRIVNVSSEWGLLRLIN  187

Query  547   NEWAKGVLNN-VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYAR  374
             NE  K  LN+ VE     +LDE++  FL D+K G  +  GWP H SAY VSK  +NAY+R
Sbjct  188   NEELKQELNDDVEKLTEERLDEILGTFLNDFKAGELEAHGWPKHFSAYKVSKVTLNAYSR  247

Query  373   ITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             I A ++  L+VNC +PG VKTD+   +G +T +EGA ++V+VAL PE GP+GV+FD  + 
Sbjct  248   ILARRHRELRVNCAHPGYVKTDMTIQSGLLTPEEGASNLVKVALLPEAGPTGVYFDLGQE  307

Query  193   IAF  185
               F
Sbjct  308   APF  310



>ref|XP_006339786.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Solanum tuberosum]
Length=484

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 206/292 (71%), Gaps = 4/292 (1%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEK-LRGVGLSD-NVLF  875
             A++R AVV+GGNKGIG EICRQLA +G+ V+LTAR+E KG+EAV   L+  G S+ N++F
Sbjct  193   ATQRIAVVSGGNKGIGLEICRQLAAKGIVVILTARDEKKGNEAVNNMLKMDGHSNYNIIF  252

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVL-NFMRAIS  698
             H+LDVTD S++  L  FI   FG+LDILVNNAGV+G+  ++  + +S   +    ++  +
Sbjct  253   HQLDVTDISSIVRLKDFIQDRFGKLDILVNNAGVLGVLLDKDVIISSQQDLFYEKIKVAT  312

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
                + + ECI+ NYYG+K M +  LPLLQ S SPRIVNV+S   KLE + NEWA GVLN+
Sbjct  313   QTSDFAEECIKTNYYGAKWMIQELLPLLQLSDSPRIVNVSSTGGKLEYVRNEWAVGVLND  372

Query  517   VES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              ++    K+DEV+N FL+D+K    + K WP  +SAYVVSKAA+N Y R+ A KYP+  +
Sbjct  373   CDNLTEDKVDEVLNVFLKDFKEDLLESKNWPQTISAYVVSKAALNGYTRVLAKKYPNFLI  432

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NCV PG+VKTD+   +G +T++EGAQS V +AL P+ GPSG F+  K++  F
Sbjct  433   NCVCPGSVKTDLRCYSGILTSEEGAQSPVWLALLPQGGPSGNFYIRKELSPF  484


 Score =   188 bits (478),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = -1

Query  712  MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAK  533
            M+  +   +++ ECI+ NYYG+K M +  LPLLQ S SPRIVNV+S   KL+ + NEWA 
Sbjct  1    MKVATQTIDIAEECIKTNYYGAKWMIQELLPLLQLSDSPRIVNVSSSTGKLQHVRNEWAI  60

Query  532  GVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKY  356
            GVLNN ++    K+DEV+N FL+D+K    + K WP  +SAYV SKAA+N Y RI A KY
Sbjct  61   GVLNNCDNLTEDKVDEVLNVFLKDFKEDLLESKNWPLTISAYVASKAALNGYTRILAKKY  120

Query  355  PSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
            P+  +NCV PG VKTD+  N+G +T +EGAQS V +AL P+ GPSG F++ K++ +F
Sbjct  121  PNFLINCVCPGYVKTDLCCNSGTLTVEEGAQSPVWLALLPQGGPSGNFYNRKELSSF  177



>gb|KEH23345.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=295

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 199/289 (69%), Gaps = 4/289 (1%)
 Frame = -1

Query  1039  RYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVLFHRLD  863
             RYAVVTG NKGIG+ IC++LA  GV VVLTARNE +G EAVE+L+     SD V+FH+LD
Sbjct  7     RYAVVTGANKGIGYGICKKLASSGVVVVLTARNEERGLEAVERLKNEFDFSDFVVFHQLD  66

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIG--LAANESALRASMGRVLNFMRAISHNY  689
             V D ++V+SL  FI T FG+LDILVNNAGV G  L   ++ LR   G  ++        Y
Sbjct  67    VDDPASVASLASFIKTMFGKLDILVNNAGVPGGKLIDGDALLRKVNGAEIDTKEIGYETY  126

Query  688   ELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES  509
             EL+ +C++ N+YG +R+TEA +PLLQ S SP IVNV+S    L++I NEWA+ V N++E+
Sbjct  127   ELAEKCLKTNFYGVERVTEALVPLLQLSTSPTIVNVSSRAGLLKNISNEWARIVFNDIEN  186

Query  508   -PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
                 K+DEV+ +F +DYK GS + K WP   SAY +SKAA+NAY RI A KYP   +N V
Sbjct  187   LTKEKIDEVLKEFEKDYKEGSLEIKDWPTFASAYTMSKAALNAYTRIMAKKYPHFHINSV  246

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              PG VKTD+N N G ++  EG ++ + +AL   +GPSG FF+  ++I+F
Sbjct  247   CPGFVKTDMNNNIGNLSIDEGVETPLMLALWSNNGPSGCFFNKGEVISF  295



>gb|AFK39427.1| unknown [Medicago truncatula]
 gb|AES80103.2| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=262

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/267 (52%), Positives = 196/267 (73%), Gaps = 7/267 (3%)
 Frame = -1

Query  982  LACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVTDASTVSSLVHFINTNFGR  803
            LA  GV VVLTAR+E KG+EA++KL+  GLSD V+FH+LDVTD+++++SLV F  T FGR
Sbjct  2    LASNGVKVVLTARDEKKGNEAIQKLKQFGLSDQVMFHQLDVTDSASITSLVQFFKTQFGR  61

Query  802  LDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFL  623
            LDILVNNAGV G+   E+     +G  +++ + ++   +++  C+  NYYG K  T+AFL
Sbjct  62   LDILVNNAGVSGVNPYET-----VGSTVDWEK-LTQTSDMAENCLRTNYYGVKETTDAFL  115

Query  622  PLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGST  446
            PLL+ S S +IVNV+S  + L++I N+WAK V +++E+    K+DEV+ +F++D+K GS 
Sbjct  116  PLLKLSNSSKIVNVSSQAALLKNIPNQWAKRVFDDIENLTEEKIDEVLKEFIKDFKEGSL  175

Query  445  KEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGA  266
            + KGWP  MSAY++SKAAMN+Y RI A KYP++ +NCV PG VKTDIN NTG +   +GA
Sbjct  176  ENKGWPTIMSAYIISKAAMNSYTRILAKKYPNMCINCVCPGFVKTDINKNTGMLPVDQGA  235

Query  265  QSIVRVALQPEDGPSGVFFDCKKIIAF  185
             S+VR+AL P+D PSG+FF  ++I  F
Sbjct  236  ASVVRLALLPDDSPSGLFFIREEISNF  262



>gb|KHN27304.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=289

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 205/292 (70%), Gaps = 8/292 (3%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKL-RGVGLSDNVL  878
             +DA +RYAVVTG NKGIG E  + LA  G+ VVLTAR+  +G +AVE+L R  G SD V+
Sbjct  4     ADAKQRYAVVTGANKGIGLETVKGLASNGIKVVLTARDVKRGYQAVEELKREFGFSDLVV  63

Query  877   FHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAIS  698
             FH+LDVTD S+V+SLV F+   FGRLDILVNNAG+ G   N   +  S    +N+ + + 
Sbjct  64    FHQLDVTDPSSVASLVEFVKIKFGRLDILVNNAGISGF--NTDGMVPSK---INW-KELP  117

Query  697   HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNN  518
               YE++ +C+  NYYG+K  TEAFLPLL+ S  P IVNV+S    L+ I NEWA+ VL++
Sbjct  118   QTYEMAEKCLTTNYYGAKETTEAFLPLLRLSNLPMIVNVSSEAGLLKYISNEWARSVLDD  177

Query  517   VESPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQV  341
              E+   +L DEV+ +++ D ++G  ++KGWP ++SAY+VSKAA+N+Y R+ A+++  L +
Sbjct  178   TENLTEELIDEVLKEYMTDLEDGLLEKKGWPTYLSAYMVSKAAINSYTRLLAYRHQKLCI  237

Query  340   NCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             NCV PG VKTDIN NTG ++ + GA S+VR+AL P   PSG FF  +++ +F
Sbjct  238   NCVCPGFVKTDINRNTGILSVENGAASVVRLALLPNGSPSGHFFTRQEVSSF  289



>gb|AAQ55960.1| menthol dehydrogenase [Mentha x piperita]
Length=311

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 201/301 (67%), Gaps = 18/301 (6%)
 Frame = -1

Query  1057  ASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLS---D  887
             A   ++RYA+VTG NKGIGFEICRQLA +G+ V+L +RNE +G EA E+L     S   D
Sbjct  2     ADTFTQRYALVTGANKGIGFEICRQLASKGMKVILASRNEKRGIEARERLLKESRSISDD  61

Query  886   NVLFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAAN------ESALRASM--  731
             +V+FH+LDV D ++  ++ HFI T FGRLDILVNNAG  G+A        +  L A++  
Sbjct  62    DVVFHQLDVADPASAVAVAHFIETKFGRLDILVNNAGFTGVAIEGDISVYQECLEANIIA  121

Query  730   ---GRVLNFMRAIS----HNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSG  572
                G+   F    +       E S ECIE NYYG+KR+TE  +PLLQ+S SP IVNV+S 
Sbjct  122   AQGGQAHPFHPKTTGRLIETLEGSKECIETNYYGTKRITETLIPLLQKSDSPTIVNVSST  181

Query  571   WSKLESIHNEWAKGVLNNVESPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAA  392
             +S L    NEWAKGV ++     GK++EV+++FL+D+ +G  ++  WPP+ +AY VSKAA
Sbjct  182   FSTLLLQPNEWAKGVFSSNSLNEGKVEEVLHEFLKDFIDGKLQQNHWPPNFAAYKVSKAA  241

Query  391   MNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVF  212
             +NAY RI A KYPS  +N V PG V+TDI YN G ++  EGA++ V++AL P+ GPSG F
Sbjct  242   VNAYTRIIARKYPSFCINSVCPGFVRTDICYNLGVLSEAEGAEAPVKLALLPDGGPSGSF  301

Query  211   F  209
             F
Sbjct  302   F  302



>ref|XP_006445101.1| hypothetical protein CICLE_v10024172mg [Citrus clementina]
 gb|ESR58341.1| hypothetical protein CICLE_v10024172mg [Citrus clementina]
Length=309

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 207/308 (67%), Gaps = 19/308 (6%)
 Frame = -1

Query  1054  SDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLF  875
             ++A+ ++AVVTG NKGIG+EI RQLA  GVT VLTAR+E +G EAVEKL+  G  DNV+F
Sbjct  2     AEAATKHAVVTGANKGIGYEIVRQLASNGVTTVLTARDEKRGLEAVEKLKQSGF-DNVIF  60

Query  874   HRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA--------SMGRVL  719
             H+LDV D + + SL +FI ++FG+LDILVNNAG+ G+  + + L          + G +L
Sbjct  61    HQLDVADPAAIHSLANFIRSHFGKLDILVNNAGISGVCMDGNDLSGVVKVNRSGTSGVIL  120

Query  718   ---NFMRAISHNYELSAECIEIN------YYGSKRMTEAFLPLLQQSKSPRIVNVTSGWS  566
                NF   +   +++              +  +  M EA +P LQ S SPRIVNV+S W 
Sbjct  121   EGDNFSGFVKVYFDIFFSLFFSFSFFPPCHPQAYLMCEALIPFLQLSDSPRIVNVSSSWG  180

Query  565   KLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAM  389
             KL+ + NEWAKGVL++VE+    ++DEV+ ++L D+K GS + KGWP  MSAYVVSK A+
Sbjct  181   KLKYVTNEWAKGVLSDVENLTEERVDEVLREYLNDFKLGSLETKGWPVSMSAYVVSKVAI  240

Query  388   NAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             NAY RI   K+P+L +NC+ PG VKTD+NYN GK+T +EGA+S V +AL P  GPSG+FF
Sbjct  241   NAYTRILVKKFPNLHINCICPGYVKTDMNYNNGKLTTEEGAESPVWLALLPNGGPSGLFF  300

Query  208   DCKKIIAF  185
               K+  +F
Sbjct  301   SRKEETSF  308



>ref|XP_011091841.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Sesamum 
indicum]
Length=291

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/287 (49%), Positives = 194/287 (68%), Gaps = 24/287 (8%)
 Frame = -1

Query  1042  KRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLD  863
             K+YAVVTG NKGIG EICRQLA +GV VVLTARNE +G +AVE L+  GLSD ++FH+LD
Sbjct  28    KKYAVVTGANKGIGLEICRQLASQGVCVVLTARNEKRGLDAVEMLKKSGLSDYIMFHQLD  87

Query  862   VTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHNYEL  683
             V D+++++ L  FI +  G+LDIL   A                       +   + YEL
Sbjct  88    VMDSASINYLAGFIKSEIGKLDILTGGA-----------------------KGKGNAYEL  124

Query  682   SAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-P  506
             + EC++INY+G+KR TEA LPLL  S SPRIVNV+S    L  I N+ A+  LN+VE+  
Sbjct  125   AVECMQINYFGTKRTTEALLPLLHLSDSPRIVNVSSTMGALSGIRNKSARETLNDVENLT  184

Query  505   PGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNP  326
               ++D+V+N++L+D K GS + KGWP +   Y VSKAA+ AY R+ A KYP + +NCV P
Sbjct  185   KERIDQVLNEYLKDIKEGSAEAKGWPSYWGVYCVSKAAVTAYTRLLAKKYPKMLINCVCP  244

Query  325   GNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             G VKTD++ ++G +  +EGA+S VR+AL P+DGPSG+FF+  ++ +F
Sbjct  245   GWVKTDLSNHSGPLRPEEGAKSPVRLALLPDDGPSGLFFNRMQVSSF  291



>ref|XP_003600312.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 ref|XP_003627594.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02070.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=287

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 202/290 (70%), Gaps = 8/290 (3%)
 Frame = -1

Query  1048  ASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRG-VGLSDNVLFH  872
             + +RYAVVTG NKGIG E  ++LA  G+ VVLTARN+ +G +A EKL+      + V+FH
Sbjct  4     SKERYAVVTGSNKGIGLETVKRLASNGIKVVLTARNQKRGIQAFEKLKKEFEFCNLVVFH  63

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHN  692
             +LDVTD  +++SLV F+ T FGRLDILVNNAG+ G  A++      +  ++N+ R +S  
Sbjct  64    QLDVTDPFSIASLVEFVKTQFGRLDILVNNAGINGFNADDM-----VEPIINW-RELSQT  117

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             YE++  CI  NYYG K  TEAFLPLLQ S SP IVNV+S    L+ I NEWA+ VL++ E
Sbjct  118   YEMAENCIITNYYGGKETTEAFLPLLQLSDSPVIVNVSSAAGLLKYISNEWARSVLDDTE  177

Query  511   SPPGKL-DEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
             +   +L DEV+ +FL+D+K GS + KGWP ++ AY +SKAA+N+Y R+ A+++P+L +NC
Sbjct  178   NLTEELIDEVLKEFLKDFKQGSLENKGWPTYLCAYKLSKAAVNSYTRLLAYRHPNLCINC  237

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
             V PG VKTD+N NTG ++ + GA S+VR+AL   +  SG FF  + +  F
Sbjct  238   VCPGFVKTDMNRNTGDLSVENGAASVVRLALLSSNSTSGNFFARQDLSCF  287



>ref|XP_004510835.1| PREDICTED: uncharacterized protein LOC101496709 [Cicer arietinum]
Length=599

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 201/282 (71%), Gaps = 7/282 (2%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             ++++RYAVVTG NKGIGFEI RQLA  G+ VVLTAR+E +G +A+E L+  GLSD VLFH
Sbjct  316   ESAERYAVVTGANKGIGFEIVRQLASSGIKVVLTARDEKRGLQALETLKASGLSDFVLFH  375

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNFMRAISHN  692
             +LDV +A++V++L  F+ + FG+LDILVNNAG+ G +  + AL     R     + ++  
Sbjct  376   QLDVANAASVATLADFVKSKFGKLDILVNNAGITGTSPLQ-ALSEDDRR-----KGLTQT  429

Query  691   YELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVE  512
             Y+L+ EC++INYYG+K  T++ LPLL+ S SPRIVNV+S   + ESI N WAK VL++ +
Sbjct  430   YKLAEECLQINYYGAKLTTQSLLPLLKLSDSPRIVNVSSTLGQFESIPNGWAKSVLSDFD  489

Query  511   S-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNC  335
             +    K+D+V+ KFL+D+   S +  GWP  + AY++SKAAMNAY RI A  +P+L +NC
Sbjct  490   NLTEEKVDQVLKKFLKDFNESSIEGNGWPMTLGAYIMSKAAMNAYTRIFAKNFPTLCINC  549

Query  334   VNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
             V PG + TDI  NTG +T +EGA S+V++AL      SG+FF
Sbjct  550   VCPGYIATDITANTGILTVEEGAASVVKLALLSNVNLSGLFF  591


 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 210/300 (70%), Gaps = 18/300 (6%)
 Frame = -1

Query  1051  DASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFH  872
             +A++RYAVVTG NKGIG EI RQLA  G+ VVLTAR+E +G +A+E L+  GLSD V+FH
Sbjct  4     EATQRYAVVTGANKGIGVEIVRQLALSGIKVVLTARDEKRGLQALETLKASGLSDFVVFH  63

Query  871   RLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRASMGRVLNF-------  713
             ++DV +A+++++L  F+ + FG+LDILVNNAG+ G   N+  L     R+L         
Sbjct  64    QVDVANAASIATLADFVKSKFGKLDILVNNAGISGTVINDKDL----ARLLIINPGALSE  119

Query  712   ---MRAISHNYELSAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNE  542
                 +A++  YEL+ EC++INYYG+K  T++ LPLLQ S SP+IVNV+   S L ++ NE
Sbjct  120   DEKKKAMTQTYELAEECLQINYYGAKITTQSLLPLLQLSDSPKIVNVS---STLGNMPNE  176

Query  541   WAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYARITA  365
             WAK + ++V++    K+DEV+ KFLED+K GS + KGWP    AY++SKAAMNAY RI A
Sbjct  177   WAKNIFSDVDNLTEEKVDEVLKKFLEDFKEGSLESKGWPKVGGAYILSKAAMNAYTRIVA  236

Query  364   HKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKIIAF  185
              K+P+L +N + PG V TDI  NTG +TA+EGA SIV++AL P    SG F++  ++ +F
Sbjct  237   KKFPTLCINSICPGFVITDITANTGMLTAEEGAASIVKLALLPNGSLSGQFYNRTEVSSF  296



>gb|EMT05793.1| Short-chain dehydrogenase/reductase 2 [Aegilops tauschii]
Length=314

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 206/301 (68%), Gaps = 11/301 (4%)
 Frame = -1

Query  1060  NASDASKRYAVVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNV  881
             +   AS R AVVTGGNKG+G E+CRQLA +GVTV+LTAR+E +G +AVE +       NV
Sbjct  11    DGKQASHRIAVVTGGNKGVGLEVCRQLAVQGVTVILTARDEKRGKDAVESICLESNLSNV  70

Query  880   LFHRLDVTDASTVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA--------SMGR  725
             +FH+LDV D S+V++L   I + +G LDILVNNA V+G+AA+E  L+A        + GR
Sbjct  71    VFHQLDVRDDSSVAALARHIESRYGELDILVNNAAVVGVAADEEGLKALNLDAETWTSGR  130

Query  724   VLNFMRAISHN-YELSAECIEINYYGSKRMTEAFLPLLQQSK-SPRIVNVTSGWSKLESI  551
                 ++ +  N YE++ +C++ NYYG KR+TEA LPLL+ SK   RIVNV+S  S+L+ +
Sbjct  131   AATLLKDVFQNTYEVARDCLDTNYYGCKRVTEALLPLLKLSKFGARIVNVSSLASELKRM  190

Query  550   HNEWAKGVLNNVE-SPPGKLDEVVNKFLEDYKNGSTKEKGWPPHMSAYVVSKAAMNAYAR  374
              NE  +  L+N++     +++ V+N F++D KNG  +E GWP  + AY VSK  +N Y R
Sbjct  191   PNEELRKDLSNIDIWDEARIEAVLNTFMDDLKNGRLEEAGWPAMLPAYSVSKMVINLYTR  250

Query  373   ITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFFDCKKI  194
             I A ++P ++VNCV PG V+TDIN+N G +T ++GA+  V ++L P+DGP+G +FD  ++
Sbjct  251   ILARRHPEMRVNCVRPGFVRTDINWNLGTLTPEQGARGPVMLSLLPQDGPTGCYFDQTEM  310

Query  193   I  191
             +
Sbjct  311   V  311



>ref|XP_010272342.1| PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase-like 
[Nelumbo nucifera]
Length=389

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 206/326 (63%), Gaps = 45/326 (14%)
 Frame = -1

Query  1030  VVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVTDA  851
             VVTG NKGIG EICRQLA  GV VVLTAR+ENKG EA E L+  GL  NV+FH+LDV D 
Sbjct  65    VVTGANKGIGLEICRQLASNGVLVVLTARDENKGVEAAENLKAAGLP-NVIFHQLDVMDP  123

Query  850   STVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRA----------------------  737
             S+++SL  F+ ++FG+LDILVNNAG+ G+  +  ALRA                      
Sbjct  124   SSIASLGDFVKSHFGKLDILVNNAGIGGVIVDXDALRAQNLQSGEWASYITRWVKEDFLL  183

Query  736   ---------------------SMGRVLNFMRAISHNYELSAECIEINYYGSKRMTEAFLP  620
                                  + G   ++ + ++  Y+L+ EC++ NYYG+KR+TE  +P
Sbjct  184   VEDVGAIVLTTKQTDVVTLILAKGEKPDWKKIMTQTYDLAEECLQTNYYGTKRVTEELIP  243

Query  619   LLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTK  443
             LLQ S S RIVNV+S   KL+ I N  AK VL +++     K+DEV+ +FL+D+K    +
Sbjct  244   LLQLSDSARIVNVSSSMGKLQHISNGRAKEVLGDIDGVTEEKVDEVITEFLKDFKEDCLE  303

Query  442   EKGWPPHMSAYVVSKAAMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKEGAQ  263
              + WP  +S+Y VSKA++NAY RI A K+P+  +NCV PG VKTDIN NTG +T +EGA+
Sbjct  304   SRDWPDVLSSYKVSKASVNAYTRILAKKHPNFCINCVCPGFVKTDINCNTGVLTVEEGAE  363

Query  262   SIVRVALQPEDGPSGVFFDCKKIIAF  185
             S VR+AL P+ GPSG+FF+ K++  F
Sbjct  364   SPVRLALLPDGGPSGLFFNRKEVSPF  389



>gb|KEH18926.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=391

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/281 (53%), Positives = 201/281 (72%), Gaps = 8/281 (3%)
 Frame = -1

Query  1030  VVTGGNKGIGFEICRQLACEGVTVVLTARNENKGSEAVEKLRGVGLSDNVLFHRLDVTDA  851
             VVTG NKGIGF +C+QLA +G+TVVLTAR+E +G EAVEKL+ + L   V+FH+LDV D 
Sbjct  104   VVTGANKGIGFAVCKQLASKGITVVLTARDEKRGLEAVEKLKQLSLPGLVVFHQLDVIDH  163

Query  850   STVSSLVHFINTNFGRLDILVNNAGVIGLAANESALRAS----MGRVLNFMRAISHNYEL  683
             +++ S V FI   FG LD+LVNNAG+ G   +  AL A+     G  +++ + I+  YE 
Sbjct  164   ASIRSFVDFIKNQFGNLDLLVNNAGIPGAQVDGEALAAANTAENGGQIDWSKIITQTYEE  223

Query  682   SAECIEINYYGSKRMTEAFLPLLQQSKSPRIVNVTSGWSKLESIHNEWAKGVLNNVES-P  506
             +   I+ NYYG+K +TEA +PLLQ S SP++VNV+S   KLE + N W K VL+++E+  
Sbjct  224   TELGIKTNYYGAKDLTEALIPLLQLSSSPKVVNVSSSMGKLEKLPNGWPKEVLSDIENLT  283

Query  505   PGKLDEVVNKFLEDYKNGSTKE-KGWPPH-MSAYVVSKAAMNAYARITAHKYPSLQVNCV  332
               K+DEV+N+FL+D+K GS  E KGWP + MS Y++SKA+++AY R+ A KYPS+ +N V
Sbjct  284   EEKIDEVLNQFLKDFKEGSLVENKGWPINSMSTYIISKASLSAYTRVAAKKYPSICINAV  343

Query  331   NPGNVKTDINYNTGKITAKEGAQSIVRVALQPEDGPSGVFF  209
              PG VKTDINYNTG +T  EGA+SI+R+AL   DG SG FF
Sbjct  344   CPGFVKTDINYNTGYLTPDEGAESILRLALL-SDGSSGHFF  383


 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = -1

Query  565  KLESIHNEWAKGVLNNVES-PPGKLDEVVNKFLEDYKNGSTKE-KGWPPH-MSAYVVSKA  395
            KLE + N W K VL+++E+    K+DEV+N+FL+D+K GS  E KGWP + MS Y++SKA
Sbjct  3    KLEKLPNGWPKEVLSDIENLTEEKIDEVLNQFLKDFKEGSLVENKGWPINSMSTYIISKA  62

Query  394  AMNAYARITAHKYPSLQVNCVNPGNVKTDINYNTGKITAKE  272
            +++AY R+ A KYPS+ +N V PG VKTDINYNTG +T  E
Sbjct  63   SLSAYTRVAAKKYPSICINAVCPGFVKTDINYNTGYLTPDE  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2797048251622