BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25081_g2_i4 len=342 path=[8706:0-69 8776:70-114 20212:115-169
8892:170-341]

Length=342
                                                                      Score     E

ref|XP_009788702.1|  PREDICTED: uncharacterized protein LOC104236...  73.9    6e-13   
ref|XP_009594666.1|  PREDICTED: uncharacterized protein LOC104091...  73.6    7e-13   
ref|XP_009773989.1|  PREDICTED: uncharacterized protein LOC104224106  73.6    8e-13   
emb|CDP04795.1|  unnamed protein product                              71.2    4e-12   
emb|CBI21002.3|  unnamed protein product                              70.9    5e-12   
ref|XP_010648620.1|  PREDICTED: uncharacterized protein LOC100264...  69.7    6e-12   
ref|XP_002282448.1|  PREDICTED: uncharacterized protein LOC100264...  70.9    8e-12   Vitis vinifera
gb|EYU21950.1|  hypothetical protein MIMGU_mgv1a019248mg              68.6    1e-11   
ref|XP_010648619.1|  PREDICTED: uncharacterized protein LOC100264...  69.7    1e-11   
ref|XP_011081930.1|  PREDICTED: uncharacterized protein LOC105164...  69.7    1e-11   
ref|XP_006483315.1|  PREDICTED: uncharacterized protein LOC102609...  69.7    2e-11   
ref|XP_009348186.1|  PREDICTED: uncharacterized protein LOC103939799  69.3    2e-11   
ref|XP_002285023.2|  PREDICTED: uncharacterized protein LOC100267997  69.3    2e-11   Vitis vinifera
ref|XP_007013344.1|  RNA binding protein, putative isoform 4          68.9    3e-11   
ref|XP_006450493.1|  hypothetical protein CICLE_v10010442mg           68.9    3e-11   
ref|XP_008385858.1|  PREDICTED: uncharacterized protein LOC103448...  68.9    3e-11   
ref|XP_004287366.1|  PREDICTED: uncharacterized protein LOC101310150  68.6    4e-11   
ref|XP_002309608.1|  agenet domain-containing family protein          68.6    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002324847.2|  hypothetical protein POPTR_0018s01440g           68.6    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011019769.1|  PREDICTED: uncharacterized protein LOC105122...  68.2    5e-11   
ref|XP_011019768.1|  PREDICTED: uncharacterized protein LOC105122...  68.2    5e-11   
ref|XP_011026479.1|  PREDICTED: uncharacterized protein LOC105127...  68.2    5e-11   
ref|XP_008337334.1|  PREDICTED: uncharacterized protein LOC103400461  67.8    6e-11   
ref|XP_008242720.1|  PREDICTED: uncharacterized protein LOC103341019  67.8    8e-11   
ref|XP_009623057.1|  PREDICTED: uncharacterized protein LOC104114...  67.4    1e-10   
ref|XP_007202060.1|  hypothetical protein PRUPE_ppa006804mg           67.4    1e-10   
ref|XP_009108874.1|  PREDICTED: uncharacterized protein LOC103834...  67.0    1e-10   
emb|CDY23326.1|  BnaA08g12200D                                        67.0    1e-10   
emb|CDY39887.1|  BnaC03g67300D                                        67.0    1e-10   
ref|XP_009610690.1|  PREDICTED: uncharacterized protein LOC104104335  65.9    1e-10   
ref|XP_006345862.1|  PREDICTED: uncharacterized protein LOC102579...  67.4    1e-10   
gb|KHN27405.1|  hypothetical protein glysoja_022114                   67.0    1e-10   
ref|XP_002524440.1|  RNA binding protein, putative                    67.0    1e-10   Ricinus communis
ref|XP_010321342.1|  PREDICTED: uncharacterized protein LOC101262...  67.0    1e-10   
gb|KHN15124.1|  hypothetical protein glysoja_011742                   67.0    2e-10   
ref|XP_004240187.1|  PREDICTED: uncharacterized protein LOC101262...  67.0    2e-10   
ref|XP_003550833.1|  PREDICTED: uncharacterized protein LOC100795...  66.6    2e-10   
ref|XP_007223007.1|  hypothetical protein PRUPE_ppa006810mg           66.6    2e-10   
ref|XP_006345863.1|  PREDICTED: uncharacterized protein LOC102579...  66.6    2e-10   
ref|XP_002878866.1|  hypothetical protein ARALYDRAFT_344161           66.2    2e-10   
emb|CDP03409.1|  unnamed protein product                              66.6    2e-10   
ref|XP_008790188.1|  PREDICTED: uncharacterized protein LOC103707469  64.3    3e-10   
ref|XP_006578160.1|  PREDICTED: uncharacterized protein LOC100812...  65.9    3e-10   
gb|KDP32359.1|  hypothetical protein JCGZ_13284                       65.5    5e-10   
gb|KDP33621.1|  hypothetical protein JCGZ_07192                       66.2    5e-10   
ref|XP_009775015.1|  PREDICTED: uncharacterized protein LOC104224...  65.1    6e-10   
ref|XP_010254324.1|  PREDICTED: uncharacterized protein LOC104595328  65.1    6e-10   
ref|XP_010472563.1|  PREDICTED: uncharacterized protein LOC104752...  65.1    7e-10   
gb|EPS73371.1|  hypothetical protein M569_01385                       62.4    9e-10   
ref|XP_004249991.2|  PREDICTED: uncharacterized protein LOC101249876  64.7    1e-09   
ref|XP_006361440.1|  PREDICTED: uncharacterized protein LOC102595...  64.7    1e-09   
ref|XP_006361441.1|  PREDICTED: uncharacterized protein LOC102595...  64.3    1e-09   
gb|KDO80331.1|  hypothetical protein CISIN_1g012860mg                 64.7    1e-09   
gb|KDO80339.1|  hypothetical protein CISIN_1g012860mg                 64.3    1e-09   
ref|XP_006451000.1|  hypothetical protein CICLE_v10008447mg           64.3    1e-09   
ref|XP_010048245.1|  PREDICTED: uncharacterized protein LOC104437066  62.4    1e-09   
gb|EYU29234.1|  hypothetical protein MIMGU_mgv1a018882mg              63.5    2e-09   
ref|XP_006294433.1|  hypothetical protein CARUB_v10023448mg           63.5    2e-09   
ref|XP_008365180.1|  PREDICTED: uncharacterized protein LOC103428...  63.5    2e-09   
ref|XP_010526204.1|  PREDICTED: uncharacterized protein LOC104803...  63.5    2e-09   
gb|KEH32112.1|  plant tudor-like RNA-binding protein                  63.2    3e-09   
ref|XP_010472559.1|  PREDICTED: uncharacterized protein LOC104752...  62.8    4e-09   
emb|CDY35351.1|  BnaA04g14960D                                        62.4    5e-09   
ref|XP_010472558.1|  PREDICTED: uncharacterized protein LOC104752...  62.8    5e-09   
ref|XP_003609252.1|  RNA binding protein                              62.8    5e-09   
ref|XP_010472562.1|  PREDICTED: uncharacterized protein LOC104752...  62.4    6e-09   
ref|XP_010087113.1|  hypothetical protein L484_012544                 61.6    7e-09   
ref|XP_010432715.1|  PREDICTED: uncharacterized protein LOC104716934  62.0    8e-09   
ref|XP_010447388.1|  PREDICTED: uncharacterized protein LOC104730...  61.6    9e-09   
ref|XP_004291486.1|  PREDICTED: uncharacterized protein LOC101295485  61.6    9e-09   
gb|ADE77810.1|  unknown                                               59.7    9e-09   
gb|KGN65299.1|  hypothetical protein Csa_1G305720                     61.6    1e-08   
ref|XP_010047789.1|  PREDICTED: uncharacterized protein LOC104436647  61.6    1e-08   
ref|XP_010688085.1|  PREDICTED: uncharacterized protein LOC104902102  61.6    1e-08   
ref|XP_008785245.1|  PREDICTED: uncharacterized protein LOC103703...  61.2    2e-08   
ref|XP_010049963.1|  PREDICTED: uncharacterized protein LOC104438...  60.8    2e-08   
ref|XP_008785237.1|  PREDICTED: uncharacterized protein LOC103703...  61.2    2e-08   
ref|XP_008785228.1|  PREDICTED: uncharacterized protein LOC103703...  61.2    2e-08   
ref|NP_194970.1|  tudor-like RNA-binding protein                      60.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44933.1|  unknown                                               60.8    2e-08   
ref|XP_003603435.1|  RNA binding protein                              60.8    2e-08   
ref|XP_010546575.1|  PREDICTED: uncharacterized protein LOC104818...  60.5    3e-08   
ref|XP_010546572.1|  PREDICTED: uncharacterized protein LOC104818...  60.5    3e-08   
ref|XP_006392332.1|  hypothetical protein EUTSA_v10023523mg           60.5    3e-08   
ref|XP_010417324.1|  PREDICTED: uncharacterized protein LOC104703...  60.5    3e-08   
ref|XP_010423760.1|  PREDICTED: uncharacterized protein LOC104708...  60.1    3e-08   
ref|XP_010906704.1|  PREDICTED: uncharacterized protein LOC105033...  60.1    3e-08   
ref|XP_010906703.1|  PREDICTED: uncharacterized protein LOC105033...  60.5    3e-08   
ref|XP_010919219.1|  PREDICTED: uncharacterized protein LOC105043...  59.7    5e-08   
ref|XP_010935823.1|  PREDICTED: uncharacterized protein LOC105055623  59.7    5e-08   
ref|XP_008802277.1|  PREDICTED: uncharacterized protein LOC103716...  59.7    5e-08   
ref|XP_010535876.1|  PREDICTED: uncharacterized protein LOC104811043  59.3    6e-08   
ref|XP_002520966.1|  RNA binding protein, putative                    58.9    8e-08   Ricinus communis
ref|XP_008775033.1|  PREDICTED: uncharacterized protein LOC103695472  59.3    8e-08   
ref|XP_007137045.1|  hypothetical protein PHAVU_009G095200g           58.5    1e-07   
emb|CDX76748.1|  BnaC08g33340D                                        57.4    1e-07   
gb|KHG04820.1|  Protein EMSY                                          58.2    2e-07   
ref|XP_010249984.1|  PREDICTED: uncharacterized protein LOC104592353  58.2    2e-07   
ref|XP_008786060.1|  PREDICTED: uncharacterized protein LOC103704...  58.2    2e-07   
dbj|BAJ53247.1|  JHL25H03.10                                          58.2    2e-07   
ref|XP_004501301.1|  PREDICTED: uncharacterized protein LOC101515...  58.2    2e-07   
ref|XP_009381265.1|  PREDICTED: uncharacterized protein LOC103969...  57.8    2e-07   
ref|XP_006838905.1|  hypothetical protein AMTR_s00002p00269570        57.4    2e-07   
ref|XP_010923509.1|  PREDICTED: uncharacterized protein LOC105046579  57.8    2e-07   
ref|XP_010274252.1|  PREDICTED: uncharacterized protein LOC104609591  57.4    2e-07   
ref|XP_010279295.1|  PREDICTED: uncharacterized protein LOC104613259  57.4    3e-07   
gb|KHG19300.1|  Protein EMSY                                          57.4    3e-07   
ref|XP_004981435.1|  PREDICTED: uncharacterized protein LOC101770262  56.6    4e-07   
ref|NP_001148982.1|  RNA binding protein                              56.6    4e-07   Zea mays [maize]
ref|XP_008676588.1|  PREDICTED: RNA binding protein isoform X1        56.2    5e-07   
ref|XP_006479620.1|  PREDICTED: uncharacterized protein LOC102613...  57.0    5e-07   
ref|XP_008785020.1|  PREDICTED: uncharacterized protein LOC103703...  57.0    5e-07   
ref|XP_006657502.1|  PREDICTED: uncharacterized protein LOC102722972  56.6    5e-07   
ref|XP_003603436.1|  ABC transporter G family member                  57.0    5e-07   
ref|XP_006475784.1|  PREDICTED: uncharacterized protein LOC102613557  56.6    6e-07   
ref|XP_009125972.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.2    6e-07   
ref|XP_006443952.1|  hypothetical protein CICLE_v10020513mg           56.2    7e-07   
gb|KDO68598.1|  hypothetical protein CISIN_1g016251mg                 56.2    7e-07   
ref|XP_002307616.1|  hypothetical protein POPTR_0005s23770g           56.2    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010918992.1|  PREDICTED: uncharacterized protein LOC105043...  56.2    8e-07   
emb|CDX68847.1|  BnaC01g06060D                                        55.8    8e-07   
ref|XP_008461067.1|  PREDICTED: uncharacterized protein LOC103499...  55.8    8e-07   
ref|XP_006412474.1|  hypothetical protein EUTSA_v10025566mg           55.8    8e-07   
gb|KGN45306.1|  hypothetical protein Csa_7G433350                     55.8    9e-07   
ref|XP_011032621.1|  PREDICTED: uncharacterized protein LOC105131379  55.8    9e-07   
ref|XP_008219898.1|  PREDICTED: uncharacterized protein LOC103320063  55.8    9e-07   
emb|CDX75245.1|  BnaA01g04570D                                        55.8    9e-07   
ref|XP_009108875.1|  PREDICTED: uncharacterized protein LOC103834...  55.5    1e-06   
ref|NP_001172846.1|  Os02g0204500                                     53.1    1e-06   
ref|XP_004135835.1|  PREDICTED: uncharacterized protein LOC101203701  55.5    1e-06   
ref|XP_009334812.1|  PREDICTED: uncharacterized protein LOC103927597  55.5    1e-06   
gb|KDP21387.1|  hypothetical protein JCGZ_21858                       55.1    2e-06   
ref|XP_006400568.1|  hypothetical protein EUTSA_v10014035mg           55.1    2e-06   
ref|XP_009403411.1|  PREDICTED: uncharacterized protein LOC103986974  55.1    2e-06   
ref|XP_010670685.1|  PREDICTED: uncharacterized protein LOC104887...  55.1    2e-06   
ref|XP_006647055.1|  PREDICTED: uncharacterized protein LOC102712...  54.7    2e-06   
dbj|BAD16008.1|  putative agenet domain-containing protein            54.7    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84934.1|  hypothetical protein OsI_06301                        54.7    2e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_197503.1|  plant Tudor-like RNA-binding protein                54.3    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69656.1|  BnaA03g56010D                                        53.9    3e-06   
ref|XP_009108876.1|  PREDICTED: uncharacterized protein LOC103834...  53.9    3e-06   
ref|XP_002873978.1|  agenet domain-containing protein                 53.9    3e-06   
emb|CDX70905.1|  BnaC03g09890D                                        53.9    4e-06   
ref|XP_009408508.1|  PREDICTED: uncharacterized protein LOC103990932  53.9    4e-06   
tpg|DAA59766.1|  TPA: hypothetical protein ZEAMMB73_643406            50.8    4e-06   
ref|XP_006289073.1|  hypothetical protein CARUB_v10002476mg           53.5    5e-06   
emb|CDY44959.1|  BnaA02g04640D                                        53.5    5e-06   
ref|XP_009126409.1|  PREDICTED: uncharacterized protein LOC103851318  53.5    5e-06   
ref|XP_010667644.1|  PREDICTED: uncharacterized protein LOC104884659  52.8    6e-06   
emb|CDY42325.1|  BnaC02g09310D                                        53.1    6e-06   
ref|XP_009407652.1|  PREDICTED: uncharacterized protein LOC103990...  53.5    6e-06   
ref|XP_010454295.1|  PREDICTED: uncharacterized protein LOC104736072  53.1    6e-06   
ref|XP_010493095.1|  PREDICTED: uncharacterized protein LOC104770379  53.1    6e-06   
gb|EMT01979.1|  hypothetical protein F775_26969                       53.1    7e-06   
ref|XP_002300812.2|  hypothetical protein POPTR_0002s04760g           53.1    7e-06   Populus trichocarpa [western balsam poplar]
gb|EAZ02975.1|  hypothetical protein OsI_25115                        53.1    8e-06   Oryza sativa Indica Group [Indian rice]
dbj|BAC83034.1|  hypothetical protein                                 53.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007050457.1|  Uncharacterized protein TCM_004243               51.6    8e-06   
ref|XP_009381129.1|  PREDICTED: uncharacterized protein LOC103969...  53.1    9e-06   
gb|EMS47996.1|  hypothetical protein TRIUR3_08002                     53.1    9e-06   
ref|XP_002517573.1|  hypothetical protein RCOM_0897890                53.1    9e-06   Ricinus communis
ref|XP_010447389.1|  PREDICTED: uncharacterized protein LOC104730...  52.8    1e-05   
ref|XP_010447385.1|  PREDICTED: uncharacterized protein LOC104730...  52.4    1e-05   
ref|XP_002869273.1|  agenet domain-containing protein                 52.4    1e-05   
ref|XP_006284938.1|  hypothetical protein CARUB_v10006237mg           52.4    2e-05   
ref|XP_010942488.1|  PREDICTED: uncharacterized protein LOC105060469  52.0    2e-05   
ref|XP_006841934.1|  hypothetical protein AMTR_s00042p00209060        51.6    2e-05   
ref|XP_008797067.1|  PREDICTED: uncharacterized protein LOC103712348  51.2    2e-05   
ref|XP_010437909.1|  PREDICTED: uncharacterized protein LOC104721...  51.6    2e-05   
ref|NP_974660.1|  tudor-like RNA-binding protein                      51.6    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHG21627.1|  Calpain-A                                             51.6    2e-05   
ref|XP_011035647.1|  PREDICTED: uncharacterized protein LOC105133...  51.6    3e-05   
ref|XP_010918089.1|  PREDICTED: uncharacterized protein LOC105042529  51.6    3e-05   
ref|XP_010670878.1|  PREDICTED: uncharacterized protein LOC104887824  50.8    3e-05   
ref|XP_002298112.2|  hypothetical protein POPTR_0001s17380g           51.2    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008457864.1|  PREDICTED: uncharacterized protein LOC103497445  50.4    6e-05   
ref|XP_010670102.1|  PREDICTED: uncharacterized protein LOC104887204  50.1    6e-05   
ref|XP_010670861.1|  PREDICTED: uncharacterized protein LOC104887807  50.1    7e-05   
gb|ACN27195.1|  unknown                                               47.4    7e-05   Zea mays [maize]
ref|XP_008461071.1|  PREDICTED: uncharacterized protein LOC103499772  48.9    8e-05   
tpg|DAA42551.1|  TPA: hypothetical protein ZEAMMB73_650642            47.0    1e-04   
gb|EAY92179.1|  hypothetical protein OsI_13894                        50.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004139421.1|  PREDICTED: uncharacterized protein LOC101208549  49.7    1e-04   
ref|XP_004136079.1|  PREDICTED: uncharacterized protein LOC101221277  48.5    2e-04   
ref|NP_001051555.1|  Os03g0796400                                     48.5    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010911315.1|  PREDICTED: uncharacterized protein LOC105037337  48.5    2e-04   
ref|XP_006650728.1|  PREDICTED: uncharacterized protein LOC102711242  48.1    3e-04   
gb|KGN60658.1|  hypothetical protein Csa_2G006040                     48.5    3e-04   
ref|NP_001145054.1|  uncharacterized protein LOC100278243             47.8    3e-04   Zea mays [maize]
ref|XP_010670872.1|  PREDICTED: uncharacterized protein LOC104887818  48.1    3e-04   
ref|XP_010228418.1|  PREDICTED: uncharacterized protein LOC100837...  48.1    3e-04   
ref|XP_010228411.1|  PREDICTED: uncharacterized protein LOC100837...  48.1    3e-04   
ref|XP_008651258.1|  PREDICTED: uncharacterized protein LOC100278...  47.4    3e-04   
ref|XP_008651255.1|  PREDICTED: uncharacterized protein LOC100278...  47.4    3e-04   
dbj|BAK08257.1|  predicted protein                                    47.8    4e-04   
ref|NP_001131239.1|  uncharacterized protein LOC100192548             47.8    4e-04   Zea mays [maize]
ref|XP_002463742.1|  hypothetical protein SORBIDRAFT_01g005220        47.8    4e-04   Sorghum bicolor [broomcorn]
ref|XP_010942486.1|  PREDICTED: uncharacterized protein LOC105060465  47.4    4e-04   
ref|XP_009781192.1|  PREDICTED: uncharacterized protein LOC104230153  47.4    5e-04   
ref|XP_008656642.1|  PREDICTED: uncharacterized protein LOC103636063  47.4    7e-04   
emb|CDM81154.1|  unnamed protein product                              47.4    8e-04   



>ref|XP_009788702.1| PREDICTED: uncharacterized protein LOC104236480 isoform X1 [Nicotiana 
sylvestris]
Length=414

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            A GPLTW++E +LTDLRITLHISNDEHLMELKNLIS+K   Y++
Sbjct  371  AYGPLTWEKEALLTDLRITLHISNDEHLMELKNLISSKGSYYIK  414



>ref|XP_009594666.1| PREDICTED: uncharacterized protein LOC104091099 isoform X1 [Nicotiana 
tomentosiformis]
Length=414

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            A GPLTW++E +LTDLRITLHISNDEHLMELKNLIS+K   Y++
Sbjct  371  AYGPLTWEKEALLTDLRITLHISNDEHLMELKNLISSKGSYYIK  414



>ref|XP_009773989.1| PREDICTED: uncharacterized protein LOC104224106 [Nicotiana sylvestris]
Length=414

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            A GPLTW++E +LTDLRITLHISNDEHLMELKNLIS+K   Y++
Sbjct  371  AYGPLTWEKEALLTDLRITLHISNDEHLMELKNLISSKGSYYIK  414



>emb|CDP04795.1| unnamed protein product [Coffea canephora]
Length=417

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+WDQET+LT+LR+ LHISNDEHLMEL+NL+S K+ ++ R
Sbjct  374  ASGPLSWDQETLLTNLRMMLHISNDEHLMELRNLLSGKTGAHCR  417



>emb|CBI21002.3| unnamed protein product [Vitis vinifera]
Length=386

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+Q TMLT+LR +LHISNDEHLMELKNLISA
Sbjct  344  ASGPLSWEQSTMLTNLRCSLHISNDEHLMELKNLISA  380



>ref|XP_010648620.1| PREDICTED: uncharacterized protein LOC100264564 isoform X3 [Vitis 
vinifera]
 ref|XP_010648621.1| PREDICTED: uncharacterized protein LOC100264564 isoform X3 [Vitis 
vinifera]
 ref|XP_010648622.1| PREDICTED: uncharacterized protein LOC100264564 isoform X3 [Vitis 
vinifera]
Length=285

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+Q TMLT+LR +LHISNDEHLMELKNLISA
Sbjct  243  ASGPLSWEQSTMLTNLRCSLHISNDEHLMELKNLISA  279



>ref|XP_002282448.1| PREDICTED: uncharacterized protein LOC100264564 isoform X1 [Vitis 
vinifera]
 ref|XP_010648618.1| PREDICTED: uncharacterized protein LOC100264564 isoform X1 [Vitis 
vinifera]
Length=440

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+Q TMLT+LR +LHISNDEHLMELKNLISA
Sbjct  398  ASGPLSWEQSTMLTNLRCSLHISNDEHLMELKNLISA  434



>gb|EYU21950.1| hypothetical protein MIMGU_mgv1a019248mg, partial [Erythranthe 
guttata]
Length=270

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE MLT+LRI LHISNDEHLME+K LISAK+   +R
Sbjct  227  ASGPLSWEQEAMLTNLRIMLHISNDEHLMEVKCLISAKTALNVR  270



>ref|XP_010648619.1| PREDICTED: uncharacterized protein LOC100264564 isoform X2 [Vitis 
vinifera]
Length=375

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+Q TMLT+LR +LHISNDEHLMELKNLISA
Sbjct  333  ASGPLSWEQSTMLTNLRCSLHISNDEHLMELKNLISA  369



>ref|XP_011081930.1| PREDICTED: uncharacterized protein LOC105164835 isoform X1 [Sesamum 
indicum]
Length=417

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE +LT+LRI LHISNDEHLMELK+LISAK+   +R
Sbjct  374  ASGPLSWEQEALLTNLRIMLHISNDEHLMELKHLISAKTAINVR  417



>ref|XP_006483315.1| PREDICTED: uncharacterized protein LOC102609023 isoform X1 [Citrus 
sinensis]
 ref|XP_006483316.1| PREDICTED: uncharacterized protein LOC102609023 isoform X2 [Citrus 
sinensis]
Length=461

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRITLHI+NDEHLMEL+NLIS 
Sbjct  357  ASGPLSWEQEALLTNLRITLHITNDEHLMELRNLISG  393



>ref|XP_009348186.1| PREDICTED: uncharacterized protein LOC103939799 [Pyrus x bretschneideri]
Length=393

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLIS  +  ++R
Sbjct  350  ASGPLSWEQEELVTNLRLSLHISNDEHLMELRNLISGDTSIHIR  393



>ref|XP_002285023.2| PREDICTED: uncharacterized protein LOC100267997 [Vitis vinifera]
Length=415

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QET++T+LR++LHISNDEHLMEL+NL+SA
Sbjct  372  ASGPLSWEQETLVTNLRLSLHISNDEHLMELRNLVSA  408



>ref|XP_007013344.1| RNA binding protein, putative isoform 4 [Theobroma cacao]
 gb|EOY30963.1| RNA binding protein, putative isoform 4 [Theobroma cacao]
Length=381

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLISA S
Sbjct  338  ASGPLSWEQEALVTNLRLSLHISNDEHLMELRNLISADS  376



>ref|XP_006450493.1| hypothetical protein CICLE_v10010442mg, partial [Citrus clementina]
 gb|ESR63733.1| hypothetical protein CICLE_v10010442mg, partial [Citrus clementina]
Length=406

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRITLHI+NDEHLMEL+NLIS 
Sbjct  362  ASGPLSWEQEALLTNLRITLHITNDEHLMELRNLISG  398



>ref|XP_008385858.1| PREDICTED: uncharacterized protein LOC103448379 isoform X1 [Malus 
domestica]
 ref|XP_008385866.1| PREDICTED: uncharacterized protein LOC103448379 isoform X1 [Malus 
domestica]
Length=393

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLIS  +  ++R
Sbjct  350  ASGPLSWEQEELVTNLRLSLHISNDEHLMELRNLISGDTSIHIR  393



>ref|XP_004287366.1| PREDICTED: uncharacterized protein LOC101310150 [Fragaria vesca 
subsp. vesca]
Length=386

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLISA +  ++R
Sbjct  343  ASGPLSWEQEELVTNLRLSLHISNDEHLMELRNLISADNNIHIR  386



>ref|XP_002309608.1| agenet domain-containing family protein [Populus trichocarpa]
 gb|EEE93131.1| agenet domain-containing family protein [Populus trichocarpa]
Length=397

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+QE +LT+LRI+L+ISNDEHLMEL+NLISA++
Sbjct  354  ASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAET  392



>ref|XP_002324847.2| hypothetical protein POPTR_0018s01440g [Populus trichocarpa]
 gb|EEF03412.2| hypothetical protein POPTR_0018s01440g [Populus trichocarpa]
Length=425

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRI+L+ISNDEHLMEL+NLISA
Sbjct  382  ASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISA  418



>ref|XP_011019769.1| PREDICTED: uncharacterized protein LOC105122390 isoform X2 [Populus 
euphratica]
Length=383

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+QE +LT+LRI+L+ISNDEHLMEL+NLISA++
Sbjct  340  ASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAET  378



>ref|XP_011019768.1| PREDICTED: uncharacterized protein LOC105122390 isoform X1 [Populus 
euphratica]
Length=414

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+QE +LT+LRI+L+ISNDEHLMEL+NLISA++
Sbjct  371  ASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISAET  409



>ref|XP_011026479.1| PREDICTED: uncharacterized protein LOC105127067 isoform X1 [Populus 
euphratica]
Length=425

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRI+L+ISNDEHLMEL+NLISA
Sbjct  382  ASGPLSWEQEALLTNLRISLNISNDEHLMELRNLISA  418



>ref|XP_008337334.1| PREDICTED: uncharacterized protein LOC103400461 [Malus domestica]
Length=393

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLIS  +  ++R
Sbjct  350  ASGPLSWEQEELVTNLRLSLHISNDEHLMELRNLISGDTSIHIR  393



>ref|XP_008242720.1| PREDICTED: uncharacterized protein LOC103341019 [Prunus mume]
Length=392

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NL+S  +  ++R
Sbjct  349  ASGPLSWEQEELVTNLRLSLHISNDEHLMELRNLVSGDNSIHIR  392



>ref|XP_009623057.1| PREDICTED: uncharacterized protein LOC104114339 isoform X1 [Nicotiana 
tomentosiformis]
Length=402

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+WDQE +LT+LRI LHISNDEHL EL+ LISA
Sbjct  359  ASGPLSWDQEALLTNLRIALHISNDEHLTELRTLISA  395



>ref|XP_007202060.1| hypothetical protein PRUPE_ppa006804mg [Prunus persica]
 gb|EMJ03259.1| hypothetical protein PRUPE_ppa006804mg [Prunus persica]
Length=394

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NL+S  +  ++R
Sbjct  351  ASGPLSWEQEELVTNLRLSLHISNDEHLMELRNLVSGDNSIHIR  394



>ref|XP_009108874.1| PREDICTED: uncharacterized protein LOC103834559 isoform X1 [Brassica 
rapa]
Length=343

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL+W+QET LTDLR++L+IS+DEHLME++NLISA + S
Sbjct  300  ASGPLSWEQETSLTDLRLSLNISDDEHLMEVRNLISAGTRS  340



>emb|CDY23326.1| BnaA08g12200D [Brassica napus]
Length=343

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL+W+QET LTDLR++L+IS+DEHLME++NLISA + S
Sbjct  300  ASGPLSWEQETSLTDLRLSLNISDDEHLMEVRNLISAGTRS  340



>emb|CDY39887.1| BnaC03g67300D [Brassica napus]
Length=350

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL+W+QET LTDLR++L+IS+DEHLME++NLISA + S
Sbjct  307  ASGPLSWEQETSLTDLRLSLNISDDEHLMEVRNLISAGTRS  347



>ref|XP_009610690.1| PREDICTED: uncharacterized protein LOC104104335 [Nicotiana tomentosiformis]
Length=273

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+WDQE +LT+LRI+LHISNDEHL EL+ LISA
Sbjct  219  ASGPLSWDQEALLTNLRISLHISNDEHLAELRTLISA  255



>ref|XP_006345862.1| PREDICTED: uncharacterized protein LOC102579948 isoform X1 [Solanum 
tuberosum]
Length=451

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSY  127
            ASGPL+WDQE +LT+LRI+LHISNDEHL ELK LISA + ++
Sbjct  358  ASGPLSWDQEALLTNLRISLHISNDEHLAELKTLISAGTGTH  399



>gb|KHN27405.1| hypothetical protein glysoja_022114 [Glycine soja]
Length=397

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLIS+++
Sbjct  354  ASGPLSWEQEALMTNLRLSLHISNDEHLMELRNLISSEN  392



>ref|XP_002524440.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF37880.1| RNA binding protein, putative [Ricinus communis]
Length=383

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGP +W+QE M+T+LR++LHISNDEHLME++NL+SA
Sbjct  340  ASGPFSWEQEEMVTNLRLSLHISNDEHLMEVRNLVSA  376



>ref|XP_010321342.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321343.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321344.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321345.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010321346.1| PREDICTED: uncharacterized protein LOC101262920 isoform X1 [Solanum 
lycopersicum]
Length=463

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+WDQE++LT+LRI+LHISNDEHL ELK LISA
Sbjct  355  ASGPLSWDQESLLTNLRISLHISNDEHLAELKTLISA  391



>gb|KHN15124.1| hypothetical protein glysoja_011742 [Glycine soja]
Length=404

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LH+SNDEHLMEL+NLIS+++   LR
Sbjct  361  ASGPLSWEQEALMTNLRLSLHVSNDEHLMELRNLISSENSIPLR  404



>ref|XP_004240187.1| PREDICTED: uncharacterized protein LOC101262920 isoform X2 [Solanum 
lycopersicum]
Length=434

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSY  127
            ASGPL+WDQE++LT+LRI+LHISNDEHL ELK LISA + ++
Sbjct  355  ASGPLSWDQESLLTNLRISLHISNDEHLAELKTLISAGTGTH  396



>ref|XP_003550833.1| PREDICTED: uncharacterized protein LOC100795963 isoform X1 [Glycine 
max]
Length=404

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL+NLIS+++   LR
Sbjct  361  ASGPLSWEQEALMTNLRLSLHISNDEHLMELRNLISSENSIPLR  404



>ref|XP_007223007.1| hypothetical protein PRUPE_ppa006810mg [Prunus persica]
 gb|EMJ24206.1| hypothetical protein PRUPE_ppa006810mg [Prunus persica]
Length=394

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASG LTW+QE +LT+LRI+LHISNDEHL+E++NLISA +  +LR
Sbjct  351  ASGSLTWEQEALLTNLRISLHISNDEHLIEVRNLISAGTNLHLR  394



>ref|XP_006345863.1| PREDICTED: uncharacterized protein LOC102579948 isoform X2 [Solanum 
tuberosum]
Length=434

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+WDQE +LT+LRI+LHISNDEHL ELK LISA
Sbjct  358  ASGPLSWDQEALLTNLRISLHISNDEHLAELKTLISA  394



>ref|XP_002878866.1| hypothetical protein ARALYDRAFT_344161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55125.1| hypothetical protein ARALYDRAFT_344161 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+WDQE  LTDLR++L+ISNDEHLMEL+NL SA
Sbjct  337  ASGPLSWDQEASLTDLRLSLNISNDEHLMELRNLKSA  373



>emb|CDP03409.1| unnamed protein product [Coffea canephora]
Length=413

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            A GPL+W+QET++T+LRI+LHISNDEHLMEL+NL S+ +
Sbjct  370  ALGPLSWEQETLMTNLRISLHISNDEHLMELRNLTSSAT  408



>ref|XP_008790188.1| PREDICTED: uncharacterized protein LOC103707469 [Phoenix dactylifera]
Length=236

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGP++WDQE ++TDLR+ L+ISNDEHL+ELKNL+S++
Sbjct  194  ASGPISWDQEALMTDLRLMLNISNDEHLLELKNLVSSE  231



>ref|XP_006578160.1| PREDICTED: uncharacterized protein LOC100812171 isoform X6 [Glycine 
max]
Length=391

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+ E +LT+LRI+LHISNDEHLME+KNL+S+
Sbjct  351  ASGPLSWEHEELLTNLRISLHISNDEHLMEIKNLVSS  387



>gb|KDP32359.1| hypothetical protein JCGZ_13284 [Jatropha curcas]
Length=411

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            A+GPL+W+QE ++T+LR++LHISNDEHLME++NL+SA
Sbjct  368  AAGPLSWEQEALVTNLRLSLHISNDEHLMEVRNLVSA  404



>gb|KDP33621.1| hypothetical protein JCGZ_07192 [Jatropha curcas]
Length=865

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL W+QE +LT+LRI+L+ISNDEHL+EL+NLIS  +  ++R
Sbjct  822  ASGPLNWEQEVLLTNLRISLNISNDEHLLELRNLISTGTSIHVR  865



>ref|XP_009775015.1| PREDICTED: uncharacterized protein LOC104224976 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRI LHISNDEHL EL+ LISA
Sbjct  359  ASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISA  395



>ref|XP_010254324.1| PREDICTED: uncharacterized protein LOC104595328 [Nelumbo nucifera]
Length=404

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE +LT+LR+ LHISNDEHL EL+NL+SA+
Sbjct  361  ASGPLSWEQEALLTNLRLMLHISNDEHLRELRNLVSAE  398



>ref|XP_010472563.1| PREDICTED: uncharacterized protein LOC104752191 isoform X4 [Camelina 
sativa]
 ref|XP_010472564.1| PREDICTED: uncharacterized protein LOC104752191 isoform X4 [Camelina 
sativa]
 ref|XP_010472565.1| PREDICTED: uncharacterized protein LOC104752191 isoform X4 [Camelina 
sativa]
Length=411

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL WDQE  LTDLR++LHIS DEHLMEL+NL SA
Sbjct  348  ASGPLNWDQEASLTDLRLSLHISVDEHLMELRNLKSA  384



>gb|EPS73371.1| hypothetical protein M569_01385, partial [Genlisea aurea]
Length=173

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  5    SGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYL  130
            SGPLTWD ET+LT+LR  LHISNDEH+ ELK+LISAK  SYL
Sbjct  128  SGPLTWDLETLLTNLRTMLHISNDEHMRELKHLISAKK-SYL  168



>ref|XP_004249991.2| PREDICTED: uncharacterized protein LOC101249876 [Solanum lycopersicum]
Length=434

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRI LHISNDEHL EL+ LIS+
Sbjct  359  ASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISS  395



>ref|XP_006361440.1| PREDICTED: uncharacterized protein LOC102595390 isoform X1 [Solanum 
tuberosum]
Length=434

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRI LHISNDEHL EL+ LIS+
Sbjct  359  ASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISS  395



>ref|XP_006361441.1| PREDICTED: uncharacterized protein LOC102595390 isoform X2 [Solanum 
tuberosum]
Length=411

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE +LT+LRI LHISNDEHL EL+ LIS+
Sbjct  359  ASGPLSWEQEALLTNLRIALHISNDEHLTELRTLISS  395



>gb|KDO80331.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=455

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL++L+SA +   +R
Sbjct  412  ASGPLSWEQEALVTNLRLSLHISNDEHLMELRSLVSADNSIPIR  455



>gb|KDO80339.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80340.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=415

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL++L+SA +   +R
Sbjct  372  ASGPLSWEQEALVTNLRLSLHISNDEHLMELRSLVSADNSIPIR  415



>ref|XP_006451000.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
 ref|XP_006451002.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
 gb|ESR64240.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
 gb|ESR64242.1| hypothetical protein CICLE_v10008447mg [Citrus clementina]
Length=415

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGPL+W+QE ++T+LR++LHISNDEHLMEL++L+SA +   +R
Sbjct  372  ASGPLSWEQEALVTNLRLSLHISNDEHLMELRSLVSADNSIPIR  415



>ref|XP_010048245.1| PREDICTED: uncharacterized protein LOC104437066 [Eucalyptus grandis]
 ref|XP_010048246.1| PREDICTED: uncharacterized protein LOC104437066 [Eucalyptus grandis]
 gb|KCW80447.1| hypothetical protein EUGRSUZ_C01790 [Eucalyptus grandis]
Length=239

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGP++W+QE +LT+LR++L+ISNDEHL+EL+NLIS++
Sbjct  196  ASGPMSWEQEALLTNLRLSLNISNDEHLIELRNLISSR  233



>gb|EYU29234.1| hypothetical protein MIMGU_mgv1a018882mg [Erythranthe guttata]
Length=350

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL+W+QE MLT+LRI L+ISNDEHL ELK+LIS K+ +
Sbjct  308  ASGPLSWEQEAMLTNLRIMLYISNDEHLKELKHLISTKTAN  348



>ref|XP_006294433.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
 ref|XP_006294434.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
 gb|EOA27331.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
 gb|EOA27332.1| hypothetical protein CARUB_v10023448mg [Capsella rubella]
Length=376

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL WDQE  LTDLR++L+ISNDEHL EL+NL SA + S
Sbjct  336  ASGPLNWDQEASLTDLRLSLNISNDEHLTELRNLKSAGTHS  376



>ref|XP_008365180.1| PREDICTED: uncharacterized protein LOC103428840 isoform X1 [Malus 
domestica]
Length=394

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASG L+W+QE +LT+LRI+LHISNDEHLME++NL+S  +   LR
Sbjct  351  ASGSLSWEQEALLTNLRISLHISNDEHLMEVRNLLSPGTNFNLR  394



>ref|XP_010526204.1| PREDICTED: uncharacterized protein LOC104803830 isoform X1 [Tarenaya 
hassleriana]
Length=383

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSY  127
            ASGPL+W+QE  LTDLR++L+IS+DEHLMEL+NLISA + S+
Sbjct  341  ASGPLSWEQEASLTDLRLSLNISDDEHLMELRNLISAGTRSH  382



>gb|KEH32112.1| plant tudor-like RNA-binding protein [Medicago truncatula]
Length=403

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE ++T+LR++L+ISNDEHL EL+NLIS++
Sbjct  360  ASGPLSWEQEALMTNLRLSLNISNDEHLTELRNLISSE  397



>ref|XP_010472559.1| PREDICTED: uncharacterized protein LOC104752191 isoform X2 [Camelina 
sativa]
 ref|XP_010472560.1| PREDICTED: uncharacterized protein LOC104752191 isoform X2 [Camelina 
sativa]
 ref|XP_010472561.1| PREDICTED: uncharacterized protein LOC104752191 isoform X2 [Camelina 
sativa]
Length=430

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNL  103
            ASGPL WDQE  LTDLR++LHIS DEHLMEL+NL
Sbjct  348  ASGPLNWDQEASLTDLRLSLHISVDEHLMELRNL  381



>emb|CDY35351.1| BnaA04g14960D [Brassica napus]
Length=350

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            A GPL WDQE  LTDLR++L+ISNDEHLME++NL S+   S
Sbjct  204  AQGPLNWDQEASLTDLRLSLNISNDEHLMEIRNLTSSAGTS  244



>ref|XP_010472558.1| PREDICTED: uncharacterized protein LOC104752191 isoform X1 [Camelina 
sativa]
Length=436

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNL  103
            ASGPL WDQE  LTDLR++LHIS DEHLMEL+NL
Sbjct  348  ASGPLNWDQEASLTDLRLSLHISVDEHLMELRNL  381



>ref|XP_003609252.1| RNA binding protein [Medicago truncatula]
Length=468

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE ++T+LR++L+ISNDEHL EL+NLIS++
Sbjct  342  ASGPLSWEQEALMTNLRLSLNISNDEHLTELRNLISSE  379



>ref|XP_010472562.1| PREDICTED: uncharacterized protein LOC104752191 isoform X3 [Camelina 
sativa]
Length=417

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNL  103
            ASGPL WDQE  LTDLR++LHIS DEHLMEL+NL
Sbjct  348  ASGPLNWDQEASLTDLRLSLHISVDEHLMELRNL  381



>ref|XP_010087113.1| hypothetical protein L484_012544 [Morus notabilis]
 gb|EXB26553.1| hypothetical protein L484_012544 [Morus notabilis]
Length=333

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++LHISNDEHL +LK+L+SA+
Sbjct  294  ASGPLSWEQESLLTNLRLSLHISNDEHLHQLKHLLSAQ  331



>ref|XP_010432715.1| PREDICTED: uncharacterized protein LOC104716934 [Camelina sativa]
Length=387

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            +SGPL+W+QE  LTDLR++L+IS+DEHLME++NLIS  + S
Sbjct  344  SSGPLSWEQEASLTDLRLSLNISDDEHLMEVRNLISTGTRS  384



>ref|XP_010447388.1| PREDICTED: uncharacterized protein LOC104730029 isoform X2 [Camelina 
sativa]
Length=387

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            +SGPL+W+QE  LTDLR++L+IS+DEHLME++NLIS  + S
Sbjct  344  SSGPLSWEQEASLTDLRLSLNISDDEHLMEVRNLISTGTRS  384



>ref|XP_004291486.1| PREDICTED: uncharacterized protein LOC101295485 [Fragaria vesca 
subsp. vesca]
Length=384

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASG L+W+Q+ +LT LR++LHISNDEHLME++NLISA
Sbjct  339  ASGSLSWEQQDLLTTLRMSLHISNDEHLMEVRNLISA  375



>gb|ADE77810.1| unknown [Picea sitchensis]
Length=162

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+WDQE +LT+LR++L++SNDEHL EL+ L S ++
Sbjct  123  ASGPLSWDQEALLTNLRLSLNVSNDEHLFELRRLCSTQA  161



>gb|KGN65299.1| hypothetical protein Csa_1G305720 [Cucumis sativus]
Length=407

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+WDQE ++T+LR++L+ISNDEHLM+LK LISA
Sbjct  364  ASGPLSWDQEVLITNLRLSLNISNDEHLMQLKYLISA  400



>ref|XP_010047789.1| PREDICTED: uncharacterized protein LOC104436647 [Eucalyptus grandis]
 ref|XP_010047790.1| PREDICTED: uncharacterized protein LOC104436647 [Eucalyptus grandis]
 gb|KCW79773.1| hypothetical protein EUGRSUZ_C01115 [Eucalyptus grandis]
Length=418

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL+W+QE ++T+LRI+LHISNDEHL ELK L+S
Sbjct  378  ASGPLSWEQEALVTNLRISLHISNDEHLTELKKLVS  413



>ref|XP_010688085.1| PREDICTED: uncharacterized protein LOC104902102 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSC  121
            ASGPL+W+QE +LT+LR +LHIS DEHL E+KNL+S+++C
Sbjct  370  ASGPLSWEQELLLTNLRHSLHISIDEHLKEIKNLVSSRTC  409



>ref|XP_008785245.1| PREDICTED: uncharacterized protein LOC103703932 isoform X3 [Phoenix 
dactylifera]
Length=412

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGP++W+QE ++T+LR+ L+ISNDEHL+ELKNL+S++
Sbjct  349  ASGPISWEQEALMTNLRLMLNISNDEHLLELKNLVSSE  386



>ref|XP_010049963.1| PREDICTED: uncharacterized protein LOC104438501 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049964.1| PREDICTED: uncharacterized protein LOC104438501 isoform X1 [Eucalyptus 
grandis]
 gb|KCW82797.1| hypothetical protein EUGRSUZ_C04172 [Eucalyptus grandis]
Length=401

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+QE ++++LR++LHIS+DEHL+EL+NL+ + S
Sbjct  356  ASGPLSWEQEALISNLRLSLHISDDEHLLELRNLVFSDS  394



>ref|XP_008785237.1| PREDICTED: uncharacterized protein LOC103703932 isoform X2 [Phoenix 
dactylifera]
Length=415

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGP++W+QE ++T+LR+ L+ISNDEHL+ELKNL+S++
Sbjct  349  ASGPISWEQEALMTNLRLMLNISNDEHLLELKNLVSSE  386



>ref|XP_008785228.1| PREDICTED: uncharacterized protein LOC103703932 isoform X1 [Phoenix 
dactylifera]
Length=434

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGP++W+QE ++T+LR+ L+ISNDEHL+ELKNL+S++
Sbjct  349  ASGPISWEQEALMTNLRLMLNISNDEHLLELKNLVSSE  386



>ref|NP_194970.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
 emb|CAA22571.1| putative protein [Arabidopsis thaliana]
 emb|CAB79961.1| putative protein [Arabidopsis thaliana]
 gb|AAO23651.1| At4g32440 [Arabidopsis thaliana]
 dbj|BAE99365.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86059.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
Length=377

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            +SGPL+W+QE  LTDLR++L+IS+DEHLME++NLIS  + S
Sbjct  334  SSGPLSWEQEASLTDLRLSLNISDDEHLMEVRNLISTGTRS  374



>gb|AFK44933.1| unknown [Medicago truncatula]
Length=417

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W++E +LT+LRI+L+ISNDEHLM +KNL+S+
Sbjct  377  ASGPLSWEKEELLTNLRISLNISNDEHLMGIKNLVSS  413



>ref|XP_003603435.1| RNA binding protein [Medicago truncatula]
 gb|AES73686.1| agenet domain protein [Medicago truncatula]
Length=417

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W++E +LT+LRI+L+ISNDEHLM +KNL+S+
Sbjct  377  ASGPLSWEKEELLTNLRISLNISNDEHLMGIKNLVSS  413



>ref|XP_010546575.1| PREDICTED: uncharacterized protein LOC104818626 isoform X2 [Tarenaya 
hassleriana]
Length=386

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSY  127
            ASGPL+W+QE  LTDLR++L+IS+ EHL EL+NLISA S S+
Sbjct  344  ASGPLSWEQEASLTDLRLSLNISDAEHLTELRNLISAGSRSH  385



>ref|XP_010546572.1| PREDICTED: uncharacterized protein LOC104818626 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546574.1| PREDICTED: uncharacterized protein LOC104818626 isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSY  127
            ASGPL+W+QE  LTDLR++L+IS+ EHL EL+NLISA S S+
Sbjct  344  ASGPLSWEQEASLTDLRLSLNISDAEHLTELRNLISAGSRSH  385



>ref|XP_006392332.1| hypothetical protein EUTSA_v10023523mg [Eutrema salsugineum]
 gb|ESQ29618.1| hypothetical protein EUTSA_v10023523mg [Eutrema salsugineum]
Length=384

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL WDQE  LTDLR++L+IS DEHLMEL+NL S  + S
Sbjct  341  ASGPLNWDQEASLTDLRLSLNISTDEHLMELRNLKSVGTYS  381



>ref|XP_010417324.1| PREDICTED: uncharacterized protein LOC104703086 isoform X1 [Camelina 
sativa]
 ref|XP_010417326.1| PREDICTED: uncharacterized protein LOC104703086 isoform X1 [Camelina 
sativa]
Length=408

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL WDQE  LTDLR++L+IS DEHLMEL++L SA
Sbjct  345  ASGPLNWDQEASLTDLRLSLNISVDEHLMELRHLKSA  381



>ref|XP_010423760.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423761.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423762.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423763.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423764.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423765.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423766.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423767.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423768.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
 ref|XP_010423769.1| PREDICTED: uncharacterized protein LOC104708831 isoform X1 [Camelina 
sativa]
Length=408

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL WDQE  LTDLR++L+IS DEHLMEL++L SA
Sbjct  345  ASGPLNWDQEASLTDLRLSLNISVDEHLMELRHLKSA  381



>ref|XP_010906704.1| PREDICTED: uncharacterized protein LOC105033538 isoform X2 [Elaeis 
guineensis]
Length=401

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W++E ++T+LRI LHISNDEH++EL++L SAK
Sbjct  360  ASGPLSWEKEALITNLRIMLHISNDEHILELRHLPSAK  397



>ref|XP_010906703.1| PREDICTED: uncharacterized protein LOC105033538 isoform X1 [Elaeis 
guineensis]
Length=431

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W++E ++T+LRI LHISNDEH++EL++L SAK
Sbjct  390  ASGPLSWEKEALITNLRIMLHISNDEHILELRHLPSAK  427



>ref|XP_010919219.1| PREDICTED: uncharacterized protein LOC105043194 isoform X2 [Elaeis 
guineensis]
Length=411

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W++E ++T+LR+ LHISNDEHL+EL+ L SAK+
Sbjct  359  ASGPLSWEKEALMTNLRLMLHISNDEHLLELRYLASAKT  397



>ref|XP_010935823.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935830.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935838.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935847.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
 ref|XP_010935856.1| PREDICTED: uncharacterized protein LOC105055623 [Elaeis guineensis]
Length=398

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE++LT+LR++LHISN+EHL +L++L+SA
Sbjct  362  ASGPLSWEQESLLTNLRLSLHISNEEHLHQLRHLLSA  398



>ref|XP_008802277.1| PREDICTED: uncharacterized protein LOC103716167 isoform X1 [Phoenix 
dactylifera]
Length=398

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+QE++LT+LR++LHISN+EHL +L++L+SA
Sbjct  362  ASGPLSWEQESLLTNLRLSLHISNEEHLHQLRHLLSA  398



>ref|XP_010535876.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535877.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535878.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535880.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
 ref|XP_010535881.1| PREDICTED: uncharacterized protein LOC104811043 [Tarenaya hassleriana]
Length=398

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGP+TW+QE  +T+LR  L+ISNDEHL++++NL+SA + +  R
Sbjct  355  ASGPITWEQEVWITNLRAALNISNDEHLVQIRNLVSADNSTVYR  398



>ref|XP_002520966.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF41383.1| RNA binding protein, putative [Ricinus communis]
Length=383

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL+W+QE++LT+LR++LHIS++EHL++LK+L+S
Sbjct  347  ASGPLSWEQESLLTNLRLSLHISDEEHLLQLKHLLS  382



>ref|XP_008775033.1| PREDICTED: uncharacterized protein LOC103695472 [Phoenix dactylifera]
Length=410

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W++E ++TDLR+ LHISNDEHL+EL++L S  +
Sbjct  358  ASGPLSWEREALMTDLRLMLHISNDEHLLELRHLASTNT  396



>ref|XP_007137045.1| hypothetical protein PHAVU_009G095200g [Phaseolus vulgaris]
 gb|ESW09039.1| hypothetical protein PHAVU_009G095200g [Phaseolus vulgaris]
Length=395

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASG L+W+QE +LT+LRI+L+ISNDEHLME+KNL S
Sbjct  355  ASGSLSWEQEELLTNLRISLNISNDEHLMEIKNLGS  390



>emb|CDX76748.1| BnaC08g33340D [Brassica napus]
Length=281

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL W+QE  LTDLR++L+IS DEHLME++NL S  S
Sbjct  240  ASGPLDWNQEASLTDLRLSLNISTDEHLMEIRNLKSTHS  278



>gb|KHG04820.1| Protein EMSY [Gossypium arboreum]
Length=400

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPLTW+QE +LT+LR++L+IS++EHL++L++L+SA+
Sbjct  360  ASGPLTWEQEFLLTNLRLSLNISDEEHLLQLRHLLSAQ  397



>ref|XP_010249984.1| PREDICTED: uncharacterized protein LOC104592353 [Nelumbo nucifera]
Length=421

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASG L+W+QE +LT+LR+ LHISNDEHL EL++L+S+++
Sbjct  378  ASGSLSWEQEALLTNLRLMLHISNDEHLKELRSLVSSEA  416



>ref|XP_008786060.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786061.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786063.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786064.1| PREDICTED: uncharacterized protein LOC103704514 isoform X1 [Phoenix 
dactylifera]
Length=400

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            A GPL+W+QE++LT+LR++LHISN+EHL +L++L+SA
Sbjct  364  ALGPLSWEQESLLTNLRLSLHISNEEHLHQLRHLLSA  400



>dbj|BAJ53247.1| JHL25H03.10 [Jatropha curcas]
Length=399

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPLTW+ E  LT+LR  LHIS+DEHLM L+NLI A S
Sbjct  353  ASGPLTWEDEARLTNLRHMLHISDDEHLMVLRNLIPANS  391



>ref|XP_004501301.1| PREDICTED: uncharacterized protein LOC101515344 isoform X1 [Cicer 
arietinum]
Length=423

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W++E +LT+LRI+L+ISNDEHL  +KNL+S 
Sbjct  383  ASGPLSWEKEELLTNLRISLNISNDEHLTGIKNLVSG  419



>ref|XP_009381265.1| PREDICTED: uncharacterized protein LOC103969462 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=401

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLI  106
            ASGP++W+QE ++T+LR+ L+ISNDEHL+EL+NLI
Sbjct  358  ASGPISWEQEALMTNLRLMLNISNDEHLVELRNLI  392



>ref|XP_006838905.1| hypothetical protein AMTR_s00002p00269570 [Amborella trichopoda]
 gb|ERN01474.1| hypothetical protein AMTR_s00002p00269570 [Amborella trichopoda]
Length=367

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE +LT+LR++LHI+N+EHL EL++L + +
Sbjct  328  ASGPLSWEQEALLTNLRLSLHITNEEHLFELRHLCTPQ  365



>ref|XP_010923509.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
 ref|XP_010923510.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
 ref|XP_010923511.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
 ref|XP_010923512.1| PREDICTED: uncharacterized protein LOC105046579 [Elaeis guineensis]
Length=403

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            A GPL+W+QE++LT+LR+ LHISN+EHL +L++L+SA++
Sbjct  364  ALGPLSWEQESLLTNLRLALHISNEEHLHQLRHLLSAQN  402



>ref|XP_010274252.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274253.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274254.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274255.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274256.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274257.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274258.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
 ref|XP_010274259.1| PREDICTED: uncharacterized protein LOC104609591 [Nelumbo nucifera]
Length=379

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL+W+QE +LT+LR++LHISN+EHL +L+ L+S
Sbjct  344  ASGPLSWEQEYLLTNLRLSLHISNEEHLNQLRYLLS  379



>ref|XP_010279295.1| PREDICTED: uncharacterized protein LOC104613259 [Nelumbo nucifera]
 ref|XP_010279296.1| PREDICTED: uncharacterized protein LOC104613259 [Nelumbo nucifera]
 ref|XP_010279297.1| PREDICTED: uncharacterized protein LOC104613259 [Nelumbo nucifera]
Length=392

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL+W+QE++LT+LR++L+ISN+EHL++L++L+S
Sbjct  357  ASGPLSWEQESLLTNLRLSLNISNEEHLLQLRHLLS  392



>gb|KHG19300.1| Protein EMSY [Gossypium arboreum]
Length=383

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPLTW+QE +LT+LR++L+IS+ EHL++L++L+SA
Sbjct  344  ASGPLTWEQEALLTNLRLSLNISDGEHLLQLRHLLSA  380



>ref|XP_004981435.1| PREDICTED: uncharacterized protein LOC101770262 [Setaria italica]
Length=292

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPLTW+QE +LT+LR++L+ISN+EHL++L+ L+S+
Sbjct  256  ASGPLTWEQEALLTNLRLSLNISNEEHLLQLRRLMSS  292



>ref|NP_001148982.1| RNA binding protein [Zea mays]
 gb|ACG33716.1| RNA binding protein [Zea mays]
Length=309

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPLTW QE +LT+LR++L+ISN+EHL++LK L+S+
Sbjct  273  ASGPLTWAQEALLTNLRLSLNISNEEHLLQLKRLLSS  309



>ref|XP_008676588.1| PREDICTED: RNA binding protein isoform X1 [Zea mays]
 ref|XP_008676593.1| PREDICTED: RNA binding protein isoform X1 [Zea mays]
 tpg|DAA51919.1| TPA: RNA binding protein isoform 1 [Zea mays]
 tpg|DAA51920.1| TPA: RNA binding protein isoform 2 [Zea mays]
Length=309

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPLTW QE +LT+LR++L+ISN+EHL++LK L+S+
Sbjct  273  ASGPLTWAQEALLTNLRLSLNISNEEHLLQLKRLLSS  309



>ref|XP_006479620.1| PREDICTED: uncharacterized protein LOC102613084 isoform X1 [Citrus 
sinensis]
Length=419

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++L+IS++EHL++L++L+SA+
Sbjct  380  ASGPLSWEQESLLTNLRLSLNISDEEHLLQLRHLLSAQ  417



>ref|XP_008785020.1| PREDICTED: uncharacterized protein LOC103703809 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008785021.1| PREDICTED: uncharacterized protein LOC103703809 isoform X1 [Phoenix 
dactylifera]
Length=408

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            +SGPL+W++E +LT+LR+ L ISNDEH++EL++L SAK+
Sbjct  360  SSGPLSWEKEVLLTNLRLMLRISNDEHILELRHLASAKT  398



>ref|XP_006657502.1| PREDICTED: uncharacterized protein LOC102722972 [Oryza brachyantha]
Length=355

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPLTW+QE++LT+LR++L+I+N+EHL++L++L+S+
Sbjct  319  ASGPLTWEQESLLTNLRLSLNITNEEHLLQLRHLLSS  355



>ref|XP_003603436.1| ABC transporter G family member [Medicago truncatula]
Length=469

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLI  106
            ASGPL+W++E +LT+LRI+L+ISNDEHLM +KNL+
Sbjct  429  ASGPLSWEKEELLTNLRISLNISNDEHLMGIKNLV  463


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYL  130
            A+GPLTW +E +LT+LR+ L+IS DEHL  +KNL+S+ +  Y+
Sbjct  134  AAGPLTWKKEEVLTNLRLLLNISIDEHLKGIKNLVSSVTSVYI  176



>ref|XP_006475784.1| PREDICTED: uncharacterized protein LOC102613557 [Citrus sinensis]
 gb|KDO80334.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80335.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
 gb|KDO80336.1| hypothetical protein CISIN_1g012860mg [Citrus sinensis]
Length=416

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASGPL+W+QE ++T+LR++LHISNDEHLME
Sbjct  372  ASGPLSWEQEALVTNLRLSLHISNDEHLME  401



>ref|XP_009125972.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103850924 
[Brassica rapa]
Length=402

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASGPL+W+QET LTDLR++L+IS+DEHLME
Sbjct  314  ASGPLSWEQETSLTDLRLSLNISDDEHLME  343



>ref|XP_006443952.1| hypothetical protein CICLE_v10020513mg [Citrus clementina]
 ref|XP_006479621.1| PREDICTED: uncharacterized protein LOC102613084 isoform X2 [Citrus 
sinensis]
 ref|XP_006479622.1| PREDICTED: uncharacterized protein LOC102613084 isoform X3 [Citrus 
sinensis]
 ref|XP_006479623.1| PREDICTED: uncharacterized protein LOC102613084 isoform X4 [Citrus 
sinensis]
 gb|ESR57192.1| hypothetical protein CICLE_v10020513mg [Citrus clementina]
Length=392

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++L+IS++EHL++L++L+SA+
Sbjct  353  ASGPLSWEQESLLTNLRLSLNISDEEHLLQLRHLLSAQ  390



>gb|KDO68598.1| hypothetical protein CISIN_1g016251mg [Citrus sinensis]
 gb|KDO68599.1| hypothetical protein CISIN_1g016251mg [Citrus sinensis]
 gb|KDO68600.1| hypothetical protein CISIN_1g016251mg [Citrus sinensis]
Length=392

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++L+IS++EHL++L++L+SA+
Sbjct  353  ASGPLSWEQESLLTNLRLSLNISDEEHLLQLRHLLSAQ  390



>ref|XP_002307616.1| hypothetical protein POPTR_0005s23770g [Populus trichocarpa]
 gb|EEE94612.1| hypothetical protein POPTR_0005s23770g [Populus trichocarpa]
Length=379

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++LHIS++EHL+ L+ L+S +
Sbjct  340  ASGPLSWEQESLLTNLRLSLHISDEEHLLHLRQLLSTQ  377



>ref|XP_010918992.1| PREDICTED: uncharacterized protein LOC105043194 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919066.1| PREDICTED: uncharacterized protein LOC105043194 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919142.1| PREDICTED: uncharacterized protein LOC105043194 isoform X1 [Elaeis 
guineensis]
Length=412

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLI  106
            ASGPL+W++E ++T+LR+ LHISNDEHL+EL+  I
Sbjct  359  ASGPLSWEKEALMTNLRLMLHISNDEHLLELRRSI  393



>emb|CDX68847.1| BnaC01g06060D [Brassica napus]
Length=360

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASGPL+W+QET LTDLR++L+IS+DEHLME
Sbjct  314  ASGPLSWEQETSLTDLRLSLNISDDEHLME  343



>ref|XP_008461067.1| PREDICTED: uncharacterized protein LOC103499769 isoform X1 [Cucumis 
melo]
Length=366

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPL+W+ E  ++++R +LHISNDE+LMEL+NL+SA
Sbjct  324  ASGPLSWEDEGQVSNIRASLHISNDEYLMELRNLMSA  360



>ref|XP_006412474.1| hypothetical protein EUTSA_v10025566mg [Eutrema salsugineum]
 gb|ESQ53927.1| hypothetical protein EUTSA_v10025566mg [Eutrema salsugineum]
Length=356

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASGPL+W+QET LTDLR++L+IS+DEHLME
Sbjct  313  ASGPLSWEQETSLTDLRLSLNISDDEHLME  342



>gb|KGN45306.1| hypothetical protein Csa_7G433350 [Cucumis sativus]
Length=366

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+ E  ++++R +LHISNDE+LMEL+NL+SA +
Sbjct  324  ASGPLSWEDEGQVSNIRASLHISNDEYLMELRNLMSANT  362



>ref|XP_011032621.1| PREDICTED: uncharacterized protein LOC105131379 [Populus euphratica]
 ref|XP_011032622.1| PREDICTED: uncharacterized protein LOC105131379 [Populus euphratica]
Length=382

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++LHIS++EHL+ L+ L+S +
Sbjct  343  ASGPLSWEQESLLTNLRLSLHISDEEHLLHLRQLLSTQ  380



>ref|XP_008219898.1| PREDICTED: uncharacterized protein LOC103320063 [Prunus mume]
Length=377

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASG LTW+QE +LT+LRI+LHISNDEHL+E
Sbjct  333  ASGSLTWEQEALLTNLRISLHISNDEHLIE  362



>emb|CDX75245.1| BnaA01g04570D [Brassica napus]
Length=361

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASGPL+W+QET LTDLR++L+IS+DEHLME
Sbjct  315  ASGPLSWEQETSLTDLRLSLNISDDEHLME  344



>ref|XP_009108875.1| PREDICTED: uncharacterized protein LOC103834559 isoform X2 [Brassica 
rapa]
Length=338

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMEL  94
            ASGPL+W+QET LTDLR++L+IS+DEHLMEL
Sbjct  300  ASGPLSWEQETSLTDLRLSLNISDDEHLMEL  330



>ref|NP_001172846.1| Os02g0204500 [Oryza sativa Japonica Group]
 dbj|BAH91575.1| Os02g0204500, partial [Oryza sativa Japonica Group]
Length=126

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASG ++W+QE M+T+LR+TL+IS DEHL EL++L+S++
Sbjct  85   ASGSISWEQEAMMTNLRLTLNISTDEHLSELRSLVSSE  122



>ref|XP_004135835.1| PREDICTED: uncharacterized protein LOC101203701 [Cucumis sativus]
 ref|XP_004166618.1| PREDICTED: uncharacterized protein LOC101230291 [Cucumis sativus]
Length=377

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+ E  ++++R +LHISNDE+LMEL+NL+SA +
Sbjct  335  ASGPLSWEDEGQVSNIRASLHISNDEYLMELRNLMSANT  373



>ref|XP_009334812.1| PREDICTED: uncharacterized protein LOC103927597 [Pyrus x bretschneideri]
Length=401

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            ASG L+W+QE +LT+LRI+LHISNDEHLME
Sbjct  357  ASGSLSWEQEALLTNLRISLHISNDEHLME  386



>gb|KDP21387.1| hypothetical protein JCGZ_21858 [Jatropha curcas]
Length=385

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++L+IS++EHL++L++L+S +
Sbjct  345  ASGPLSWEQESLLTNLRLSLNISDEEHLLQLRHLLSTR  382



>ref|XP_006400568.1| hypothetical protein EUTSA_v10014035mg [Eutrema salsugineum]
 gb|ESQ42021.1| hypothetical protein EUTSA_v10014035mg [Eutrema salsugineum]
Length=338

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS  + +  R
Sbjct  294  ASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLISDDNSTIFR  338



>ref|XP_009403411.1| PREDICTED: uncharacterized protein LOC103986974 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGP++W+ E  +T+LR+ L+ISNDEHLME++NLI ++
Sbjct  362  ASGPISWEWEAFMTNLRLMLNISNDEHLMEIRNLIRSE  399



>ref|XP_010670685.1| PREDICTED: uncharacterized protein LOC104887681 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=378

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL+W QET LT+LR+ L++SNDEHL EL+ L S
Sbjct  334  ASGPLSWQQETALTNLRLKLYVSNDEHLTELRRLRS  369



>ref|XP_006647055.1| PREDICTED: uncharacterized protein LOC102712500 isoform X1 [Oryza 
brachyantha]
Length=410

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASG ++W+QE ++T+LR+TL+IS DEHL EL+NLIS++
Sbjct  369  ASGSISWEQEALMTNLRLTLNISTDEHLSELRNLISSE  406



>dbj|BAD16008.1| putative agenet domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD38428.1| putative agenet domain-containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ22156.1| hypothetical protein OsJ_05817 [Oryza sativa Japonica Group]
 dbj|BAG91727.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00119.1| unnamed protein product [Oryza sativa Japonica Group]
Length=410

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASG ++W+QE M+T+LR+TL+IS DEHL EL++L+S++
Sbjct  369  ASGSISWEQEAMMTNLRLTLNISTDEHLSELRSLVSSE  406



>gb|EAY84934.1| hypothetical protein OsI_06301 [Oryza sativa Indica Group]
Length=410

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASG ++W+QE M+T+LR+TL+IS DEHL EL++L+S++
Sbjct  369  ASGSISWEQEAMMTNLRLTLNISTDEHLSELRSLVSSE  406



>ref|NP_197503.1| plant Tudor-like RNA-binding protein [Arabidopsis thaliana]
 gb|AAM62492.1| unknown [Arabidopsis thaliana]
 gb|AAO24570.1| At5g20030 [Arabidopsis thaliana]
 gb|AED92781.1| plant Tudor-like RNA-binding protein [Arabidopsis thaliana]
Length=326

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS  + +  R
Sbjct  282  ASGPIITWEQETWITNLRLKLNISNEEHLMQIRNLISDDNSTIYR  326



>emb|CDY69656.1| BnaA03g56010D [Brassica napus]
 emb|CDX88864.1| BnaA03g07850D [Brassica napus]
Length=304

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGP-LTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP +TW+QET +T+LR+ L+ISN+EHLM++KNLIS
Sbjct  260  ASGPNITWEQETWITNLRLRLNISNEEHLMQIKNLIS  296



>ref|XP_009108876.1| PREDICTED: uncharacterized protein LOC103834559 isoform X3 [Brassica 
rapa]
Length=335

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMEL  94
            ASGPL+W+QET LTDLR++L+IS+DEHLME 
Sbjct  300  ASGPLSWEQETSLTDLRLSLNISDDEHLMEC  330



>ref|XP_002873978.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50237.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS  + +  R
Sbjct  281  ASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLISDDNSTIYR  325



>emb|CDX70905.1| BnaC03g09890D [Brassica napus]
Length=312

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    ASGP-LTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYLR  133
            ASGP +TW+QET +T+LR+ L+ISN+EHLM+++NLIS  + +  R
Sbjct  268  ASGPNITWEQETWITNLRLRLNISNEEHLMQIRNLISVDNGTTYR  312



>ref|XP_009408508.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408510.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408511.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408512.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408513.1| PREDICTED: uncharacterized protein LOC103990932 [Musa acuminata 
subsp. malaccensis]
Length=374

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL+W+QE++LT+LR++L+ISN+EHL+ L+ L+S
Sbjct  335  ASGPLSWEQESLLTNLRLSLNISNEEHLLHLRQLLS  370



>tpg|DAA59766.1| TPA: hypothetical protein ZEAMMB73_643406 [Zea mays]
Length=73

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   ASGPLTWDQETMLTDLRITLHISNDEHLMEL  94
           A+GPLTW+QE++LT+LR++L+ISN+EHL++ 
Sbjct  39  AAGPLTWEQESLLTNLRLSLNISNEEHLLQF  69



>ref|XP_006289073.1| hypothetical protein CARUB_v10002476mg [Capsella rubella]
 gb|EOA21971.1| hypothetical protein CARUB_v10002476mg [Capsella rubella]
Length=326

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS
Sbjct  282  ASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  318



>emb|CDY44959.1| BnaA02g04640D [Brassica napus]
Length=313

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGP-LTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP +TW+QET +T+LR+ L+ISN+EHLM+++NLIS
Sbjct  269  ASGPNITWEQETWITNLRLRLNISNEEHLMQIRNLIS  305



>ref|XP_009126409.1| PREDICTED: uncharacterized protein LOC103851318 [Brassica rapa]
Length=313

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGP-LTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP +TW+QET +T+LR+ L+ISN+EHLM+++NLIS
Sbjct  269  ASGPNITWEQETWITNLRLRLNISNEEHLMQIRNLIS  305



>ref|XP_010667644.1| PREDICTED: uncharacterized protein LOC104884659 [Beta vulgaris 
subsp. vulgaris]
Length=261

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            +SGPL+W QE  LTDLR+ L +SNDEHL EL+ L S ++
Sbjct  216  SSGPLSWRQEIALTDLRLKLSVSNDEHLTELRRLKSGRN  254



>emb|CDY42325.1| BnaC02g09310D [Brassica napus]
Length=307

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS
Sbjct  263  ASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  299



>ref|XP_009407652.1| PREDICTED: uncharacterized protein LOC103990296 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=409

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            A GP++W++E ++T+LR+ L+ISNDEHLMEL+NL+ ++
Sbjct  366  ALGPISWEREALMTNLRLMLNISNDEHLMELRNLMHSE  403



>ref|XP_010454295.1| PREDICTED: uncharacterized protein LOC104736072 [Camelina sativa]
Length=322

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS
Sbjct  278  ASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  314



>ref|XP_010493095.1| PREDICTED: uncharacterized protein LOC104770379 [Camelina sativa]
Length=326

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGP+ TW+QET +T+LR+ L+ISN+EHLM+++NLIS
Sbjct  282  ASGPIITWEQETWITNLRLRLNISNEEHLMQIRNLIS  318



>gb|EMT01979.1| hypothetical protein F775_26969 [Aegilops tauschii]
Length=386

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            A G ++W+QE ++T+LR+TL+IS DEHL EL+NL ++  CS
Sbjct  345  AYGSISWEQEALMTNLRLTLNISTDEHLSELRNLANSAVCS  385



>ref|XP_002300812.2| hypothetical protein POPTR_0002s04760g [Populus trichocarpa]
 gb|EEE80085.2| hypothetical protein POPTR_0002s04760g [Populus trichocarpa]
Length=394

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPL+W+QE++LT+LR++L+IS++EHL+ L+ L+S +
Sbjct  344  ASGPLSWEQESLLTNLRLSLNISDEEHLLHLRQLLSTQ  381



>gb|EAZ02975.1| hypothetical protein OsI_25115 [Oryza sativa Indica Group]
Length=362

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            A GPLTW+QE++LT+LR++L+I+N+EHL++L++L+S+
Sbjct  326  ALGPLTWEQESLLTNLRLSLNITNEEHLLQLRHLLSS  362



>dbj|BAC83034.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ38899.1| hypothetical protein OsJ_23318 [Oryza sativa Japonica Group]
Length=362

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            A GPLTW+QE++LT+LR++L+I+N+EHL++L++L+S+
Sbjct  326  ALGPLTWEQESLLTNLRLSLNITNEEHLLQLRHLLSS  362



>ref|XP_007050457.1| Uncharacterized protein TCM_004243 [Theobroma cacao]
 gb|EOX94614.1| Uncharacterized protein TCM_004243 [Theobroma cacao]
Length=195

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASGPLTW+QE++LT+LR++L+IS++E+L+ L++L+S +
Sbjct  156  ASGPLTWEQESLLTNLRLSLNISDEEYLLHLRHLLSPQ  193



>ref|XP_009381129.1| PREDICTED: uncharacterized protein LOC103969354 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASG ++W+QE++LT+LR+ L+ISNDE+L EL+NL+S
Sbjct  362  ASGAISWEQESLLTNLRLMLNISNDEYLSELRNLMS  397



>gb|EMS47996.1| hypothetical protein TRIUR3_08002 [Triticum urartu]
Length=387

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            A G ++W+QE ++T+LR+TL+IS DEHL EL+NL ++  CS
Sbjct  346  AYGSISWEQEALMTNLRLTLNISTDEHLSELRNLANSAVCS  386



>ref|XP_002517573.1| hypothetical protein RCOM_0897890 [Ricinus communis]
 gb|EEF44737.1| hypothetical protein RCOM_0897890 [Ricinus communis]
Length=473

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ASGPL+W+ E  LT+LR  LHIS+DEHL  L+ LISA S
Sbjct  430  ASGPLSWEDEAKLTNLRDMLHISDDEHLKVLRILISANS  468



>ref|XP_010447389.1| PREDICTED: uncharacterized protein LOC104730029 isoform X3 [Camelina 
sativa]
Length=385

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            +SGPL+W+QE  LTDLR++L+IS+DEHLME
Sbjct  344  SSGPLSWEQEASLTDLRLSLNISDDEHLME  373



>ref|XP_010447385.1| PREDICTED: uncharacterized protein LOC104730029 isoform X1 [Camelina 
sativa]
 ref|XP_010447386.1| PREDICTED: uncharacterized protein LOC104730029 isoform X1 [Camelina 
sativa]
Length=387

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            +SGPL+W+QE  LTDLR++L+IS+DEHLME
Sbjct  344  SSGPLSWEQEASLTDLRLSLNISDDEHLME  373



>ref|XP_002869273.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45532.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            +SGPL+W+QE  LTDLR++L+IS+DEHLME
Sbjct  335  SSGPLSWEQEASLTDLRLSLNISDDEHLME  364



>ref|XP_006284938.1| hypothetical protein CARUB_v10006237mg [Capsella rubella]
 gb|EOA17836.1| hypothetical protein CARUB_v10006237mg [Capsella rubella]
Length=390

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            +SGPL+W+QE  LTDLR++L+IS+DEHLME
Sbjct  347  SSGPLSWEQEASLTDLRLSLNISDDEHLME  376



>ref|XP_010942488.1| PREDICTED: uncharacterized protein LOC105060469 [Elaeis guineensis]
Length=332

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            +SG LTW QE  LT+LR+ LHISNDEH  ELK L S +S
Sbjct  288  SSGTLTWKQEGYLTNLRLGLHISNDEHQSELKRLASTQS  326



>ref|XP_006841934.1| hypothetical protein AMTR_s00042p00209060 [Amborella trichopoda]
 gb|ERN03609.1| hypothetical protein AMTR_s00042p00209060 [Amborella trichopoda]
Length=290

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISA  112
            ASGPLTW+ E ++T LR+ LHIS DEHL EL++L S+
Sbjct  253  ASGPLTWEHEALMTTLRLNLHISIDEHLAELRHLASS  289



>ref|XP_008797067.1| PREDICTED: uncharacterized protein LOC103712348 [Phoenix dactylifera]
Length=266

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   LTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            LTW+QE  LT LR+ L ISNDEHL ELK+L SA+S
Sbjct  226  LTWEQEAFLTQLRLQLRISNDEHLAELKHLASAQS  260



>ref|XP_010437909.1| PREDICTED: uncharacterized protein LOC104721588 isoform X1 [Camelina 
sativa]
Length=379

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            +SGPL+W+QE  LTDLR++L+IS+DEHLME
Sbjct  348  SSGPLSWEQEVSLTDLRLSLNISDDEHLME  377



>ref|NP_974660.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
 dbj|BAF01084.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86060.1| tudor-like RNA-binding protein [Arabidopsis thaliana]
Length=393

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLME  91
            +SGPL+W+QE  LTDLR++L+IS+DEHLME
Sbjct  334  SSGPLSWEQEASLTDLRLSLNISDDEHLME  363



>gb|KHG21627.1| Calpain-A [Gossypium arboreum]
Length=335

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  5    SGPLTWDQETMLTDLRITLHISNDEHLMELKNL  103
            SGPLTW++E  +T+LR TL+ISNDEHL EL+ L
Sbjct  291  SGPLTWEEEAKVTNLRCTLNISNDEHLRELRKL  323



>ref|XP_011035647.1| PREDICTED: uncharacterized protein LOC105133379 isoform X1 [Populus 
euphratica]
Length=394

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            +SGPL+W+ E  LT +R  LHIS+DEHLM L+NL S  S
Sbjct  351  SSGPLSWEDEENLTSIRDKLHISDDEHLMVLRNLTSVNS  389



>ref|XP_010918089.1| PREDICTED: uncharacterized protein LOC105042529 [Elaeis guineensis]
Length=415

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELK  97
            A+GPL+WD+E ++T+LR  L ISNDEHL EL+
Sbjct  359  AAGPLSWDKEVLITNLRFMLRISNDEHLSELR  390



>ref|XP_010670878.1| PREDICTED: uncharacterized protein LOC104887824 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            +SGPL+W+QE  LT LR+ L +SNDEHL EL+ L S++
Sbjct  229  SSGPLSWEQEIELTKLRLKLSVSNDEHLTELRRLKSSR  266



>ref|XP_002298112.2| hypothetical protein POPTR_0001s17380g [Populus trichocarpa]
 gb|EEE82917.2| hypothetical protein POPTR_0001s17380g [Populus trichocarpa]
Length=394

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            ++GPL+W+ E  LT LR  LHIS+DEHLM L+NL S  S
Sbjct  351  SAGPLSWEDEENLTSLRDELHISDDEHLMVLRNLTSVNS  389



>ref|XP_008457864.1| PREDICTED: uncharacterized protein LOC103497445 [Cucumis melo]
 ref|XP_008457872.1| PREDICTED: uncharacterized protein LOC103497445 [Cucumis melo]
Length=390

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL+W++E +LTDLR++LHISNDEHLME+KNL+SA   S
Sbjct  349  ASGPLSWEKELLLTDLRLSLHISNDEHLMEIKNLVSASISS  389



>ref|XP_010670102.1| PREDICTED: uncharacterized protein LOC104887204 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    SGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            SGPL+W QE  LT LR+ L +SNDEHL EL+ L S++
Sbjct  229  SGPLSWQQEIELTKLRLKLSVSNDEHLAELRRLKSSR  265



>ref|XP_010670861.1| PREDICTED: uncharacterized protein LOC104887807 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    SGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            SGPL+W QE  LT LR+ L +SNDEHL EL+ L S++
Sbjct  229  SGPLSWQQEIELTKLRLKLSVSNDEHLAELRRLKSSR  265



>gb|ACN27195.1| unknown [Zea mays]
Length=75

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2   ASGPLTWDQETMLTDLRITLHISNDEH  82
           A+GPLTW+QE++LT+LR++L+ISN+EH
Sbjct  39  AAGPLTWEQESLLTNLRLSLNISNEEH  65



>ref|XP_008461071.1| PREDICTED: uncharacterized protein LOC103499772 [Cucumis melo]
Length=201

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSYL  130
            ASGPL +W+ E  ++++R  LH+SNDE+L+ELKNLIS     Y+
Sbjct  158  ASGPLLSWEDEGEVSNIRALLHVSNDEYLLELKNLISTNRKIYV  201



>tpg|DAA42551.1| TPA: hypothetical protein ZEAMMB73_650642 [Zea mays]
Length=75

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2   ASGPLTWDQETMLTDLRITLHISNDEH  82
           A+GPLTW+QE++LT+LR++L+ISN+EH
Sbjct  39  AAGPLTWEQESLLTNLRLSLNISNEEH  65



>gb|EAY92179.1| hypothetical protein OsI_13894 [Oryza sativa Indica Group]
Length=817

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE++LT+LR++L+ISN+EH
Sbjct  780  ASGPLTWEQESLLTNLRLSLNISNEEH  806



>ref|XP_004139421.1| PREDICTED: uncharacterized protein LOC101208549 [Cucumis sativus]
 ref|XP_004169315.1| PREDICTED: uncharacterized protein LOC101223903 [Cucumis sativus]
Length=493

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCSY  127
            ASGPL+W++E +LTDLR++LHISNDEHLME+KNL+S     Y
Sbjct  349  ASGPLSWEKELLLTDLRLSLHISNDEHLMEIKNLVSTIYMGY  390



>ref|XP_004136079.1| PREDICTED: uncharacterized protein LOC101221277 [Cucumis sativus]
 ref|XP_004158806.1| PREDICTED: uncharacterized LOC101221277 [Cucumis sativus]
 gb|KGN45303.1| hypothetical protein Csa_7G433320 [Cucumis sativus]
Length=252

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    ASGPL-TWDQETMLTDLRITLHISNDEHLMELKNLIS  109
            ASGPL +W+ E  ++++R  LH+SNDE+L+ELKNLIS
Sbjct  209  ASGPLLSWEDEGEVSNIRALLHVSNDEYLLELKNLIS  245



>ref|NP_001051555.1| Os03g0796400 [Oryza sativa Japonica Group]
 gb|AAT76412.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99343.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13469.1| Os03g0796400 [Oryza sativa Japonica Group]
 gb|EEE60092.1| hypothetical protein OsJ_12949 [Oryza sativa Japonica Group]
Length=298

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE++LT+LR++L+ISN+EH
Sbjct  261  ASGPLTWEQESLLTNLRLSLNISNEEH  287



>ref|XP_010911315.1| PREDICTED: uncharacterized protein LOC105037337 [Elaeis guineensis]
Length=335

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  5    SGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            S  LTW QE  LT+LR+ LHISNDEH  ELK L S +S
Sbjct  288  SRALTWKQEAHLTNLRLRLHISNDEHQSELKRLASTQS  325



>ref|XP_006650728.1| PREDICTED: uncharacterized protein LOC102711242 [Oryza brachyantha]
Length=299

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE++LT+LR++L+ISN+EH
Sbjct  262  ASGPLTWEQESLLTNLRLSLNISNEEH  288



>gb|KGN60658.1| hypothetical protein Csa_2G006040 [Cucumis sativus]
Length=390

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKSCS  124
            ASGPL+W++E +LTDLR++LHISNDEHLME+KNL+S    S
Sbjct  349  ASGPLSWEKELLLTDLRLSLHISNDEHLMEIKNLVSTSISS  389



>ref|NP_001145054.1| uncharacterized protein LOC100278243 [Zea mays]
 gb|ACG44670.1| hypothetical protein [Zea mays]
Length=229

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            A+GPLTW+QE++LT+LR++L+ISN+EH
Sbjct  193  AAGPLTWEQESLLTNLRLSLNISNEEH  219



>ref|XP_010670872.1| PREDICTED: uncharacterized protein LOC104887818 [Beta vulgaris 
subsp. vulgaris]
Length=285

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNL  103
            +SGPL+W QE  LT LR+ L +SNDEHL EL+ L
Sbjct  236  SSGPLSWQQEIELTKLRLKLSVSNDEHLKELRRL  269



>ref|XP_010228418.1| PREDICTED: uncharacterized protein LOC100837427 isoform X2 [Brachypodium 
distachyon]
Length=291

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE++LT+LR++L+ISN+EH
Sbjct  255  ASGPLTWEQESLLTNLRLSLNISNEEH  281



>ref|XP_010228411.1| PREDICTED: uncharacterized protein LOC100837427 isoform X1 [Brachypodium 
distachyon]
Length=295

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE++LT+LR++L+ISN+EH
Sbjct  259  ASGPLTWEQESLLTNLRLSLNISNEEH  285



>ref|XP_008651258.1| PREDICTED: uncharacterized protein LOC100278243 isoform X2 [Zea 
mays]
Length=228

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            A+GPLTW+QE++LT+LR++L+ISN+EH
Sbjct  192  AAGPLTWEQESLLTNLRLSLNISNEEH  218



>ref|XP_008651255.1| PREDICTED: uncharacterized protein LOC100278243 isoform X1 [Zea 
mays]
 ref|XP_008651256.1| PREDICTED: uncharacterized protein LOC100278243 isoform X1 [Zea 
mays]
 ref|XP_008651257.1| PREDICTED: uncharacterized protein LOC100278243 isoform X1 [Zea 
mays]
 tpg|DAA59767.1| TPA: hypothetical protein ZEAMMB73_643406 [Zea mays]
Length=229

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            A+GPLTW+QE++LT+LR++L+ISN+EH
Sbjct  193  AAGPLTWEQESLLTNLRLSLNISNEEH  219



>dbj|BAK08257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE++LT+LR++L+ISN+EH
Sbjct  241  ASGPLTWEQESLLTNLRLSLNISNEEH  267



>ref|NP_001131239.1| uncharacterized protein LOC100192548 [Zea mays]
 ref|XP_008681053.1| PREDICTED: uncharacterized protein LOC100192548 isoform X1 [Zea 
mays]
 gb|ACF79564.1| unknown [Zea mays]
 gb|ACL54797.1| unknown [Zea mays]
 gb|AFW67363.1| hypothetical protein ZEAMMB73_925620 [Zea mays]
 gb|AFW67364.1| hypothetical protein ZEAMMB73_925620 [Zea mays]
 gb|AFW67365.1| hypothetical protein ZEAMMB73_925620 [Zea mays]
Length=304

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE +LT+LR++L+ISN+EH
Sbjct  268  ASGPLTWEQEALLTNLRLSLNISNEEH  294



>ref|XP_002463742.1| hypothetical protein SORBIDRAFT_01g005220 [Sorghum bicolor]
 gb|EER90740.1| hypothetical protein SORBIDRAFT_01g005220 [Sorghum bicolor]
Length=307

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEH  82
            ASGPLTW+QE +LT+LR++L+ISN+EH
Sbjct  271  ASGPLTWEQEALLTNLRLSLNISNEEH  297



>ref|XP_010942486.1| PREDICTED: uncharacterized protein LOC105060465 [Elaeis guineensis]
Length=277

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  14   LTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
             TW+QE  +TDLR+ LHIS DEH  ELK+L S +S
Sbjct  237  FTWEQEAFMTDLRLHLHISTDEHREELKHLASTQS  271



>ref|XP_009781192.1| PREDICTED: uncharacterized protein LOC104230153 [Nicotiana sylvestris]
Length=337

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 3/31 (10%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMEL  94
            ASGPL+WDQE +LT+LRI+LH   DEH+ EL
Sbjct  288  ASGPLSWDQEALLTNLRISLH---DEHVAEL  315



>ref|XP_008656642.1| PREDICTED: uncharacterized protein LOC103636063 [Zea mays]
 gb|AFW83226.1| hypothetical protein ZEAMMB73_917839 [Zea mays]
Length=396

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    ASG-PLTWDQETMLTDLRITLHISNDEHLMELKNLISAK  115
            ASG PL+W++E +L+DLR+ LHISNDEHL  +  +++ K
Sbjct  354  ASGNPLSWEKEGLLSDLRVHLHISNDEHLKAINVILNRK  392



>emb|CDM81154.1| unnamed protein product [Triticum aestivum]
 emb|CDM81163.1| unnamed protein product [Triticum aestivum]
Length=447

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    ASGPLTWDQETMLTDLRITLHISNDEHLMELKNLISAKS  118
            A+GPL+W +E +L+DLR+ LH+S DEHL  +++L    S
Sbjct  404  ATGPLSWAKEELLSDLRLHLHVSGDEHLQLIRSLNGGNS  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288