BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25077_g1_i2 len=2181 path=[1599:0-195 1272:196-314 1912:315-336
1534:337-408 2004:409-447 1336:448-596 2191:597-636 2231:637-683
12913:684-699 2290:700-725 1591:726-732 1598:733-773 12696:774-839
2476:840-896 353:897-996 453:997-1065 2665:1066-1097 2696:1098-1302
328:1303-1327 2925:1328-1385 4373:1386-2180]

Length=2181
                                                                      Score     E

ref|XP_011096679.1|  PREDICTED: 50S ribosomal protein L20, chloro...    246   1e-73   
ref|XP_009759705.1|  PREDICTED: 50S ribosomal protein L20, chloro...    238   9e-71   
ref|XP_006353017.1|  PREDICTED: 50S ribosomal protein L20, chloro...    238   1e-70   
ref|XP_004233169.1|  PREDICTED: 50S ribosomal protein L20, chloro...    237   2e-70   
ref|XP_007212231.1|  hypothetical protein PRUPE_ppa013387mg             236   7e-70   
ref|XP_009340119.1|  PREDICTED: 50S ribosomal protein L20, organe...    235   1e-69   
gb|ADR71306.1|  50S ribosomal protein L20                               234   3e-69   
ref|XP_006425198.1|  hypothetical protein CICLE_v10029584mg             234   3e-69   
ref|XP_008383202.1|  PREDICTED: 50S ribosomal protein L20, organe...    234   3e-69   
ref|XP_011085205.1|  PREDICTED: 50S ribosomal protein L20, chloro...    233   4e-69   
emb|CDP17311.1|  unnamed protein product                                233   9e-69   
gb|KHG19210.1|  rplT                                                    232   1e-68   
ref|XP_006383403.1|  ribosomal protein L20                              231   2e-68   
ref|XP_007023565.1|  Ribosomal protein L20                              230   8e-68   
gb|EYU19087.1|  hypothetical protein MIMGU_mgv1a016369mg                230   9e-68   
gb|KDP26889.1|  hypothetical protein JCGZ_18047                         229   1e-67   
ref|XP_010269032.1|  PREDICTED: 50S ribosomal protein L20, chloro...    229   2e-67   
ref|XP_010276581.1|  PREDICTED: 50S ribosomal protein L20, chloro...    229   2e-67   
gb|EYU19124.1|  hypothetical protein MIMGU_mgv1a016364mg                229   3e-67   
ref|XP_008456292.1|  PREDICTED: 50S ribosomal protein L20, chloro...    229   3e-67   
ref|XP_004139908.1|  PREDICTED: 50S ribosomal protein L20-like is...    228   7e-67   
ref|XP_010537762.1|  PREDICTED: 50S ribosomal protein L20, chloro...    227   1e-66   
ref|XP_004293880.1|  PREDICTED: 50S ribosomal protein L20-like is...    224   2e-65   
emb|CDX96808.1|  BnaA08g23510D                                          223   2e-65   
ref|XP_006416785.1|  hypothetical protein EUTSA_v10009114mg             223   3e-65   
ref|XP_009149112.1|  PREDICTED: 50S ribosomal protein L20, chloro...    223   3e-65   
ref|XP_008801202.1|  PREDICTED: 50S ribosomal protein L20, chloro...    223   4e-65   
ref|XP_007138298.1|  hypothetical protein PHAVU_009G196700g             223   5e-65   
emb|CDX83942.1|  BnaC08g17030D                                          223   5e-65   
ref|XP_008781248.1|  PREDICTED: 50S ribosomal protein L20, chloro...    222   8e-65   
ref|XP_010045096.1|  PREDICTED: 50S ribosomal protein L20, chloro...    222   9e-65   
dbj|BAK05413.1|  predicted protein                                      222   9e-65   
ref|NP_001151809.1|  50S ribosomal protein L20                          222   1e-64   Zea mays [maize]
gb|EMS67561.1|  50S ribosomal protein L20                               221   1e-64   
ref|XP_006574365.1|  PREDICTED: uncharacterized protein LOC100527...    221   1e-64   
ref|XP_002530749.1|  50S ribosomal protein L20, putative                225   1e-64   Ricinus communis
ref|NP_173118.1|  ribosomal protein L20                                 221   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491147.1|  PREDICTED: 50S ribosomal protein L20-like is...    221   2e-64   
ref|XP_003617050.1|  50S ribosomal protein L20                          220   3e-64   
gb|KFK43877.1|  hypothetical protein AALP_AA1G185600                    220   4e-64   
ref|XP_009110443.1|  PREDICTED: 50S ribosomal protein L20, chloro...    220   4e-64   
emb|CDM84066.1|  unnamed protein product                                220   5e-64   
ref|XP_004969858.1|  PREDICTED: 50S ribosomal protein L20, chloro...    219   6e-64   
ref|XP_003569741.1|  PREDICTED: 50S ribosomal protein L20, chloro...    219   6e-64   
ref|NP_001235366.1|  uncharacterized protein LOC100527387               219   6e-64   
ref|XP_002890186.1|  predicted protein                                  219   7e-64   
ref|XP_006654683.1|  PREDICTED: 50S ribosomal protein L20, chloro...    219   7e-64   
ref|NP_001056116.1|  Os05g0528200                                       219   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456306.1|  hypothetical protein SORBIDRAFT_03g033790          218   2e-63   Sorghum bicolor [broomcorn]
gb|EMT06821.1|  50S ribosomal protein L20                               218   2e-63   
ref|XP_002268463.1|  PREDICTED: 50S ribosomal protein L20, chloro...    218   3e-63   Vitis vinifera
gb|EAY98774.1|  hypothetical protein OsI_20708                          219   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010935221.1|  PREDICTED: 50S ribosomal protein L20, chloro...    218   3e-63   
ref|XP_006847994.1|  hypothetical protein AMTR_s00029p00161530          218   4e-63   
ref|XP_010092489.1|  50S ribosomal protein L20                          220   4e-63   
gb|AFK48588.1|  unknown                                                 217   5e-63   
ref|NP_001044164.1|  Os01g0734100                                       217   5e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568051.1|  PREDICTED: 50S ribosomal protein L20, chloro...    217   6e-63   
ref|XP_009408193.1|  PREDICTED: 50S ribosomal protein L20, chloro...    215   3e-62   
ref|XP_010672459.1|  PREDICTED: 50S ribosomal protein L20, chloro...    214   6e-62   
ref|XP_010674944.1|  PREDICTED: 50S ribosomal protein L20, chloro...    213   1e-61   
ref|XP_010269028.1|  PREDICTED: 50S ribosomal protein L20, chloro...    214   1e-61   
ref|XP_010667813.1|  PREDICTED: 50S ribosomal protein L20, chloro...    208   8e-60   
gb|ABK22506.1|  unknown                                                 208   1e-59   Picea sitchensis
ref|XP_006644665.1|  PREDICTED: 50S ribosomal protein L20, chloro...    205   9e-59   
ref|XP_001772593.1|  predicted protein                                  195   3e-55   
ref|XP_002963494.1|  hypothetical protein SELMODRAFT_227421             172   1e-46   
ref|XP_005845388.1|  hypothetical protein CHLNCDRAFT_25913              170   5e-46   
ref|XP_005646214.1|  putative 50S ribosomal protein L20                 167   3e-45   
ref|XP_010269033.1|  PREDICTED: 50S ribosomal protein L20, chloro...    159   3e-42   
ref|XP_002505674.1|  predicted protein                                  156   3e-41   Micromonas commoda
gb|KFM27719.1|  50S ribosomal protein L20                               154   3e-40   
ref|XP_001422740.1|  Putative mitochondrial ribosomal protein L20       142   3e-36   Ostreococcus lucimarinus CCE9901
ref|WP_012567485.1|  50S ribosomal protein L20                          142   3e-36   
gb|EFA74733.1|  hypothetical protein PPL_11764                          141   1e-35   Polysphondylium pallidum PN500
gb|EKE09492.1|  50S ribosomal protein L20                               141   2e-35   
ref|WP_029010942.1|  50S ribosomal protein L20                          139   9e-35   
ref|WP_028034207.1|  50S ribosomal protein L20                          139   1e-34   
ref|WP_008834381.1|  50S ribosomal protein L20                          139   2e-34   
ref|WP_011304263.1|  50S ribosomal protein L20                          138   2e-34   
ref|WP_028878778.1|  50S ribosomal protein L20                          138   2e-34   
dbj|GAM24927.1|  hypothetical protein SAMD00019534_081020               137   3e-34   
ref|WP_040843389.1|  50S ribosomal protein L20                          137   3e-34   
ref|WP_011580017.1|  50S ribosomal protein L20                          138   3e-34   
ref|WP_013650959.1|  50S ribosomal protein L20                          137   3e-34   
ref|XP_002948443.1|  mitochondrial ribosomal protein L20                137   4e-34   
emb|CEI84853.1|  50S ribosomal protein L20                              137   4e-34   
ref|WP_035025166.1|  MULTISPECIES: 50S ribosomal protein L20            137   5e-34   
ref|WP_026868581.1|  50S ribosomal protein L20                          136   7e-34   
ref|WP_024588135.1|  50S ribosomal protein L20                          137   8e-34   
ref|WP_037235402.1|  50S ribosomal protein L20                          136   8e-34   
ref|WP_006936626.1|  50S ribosomal protein L20                          135   1e-33   
ref|WP_008190886.1|  50S ribosomal protein L20                          135   1e-33   
ref|WP_013418492.1|  50S ribosomal protein L20                          135   1e-33   
ref|WP_019904744.1|  50S ribosomal protein L20                          135   2e-33   
ref|WP_024081824.1|  50S ribosomal protein L20                          135   2e-33   
ref|WP_037019231.1|  50S ribosomal protein L20                          135   2e-33   
ref|WP_012453520.1|  MULTISPECIES: 50S ribosomal protein L20            135   2e-33   
gb|AHX04165.1|  ribosomal protein L20                                   135   2e-33   
ref|WP_024849468.1|  50S ribosomal protein L20                          135   3e-33   
emb|CEG02138.1|  Ribosomal protein L20                                  134   3e-33   
ref|WP_011154821.1|  50S ribosomal protein L20                          134   4e-33   
ref|WP_020400112.1|  50S ribosomal protein L20                          134   4e-33   
ref|WP_025029706.1|  50S ribosomal protein L20                          135   4e-33   
ref|WP_037459051.1|  50S ribosomal protein L20                          134   4e-33   
ref|WP_034836891.1|  50S ribosomal protein L20                          134   5e-33   
ref|WP_040986810.1|  50S ribosomal protein L20                          134   5e-33   
ref|WP_028481833.1|  50S ribosomal protein L20                          134   5e-33   
ref|WP_015932001.1|  50S ribosomal protein L20                          134   6e-33   
ref|WP_023002609.1|  MULTISPECIES: 50S ribosomal protein L20            134   6e-33   
ref|WP_024071768.1|  50S ribosomal protein L20                          134   6e-33   
ref|WP_006010467.1|  50S ribosomal protein L20                          134   6e-33   
ref|WP_012335023.1|  MULTISPECIES: 50S ribosomal protein L20            134   6e-33   
ref|WP_003602669.1|  50S ribosomal protein L20                          134   7e-33   
ref|WP_007009055.1|  50S ribosomal protein L20                          134   7e-33   
ref|WP_038602345.1|  50S ribosomal protein L20                          133   8e-33   
ref|WP_036362947.1|  50S ribosomal protein L20                          133   9e-33   
ref|WP_007302081.1|  MULTISPECIES: 50S ribosomal protein L20            133   9e-33   
ref|WP_012461400.1|  50S ribosomal protein L20                          133   9e-33   
ref|WP_018044556.1|  MULTISPECIES: 50S ribosomal protein L20            133   1e-32   
gb|EWM28277.1|  50s ribosomal protein l20                               134   1e-32   
tpg|DAA57761.1|  TPA: hypothetical protein ZEAMMB73_608772              132   1e-32   
ref|WP_006013542.1|  50S ribosomal protein L20                          133   1e-32   
ref|WP_009758999.1|  50S ribosomal protein L20                          133   1e-32   
gb|ETZ04719.1|  50S ribosomal protein L20                               133   1e-32   
ref|WP_017531794.1|  50S ribosomal protein L20                          133   1e-32   
ref|WP_038249658.1|  50S ribosomal protein L20                          133   1e-32   
ref|WP_011642072.1|  50S ribosomal protein L20                          132   1e-32   
ref|WP_009538887.1|  50S ribosomal protein L20                          132   2e-32   
ref|WP_010962891.1|  50S ribosomal protein L20                          132   2e-32   
ref|XP_644502.1|  hypothetical protein DDB_G0273771                     132   2e-32   Dictyostelium discoideum AX4
ref|XP_001689789.1|  mitochondrial ribosomal protein L20                132   2e-32   Chlamydomonas reinhardtii
ref|WP_008596342.1|  50S ribosomal protein L20                          133   2e-32   
ref|XP_007509956.1|  50S ribosomal protein L20                          132   2e-32   
ref|WP_006279340.1|  MULTISPECIES: 50S ribosomal protein L20            132   2e-32   
ref|WP_041046059.1|  50S ribosomal protein L20                          132   3e-32   
ref|WP_038539115.1|  50S ribosomal protein L20                          132   3e-32   
ref|WP_015589254.1|  50S ribosomal protein L20                          132   3e-32   
ref|WP_010402775.1|  50S ribosomal protein L20                          132   3e-32   
ref|XP_003059992.1|  predicted protein                                  132   3e-32   
ref|WP_029042248.1|  50S ribosomal protein L20                          132   3e-32   
ref|WP_008616781.1|  50S ribosomal protein L20                          131   4e-32   
ref|WP_024924238.1|  MULTISPECIES: 50S ribosomal protein L20            132   4e-32   
ref|WP_002728693.1|  MULTISPECIES: 50S ribosomal protein L20            131   4e-32   
ref|WP_036485217.1|  50S ribosomal protein L20                          132   5e-32   
ref|WP_009869562.1|  MULTISPECIES: 50S ribosomal protein L20            131   5e-32   
ref|WP_027315906.1|  50S ribosomal protein L20                          131   5e-32   
ref|WP_022709387.1|  50S ribosomal protein L20                          132   5e-32   
ref|WP_011944544.1|  50S ribosomal protein L20                          131   5e-32   
ref|WP_014954649.1|  50S ribosomal protein L20                          131   6e-32   
ref|WP_019173816.1|  50S ribosomal protein L20                          131   7e-32   
ref|WP_008943356.1|  50S ribosomal protein L20                          131   7e-32   
ref|XP_009616278.1|  PREDICTED: 50S ribosomal protein L20, cyanel...    129   9e-32   
ref|WP_011256855.1|  50S ribosomal protein L20                          130   9e-32   
ref|WP_011712062.1|  50S ribosomal protein L20                          130   9e-32   
ref|WP_029030312.1|  50S ribosomal protein L20                          130   1e-31   
ref|WP_009450931.1|  50S ribosomal protein L20                          130   1e-31   
ref|XP_003385334.1|  PREDICTED: 50S ribosomal protein L20-like          132   1e-31   
ref|WP_024161173.1|  50S ribosomal protein L20                          130   1e-31   
ref|WP_015587849.1|  50S ribosomal protein L20                          130   1e-31   
ref|WP_032112258.1|  50S ribosomal protein L20                          130   1e-31   
ref|WP_014869313.1|  MULTISPECIES: 50S ribosomal protein L20            130   1e-31   
ref|WP_019834127.1|  50S ribosomal protein L20                          130   2e-31   
ref|WP_019403890.1|  50S ribosomal protein L20                          129   2e-31   
ref|WP_029349792.1|  50S ribosomal protein L20                          129   2e-31   
ref|WP_029012315.1|  50S ribosomal protein L20                          129   2e-31   
ref|WP_022006321.1|  50S ribosomal protein L20                          129   2e-31   
ref|WP_013951076.1|  50S ribosomal protein L20                          129   2e-31   
ref|WP_008553032.1|  MULTISPECIES: 50S ribosomal protein L20            129   2e-31   
emb|CCQ72711.1|  50S ribosomal subunit protein L20                      129   2e-31   
ref|WP_036117896.1|  50S ribosomal protein L20                          129   2e-31   
ref|WP_027834228.1|  50S ribosomal protein L20                          129   3e-31   
emb|CBJ48761.1|  50S ribosomal protein L20P                             129   3e-31   
ref|WP_014238729.1|  50S ribosomal protein L20                          129   3e-31   
ref|WP_015333358.1|  50S ribosomal protein L20                          130   3e-31   
dbj|GAK32500.1|  50S ribosomal protein L20                              129   3e-31   
ref|WP_014743716.1|  50S ribosomal protein L20                          129   3e-31   
ref|WP_029936734.1|  50S ribosomal protein L20                          129   3e-31   
ref|WP_029062762.1|  50S ribosomal protein L20                          129   4e-31   
ref|WP_026480374.1|  50S ribosomal protein L20                          129   4e-31   
ref|WP_018689708.1|  50S ribosomal protein L20                          129   4e-31   
ref|WP_007068518.1|  50S ribosomal protein L20                          129   5e-31   
ref|WP_023786089.1|  50S ribosomal protein L20                          129   5e-31   
ref|WP_019965303.1|  50S ribosomal protein L20                          128   5e-31   
ref|WP_029640755.1|  50S ribosomal protein L20                          128   5e-31   
emb|CCA14914.1|  50S ribosomal protein L20 putative                     128   5e-31   
ref|WP_013165152.1|  50S ribosomal protein L20                          128   5e-31   
ref|WP_033925474.1|  50S ribosomal protein L20                          128   5e-31   
ref|WP_018430571.1|  50S ribosomal protein L20                          129   6e-31   
ref|WP_038465301.1|  50S ribosomal protein L20                          128   7e-31   
ref|WP_010161044.1|  MULTISPECIES: 50S ribosomal protein L20            128   7e-31   
ref|WP_027288222.1|  50S ribosomal protein L20                          128   8e-31   
ref|WP_027298591.1|  50S ribosomal protein L20                          128   8e-31   
ref|WP_019515416.1|  50S ribosomal protein L20                          128   8e-31   
emb|CDX18537.1|  50S ribosomal subunit protein L20                      128   9e-31   
ref|WP_023796882.1|  MULTISPECIES: 50S ribosomal protein L20            128   1e-30   
ref|WP_018389391.1|  50S ribosomal protein L20                          128   1e-30   
ref|WP_038665948.1|  50S ribosomal protein L20                          127   1e-30   
emb|CCI43200.1|  unnamed protein product                                127   1e-30   
ref|WP_034157821.1|  50S ribosomal protein L20                          127   1e-30   
ref|WP_022687966.1|  50S ribosomal protein L20                          127   1e-30   
ref|WP_020084061.1|  50S ribosomal protein L20                          127   1e-30   
ref|WP_013528310.1|  MULTISPECIES: 50S ribosomal protein L20            127   1e-30   
ref|WP_014791450.1|  50S ribosomal protein L20                          127   1e-30   
ref|WP_027053776.1|  50S ribosomal protein L20                          127   2e-30   
ref|WP_019231063.1|  50S ribosomal protein L20                          127   2e-30   
ref|WP_006201247.1|  MULTISPECIES: 50S ribosomal protein L20            127   2e-30   
ref|WP_037532450.1|  50S ribosomal protein L20                          127   2e-30   
dbj|GAM01434.1|  50S ribosomal protein L20                              127   2e-30   
ref|WP_010302273.1|  50S ribosomal protein L20                          127   2e-30   
ref|WP_010184217.1|  50S ribosomal protein L20                          127   2e-30   
ref|XP_008605363.1|  50S ribosomal protein L20                          126   2e-30   
ref|WP_010682315.1|  50S ribosomal protein L20                          127   3e-30   
ref|WP_027049077.1|  50S ribosomal protein L20                          127   3e-30   
ref|WP_010406000.1|  MULTISPECIES: 50S ribosomal protein L20            126   3e-30   
ref|WP_012975157.1|  50S ribosomal protein L20                          126   3e-30   
ref|WP_028467119.1|  50S ribosomal protein L20                          126   3e-30   
ref|WP_027230884.1|  50S ribosomal protein L20                          127   3e-30   
ref|WP_017669465.1|  50S ribosomal protein L20                          126   3e-30   
ref|WP_028967241.1|  50S ribosomal protein L20                          126   3e-30   
ref|WP_027372212.1|  MULTISPECIES: 50S ribosomal protein L20            126   3e-30   
ref|WP_023672281.1|  MULTISPECIES: 50S ribosomal protein L20            127   3e-30   
ref|WP_023837523.1|  50S ribosomal protein L20                          126   3e-30   
ref|WP_023814515.1|  50S ribosomal protein L20                          127   3e-30   
ref|WP_035543838.1|  MULTISPECIES: 50S ribosomal protein L20            126   4e-30   
ref|WP_034962397.1|  50S ribosomal protein L20                          126   4e-30   
ref|XP_001630524.1|  predicted protein                                  126   4e-30   Nematostella vectensis
ref|WP_032138857.1|  50S ribosomal protein L20                          126   4e-30   
ref|WP_011995133.1|  50S ribosomal protein L20                          126   4e-30   
ref|WP_010543146.1|  MULTISPECIES: 50S ribosomal protein L20            126   4e-30   
ref|WP_040256020.1|  MULTISPECIES: 50S ribosomal protein L20            125   4e-30   
ref|WP_014273660.1|  50S ribosomal protein L20                          125   5e-30   
ref|WP_028795849.1|  50S ribosomal protein L20                          125   5e-30   
ref|WP_023450274.1|  50S ribosomal protein L20                          125   5e-30   
ref|WP_035029382.1|  MULTISPECIES: 50S ribosomal protein L20            126   5e-30   
ref|WP_039195539.1|  50S ribosomal protein L20                          126   5e-30   
ref|WP_040968947.1|  50S ribosomal protein L20                          126   5e-30   
ref|WP_022195251.1|  50S ribosomal protein L20                          125   5e-30   
ref|WP_008518753.1|  50S ribosomal protein L20                          125   5e-30   
ref|WP_012320099.1|  MULTISPECIES: 50S ribosomal protein L20            125   5e-30   
ref|WP_015459072.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_014415279.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_014014575.1|  MULTISPECIES: 50S ribosomal protein L20            125   6e-30   
ref|WP_022187282.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_037524701.1|  50S ribosomal protein L20                          125   6e-30   
dbj|GAL69034.1|  LSU ribosomal protein L20p                             125   6e-30   
ref|WP_010421917.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_019647061.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_027135300.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_011270689.1|  50S ribosomal protein L20                          125   6e-30   
ref|WP_029941638.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_004997919.1|  MULTISPECIES: 50S ribosomal protein L20            125   7e-30   
ref|WP_017971739.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_014409422.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_014392580.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_012151091.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_021777757.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_039712474.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_019986549.1|  50S ribosomal protein L20                          124   7e-30   
ref|WP_041000056.1|  50S ribosomal protein L20                          125   7e-30   
ref|WP_031934472.1|  50S ribosomal protein L20                          125   8e-30   
ref|WP_007840009.1|  MULTISPECIES: 50S ribosomal protein L20            125   8e-30   
ref|WP_011415678.1|  50S ribosomal protein L20                          125   8e-30   
ref|XP_002286390.1|  RL20, ribosomal protein 20 60S large ribosom...    124   8e-30   Thalassiosira pseudonana CCMP1335
ref|WP_004597959.1|  50S ribosomal protein L20                          125   8e-30   
ref|WP_014365592.1|  50S ribosomal protein L20                          125   8e-30   
ref|WP_027384638.1|  50S ribosomal protein L20                          125   9e-30   
ref|XP_008867841.1|  ribosomal protein L20                              124   9e-30   
ref|WP_015596608.1|  50S ribosomal protein L20                          125   9e-30   
ref|WP_034688276.1|  50S ribosomal protein L20                          125   9e-30   
ref|WP_033922591.1|  50S ribosomal protein L20                          125   9e-30   
ref|WP_039348143.1|  50S ribosomal protein L20                          125   9e-30   
ref|WP_008127401.1|  50S ribosomal protein L20                          125   9e-30   
ref|WP_011391269.1|  50S ribosomal protein L20                          125   1e-29   
ref|WP_007561402.1|  50S ribosomal protein L20                          125   1e-29   
ref|WP_007088700.1|  MULTISPECIES: 50S ribosomal protein L20            125   1e-29   
ref|WP_026987409.1|  50S ribosomal protein L20                          125   1e-29   
ref|WP_022729989.1|  50S ribosomal protein L20                          125   1e-29   
ref|XP_009838082.1|  ribosomal protein L20                              124   1e-29   
ref|WP_034442321.1|  50S ribosomal protein L20                          125   1e-29   
gb|AIQ91293.1|  ribosomal protein L20                                   125   1e-29   
ref|WP_007439031.1|  50S ribosomal protein L20                          125   1e-29   
ref|WP_034694451.1|  50S ribosomal protein L20                          124   1e-29   
ref|WP_006834668.1|  50S ribosomal protein L20                          124   1e-29   
ref|WP_009415231.1|  50S ribosomal protein L20                          124   1e-29   
ref|WP_017971071.1|  50S ribosomal protein L20                          124   1e-29   
ref|WP_008271734.1|  50S ribosomal protein L20                          124   1e-29   
ref|WP_031395288.1|  MULTISPECIES: 50S ribosomal protein L20            124   1e-29   
ref|WP_010409585.1|  50S ribosomal protein L20                          124   1e-29   
ref|WP_019994367.1|  50S ribosomal protein L20                          125   2e-29   
dbj|GAK45350.1|  50S ribosomal protein L20                              124   2e-29   
dbj|GAJ28047.1|  50S ribosomal protein L20                              124   2e-29   
ref|WP_016200457.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_014412519.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_039344075.1|  50S ribosomal protein L20                          124   2e-29   
gb|KFX71938.1|  50S ribosomal protein L20                               124   2e-29   
ref|WP_013695250.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_018676659.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_012736699.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_012048646.1|  MULTISPECIES: 50S ribosomal protein L20            124   2e-29   
ref|WP_022981258.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_012149844.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_013598362.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_032131133.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_011477531.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_012172967.1|  50S ribosomal protein L20                          124   2e-29   
ref|WP_020897363.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_007406685.1|  50S ribosomal protein L20                          124   3e-29   
ref|WP_029003628.1|  50S ribosomal protein L20                          124   3e-29   
ref|WP_040995267.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_013946005.1|  MULTISPECIES: 50S ribosomal protein L20            124   3e-29   
ref|WP_034955724.1|  50S ribosomal protein L20                          124   3e-29   
ref|WP_012782449.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_032073336.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_034705993.1|  MULTISPECIES: 50S ribosomal protein L20            123   3e-29   
ref|WP_027064529.1|  MULTISPECIES: 50S ribosomal protein L20            123   3e-29   
ref|WP_023508019.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_014408858.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_034905688.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_025294634.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_013461915.1|  50S ribosomal protein L20                          123   3e-29   
ref|WP_008888574.1|  MULTISPECIES: 50S ribosomal protein L20            123   4e-29   
ref|WP_022732736.1|  50S ribosomal protein L20                          123   4e-29   
ref|WP_012152997.1|  50S ribosomal protein L20                          123   4e-29   
gb|KFF74579.1|  50S ribosomal protein L20                               123   4e-29   
ref|WP_017943964.1|  50S ribosomal protein L20                          123   4e-29   
ref|WP_019461133.1|  MULTISPECIES: 50S ribosomal protein L20            123   4e-29   
ref|XP_004347755.1|  ribosomal protein L20, putative                    124   4e-29   
gb|KDO16588.1|  50S ribosomal protein L20                               122   4e-29   
ref|WP_015754447.1|  50S ribosomal protein L20                          123   5e-29   
ref|WP_029016192.1|  MULTISPECIES: 50S ribosomal protein L20            123   5e-29   
ref|WP_026318882.1|  50S ribosomal protein L20                          123   5e-29   
ref|WP_009281993.1|  50S ribosomal protein L20                          122   5e-29   
ref|WP_009085968.1|  MULTISPECIES: 50S ribosomal protein L20            122   5e-29   
ref|WP_024282491.1|  50S ribosomal protein L20                          122   5e-29   
ref|WP_038558953.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_029293267.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_002979659.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_017442423.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_010703234.1|  50S ribosomal protein L20                          123   6e-29   
dbj|BAQ15985.1|  LSU ribosomal protein L20p                             122   6e-29   
ref|WP_026995256.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_008580804.1|  MULTISPECIES: 50S ribosomal protein L20            122   6e-29   
ref|WP_027442371.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_007476181.1|  50S ribosomal protein L20                          123   6e-29   
ref|WP_029058692.1|  50S ribosomal protein L20                          122   6e-29   
ref|WP_015816101.1|  50S ribosomal protein L20                          122   7e-29   
gb|KEG21206.1|  50S ribosomal protein L20                               123   7e-29   
ref|WP_023431511.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_027281833.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_025824929.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_034711139.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_034040731.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_008503673.1|  50S ribosomal protein L20                          123   7e-29   
ref|WP_036775750.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_034676301.1|  50S ribosomal protein L20                          122   7e-29   
ref|WP_002965185.1|  MULTISPECIES: 50S ribosomal protein L20            123   7e-29   
ref|WP_010700644.1|  50S ribosomal protein L20                          123   7e-29   
ref|WP_007165579.1|  50S ribosomal protein L20                          122   8e-29   
ref|WP_025885633.1|  50S ribosomal protein L20                          122   8e-29   
dbj|BAO55786.1|  LSU ribosomal protein L20p                             122   8e-29   
ref|WP_009185921.1|  50S ribosomal protein L20                          122   8e-29   
gb|EDM43920.1|  50S ribosomal protein L20                               122   9e-29   
ref|WP_028122445.1|  50S ribosomal protein L20                          122   9e-29   
ref|WP_007633980.1|  50S ribosomal protein L20                          122   9e-29   
ref|XP_009519414.1|  Mitochondrial/chloroplast ribosomal protein L20    122   9e-29   
ref|WP_020590808.1|  50S ribosomal protein L20                          122   9e-29   
ref|WP_008601126.1|  50S ribosomal protein L20                          122   9e-29   
ref|WP_036258767.1|  50S ribosomal protein L20                          122   1e-28   
ref|XP_002901830.1|  50S ribosomal protein L20, putative                122   1e-28   
ref|WP_010239708.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_027385359.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_040964344.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_011191043.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_018279186.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_002674637.1|  MULTISPECIES: 50S ribosomal protein L20            122   1e-28   
ref|WP_010701895.1|  50S ribosomal protein L20                          122   1e-28   
gb|EJK74097.1|  hypothetical protein THAOC_04243                        121   1e-28   
ref|WP_026379304.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_028887165.1|  50S ribosomal protein L20                          121   1e-28   
ref|WP_026753165.1|  50S ribosomal protein L20                          121   1e-28   
ref|WP_027510575.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_015338482.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_006468099.1|  MULTISPECIES: 50S ribosomal protein L20            122   1e-28   
ref|WP_004918977.1|  50S ribosomal protein L20                          121   1e-28   
ref|WP_025897744.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_023455325.1|  50S ribosomal protein L20                          121   1e-28   
ref|WP_034965198.1|  MULTISPECIES: 50S ribosomal protein L20            121   1e-28   
ref|WP_027379384.1|  50S ribosomal protein L20                          121   1e-28   
ref|WP_007872656.1|  50S ribosomal protein L20                          122   1e-28   
ref|WP_017665007.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_038530925.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_010126517.1|  50S ribosomal protein L20                          122   2e-28   
ref|WP_025841131.1|  50S ribosomal protein L20                          122   2e-28   
ref|WP_006273309.1|  50S ribosomal protein L20                          121   2e-28   
dbj|GAK94600.1|  LSU ribosomal protein L20p                             121   2e-28   
ref|WP_027377393.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_040250654.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_022079278.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_013868673.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_025824077.1|  50S ribosomal protein L20                          122   2e-28   
ref|WP_028873112.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_034716460.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_022713356.1|  50S ribosomal protein L20                          122   2e-28   
ref|WP_020944687.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_008239793.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_019559461.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_039843608.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_039368473.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_028036191.1|  50S ribosomal protein L20                          121   2e-28   
ref|WP_038337134.1|  50S ribosomal protein L20                          120   2e-28   
ref|XP_009035407.1|  hypothetical protein AURANDRAFT_8683               120   2e-28   
ref|WP_015360853.1|  50S ribosomal protein L20                          120   2e-28   
ref|WP_033955893.1|  50S ribosomal protein L20                          120   2e-28   
ref|WP_040279931.1|  50S ribosomal protein L20                          120   2e-28   
ref|WP_009036256.1|  50S ribosomal protein L20                          120   3e-28   
dbj|BAO74470.1|  LSU ribosomal protein L20p                             120   3e-28   
ref|WP_036510712.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_039617361.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_004108079.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_007651475.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_012759783.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_009056165.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_036797943.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_008038083.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_014890448.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_035005479.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_027138917.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_022734811.1|  50S ribosomal protein L20                          120   3e-28   
dbj|GAK96386.1|  LSU ribosomal protein L20p                             120   3e-28   
ref|WP_018409162.1|  MULTISPECIES: 50S ribosomal protein L20            120   3e-28   
ref|WP_010669173.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_003622900.1|  MULTISPECIES: 50S ribosomal protein L20            120   3e-28   
ref|WP_014363747.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_005768100.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_015397489.1|  50S ribosomal protein L20                          121   3e-28   
ref|WP_034465171.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_040585887.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_019976847.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_004636001.1|  MULTISPECIES: 50S ribosomal protein L20            120   3e-28   
ref|WP_011251849.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_017184255.1|  50S ribosomal protein L20                          120   3e-28   
ref|WP_012926782.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_038265605.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_004687778.1|  50S ribosomal protein L20                          121   4e-28   
ref|WP_026810231.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_013996650.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_023978114.1|  MULTISPECIES: 50S ribosomal protein L20            120   4e-28   
ref|WP_007003536.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_022672917.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_003555927.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_027487754.1|  50S ribosomal protein L20                          120   4e-28   
gb|KEG15798.1|  50S ribosomal protein L20                               120   4e-28   
ref|WP_007656428.1|  50S ribosomal protein L20                          120   4e-28   
ref|WP_014078134.1|  50S ribosomal protein L20                          120   4e-28   
dbj|GAL62935.1|  LSU ribosomal protein L20p                             120   4e-28   
ref|WP_018182352.1|  50S ribosomal protein L20                          120   5e-28   
emb|CEN45999.1|  50S ribosomal subunit protein L20                      120   5e-28   
ref|WP_024741323.1|  50S ribosomal protein L20                          120   5e-28   
ref|WP_012148493.1|  50S ribosomal protein L20                          120   5e-28   
ref|WP_006795594.1|  50S ribosomal protein L20                          120   5e-28   
ref|WP_014766732.1|  50S ribosomal protein L20                          120   5e-28   
gb|AIL46354.1|  LSU ribosomal protein L20p                              119   5e-28   
ref|WP_010520026.1|  50S ribosomal protein L20                          120   5e-28   
ref|WP_012654655.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_039053297.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_019670295.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_019388181.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_021245371.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_037498602.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_027879973.1|  50S ribosomal protein L20                          119   6e-28   
ref|WP_034853571.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_006557068.1|  50S ribosomal protein L20                          120   6e-28   
ref|WP_014680318.1|  50S ribosomal protein L20                          119   6e-28   
ref|WP_017969606.1|  50S ribosomal protein L20                          119   7e-28   
gb|EWG98836.1|  50S ribosomal protein L20                               119   7e-28   
ref|WP_025537678.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_037360730.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_012710091.1|  MULTISPECIES: 50S ribosomal protein L20            120   7e-28   
ref|WP_026397857.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_014021145.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_009359764.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_026613580.1|  MULTISPECIES: 50S ribosomal protein L20            120   7e-28   
ref|WP_027078877.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_010182163.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_011451616.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_015950512.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_034261793.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_011180044.1|  50S ribosomal protein L20                          120   7e-28   
emb|CAI78702.1|  Ribosomal protein L20                                  119   7e-28   
ref|WP_014200642.1|  50S ribosomal protein L20                          119   7e-28   
ref|WP_025860378.1|  50S ribosomal protein L20                          119   7e-28   
emb|CDW77847.1|  50s ribosomal protein l20                              123   7e-28   
ref|WP_015088916.1|  50S ribosomal protein L20                          120   8e-28   
ref|WP_004862306.1|  50S ribosomal protein L20                          120   8e-28   
ref|WP_028289874.1|  MULTISPECIES: 50S ribosomal protein L20            119   8e-28   
ref|WP_005866390.1|  50S ribosomal protein L20                          120   8e-28   
ref|WP_008992655.1|  50S ribosomal protein L20                          119   8e-28   
ref|WP_034489208.1|  50S ribosomal protein L20                          120   8e-28   
ref|WP_019220861.1|  50S ribosomal protein L20                          120   8e-28   



>ref|XP_011096679.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Sesamum 
indicum]
Length=124

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 123/125 (98%), Gaps = 1/125 (1%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR AFPGNKTV+P P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKTVLP-PKKEG  119

Query  461  LSILV  475
            LSILV
Sbjct  120  LSILV  124



>ref|XP_009759705.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Nicotiana 
sylvestris]
Length=125

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSELSMHEPYSFKALVDIS +AFPGNK  I  P+K+G
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSELSMHEPYSFKALVDISSSAFPGNKKAIVPPKKEG  120

Query  461  LSILV  475
            L+I++
Sbjct  121  LAIVL  125



>ref|XP_006353017.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Solanum 
tuberosum]
Length=125

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEV KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEVFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSELSMHEPYSFKALVD+SR+AFPGNK  I  P+K+G
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSELSMHEPYSFKALVDVSRSAFPGNKKSIVPPKKEG  120

Query  461  LSILV  475
            L+I++
Sbjct  121  LAIVL  125



>ref|XP_004233169.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Solanum 
lycopersicum]
Length=125

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEV KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEVFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSELSMHEPYSFKALVD+SR+AFPGNK  I  P+K+G
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSELSMHEPYSFKALVDVSRSAFPGNKKSIVPPKKEG  120

Query  461  LSILV  475
            L++++
Sbjct  121  LAVVL  125



>ref|XP_007212231.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica]
 ref|XP_007212232.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica]
 ref|XP_007226592.1| hypothetical protein PRUPE_ppa023673mg [Prunus persica]
 gb|EMJ13430.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica]
 gb|EMJ13431.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica]
 gb|EMJ27791.1| hypothetical protein PRUPE_ppa023673mg [Prunus persica]
Length=125

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNK V+  P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKNVVHAPKKEG  120

Query  461  LSILV  475
            LS+LV
Sbjct  121  LSMLV  125



>ref|XP_009340119.1| PREDICTED: 50S ribosomal protein L20, organellar chromatophore-like 
[Pyrus x bretschneideri]
 ref|XP_009340537.1| PREDICTED: 50S ribosomal protein L20, organellar chromatophore-like 
[Pyrus x bretschneideri]
Length=125

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWIQRINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEP+SFK+LVDISR+AFPGNK V+P P+KKG
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPHSFKSLVDISRSAFPGNKNVVPAPQKKG  120

Query  461  LSILV  475
            L ILV
Sbjct  121  LQILV  125



>gb|ADR71306.1| 50S ribosomal protein L20 [Hevea brasiliensis]
Length=125

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDIS  AFPGNK V+  P K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISHNAFPGNKNVVLPPRKVN  120

Query  461  LSILV  475
            +SI V
Sbjct  121  ISINV  125



>ref|XP_006425198.1| hypothetical protein CICLE_v10029584mg [Citrus clementina]
 ref|XP_006488621.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Citrus 
sinensis]
 gb|ESR38438.1| hypothetical protein CICLE_v10029584mg [Citrus clementina]
 gb|KDO67094.1| hypothetical protein CISIN_1g033167mg [Citrus sinensis]
Length=125

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR AFPGNK ++  P K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKNIVHPPRKAD  120

Query  461  LSI  469
            +SI
Sbjct  121  ISI  123



>ref|XP_008383202.1| PREDICTED: 50S ribosomal protein L20, organellar chromatophore 
[Malus domestica]
Length=125

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWIQRINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEP+SFK+LVDISR+AFPGNK  +P P+KKG
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPHSFKSLVDISRSAFPGNKNAVPAPQKKG  120

Query  461  LSILV  475
            L ILV
Sbjct  121  LQILV  125



>ref|XP_011085205.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Sesamum 
indicum]
Length=124

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRY  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGV YGNFMHGL K+NIQLNRKVLSELSMHEPYSFKALVDISR AFPGNKT IP P+K+G
Sbjct  61   HGVKYGNFMHGLTKKNIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKTGIP-PKKEG  119

Query  461  LSILV  475
            L+ILV
Sbjct  120  LAILV  124



>emb|CDP17311.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEV KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTRQ
Sbjct  1    MNKKEVFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEP+SFKALVDISRTAFPGNK  +   +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPHSFKALVDISRTAFPGNKKPVLASKKEG  120

Query  461  LSILV  475
            L++++
Sbjct  121  LAVVL  125



>gb|KHG19210.1| rplT [Gossypium arboreum]
 gb|KHG19211.1| rplT [Gossypium arboreum]
Length=125

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+LKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEILKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSE+SMHEPYSFKALVDISR AFPGNK V+    K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKALVDISRNAFPGNKNVVLPTRKAD  120

Query  461  LSILV  475
            +SI V
Sbjct  121  VSINV  125



>ref|XP_006383403.1| ribosomal protein L20 [Populus trichocarpa]
 ref|XP_011021299.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Populus 
euphratica]
 gb|ERP61200.1| ribosomal protein L20 [Populus trichocarpa]
Length=126

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSE+SMHEPYSFKALVDISR AFPGNK V+  P K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKALVDISRNAFPGNKNVVHPPRKVD  120

Query  461  LSIL  472
            +S +
Sbjct  121  MSAV  124



>ref|XP_007023565.1| Ribosomal protein L20 [Theobroma cacao]
 gb|EOY26187.1| Ribosomal protein L20 [Theobroma cacao]
Length=125

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+LKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTRQ
Sbjct  1    MNKKEILKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR AFPGNK ++    K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKNIVLPTRKAN  120

Query  461  LSILV  475
            ++I V
Sbjct  121  VAINV  125



>gb|EYU19087.1| hypothetical protein MIMGU_mgv1a016369mg [Erythranthe guttata]
Length=124

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 1/125 (1%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKK+V +LAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI RINAGTRQ
Sbjct  1    MNKKKVFELAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIMRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            +GVNYGNF+HGL KENIQLNRKVLSE+SMHEPYSFKALVD+SRTAFPGNK V+P P+K+G
Sbjct  61   YGVNYGNFIHGLTKENIQLNRKVLSEISMHEPYSFKALVDVSRTAFPGNKAVVP-PKKQG  119

Query  461  LSILV  475
            L++LV
Sbjct  120  LAMLV  124



>gb|KDP26889.1| hypothetical protein JCGZ_18047 [Jatropha curcas]
Length=129

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 113/116 (97%), Gaps = 1/116 (1%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+LKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEILKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVI-PT  445
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR AFPGNK V+ PT
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNAFPGNKNVVLPT  116



>ref|XP_010269032.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X2 [Nelumbo nucifera]
Length=125

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR  FPGNK V+  P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNVFPGNKKVVIPPKKEG  120

Query  461  LSILV  475
            LSI+ 
Sbjct  121  LSIVA  125



>ref|XP_010276581.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010276582.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010276583.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Nelumbo 
nucifera]
Length=125

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR AFPGNK V+  P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKNVVIPPKKEG  120

Query  461  LSILV  475
            L I+ 
Sbjct  121  LPIVA  125



>gb|EYU19124.1| hypothetical protein MIMGU_mgv1a016364mg [Erythranthe guttata]
Length=124

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKK+V +LAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI RINAGTRQ
Sbjct  1    MNKKKVFELAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIMRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            +GVNYGNF+HGL KENIQLNRKVLSE+SMHEPYSFKALVD+SRTAFPGNK  +P P+K+G
Sbjct  61   YGVNYGNFIHGLTKENIQLNRKVLSEISMHEPYSFKALVDVSRTAFPGNKAAVP-PKKQG  119

Query  461  LSILV  475
            L++LV
Sbjct  120  LAMLV  124



>ref|XP_008456292.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Cucumis 
melo]
 ref|XP_008456293.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Cucumis 
melo]
 ref|XP_008456294.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Cucumis 
melo]
 ref|XP_008456295.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Cucumis 
melo]
 ref|XP_008456297.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Cucumis 
melo]
Length=125

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSELSMHEPYSFKALVDISR AFPGNK V+  P+K  
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKNVVFPPKKDA  120

Query  461  LSILV  475
             S++V
Sbjct  121  ASMIV  125



>ref|XP_004139908.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Cucumis 
sativus]
 ref|XP_004139909.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Cucumis 
sativus]
 ref|XP_004139910.1| PREDICTED: 50S ribosomal protein L20-like isoform 3 [Cucumis 
sativus]
 ref|XP_004139911.1| PREDICTED: 50S ribosomal protein L20-like isoform 4 [Cucumis 
sativus]
 ref|XP_004154571.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Cucumis 
sativus]
 ref|XP_004154572.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154573.1| PREDICTED: 50S ribosomal protein L20-like isoform 3 [Cucumis 
sativus]
 gb|KGN46794.1| hypothetical protein Csa_6G135990 [Cucumis sativus]
Length=125

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSE+SMHEPYSFKALVDISR AFPGNK V+  P+K  
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSEISMHEPYSFKALVDISRNAFPGNKNVVFPPKKDA  120

Query  461  LSILV  475
             S++V
Sbjct  121  ASMIV  125



>ref|XP_010537762.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Tarenaya 
hassleriana]
Length=126

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MRSLWIQRINAGTRQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSELSMHEPYSFKALVDISR +FPGNK ++    K  
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSELSMHEPYSFKALVDISRNSFPGNKNIVQASRKID  120

Query  461  LS  466
            +S
Sbjct  121  IS  122



>ref|XP_004293880.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293881.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=124

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            M+K ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMR+LWIQRINAGTR 
Sbjct  1    MHKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRALWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSE+SMHEPY+FKALVD+S +AFPGNK V+P P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYTFKALVDVSHSAFPGNKAVVP-PKKEG  119

Query  461  LSILV  475
            L IL+
Sbjct  120  LQILL  124



>emb|CDX96808.1| BnaA08g23510D [Brassica napus]
Length=126

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+  P K  
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNSFPGNKNVVQAPRKVD  120

Query  461  LS  466
            +S
Sbjct  121  VS  122



>ref|XP_006416785.1| hypothetical protein EUTSA_v10009114mg [Eutrema salsugineum]
 gb|ESQ35138.1| hypothetical protein EUTSA_v10009114mg [Eutrema salsugineum]
Length=126

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+  P K  
Sbjct  61   HGVNYGNFVHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRKSFPGNKNVVQAPRKVD  120

Query  461  LS  466
            +S
Sbjct  121  IS  122



>ref|XP_009149112.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Brassica 
rapa]
 emb|CDY40036.1| BnaC05g12790D [Brassica napus]
 emb|CDY35115.1| BnaA06g11250D [Brassica napus]
Length=126

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+  P K  
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNSFPGNKNVVQAPRKLD  120

Query  461  LS  466
            +S
Sbjct  121  IS  122



>ref|XP_008801202.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008801203.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008801205.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008801206.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_010930227.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010930228.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010930229.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Elaeis 
guineensis]
Length=121

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR AFPGNK     P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNK----VPKKEG  116

Query  461  LSILV  475
            LS ++
Sbjct  117  LSTVL  121



>ref|XP_007138298.1| hypothetical protein PHAVU_009G196700g [Phaseolus vulgaris]
 gb|ESW10292.1| hypothetical protein PHAVU_009G196700g [Phaseolus vulgaris]
Length=121

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRV  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFK+LVDISR AFPGNK V+  P K
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKSLVDISRNAFPGNKNVVIPPRK  118



>emb|CDX83942.1| BnaC08g17030D [Brassica napus]
Length=126

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+  P K
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNSFPGNKNVVQAPRK  118



>ref|XP_008781248.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Phoenix 
dactylifera]
Length=121

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR +FPGNK     P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNSFPGNK----VPKKEG  116

Query  461  LSILV  475
            LS ++
Sbjct  117  LSTIL  121



>ref|XP_010045096.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87249.1| hypothetical protein EUGRSUZ_B03760 [Eucalyptus grandis]
Length=125

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK +VLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKAKVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            H VNYGNF HGLMKENIQLNRKVLSELSMHEP+SFKALVDISR AFPGNK V+  P K  
Sbjct  61   HSVNYGNFTHGLMKENIQLNRKVLSELSMHEPHSFKALVDISRNAFPGNKNVVHAPRKVA  120

Query  461  LSILV  475
            + + V
Sbjct  121  VPLSV  125



>dbj|BAK05413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+   P  +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNR---PPAQKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAIL  122



>ref|NP_001151809.1| 50S ribosomal protein L20 [Zea mays]
 ref|NP_001152923.1| LOC100280565 [Zea mays]
 ref|XP_002441421.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor]
 ref|XP_004961424.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Setaria 
italica]
 ref|XP_008654882.1| PREDICTED: LOC100280565 isoform X1 [Zea mays]
 gb|ACG24749.1| 50S ribosomal protein L20 [Zea mays]
 gb|ACG44382.1| 50S ribosomal protein L20 [Zea mays]
 gb|EES19851.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor]
 gb|AFW82543.1| 50S ribosomal protein L20 isoform 1 [Zea mays]
 gb|AFW82544.1| 50S ribosomal protein L20 isoform 2 [Zea mays]
Length=122

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR AFPGN+   P P K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNAFPGNR---PVPAKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LASIL  122



>gb|EMS67561.1| 50S ribosomal protein L20 [Triticum urartu]
 gb|EMT29617.1| 50S ribosomal protein L20 [Aegilops tauschii]
Length=122

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKEN+QLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+   P  +K+G
Sbjct  61   HGVNYGNFMHGLMKENVQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNR---PAAKKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LASIL  122



>ref|XP_006574365.1| PREDICTED: uncharacterized protein LOC100527387 isoform X1 [Glycine 
max]
 ref|XP_006574366.1| PREDICTED: uncharacterized protein LOC100527387 isoform X2 [Glycine 
max]
 gb|KHN38460.1| 50S ribosomal protein L20 [Glycine soja]
Length=121

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            HGVNYGNFMHGLMKENIQLNRKVLSE+SMHEPYSFK+LVDISR AFPGNK V+  P K
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKSLVDISRNAFPGNKNVVIPPRK  118



>ref|XP_002530749.1| 50S ribosomal protein L20, putative [Ricinus communis]
 gb|EEF31655.1| 50S ribosomal protein L20, putative [Ricinus communis]
Length=224

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR   PGNK ++  P K
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNTNPGNKNLVFPPRK  118



>ref|NP_173118.1| ribosomal protein L20 [Arabidopsis thaliana]
 ref|XP_006305777.1| hypothetical protein CARUB_v10010647mg [Capsella rubella]
 ref|XP_010498002.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Camelina 
sativa]
 ref|XP_010459220.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Camelina 
sativa]
 ref|XP_010476793.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Camelina 
sativa]
 gb|AAM63502.1| ribosomal protein L20, putative [Arabidopsis thaliana]
 gb|ABD38912.1| At1g16740 [Arabidopsis thaliana]
 gb|AEE29491.1| ribosomal protein L20 [Arabidopsis thaliana]
 gb|EOA38675.1| hypothetical protein CARUB_v10010647mg [Capsella rubella]
Length=126

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+    K  
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRKSFPGNKNVVQASRKVD  120

Query  461  LS  466
            +S
Sbjct  121  IS  122



>ref|XP_004491147.1| PREDICTED: 50S ribosomal protein L20-like isoform X1 [Cicer arietinum]
 ref|XP_004491148.1| PREDICTED: 50S ribosomal protein L20-like isoform X2 [Cicer arietinum]
Length=121

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIQRINAGTRV  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSE+SMHEPYSFK+LVDISR AFPGNK V+  P K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKSLVDISRNAFPGNKNVVVPPRKVA  120

Query  461  L  463
            L
Sbjct  121  L  121



>ref|XP_003617050.1| 50S ribosomal protein L20 [Medicago truncatula]
 gb|AET00009.1| 50S ribosomal protein L20 [Medicago truncatula]
 gb|AFK37819.1| unknown [Medicago truncatula]
 gb|KEH17282.1| 50S ribosomal protein L20 [Medicago truncatula]
Length=121

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            HGVNYGNFMHGL+KENIQLNRKVLSE+SMHEPYSFK+LVDISR AFPGNK V+  P K
Sbjct  61   HGVNYGNFMHGLLKENIQLNRKVLSEISMHEPYSFKSLVDISRNAFPGNKNVVVPPRK  118



>gb|KFK43877.1| hypothetical protein AALP_AA1G185600 [Arabis alpina]
Length=126

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+    K  
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNSFPGNKNVVQASRKIH  120

Query  461  LS  466
            +S
Sbjct  121  VS  122



>ref|XP_009110443.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Brassica 
rapa]
Length=126

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAK FRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKRFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK V+  P K  
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRNSFPGNKNVVQAPRKVD  120

Query  461  LS  466
            +S
Sbjct  121  VS  122



>emb|CDM84066.1| unnamed protein product [Triticum aestivum]
Length=122

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+S TAFPGN+   P  +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSSTAFPGNR---PPAQKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAIL  122



>ref|XP_004969858.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Setaria 
italica]
Length=121

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+ V    +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV----KKEG  116

Query  461  LSILV  475
            L+ ++
Sbjct  117  LAAIL  121



>ref|XP_003569741.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Brachypodium 
distachyon]
 ref|XP_010232270.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Brachypodium 
distachyon]
Length=122

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGL KENIQLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+   P  +K+G
Sbjct  61   HGVNYGNFMHGLTKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNR---PPAQKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAIL  122



>ref|NP_001235366.1| uncharacterized protein LOC100527387 [Glycine max]
 gb|ACU16475.1| unknown [Glycine max]
Length=121

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRN KRDMRSLWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNNKRDMRSLWIQRINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            HGVNYGNFMHGLMKENIQLNRKVLSE+SMHEPYSFK+LVDISR AFPGNK V+  P K
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKSLVDISRNAFPGNKNVVIPPRK  118



>ref|XP_002890186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66445.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=126

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKE+ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKR+MR LWI+RINAG+RQ
Sbjct  1    MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR +FPGNK ++    K  
Sbjct  61   HGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRKSFPGNKNMVQASRKVD  120

Query  461  LS  466
            +S
Sbjct  121  IS  122



>ref|XP_006654683.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006654684.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X2 [Oryza brachyantha]
Length=120

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 5/125 (4%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+     P K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNR-----PVKEG  115

Query  461  LSILV  475
            L+ ++
Sbjct  116  LASIL  120



>ref|NP_001056116.1| Os05g0528200 [Oryza sativa Japonica Group]
 gb|AAU43963.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group]
 dbj|BAF18030.1| Os05g0528200 [Oryza sativa Japonica Group]
 dbj|BAG88509.1| unnamed protein product [Oryza sativa Japonica Group]
Length=121

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+ V    +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV----KKEG  116

Query  461  LSILV  475
            L+ ++
Sbjct  117  LASIL  121



>ref|XP_002456306.1| hypothetical protein SORBIDRAFT_03g033790 [Sorghum bicolor]
 gb|EES01426.1| hypothetical protein SORBIDRAFT_03g033790 [Sorghum bicolor]
Length=121

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRT+FPGN+ V     K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTSFPGNRPV----RKEG  116

Query  461  LSILV  475
            L+ ++
Sbjct  117  LAAIL  121



>gb|EMT06821.1| 50S ribosomal protein L20 [Aegilops tauschii]
Length=122

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRTAF GN+   P  +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFLGNR---PPAQKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAIL  122



>ref|XP_002268463.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Vitis vinifera]
 emb|CAN74888.1| hypothetical protein VITISV_041868 [Vitis vinifera]
 emb|CBI34109.3| unnamed protein product [Vitis vinifera]
Length=125

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWI+RINAG+R 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIERINAGSRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNY NF+HGLMKENIQLNRKVLSELSMHEPY+FKALVDIS+ AFPGNK  +  P K+G
Sbjct  61   HGVNYNNFIHGLMKENIQLNRKVLSELSMHEPYTFKALVDISQNAFPGNKKAVLPPRKEG  120

Query  461  LSILV  475
            +S+++
Sbjct  121  ISVVL  125



>gb|EAY98774.1| hypothetical protein OsI_20708 [Oryza sativa Indica Group]
 gb|EEE64440.1| hypothetical protein OsJ_19285 [Oryza sativa Japonica Group]
Length=151

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  31   MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRI  90

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+ V    +K+G
Sbjct  91   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV----KKEG  146

Query  461  LSILV  475
            L+ ++
Sbjct  147  LASIL  151



>ref|XP_010935221.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Elaeis 
guineensis]
Length=121

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAG R 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGARL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENI LNRKVLSELSMHEPYSFKALVDISR +FPGNK     P+K+G
Sbjct  61   HGVNYGNFMHGLMKENIHLNRKVLSELSMHEPYSFKALVDISRKSFPGNK----VPKKEG  116

Query  461  LSILV  475
            LS ++
Sbjct  117  LSTIL  121



>ref|XP_006847994.1| hypothetical protein AMTR_s00029p00161530 [Amborella trichopoda]
 gb|ERN09575.1| hypothetical protein AMTR_s00029p00161530 [Amborella trichopoda]
Length=125

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 114/125 (91%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN---KTVIPTPE  451
            HGVNYGNFMHGL+KENIQLNRKVLSELSMHEPYSFKALVDISR AFPGN   K  I TP 
Sbjct  61   HGVNYGNFMHGLLKENIQLNRKVLSELSMHEPYSFKALVDISRAAFPGNNPQKKEI-TPP  119

Query  452  KKGLS  466
            KKG++
Sbjct  120  KKGIA  124



>ref|XP_010092489.1| 50S ribosomal protein L20 [Morus notabilis]
 gb|EXB51255.1| 50S ribosomal protein L20 [Morus notabilis]
Length=204

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  95   GIMNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGT  274
              MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWI+RINAGT
Sbjct  45   STMNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIERINAGT  104

Query  275  RQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEK  454
            RQHGVNYGNFMHGL KENIQLNRKVLSELSMHEPYSFKALV+ISR++FPGNK ++  P+K
Sbjct  105  RQHGVNYGNFMHGLTKENIQLNRKVLSELSMHEPYSFKALVNISRSSFPGNKNIVFPPKK  164

Query  455  KGLSI  469
            +  S+
Sbjct  165  EVTSL  169



>gb|AFK48588.1| unknown [Lotus japonicus]
Length=121

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIR+ARERVEKALQYSYRDRRNKKRDMR LWIQRINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRVARERVEKALQYSYRDRRNKKRDMRGLWIQRINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGL+KENIQLNRKVLSELSMHEPY+FK+LVDISR +FPGNK V+  P K  
Sbjct  61   HGVNYGNFMHGLLKENIQLNRKVLSELSMHEPYTFKSLVDISRNSFPGNKNVVIPPRKAA  120

Query  461  L  463
            +
Sbjct  121  I  121



>ref|NP_001044164.1| Os01g0734100 [Oryza sativa Japonica Group]
 dbj|BAB68076.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group]
 dbj|BAB89939.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group]
 dbj|BAF06078.1| Os01g0734100 [Oryza sativa Japonica Group]
 dbj|BAG89130.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71439.1| hypothetical protein OsI_03640 [Oryza sativa Indica Group]
 gb|EEE55345.1| hypothetical protein OsJ_03363 [Oryza sativa Japonica Group]
Length=122

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDR NKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRHNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD+SR+AFPGN+   P  +K+G
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRSAFPGNR---PPVKKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAIL  122



>ref|XP_003568051.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Brachypodium 
distachyon]
 ref|XP_010231130.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Brachypodium 
distachyon]
Length=121

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGL+KEN+QLNRKVLSELSMHEPYSFKALVD+SRTAFPGN+ V    +K+G
Sbjct  61   HGVNYGNFMHGLVKENVQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV----KKEG  116

Query  461  LSILV  475
            L+ ++
Sbjct  117  LASIL  121



>ref|XP_009408193.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408194.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408195.1| PREDICTED: 50S ribosomal protein L20, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=121

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 110/125 (88%), Gaps = 4/125 (3%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAG R 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGARL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDIS  AFPGNK     P+K  
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISSNAFPGNK----GPKKDS  116

Query  461  LSILV  475
             SI+ 
Sbjct  117  SSIVA  121



>ref|XP_010672459.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=122

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKK++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWI+RINAGTRQ
Sbjct  1    MNKKKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIERINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFM GLMKENIQLNRKVLSEL+MHEPYSFKALVD+SR AFPGNK      +K G
Sbjct  61   HGVNYGNFMCGLMKENIQLNRKVLSELAMHEPYSFKALVDVSRNAFPGNKI---ESKKVG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAVL  122



>ref|XP_010674944.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010674945.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=122

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKK++ KLAKGF+GRAKNCIRIARERVEKALQYSYRDRR KKRDMRSLWI+RINAGTRQ
Sbjct  1    MNKKKIFKLAKGFQGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIERINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFM GLMKENIQLNRKVLSEL+MHEPYSFKALVD+S  AFPGNK     P+K G
Sbjct  61   HGVNYGNFMCGLMKENIQLNRKVLSELAMHEPYSFKALVDVSGNAFPGNKI---EPKKVG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LATVL  122



>ref|XP_010269028.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269029.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269031.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X1 [Nelumbo nucifera]
Length=144

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNK  430
            HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR  FPGNK
Sbjct  61   HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNVFPGNK  110



>ref|XP_010667813.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=122

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKK++ KLAKGF+GRAKNCI IARERVEKALQYSYRDRR KKRDMRSLWI+RIN GTRQ
Sbjct  1    MNKKKIFKLAKGFQGRAKNCIGIARERVEKALQYSYRDRRTKKRDMRSLWIERINVGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFM GLMKENIQLNRKVLSEL+MHEPYSFKALVD+SR A PGNK     P+K G
Sbjct  61   HGVNYGNFMCGLMKENIQLNRKVLSELAMHEPYSFKALVDVSRNASPGNKI---EPKKVG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LATIL  122



>gb|ABK22506.1| unknown [Picea sitchensis]
Length=125

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            M K ++LKLAKGFRGRAKNCIR+ARERVEKALQYSYRDRRNKKRDMR LWIQRINAGTR 
Sbjct  1    MQKDQILKLAKGFRGRAKNCIRVARERVEKALQYSYRDRRNKKRDMRGLWIQRINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYG F+HGL KENIQLNRKVLSEL+MHEPYSFK+LV+I+R AFPGNK   P   K+ 
Sbjct  61   HGVNYGQFIHGLTKENIQLNRKVLSELAMHEPYSFKSLVEIARNAFPGNKVPCPIDTKET  120

Query  461  LSI  469
             ++
Sbjct  121  TTL  123



>ref|XP_006644665.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Oryza 
brachyantha]
Length=122

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRG AKNCIRIARERVEKALQYSYRD RNKKRDMRSLWI+RINA TR 
Sbjct  1    MNKGKIFKLAKGFRGMAKNCIRIARERVEKALQYSYRDIRNKKRDMRSLWIERINADTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKG  460
            HGVNYGNFM GLMKENIQLNRKVLSELSMHEPYSFKALVD+S +AFPGN+   P  +K+G
Sbjct  61   HGVNYGNFMRGLMKENIQLNRKVLSELSMHEPYSFKALVDVSSSAFPGNR---PPVKKEG  117

Query  461  LSILV  475
            L+ ++
Sbjct  118  LAAIL  122



>ref|XP_001772593.1| predicted protein [Physcomitrella patens]
 gb|EDQ62635.1| predicted protein [Physcomitrella patens]
Length=113

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MN +++L+LAKGFRGR+KNCIR ARERVEKALQY+YRDRRNKKRDMR LWIQRINAGTRQ
Sbjct  1    MNNQKILQLAKGFRGRSKNCIRAARERVEKALQYAYRDRRNKKRDMRGLWIQRINAGTRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKT  433
            HGVNYG+FM+GL KENI LNRKVLSEL+MHEPYSFK+LVDISR AF   KT
Sbjct  61   HGVNYGDFMNGLSKENIDLNRKVLSELAMHEPYSFKSLVDISRIAFTQVKT  111



>ref|XP_002963494.1| hypothetical protein SELMODRAFT_227421 [Selaginella moellendorffii]
 ref|XP_002988205.1| hypothetical protein SELMODRAFT_271988 [Selaginella moellendorffii]
 gb|EFJ10624.1| hypothetical protein SELMODRAFT_271988 [Selaginella moellendorffii]
 gb|EFJ35365.1| hypothetical protein SELMODRAFT_227421 [Selaginella moellendorffii]
Length=119

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            M+K  +LKLA+GFRGRAKNCIRIARERVEKALQY+YRDRR+KKRDMRSLWI RINAG R 
Sbjct  1    MHKDTILKLARGFRGRAKNCIRIARERVEKALQYAYRDRRSKKRDMRSLWIMRINAGARI  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDIS  406
            +G+ Y NFMHGL +ENIQLNRKVLSE++M+EPYSFK L DIS
Sbjct  61   YGLRYSNFMHGLNRENIQLNRKVLSEIAMNEPYSFKCLADIS  102



>ref|XP_005845388.1| hypothetical protein CHLNCDRAFT_25913 [Chlorella variabilis]
 gb|EFN53286.1| hypothetical protein CHLNCDRAFT_25913 [Chlorella variabilis]
Length=133

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK +V KLAKGFRGRAKNCIRIARERVEK+LQY++RDRR KKRDMRSLWI RI AG+RQ
Sbjct  1    MNKTKVFKLAKGFRGRAKNCIRIARERVEKSLQYAFRDRRTKKRDMRSLWITRITAGSRQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            +GV Y   +HGL +ENIQ+NRK+LSEL+M+EPYSFKALVD
Sbjct  61   YGVKYSELIHGLKQENIQINRKMLSELAMNEPYSFKALVD  100



>ref|XP_005646214.1| putative 50S ribosomal protein L20 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21670.1| putative 50S ribosomal protein L20 [Coccomyxa subellipsoidea 
C-169]
Length=109

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            M+K +V +LAKGFRGR+KNCIRIARERVEKALQY++RDR+ KKRDMRSLWIQRINA +++
Sbjct  1    MHKDKVFQLAKGFRGRSKNCIRIARERVEKALQYAWRDRKAKKRDMRSLWIQRINAASKE  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
            HGV Y   MHGL ++NIQ+NRKVLSEL+M EP+SFKALVD  RT
Sbjct  61   HGVPYSRLMHGLQQDNIQVNRKVLSELAMQEPFSFKALVDQVRT  104



>ref|XP_010269033.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform 
X3 [Nelumbo nucifera]
Length=115

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++ KLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWI+RINAGTR 
Sbjct  1    MNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRL  60

Query  281  HGVNYGNFMHGLMKENIQLNRK  346
            HGVNYGNFMHGLMKENIQLNRK
Sbjct  61   HGVNYGNFMHGLMKENIQLNRK  82



>ref|XP_002505674.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66932.1| predicted protein [Micromonas sp. RCC299]
Length=115

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            M  +++ KLAKGFRGRAKN IRIAR RVEKALQY+YRDR+ KKRD R LWIQ+INAGTR+
Sbjct  1    MKAEKIFKLAKGFRGRAKNTIRIARNRVEKALQYAYRDRKAKKRDFRGLWIQQINAGTRE  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            HG+ YG F+ GL  ENIQLNRK+L++L+ +EPYSFKALVD
Sbjct  61   HGIGYGEFISGLKDENIQLNRKMLADLAQNEPYSFKALVD  100



>gb|KFM27719.1| 50S ribosomal protein L20 [Auxenochlorella protothecoides]
Length=118

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNK ++LKLAKGFRGR+KNCIR+ARERVEK+LQY++RDR+ KKRDMR+LWIQ+INAG RQ
Sbjct  1    MNKDKILKLAKGFRGRSKNCIRVARERVEKSLQYAFRDRKAKKRDMRALWIQQINAGARQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            +GV Y + + GL  +N+ LNRK+LSEL+  EP SFKALVD
Sbjct  61   YGVKYSSLISGLAAQNVGLNRKMLSELARTEPLSFKALVD  100



>ref|XP_001422740.1| Putative mitochondrial ribosomal protein L20 [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP01057.1| Putative mitochondrial ribosomal protein L20 [Ostreococcus lucimarinus 
CCE9901]
Length=110

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            K ++ K AKGFRGRAK+C++IAR RVEKA QY YRDRRNKKRD R+LWI RINA TR+HG
Sbjct  4    KDKIFKAAKGFRGRAKSCVKIARNRVEKAWQYQYRDRRNKKRDWRALWITRINAATREHG  63

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            V Y  F++ L  EN+ ++RK+L+EL+++EP SFKALVD
Sbjct  64   VRYNEFINSLTAENVCVDRKILAELAVNEPKSFKALVD  101



>ref|WP_012567485.1| 50S ribosomal protein L20 [Rhodospirillum centenum]
 ref|YP_002298513.1| 50S ribosomal protein L20 [Rhodospirillum centenum SW]
 sp|B6IPJ8.1|RL20_RHOCS RecName: Full=50S ribosomal protein L20 [Rhodospirillum centenum 
SW]
 gb|ACI99700.1| ribosomal protein L20 [Rhodospirillum centenum SW]
Length=119

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKG+RGR+  C RIA ERVEKAL+Y+YRDRRN+KRD R LWIQRINAG R HG+
Sbjct  15   KKVLKLAKGYRGRSSKCYRIALERVEKALRYAYRDRRNRKRDFRGLWIQRINAGARLHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  FMHGL +  I+++RKVLS+++  EP SFKALV+ ++ A   
Sbjct  75   TYSKFMHGLKRAGIEVDRKVLSDIAAREPESFKALVEQAQKALAA  119



>gb|EFA74733.1| hypothetical protein PPL_11764 [Polysphondylium pallidum PN500]
Length=118

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MN  ++ KLAKGF GR+KNC  +ARERVEK+L+Y+Y  RR  KRDMRS+WIQRINAG RQ
Sbjct  1    MNIDKIFKLAKGFYGRSKNCKSLARERVEKSLEYNYVSRRLVKRDMRSMWIQRINAGARQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
            H + Y  F  G++  NIQ+NRK+LSEL++ EPYSFKAL D ++   
Sbjct  61   HDLTYNAFTRGMVASNIQINRKILSELAITEPYSFKALTDYAKVTL  106



>gb|EKE09492.1| 50S ribosomal protein L20 [uncultured bacterium]
Length=119

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKG+RGR+K+C RIA +RVEKALQY+YRDRR +KRD R+LWIQRINAG R+HG+
Sbjct  15   KKVLKLAKGYRGRSKSCYRIALQRVEKALQYAYRDRRTRKRDFRALWIQRINAGAREHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  F++GL +  I+++RKVL++L++HEP +FK +V  ++ A 
Sbjct  75   TYSKFVNGLTRAGIEIDRKVLADLAVHEPIAFKEIVAQAQKAL  117



>ref|WP_029010942.1| 50S ribosomal protein L20 [Azospirillum halopraeferens]
Length=122

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            +++LKLAKG+RGR   C RIA E+VEKAL+Y+YRDRRNKKRD R LWIQRINAG RQHG+
Sbjct  15   RKILKLAKGYRGRNSTCFRIAIEKVEKALRYAYRDRRNKKRDFRGLWIQRINAGVRQHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  F++G+    I+++RKVL++L+  EP SFKALVD +R A   
Sbjct  75   TYSRFINGIKLAGIEMDRKVLADLAAREPDSFKALVDRARDALSA  119



>ref|WP_028034207.1| 50S ribosomal protein L20 [Chelativorans sp. J32]
Length=133

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVL+++++HEP +F ALV  S+ A    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVAKSKAALEYLKNTTP  125



>ref|WP_008834381.1| 50S ribosomal protein L20 [Mesorhizobium alhagi]
 gb|EHK58767.1| 50S ribosomal protein L20 [Mesorhizobium alhagi CCNWXJ12-2]
Length=133

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LW+QRINA TR+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWVQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKGLS  466
             YG F+ GL K  I+++RKVLS++++HEP +F ALV  ++ A    K   P   +  ++
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAFAALVAQAKVALEYLKNTTPNAFESAVA  133



>ref|WP_011304263.1| 50S ribosomal protein L20 [Ehrlichia canis]
 ref|YP_302783.1| 50S ribosomal protein L20 [Ehrlichia canis str. Jake]
 sp|Q3YSX0.1|RL20_EHRCJ RecName: Full=50S ribosomal protein L20 [Ehrlichia canis str. 
Jake]
 gb|AAZ68185.1| LSU ribosomal protein L20P [Ehrlichia canis str. Jake]
Length=124

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+KLAKG+RGR+KNC RIA +RVEKALQY+YRDRRN+KR  RSLWI RINA  RQHG+
Sbjct  15   KKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSLWIMRINAAARQHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKT  433
             Y +F+HGL   NI LNRKVL++++++   +FK +VDI++ A   ++ 
Sbjct  75   LYSDFIHGLSLANITLNRKVLADMAVNNQDNFKQIVDITKEALTKSRV  122



>ref|WP_028878778.1| 50S ribosomal protein L20 [Terasakiella pusilla]
Length=118

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K+++K AKG+RGR KN +R+A E+V+K LQY YRDRRNKKR+ RSLWIQRINAGTRQ+G
Sbjct  13   RKKIIKQAKGYRGRNKNVLRVAMEKVDKGLQYQYRDRRNKKRNFRSLWIQRINAGTRQYG  72

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            V+Y  FM+GL    I+L+RKVL++L+  EP +FK+LVD ++ A  
Sbjct  73   VSYSQFMNGLKLAGIELDRKVLADLAAREPEAFKSLVDQAQAALA  117



>dbj|GAM24927.1| hypothetical protein SAMD00019534_081020, partial [Acytostelium 
subglobosum LB1]
Length=123

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MN  ++ KLAKGF GR+KNC  +ARERVEK L+Y+Y  RR  KRDMR++WIQRINAG RQ
Sbjct  7    MNIDKIFKLAKGFYGRSKNCKSLARERVEKGLEYNYVSRRLIKRDMRAMWIQRINAGVRQ  66

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR  409
            H + Y +F   L+  NI LNRK+LSEL++ EPYSFKAL D+++
Sbjct  67   HDLTYNSFARALVASNIVLNRKILSELAITEPYSFKALTDLAK  109



>ref|WP_040843389.1| 50S ribosomal protein L20 [Nitrospirillum amazonense]
Length=120

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGR+ NC RIA E+VEKAL+Y+YRDRR KKR+ R+LWIQRINAG R HG+
Sbjct  15   KKILKLAKGYRGRSNNCFRIAIEKVEKALRYAYRDRRAKKRNFRALWIQRINAGARIHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  FMHGL +  I ++RKVL++++  EP +FK LVD ++ A   
Sbjct  75   TYSQFMHGLKRAAIDVDRKVLADIAAREPEAFKVLVDQAQAALKA  119



>ref|WP_011580017.1| 50S ribosomal protein L20 [Chelativorans sp. BNC1]
 ref|YP_673239.1| 50S ribosomal protein L20 [Chelativorans sp. BNC1]
 sp|Q11KK1.1|RL20_CHESB RecName: Full=50S ribosomal protein L20 [Chelativorans sp. BNC1]
 gb|ABG62074.1| LSU ribosomal protein L20P [Chelativorans sp. BNC1]
Length=133

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVL+++++HEP +F ALV  S+ +    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVAKSKASLEYLKNTTP  125



>ref|WP_013650959.1| 50S ribosomal protein L20 [Polymorphum gilvum]
 ref|YP_004301929.1| Phenylalanyl-tRNA synthetase, alpha subunit [Polymorphum gilvum 
SL003B-26A1]
 gb|ADZ68635.1| Phenylalanyl-tRNA synthetase, alpha subunit [Polymorphum gilvum 
SL003B-26A1]
Length=118

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEKA QY+YRDR+ +KR+ RSLWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKAAQYAYRDRKVRKRNFRSLWIQRINAATREHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG F+ GL K  I+++RKVLS+L++H+P +FKALVD ++ A  
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDLAIHQPEAFKALVDKAQGALA  118



>ref|XP_002948443.1| mitochondrial ribosomal protein L20 [Volvox carteri f. nagariensis]
 gb|EFJ50318.1| mitochondrial ribosomal protein L20 [Volvox carteri f. nagariensis]
Length=117

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            +N++++ +LA GFRGRA+NCI++AR +VEKALQ++Y  R+ KKR  RS+WIQRINAGTR+
Sbjct  3    INRQKIFQLASGFRGRARNCIKLARLQVEKALQHAYVGRKLKKRHWRSVWIQRINAGTRE  62

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            HG+ Y   +  L  EN+QLNRKVLSEL+M+EPYSFKALV+
Sbjct  63   HGMTYTTLITRLKDENVQLNRKVLSELAMNEPYSFKALVE  102



>emb|CEI84853.1| 50S ribosomal protein L20 [Ehrlichia mineirensis]
Length=124

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++KLAKG+RGR+KNC R+A +RVEKALQY+YRDRRN+KR  RSLWI RINA  RQHG+
Sbjct  15   KKIIKLAKGYRGRSKNCYRVALQRVEKALQYAYRDRRNRKRFFRSLWIMRINAAVRQHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKT  433
             Y +F+HGL   NI LNRKVL++++++   +FK +VDI++ A   ++ 
Sbjct  75   LYSDFIHGLSLANITLNRKVLADMAVNNQDNFKQIVDITKEALTKSRV  122



>ref|WP_035025166.1| MULTISPECIES: 50S ribosomal protein L20 [Proteobacteria]
 gb|EXL09155.1| 50S ribosomal protein L20 [Aquamicrobium defluvii]
 gb|EZQ17346.1| 50S ribosomal protein L20 [Pseudomonas bauzanensis]
Length=132

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +2

Query  95   GIMNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGT  274
            G    K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+ +KR+ R+LWIQRINA  
Sbjct  9    GHARHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKARKRNFRALWIQRINAAV  68

Query  275  RQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
            R+HG+ YG F+ GL K  I+++RKVLS++++HEP +F ALV  S+TA    K   P
Sbjct  69   REHGLTYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAFAALVAKSKTALEYLKDTTP  124



>ref|WP_026868581.1| 50S ribosomal protein L20 [Inquilinus limosus]
Length=121

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA    RIA E+VEKAL+Y+YRDRRNKKRD R LWIQRINAG R+HG+
Sbjct  15   KKILKLAKGYRGRASTNYRIAIEKVEKALRYAYRDRRNKKRDFRGLWIQRINAGVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FMHG+    I ++RKV+S+++  EP SFKALV+ ++ A 
Sbjct  75   TYSKFMHGIKLAGIDIDRKVMSDIATREPESFKALVEQAQAAL  117



>ref|WP_024588135.1| 50S ribosomal protein L20 [Aliihoeflea sp. 2WW]
Length=133

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVLS++++HEP +F ALV  S+ +    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAFAALVGKSKASLDYLKDTTP  125



>ref|WP_037235402.1| 50S ribosomal protein L20 [Rhodomicrobium udaipurense]
 gb|KAI95380.1| 50S ribosomal protein L20 [Rhodomicrobium udaipurense JA643]
Length=124

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL+ AKGF GR KN IRIA++ VEK+LQY+YRDRR KKR+ RSLWIQRINA TR+HG+
Sbjct  15   KKVLEQAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRRTKKRNFRSLWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F+ GL K  I+++RKVLS+L++ +P  F ALV  +R A P 
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDLAITDPAGFAALVGKAREALPA  119



>ref|WP_006936626.1| 50S ribosomal protein L20 [Labrenzia aggregata]
 gb|EAV42607.1| 50S ribosomal protein L20 [Stappia aggregata IAM 12614]
Length=119

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ KKR+ RSLWIQRINA TRQHG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKAKKRNFRSLWIQRINAATRQHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F+ GL K  I+++RKVLS+L++++P +FKALVD ++ A   
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVDQAQGALAA  119



>ref|WP_008190886.1| 50S ribosomal protein L20 [Labrenzia alexandrii]
 gb|EEE44079.1| ribosomal protein L20 [Labrenzia alexandrii DFL-11]
Length=119

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ KKR+ RSLWIQRINA TRQHG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRVAKQAVEKAGQYAYRDRKAKKRNFRSLWIQRINAATRQHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F++GL K  I+++RKVLS+L++ +P +FKALVD ++ A   
Sbjct  75   TYGTFINGLNKAGIEVDRKVLSDLAISQPDAFKALVDQAQGALAA  119



>ref|WP_013418492.1| 50S ribosomal protein L20 [Rhodomicrobium vannielii]
 ref|YP_004011187.1| 50S ribosomal protein L20 [Rhodomicrobium vannielii ATCC 17100]
 gb|ADP70088.1| ribosomal protein L20 [Rhodomicrobium vannielii ATCC 17100]
Length=124

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL+ AKGF GR KN IRIA++ VEK+LQY+YRDRR KKR+ RSLWIQRINA TR+HG+
Sbjct  15   KKVLEQAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRRTKKRNFRSLWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F+ GL K  I+++RKVLS++++ +P  F ALV  +R A P 
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAITDPTGFAALVGKAREALPA  119



>ref|WP_019904744.1| 50S ribosomal protein L20 [Methylobacterium sp. 77]
Length=124

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK A+G+ GR KN IRIA++ VEK +QY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAARGYYGRRKNTIRIAKQAVEKGMQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F++GLMK  I+++RK LSEL++HEP SF  +V+ ++ A P
Sbjct  75   TYSRFINGLMKSGIEVDRKALSELAIHEPASFAVVVEKAKAALP  118



>ref|WP_024081824.1| 50S ribosomal protein L20 [Magnetospirillum gryphiswaldense]
 ref|YP_008939553.1| 50S ribosomal subunit protein L20 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CAM76289.1| 50S ribosomal protein L20 [Magnetospirillum gryphiswaldense MSR-1]
 emb|CDL00899.1| 50S ribosomal subunit protein L20 [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=118

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKGFRGR+  C R+A E+VEKAL+Y+YRDRR KKR+ R+LWIQRINAGTRQ+G+
Sbjct  15   KKILKLAKGFRGRSSTCFRVAIEKVEKALRYAYRDRRAKKRNFRALWIQRINAGTRQYGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM+GL K  I L+RKVL++++  EP SFK+LV  +  A 
Sbjct  75   PYSRFMNGLKKAGIVLDRKVLADIAAREPESFKSLVQKAEAAL  117



>ref|WP_037019231.1| 50S ribosomal protein L20 [Rhizobiales bacterium YIM 77505]
Length=121

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK++QY+YRDR+N+KR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKQAKGFYGRRKNTIRIAKQAVEKSMQYAYRDRKNRKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F+ GL K  I+++RKVLSEL++HEP +F A V+ +++A P
Sbjct  75   TYSRFIDGLGKAGIEVDRKVLSELAIHEPAAFAAYVEKAKSALP  118



>ref|WP_012453520.1| MULTISPECIES: 50S ribosomal protein L20 [Methylobacterium]
 ref|YP_001924307.1| 50S ribosomal protein L20 [Methylobacterium populi BJ001]
 sp|B1ZGB4.1|RL20_METPB RecName: Full=50S ribosomal protein L20 [Methylobacterium populi 
BJ001]
 gb|ACB79772.1| ribosomal protein L20 [Methylobacterium populi BJ001]
Length=121

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEK LQY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F++ L K  I+++RK LSEL++HEP +F A+V+ +++A P
Sbjct  75   TYSRFINALAKSGIEVDRKALSELAIHEPAAFAAVVEKAKSALP  118



>gb|AHX04165.1| ribosomal protein L20 [Ehrlichia sp. HF]
Length=124

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+KLAKG+RGR+KNC RIA +RVEKALQY+YRDRRN+KR  RSLWI RINA  RQHG+
Sbjct  15   KKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSLWIMRINAAARQHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKT  433
             Y +F+HGL   NI LNRK+L++++++   +FK +VD+ + A   ++ 
Sbjct  75   LYSDFIHGLSLTNITLNRKILADMAVNHQDNFKQIVDLIKEALTKHRV  122



>ref|WP_024849468.1| 50S ribosomal protein L20 [Aminobacter sp. J41]
Length=133

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL  AKGF GR KN IRIA++ VEK+LQY+YRDR+ +KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVLAQAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKARKRNFRALWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVLS++++HEP +F ALV  S+TA    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDIAIHEPQAFAALVAKSKTALEYLKDTTP  125



>emb|CEG02138.1| Ribosomal protein L20 [Ostreococcus tauri]
Length=110

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            + ++   AKG RGRAKNC +IAR RVEKA QY YRDRR KKR+ R+LWI RINA TR+HG
Sbjct  4    RDKIFAFAKGMRGRAKNCAKIARNRVEKAWQYQYRDRRTKKRNARALWITRINAATREHG  63

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
            + Y  F+HGL +EN+ ++RK+L+EL+++EP SF+ALV+  +T
Sbjct  64   LKYNEFVHGLGRENVCVDRKILAELAVNEPLSFRALVERVKT  105



>ref|WP_011154821.1| 50S ribosomal protein L20 [Ehrlichia ruminantium]
 ref|YP_180004.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 ref|YP_197009.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 ref|YP_196055.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Gardel]
 sp|Q5FH69.1|RL20_EHRRG RecName: Full=50S ribosomal protein L20 [Ehrlichia ruminantium 
str. Gardel]
 sp|Q5HC39.1|RL20_EHRRW RecName: Full=50S ribosomal protein L20 [Ehrlichia ruminantium 
str. Welgevonden]
 emb|CAH57853.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 emb|CAI27581.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Gardel]
 emb|CAI26627.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
Length=123

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+KLAKG+RGR+KNC R+A +RVEKALQY+YRDRRN+KR  RSLWI RINA  RQ+G+
Sbjct  15   KKVIKLAKGYRGRSKNCYRVALQRVEKALQYAYRDRRNRKRFFRSLWIMRINAAVRQYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKT  433
             Y +F++GL   NI LNRK+L+++++H   +FK +VD+++ A   ++ 
Sbjct  75   LYSDFIYGLSLANITLNRKILADMAVHNKDNFKQIVDLTKEALTKSRV  122



>ref|WP_020400112.1| 50S ribosomal protein L20 [Kordiimonas gwangyangensis]
Length=119

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL+ AKG+RGR KN I++AR+ VEKA QY+YRDR+ KKR  R+LWIQRINAGTR  G+
Sbjct  15   KKVLEQAKGYRGRRKNTIKVARQAVEKAGQYAYRDRKAKKRTFRALWIQRINAGTRALGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG FMHGL    ++L+RKVLS+L++ EP +F+ALVD ++ A  
Sbjct  75   QYGQFMHGLKLAGVELDRKVLSDLAIKEPAAFEALVDQAKAALA  118



>ref|WP_025029706.1| 50S ribosomal protein L20 [Nitratireductor aquibiodomus]
Length=133

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKGF GR KN IRIA++ VEK+LQY+YRDR+ +KR+ R+LWIQRINAG R+HG+
Sbjct  15   KKVMKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKARKRNFRALWIQRINAGAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVL+++++HEP +F ALV  S+ A    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVKKSKEALVYLKDTTP  125



>ref|WP_037459051.1| 50S ribosomal protein L20 [Skermanella stibiiresistens]
 gb|EWY37347.1| 50S ribosomal protein L20 [Skermanella stibiiresistens SB22]
Length=121

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            +++LKLAKG+RGR+  C RIA ++VEKAL+Y+YRDRRNKKR+ RSLWIQRINAG RQ+G+
Sbjct  15   RKILKLAKGYRGRSSKCFRIAIQKVEKALRYAYRDRRNKKREFRSLWIQRINAGVRQYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  FM+G+ +  + ++RKVL+ L+ HEP +FK LVD
Sbjct  75   TYSRFMNGMKRAGVDVDRKVLASLAAHEPDAFKVLVD  111



>ref|WP_034836891.1| 50S ribosomal protein L20 [Inquilinus limosus]
 gb|KGM33918.1| 50S ribosomal protein L20 [Inquilinus limosus MP06]
Length=121

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA    RIA E+VEKAL+Y+YRDRRNKKRD R LWIQRINAG R+HG+
Sbjct  15   KKILKLAKGYRGRASTNYRIAIEKVEKALRYAYRDRRNKKRDFRGLWIQRINAGVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FMHG+    I ++RKV+S+++  +  SFKALVD ++ A 
Sbjct  75   TYSKFMHGIKLAGIDIDRKVMSDIATRDAESFKALVDQAQAAL  117



>ref|WP_040986810.1| 50S ribosomal protein L20 [Mesorhizobium plurifarium]
 emb|CDX38245.1| 50S ribosomal subunit protein L20 [Mesorhizobium plurifarium]
 emb|CDX53421.1| 50S ribosomal subunit protein L20 [Mesorhizobium plurifarium]
 emb|CDX19301.1| 50S ribosomal subunit protein L20 [Mesorhizobium plurifarium]
Length=133

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA   +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAAVHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVLS++++HEP +F ALV  ++ A    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAFAALVGKAKVALEYLKNTTP  125



>ref|WP_028481833.1| 50S ribosomal protein L20 [Nesiotobacter exalbescens]
Length=118

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ +KR+ RSLWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKTRKRNFRSLWIQRINAATREHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTA  415
             YG F+ GL K  I+++RKVLS+L++++P +FKALVD ++ A
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVDKAQAA  116



>ref|WP_015932001.1| 50S ribosomal protein L20 [Methylobacterium nodulans]
 ref|YP_002500698.1| 50S ribosomal protein L20 [Methylobacterium nodulans ORS 2060]
 sp|B8IP77.1|RL20_METNO RecName: Full=50S ribosomal protein L20 [Methylobacterium nodulans 
ORS 2060]
 gb|ACL60395.1| ribosomal protein L20 [Methylobacterium nodulans ORS 2060]
Length=125

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEK LQY+YRDR+N+KR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNRKRSFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y  F+ GL K  I ++RK LSEL++HEP +F A+V+ ++ A P  
Sbjct  75   TYSRFIDGLAKAGIVVDRKALSELAIHEPAAFSAVVEKAKAALPAE  120



>ref|WP_023002609.1| MULTISPECIES: 50S ribosomal protein L20 [Labrenzia]
 gb|ERP87508.1| 50S ribosomal protein L20 [Labrenzia sp. C1B10]
 gb|ERS07811.1| 50S ribosomal protein L20 [Labrenzia sp. C1B70]
Length=119

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKG+ GR KN IR+A++ VEKA QY+YRDR+ KKR+ RSLWIQRINA TRQHG+
Sbjct  15   KKVIKAAKGYYGRRKNTIRVAKQAVEKAGQYAYRDRKAKKRNFRSLWIQRINAATRQHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F+ GL K  I+++RKVLS+L++++P +FKALVD ++ A   
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVDQAQGALAA  119



>ref|WP_024071768.1| 50S ribosomal protein L20 [Ehrlichia muris]
 ref|YP_008928792.1| 50S ribosomal protein L20 [Ehrlichia muris AS145]
 gb|AHC38969.1| 50S ribosomal protein L20 [Ehrlichia muris AS145]
Length=124

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+KLAKG+RGR+KNC RIA +RVEKALQY+YRDRRN+KR  RSLWI RINA  RQ+G+
Sbjct  15   KKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSLWIMRINAAARQYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTV  436
             Y +F+HGL   NI LNRK+L++++++   +FK +V++++ A   ++ V
Sbjct  75   LYSDFIHGLSLANITLNRKILADMAVNHQDNFKQIVNLTKEALTKHRVV  123



>ref|WP_006010467.1| 50S ribosomal protein L20 [Ehrlichia chaffeensis]
 ref|YP_507021.1| 50S ribosomal protein L20 [Ehrlichia chaffeensis str. Arkansas]
 sp|Q2GHR2.1|RL20_EHRCR RecName: Full=50S ribosomal protein L20 [Ehrlichia chaffeensis 
str. Arkansas]
 gb|EAM85813.1| Ribosomal protein L20, bacterial and organelle form [Ehrlichia 
chaffeensis str. Sapulpa]
 gb|ABD45437.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Arkansas]
 gb|AHX04013.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Heartland]
 gb|AHX05947.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Jax]
 gb|AHX06937.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Liberty]
 gb|AHX07369.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Osceola]
 gb|AHX08518.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Saint Vincent]
 gb|AHX09341.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Wakulla]
 gb|AHX10885.1| ribosomal protein L20 [Ehrlichia chaffeensis str. West Paces]
Length=124

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+KLAKG+RGR+KNC RIA +RVEKALQY+YRDRRN+KR  RSLWI RINA  RQHG+
Sbjct  15   KKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSLWIMRINAAVRQHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y +F+HGL   N+ LNRKVL++++++    FK +VD+ + A 
Sbjct  75   LYSDFIHGLSLANVTLNRKVLADMAVNHKDHFKQIVDLIKEAL  117



>ref|WP_012335023.1| MULTISPECIES: 50S ribosomal protein L20 [Methylobacterium]
 ref|YP_001772072.1| 50S ribosomal protein L20 [Methylobacterium sp. 4-46]
 sp|B0UPJ6.1|RL20_METS4 RecName: Full=50S ribosomal protein L20 [Methylobacterium sp. 
4-46]
 gb|ACA19638.1| ribosomal protein L20 [Methylobacterium sp. 4-46]
Length=125

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEK LQY+YRDR+N+KR+ RSLWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNRKRNFRSLWIQRLNAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y   + GL K  I ++RK LSEL++HEP +F A+V+ +R A P  
Sbjct  75   TYSRLIDGLAKAGIVVDRKALSELAIHEPAAFAAVVEQARAALPAE  120



>ref|WP_003602669.1| 50S ribosomal protein L20 [Methylobacterium extorquens]
 ref|YP_001639098.1| 50S ribosomal protein L20 [Methylobacterium extorquens PA1]
 ref|YP_002962661.1| 50S ribosomal protein L20 [Methylobacterium extorquens AM1]
 ref|YP_003067844.1| 50S ribosomal protein L20 [Methylobacterium extorquens DM4]
 sp|A9W371.1|RL20_METEP RecName: Full=50S ribosomal protein L20 [Methylobacterium extorquens 
PA1]
 gb|ABY30027.1| ribosomal protein L20 [Methylobacterium extorquens PA1]
 gb|ACS39384.1| 50S ribosomal protein L20 [Methylobacterium extorquens AM1]
 emb|CAX23898.1| 50S ribosomal protein L20 [Methylobacterium extorquens DM4]
 gb|EHP91118.1| 50S ribosomal protein L20 [Methylobacterium extorquens DSM 13060]
Length=121

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEK LQY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F++ L +  I+++RK LSEL++HEP +F A+V+ +++A P
Sbjct  75   TYSRFINALAQSGIEVDRKALSELAIHEPAAFAAVVEKAKSALP  118



>ref|WP_007009055.1| 50S ribosomal protein L20 [Nitratireductor aquibiodomus]
 gb|EIM73924.1| 50S ribosomal protein L20 [Nitratireductor aquibiodomus RA22]
Length=133

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKGF GR KN IRIA++ VEK++QY+YRDR+ +KR+ R+LWIQRINAG R+HG+
Sbjct  15   KKVMKAAKGFYGRRKNTIRIAKQAVEKSMQYAYRDRKARKRNFRALWIQRINAGAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+++RKVL+++++HEP +F ALV  S+ A    K   P
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVKKSKEALVYLKDTTP  125



>ref|WP_038602345.1| 50S ribosomal protein L20 [Rickettsiales bacterium Ac37b]
 gb|AIL64909.1| Ribosomal protein L20 [Rickettsiales bacterium Ac37b]
Length=117

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGR+KNC RIA E+VEKAL+Y+YRDRRN+KRD R+LWIQRINA  R++G+
Sbjct  15   KKILKLAKGYRGRSKNCYRIAIEKVEKALRYAYRDRRNRKRDFRALWIQRINAAVREYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  F+ G+ K  I ++RKVL++L++ EP +FK++V+ ++ A 
Sbjct  75   VYSRFIDGINKSGITMDRKVLADLAVREPEAFKSVVEQAKAAL  117



>ref|WP_036362947.1| 50S ribosomal protein L20 [Microvirga lupini]
Length=122

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK++QY+ RDRRNKKR  R+LWIQR+NA  R HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSMQYATRDRRNKKRTFRALWIQRLNAAVRTHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F+ GL K  I+++RKVLSEL++HEP +F A V+ ++ A P
Sbjct  75   TYSRFIDGLGKAGIEVDRKVLSELAIHEPAAFAAYVERAKAALP  118



>ref|WP_007302081.1| MULTISPECIES: 50S ribosomal protein L20 [Wolbachia]
 ref|YP_001975425.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Culex quinquefasciatus 
Pel]
 sp|B3CLK2.1|RL20_WOLPP RecName: Full=50S ribosomal protein L20 [Wolbachia endosymbiont 
of Culex quinquefasciatus Pel]
 emb|CAQ54770.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex quinquefasciatus 
Pel]
 gb|EEB55652.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex quinquefasciatus 
JHB]
 emb|CDH88474.1| 50S ribosomal protein L20,50S ribosomal protein L20,50S ribosomal 
protein L20,ribosomal protein L20,Ribosomal protein L20 
[Wolbachia endosymbiont wPip_Mol of Culex molestus]
Length=121

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKG+RGRAKNC RIA +RVEKALQY+YRDRRN+KRD R LWI RINA  R+HG+
Sbjct  15   KKVLKLAKGYRGRAKNCYRIALQRVEKALQYAYRDRRNRKRDFRGLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             YG FMHGL    + LNRK+L+E++++    F  L++   +    N
Sbjct  75   TYGRFMHGLKLVGVDLNRKILAEMAVNHKDDFAKLIETVSSKLAEN  120



>ref|WP_012461400.1| 50S ribosomal protein L20 [Orientia tsutsugamushi]
 ref|YP_001937481.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Ikeda]
 sp|B3CRZ0.1|RL20_ORITI RecName: Full=50S ribosomal protein L20 [Orientia tsutsugamushi 
str. Ikeda]
 dbj|BAG40247.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Ikeda]
Length=121

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +2

Query  95   GIMNK---KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRIN  265
            G +NK   K++LKLAKG+RGRAKNC RIA ++VEKALQYSYRDRRN+KR  R+LWIQRIN
Sbjct  7    GKVNKNRHKKILKLAKGYRGRAKNCFRIAIQKVEKALQYSYRDRRNRKRQFRALWIQRIN  66

Query  266  AGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            A  RQ+ + Y  F++GL + NI ++RKV+++L++H   SF  LV++++ +  
Sbjct  67   AAVRQYDITYSQFINGLKQANITVDRKVMADLAVHNADSFVHLVELTKKSLA  118



>ref|WP_018044556.1| MULTISPECIES: 50S ribosomal protein L20 [Methylobacterium]
Length=124

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK A+G+ GR KN IRIA++ VEK +QY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAARGYYGRRKNTIRIAKQAVEKGMQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F++GL K  I+++RK LSEL++HEP SF  +V+ ++ A P
Sbjct  75   TYSRFINGLAKSGIEVDRKALSELAIHEPASFAVVVEKAKAALP  118



>gb|EWM28277.1| 50s ribosomal protein l20 [Nannochloropsis gaditana]
Length=158

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++K+AKG+RGR  NC RIA +RVEKALQY+YRDR+ KKR+ RSLWIQRI A  +Q+G+
Sbjct  57   KKIVKMAKGYRGRT-NCFRIAVQRVEKALQYAYRDRKVKKREFRSLWIQRIGAAVQQYGM  115

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
            NY  F+ GL + NI LNRKVL++L++ EPYSFKA+V+  R+
Sbjct  116  NYSRFIPGLRRANITLNRKVLADLAVSEPYSFKAVVETVRS  156



>tpg|DAA57761.1| TPA: hypothetical protein ZEAMMB73_608772 [Zea mays]
Length=76

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 4/80 (5%)
 Frame = +2

Query  236  MRSLWIQRINAGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTA  415
            MR LWI+RINAGTR HGVNYGNF+HGLMKENIQLNRKVLSELSMHEPYSFKALVD+SRT 
Sbjct  1    MRPLWIERINAGTRLHGVNYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTG  60

Query  416  FPGNKTVIPTPEKKGLSILV  475
            FPGN+ V    +K+GL+ ++
Sbjct  61   FPGNRPV----KKEGLAAIL  76



>ref|WP_006013542.1| 50S ribosomal protein L20 [Wolbachia pipientis]
 emb|CCE77306.1| 50S ribosomal subunit protein L20 [Wolbachia pipientis wAlbB]
Length=121

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKG+RGRAKNC RIA +RVEKALQY+YRDRRN+KRD R LWI RINA  R+HG+
Sbjct  15   KKVLKLAKGYRGRAKNCYRIALQRVEKALQYAYRDRRNRKRDFRGLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             YG FMHGL    + LNRK+L+E++++    F  L++   +    N
Sbjct  75   TYGRFMHGLKLVGVDLNRKILAEMAVNHKDDFAKLIETVNSKLAEN  120



>ref|WP_009758999.1| 50S ribosomal protein L20 [Roseibium sp. TrichSKD4]
 gb|EFO32417.1| ribosomal protein L20 [Roseibium sp. TrichSKD4]
Length=118

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ KKR+ RSLWIQRINA TRQHG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKAKKRNFRSLWIQRINAATRQHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG F+ GL K  ++++RKVLS+L++++P +FKALV+ ++ A  
Sbjct  75   TYGRFIDGLNKAGVEVDRKVLSDLAINQPDAFKALVEKAQGALA  118



>gb|ETZ04719.1| 50S ribosomal protein L20 [Holospora undulata HU1]
 dbj|GAJ45918.1| 50S ribosomal protein L20 [Holospora elegans E1]
Length=133

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++K+AKG+RGR+ +C RIA +RVEKALQY YRDRR KKRD R+LWIQRINA  R HG+
Sbjct  15   KKIIKMAKGYRGRSGSCFRIALQRVEKALQYMYRDRRCKKRDFRALWIQRINAAVRHHGI  74

Query  290  NYGNFMHG---LMKENIQ-LNRKVLSELSMHEPYSFKALVDISRTAFPGNKTV  436
             Y +FMHG   L KE  + LNRK+LS++++H P +  AL++  +   PG++ V
Sbjct  75   VYSDFMHGLSLLQKEAGEVLNRKILSDMAVHSPETLSALIERVKAVIPGHRCV  127



>ref|WP_017531794.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Diaphorina 
citri]
Length=121

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAKNC RIA +RVEKALQYSYRDRRN+KRD R LWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKNCYRIALQRVEKALQYSYRDRRNRKRDFRGLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             YG FMHGL    + LNRK+L+E++++    F  L++   +    N
Sbjct  75   TYGRFMHGLKLAGVDLNRKILAEMAVNYKDDFAKLIETVNSKLVEN  120



>ref|WP_038249658.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Glossina 
morsitans morsitans]
 gb|KDB19554.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Glossina 
morsitans morsitans]
Length=121

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAK+C RIA +RVEKAL+Y+YRDRRN+KRD RSLWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKSCYRIALQRVEKALRYAYRDRRNRKRDFRSLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG FMHGL  + I LNRK+L+E++++    F  LV+
Sbjct  75   TYGRFMHGLTLDGIDLNRKILAEMAVNYKDDFAKLVE  111



>ref|WP_011642072.1| 50S ribosomal protein L20 [Maricaulis maris]
 ref|YP_755363.1| 50S ribosomal protein L20 [Maricaulis maris MCS10]
 sp|Q0ATG2.1|RL20_MARMM RecName: Full=50S ribosomal protein L20 [Maricaulis maris MCS10]
 gb|ABI64425.1| LSU ribosomal protein L20P [Maricaulis maris MCS10]
Length=118

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K V+K AKG+ GR KN  R+A + VEKA QY+YRDRR KKR+ R+LWIQRINAG RQH +
Sbjct  15   KSVIKKAKGYYGRRKNTFRVAVQAVEKAGQYAYRDRRAKKRNFRALWIQRINAGARQHEM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
            +Y  FM+GL K  I+++RKVL++++MHEP +FKALVD +R A 
Sbjct  75   SYSVFMNGLTKAGIEVDRKVLADIAMHEPDAFKALVDQARAAL  117



>ref|WP_009538887.1| 50S ribosomal protein L20 [Caenispirillum salinarum]
 gb|EKV32399.1| LSU ribosomal protein L20p [Caenispirillum salinarum AK4]
Length=118

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKG+RGR     R+A E+VEK LQY+YRDRRNKKRD RSLWIQRINAG R HG+
Sbjct  15   KKVLKLAKGYRGRNSTNFRVAIEKVEKGLQYAYRDRRNKKRDFRSLWIQRINAGARAHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM+GL K  I+L+RKVL++L++ EP +F +LV  +  A 
Sbjct  75   TYSKFMNGLSKAGIELDRKVLADLAVREPDAFASLVKQAEEAL  117



>ref|WP_010962891.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
melanogaster]
 ref|NP_966615.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
melanogaster]
 sp|Q73GR7.1|RL20_WOLPM RecName: Full=50S ribosomal protein L20 [Wolbachia endosymbiont 
of Drosophila melanogaster]
 gb|AAS14549.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila melanogaster]
 gb|ERN55457.1| 50S ribosomal protein L20 [Wolbachia pipientis wMelPop]
Length=121

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAK+C RIA +RVEKALQY+YRDRR +KRD RSLWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRTRKRDFRSLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG FMHGL    I LNRK+L+E++++    F  LV+
Sbjct  75   TYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVE  111



>ref|XP_644502.1| hypothetical protein DDB_G0273771 [Dictyostelium discoideum AX4]
 ref|XP_644748.1| hypothetical protein DDB_G0273295 [Dictyostelium discoideum AX4]
 gb|EAL70576.1| hypothetical protein DDB_G0273771 [Dictyostelium discoideum AX4]
 gb|EAL70865.1| hypothetical protein DDB_G0273295 [Dictyostelium discoideum AX4]
Length=122

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MN  +V KLAKGF GR+KNC  +ARERVEK L+Y+Y  R+ KKRD R +WI+RINAG RQ
Sbjct  1    MNIDKVFKLAKGFFGRSKNCKSLARERVEKGLEYNYVSRKLKKRDFRKMWIERINAGARQ  60

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG--NKTVIPTPEK  454
            H + Y +F  GL+   +++NRK+LSEL++ EP+SFK LVD S+        K+ IP  + 
Sbjct  61   HEMTYSDFQRGLIASGVEINRKILSELAVSEPFSFKVLVDHSKNTVSNLHPKSYIPLDQP  120

Query  455  K  457
            K
Sbjct  121  K  121



>ref|XP_001689789.1| mitochondrial ribosomal protein L20 [Chlamydomonas reinhardtii]
 gb|EDP09527.1| mitochondrial ribosomal protein L20 [Chlamydomonas reinhardtii]
Length=115

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            +N++++L+LA  FRGRA+ CI IAR RVEKALQ++Y  R+ KKR  RS+WIQRINA +R+
Sbjct  3    INRQKILQLASSFRGRARTCINIARLRVEKALQHAYVGRKLKKRHWRSVWIQRINAASRE  62

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            HG++Y   + GL  EN+ LNRKVLSEL+M EP+SFKALV+
Sbjct  63   HGMSYTGLITGLKAENVALNRKVLSELAMSEPFSFKALVE  102



>ref|WP_008596342.1| 50S ribosomal protein L20 [Nitratireductor pacificus]
 gb|EKF19256.1| 50S ribosomal protein L20 [Nitratireductor pacificus pht-3B]
Length=133

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVMKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWIQRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG  + GL K  I+++RKVLS++++HEP +F ALV  ++ A    K   P
Sbjct  75   TYGRLIDGLNKAGIEIDRKVLSDMAIHEPQAFAALVGKAKEALVYLKDTTP  125



>ref|XP_007509956.1| 50S ribosomal protein L20 [Bathycoccus prasinos]
 emb|CCO19071.1| 50S ribosomal protein L20 [Bathycoccus prasinos]
Length=123

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            K+++  LAKGFRGRAKNC R+A +RVEKALQY YRDRR KKR+ R  WI RINA +R+HG
Sbjct  4    KEKIFALAKGFRGRAKNCFRVANQRVEKALQYQYRDRRTKKREARKDWIVRINAASREHG  63

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            V Y  FM G+  +N+ L+RK+L+EL+++EP SF+AL +
Sbjct  64   VKYAEFMRGIGVDNVCLDRKILAELAVNEPKSFRALCE  101



>ref|WP_006279340.1| MULTISPECIES: 50S ribosomal protein L20 [Wolbachia]
 ref|YP_002727359.1| ribosomal protein L20 [Wolbachia sp. wRi]
 sp|C0R3S6.1|RL20_WOLWR RecName: Full=50S ribosomal protein L20 [Wolbachia sp. wRi]
 gb|EAL59237.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila ananassae]
 gb|EEH12412.1| ribosomal protein L20 [Wolbachia endosymbiont of Muscidifurax 
uniraptor]
 gb|ACN95568.1| ribosomal protein L20 [Wolbachia sp. wRi]
 emb|CDR79227.1| 50S ribosomal protein L20,50S ribosomal protein L20,50S ribosomal 
protein L20,ribosomal protein L20,Ribosomal protein L20 
[Wolbachia]
Length=121

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAK+C RIA +RVEKALQY+YRDRR +KRD RSLWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRTRKRDFRSLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG FMHGL    I LNRK+L+E++++    F  LV+
Sbjct  75   TYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVE  111



>ref|WP_041046059.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Cimex lectularius]
 dbj|BAP00201.1| ribosomal protein L20 [Wolbachia endosymbiont of Cimex lectularius]
Length=121

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAK+C RIA +RVEKALQY+YRDRRN+KRD RSLWI R+NA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRNRKRDFRSLWIIRVNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG FM+GL    I LNRKVL+E++++    F  LV+
Sbjct  75   TYGRFMYGLTLAGISLNRKVLAEMAVNYKDDFAELVE  111



>ref|WP_038539115.1| 50S ribosomal protein L20 [endosymbiont of Acanthamoeba sp. UWC36]
 gb|AIF81327.1| 50S ribosomal protein L20 [endosymbiont of Acanthamoeba sp. UWC8]
 gb|KIE04763.1| 50S ribosomal protein L20 [endosymbiont of Acanthamoeba sp. UWC36]
Length=121

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG++GR+KNC R+A E+VEK LQY+YRDRRNKKRD R+LWIQRINA  R+HG+
Sbjct  15   KKILKLAKGYKGRSKNCFRVAVEKVEKGLQYAYRDRRNKKRDFRALWIQRINAAVREHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  F+ GL    + LNRK+LSE+++H+  +F+ +V +S  A 
Sbjct  75   IYSQFIKGLKLSGVDLNRKMLSEIAIHDQPAFEKVVALSLEAI  117



>ref|WP_015589254.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
simulans]
 ref|YP_007889355.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
simulans wHa]
 gb|AGK00178.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
simulans wHa]
Length=121

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAK+C RIA +RVEKALQY+YRDRRN+KRD R LWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRNRKRDFRGLWIIRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG FMHGL    I LNRK+L+E++++    F  LV+
Sbjct  75   TYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVE  111



>ref|WP_010402775.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Nasonia 
vitripennis]
Length=118

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAKNC RIA +RVEKALQY+YRDRR  KRD R LWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKNCYRIALQRVEKALQYAYRDRRTCKRDFRGLWIIRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDI  403
             YG FMHGL    I LNRK+L+E++++    F  L++I
Sbjct  75   TYGKFMHGLKLAEIDLNRKILAEMAVNHKDDFAKLIEI  112



>ref|XP_003059992.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55944.1| predicted protein [Micromonas pusilla CCMP1545]
Length=125

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            ++KK V +L+KGFRGRAKN IRIAR RVEKALQ++ R RR +  ++R  WIQ+INAG R+
Sbjct  9    ISKKRVFELSKGFRGRAKNTIRIARIRVEKALQHATRHRRARAGEVRRNWIQQINAGARE  68

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            HG+ Y   +HGL +ENI +NRK+LS+L+++EPYSFKALVD
Sbjct  69   HGLKYSELIHGLKEENIHMNRKMLSDLAINEPYSFKALVD  108



>ref|WP_029042248.1| 50S ribosomal protein L20 [Cucumibacter marinus]
Length=133

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR K+ IR AR+ VEKA QY+YRDR+ +KR+ R+LW+QRINA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKSTIRTARQAVEKAGQYAYRDRKARKRNFRALWVQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTP  448
             YG F+ GL K  + ++RKVL++L++HEP +FKALVD ++ A    K V  T 
Sbjct  75   TYGRFIDGLSKAEVAVDRKVLADLAVHEPEAFKALVDSAKAALGYLKDVEATT  127



>ref|WP_008616781.1| 50S ribosomal protein L20 [Magnetospirillum sp. SO-1]
 gb|EME70150.1| 50S ribosomal protein L20 [Magnetospirillum sp. SO-1]
Length=118

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGR+  C R+A ++VEKAL+Y+YRDRR KKR+ R+LWIQRINAG+R +G+
Sbjct  15   KKILKLAKGYRGRSSTCFRVAIQKVEKALRYAYRDRRAKKRNFRALWIQRINAGSRAYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM GL K  I L+RKVLS++++ EP +FK+LV+ ++ A 
Sbjct  75   PYSRFMDGLKKAGIALDRKVLSDIAIREPEAFKSLVEKAQAAL  117



>ref|WP_024924238.1| MULTISPECIES: 50S ribosomal protein L20 [Mesorhizobium]
 ref|XP_005970849.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Pantholops 
hodgsonii]
Length=133

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+ +KR+ R+LW+QRINA  R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKARKRNFRALWVQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKGLS  466
             YG F+ GL K  I+++RKVLS++++HEP +F  LV  ++ A    K   P   +  ++
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAFAVLVGKAKVALEYLKNTTPNAFESAVA  133



>ref|WP_002728693.1| MULTISPECIES: 50S ribosomal protein L20 [Phaeospirillum]
 emb|CCG41524.1| 50S ribosomal subunit protein L20 [Phaeospirillum molischianum 
DSM 120]
 gb|EPY03302.1| 50S ribosomal protein L20 [Phaeospirillum fulvum MGU-K5]
Length=118

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            +++LKLAKG+RGRA  C R+A E+VEKAL+Y+YRDRR KKR+ R+LWIQRINAG+R +G+
Sbjct  15   RKILKLAKGYRGRASTCFRVAIEKVEKALRYAYRDRRAKKRNFRALWIQRINAGSRAYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM GL K  I L+RKVLS++++ EP +F++LV+ ++ A 
Sbjct  75   PYSRFMDGLKKAGIALDRKVLSDIAIREPEAFRSLVEKAQAAL  117



>ref|WP_036485217.1| 50S ribosomal protein L20 [Nitratireductor basaltis]
 gb|KFB08463.1| 50S ribosomal protein L20 [Nitratireductor basaltis]
Length=133

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IR+A++ VEK++QY+YRDR+ +KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVLKSAKGFYGRRKNTIRVAKQAVEKSMQYAYRDRKARKRNFRALWIQRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG  + GL K  I+++RKVLS++++HEP +F ALV  ++TA    K   P
Sbjct  75   TYGRLIDGLNKAGIEIDRKVLSDMAIHEPQAFGALVKQAKTALEYLKDTTP  125



>ref|WP_009869562.1| MULTISPECIES: 50S ribosomal protein L20 [Magnetospirillum]
 ref|YP_423746.1| 50S ribosomal protein L20 [Magnetospirillum magneticum AMB-1]
 sp|Q2VYY8.1|RL20_MAGSA RecName: Full=50S ribosomal protein L20 [Magnetospirillum magneticum 
AMB-1]
 dbj|BAE53187.1| Ribosomal protein L20 [Magnetospirillum magneticum AMB-1]
 gb|KIL97628.1| LSU ribosomal protein L20p [Magnetospirillum magnetotacticum 
MS-1]
Length=118

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGR+  C R+A ++VEKAL+Y+YRDRR KKR+ R+LWIQRINAG+R +G+
Sbjct  15   KKILKLAKGYRGRSSTCFRVAIQKVEKALRYAYRDRRAKKRNFRALWIQRINAGSRAYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM GL K  I L+RKVLS++++ EP +FK+LV+ ++ A 
Sbjct  75   PYSRFMDGLKKAGIALDRKVLSDIAIREPDAFKSLVEKAQAAL  117



>ref|WP_027315906.1| 50S ribosomal protein L20 [Microvirga flocculans]
Length=122

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V K AKGF GR KN IRIA++ VEK++QY+ RDRRNKKR  R+LWIQR+NA  R HG+
Sbjct  15   KKVFKAAKGFYGRRKNTIRIAKQAVEKSMQYATRDRRNKKRTFRALWIQRLNAAVRVHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F+ GL K  I+++RKVLSEL++HEP +F A V+ ++ A P
Sbjct  75   TYSRFIDGLGKAGIEVDRKVLSELAIHEPAAFAAYVERAKAALP  118



>ref|WP_022709387.1| 50S ribosomal protein L20 [Pseudochrobactrum sp. AO18b]
Length=133

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK A+GFRGR KN IR A+  V+++ QY+YRDR+N+KR  R+LWIQRINA  R HG+
Sbjct  15   KKVLKQAEGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRTFRALWIQRINAAVRMHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K NI+++RKVLS+L++HEP +F ALV  ++ A    K   P
Sbjct  75   TYGRFIDGLAKANIEVDRKVLSDLAIHEPAAFGALVASAKKALEYLKDTTP  125



>ref|WP_011944544.1| 50S ribosomal protein L20 [Orientia tsutsugamushi]
 ref|YP_001248416.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Boryong]
 sp|A5CCZ4.1|RL20_ORITB RecName: Full=50S ribosomal protein L20 [Orientia tsutsugamushi 
str. Boryong]
 emb|CAM79624.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Boryong]
Length=121

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = +2

Query  95   GIMNK---KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRIN  265
            G +NK   K++LKLAKG+RGRAKNC RIA ++VEKALQYSYRDRRN+KR  R+LWIQRIN
Sbjct  7    GKVNKNRHKKILKLAKGYRGRAKNCFRIAIQKVEKALQYSYRDRRNRKRQFRALWIQRIN  66

Query  266  AGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            A  RQ+ + Y  F++GL + NI ++RKV++ L++H   SF  LV++++ +  
Sbjct  67   AAVRQYDMTYSQFINGLKQANITVDRKVMANLAVHNADSFVHLVELTKKSLA  118



>ref|WP_014954649.1| 50S ribosomal protein L20 [alpha proteobacterium HIMB59]
 ref|YP_006757995.1| 50S ribosomal protein L20 [alpha proteobacterium HIMB59]
 gb|AFS48818.1| LSU ribosomal protein L20P [alpha proteobacterium HIMB59]
Length=119

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V +  KG RGR KN  R+A + ++KALQY+YRDRRNKKRD R LWIQRINAG R++G+
Sbjct  15   KKVFEFTKGHRGRRKNVYRVATQSMDKALQYAYRDRRNKKRDFRGLWIQRINAGVREYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTA  415
             Y  F+ GL K NI++NRK+LSE++ HEP  FK++V+ +++ 
Sbjct  75   TYAKFIDGLKKANIEINRKILSEIAFHEPAQFKSIVEKAKST  116



>ref|WP_019173816.1| 50S ribosomal protein L20 [Pseudaminobacter salicylatoxidans]
Length=133

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+ +KR+ R+LW+QRINA  R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKVRKRNFRALWVQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTPEKKGLS  466
             YG F+ GL K  I+++RKVLS++++HEP +F ALV  ++      K   P   +  ++
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAFAALVAKAKVGLEYLKDTTPNAFESAVA  133



>ref|WP_008943356.1| 50S ribosomal protein L20 [Oceanibaculum indicum]
 gb|EKE78099.1| 50S ribosomal protein L20 [Oceanibaculum indicum P24]
Length=121

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL LAKG+RGR  +  RIA E+VEK LQY+YRDRRNKKRD R LWIQRINA  R HG+
Sbjct  15   KKVLDLAKGYRGRGNSSYRIALEKVEKGLQYAYRDRRNKKRDFRGLWIQRINAAARMHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y  FM G+ K  I ++RKVLS+++  EP +FK+LV+ ++ A   N
Sbjct  75   PYSKFMDGIKKAGIDIDRKVLSDIATREPDTFKSLVEQAQAALASN  120



>ref|XP_009616278.1| PREDICTED: 50S ribosomal protein L20, cyanelle-like [Nicotiana 
tomentosiformis]
Length=81

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ
Sbjct  1    MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  60

Query  281  HGV  289
            HGV
Sbjct  61   HGV  63



>ref|WP_011256855.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Brugia malayi]
 ref|YP_198487.1| 50S ribosomal protein L20 [Wolbachia endosymbiont strain TRS 
of Brugia malayi]
 sp|Q5GRX9.1|RL20_WOLTR RecName: Full=50S ribosomal protein L20 [Wolbachia endosymbiont 
strain TRS of Brugia malayi]
 gb|AAW71245.1| Ribosomal protein L20 [Wolbachia endosymbiont strain TRS of Brugia 
malayi]
Length=121

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L LAKG+RGRAK+C RIA +RVEKALQY+YRDRRN+KRD RSLWI RINA  R+HG+
Sbjct  15   KKILNLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRNRKRDFRSLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             YG FMHGL    + LNRK+L+E++++    F  L +   +    N
Sbjct  75   TYGRFMHGLALAGVDLNRKILAEMAVNYKDDFTKLAETVSSKLAEN  120



>ref|WP_011712062.1| 50S ribosomal protein L20 [Magnetococcus marinus]
 ref|YP_864298.1| 50S ribosomal protein L20 [Magnetococcus marinus MC-1]
 sp|A0L4J9.1|RL20_MAGSM RecName: Full=50S ribosomal protein L20 [Magnetococcus marinus 
MC-1]
 gb|ABK42892.1| LSU ribosomal protein L20P [Magnetococcus marinus MC-1]
Length=117

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR  +C RIA+++VEK LQY+YRDR+N KR+MR LWI RINA TR HG+
Sbjct  15   KKVLKAAKGYTGRNNSCFRIAKQKVEKGLQYAYRDRKNLKREMRRLWIARINAATRLHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
            +Y  FM+GL K  I+L+RKVLSEL++ EP SF  LV+ ++ A 
Sbjct  75   SYSQFMNGLNKAGIELDRKVLSELAISEPESFGTLVEQAKAAL  117



>ref|WP_029030312.1| 50S ribosomal protein L20 [Salinarimonas rosea]
Length=124

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IR A+  V++++QY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRTAKAAVDRSMQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  F+ GL K  I+++RKVLS++++HEP +F ALV+ ++ A P 
Sbjct  75   TYSRFIDGLNKAGIEVDRKVLSDIAIHEPAAFAALVEKAKGALPA  119



>ref|WP_009450931.1| 50S ribosomal protein L20 [Nitratireductor indicus]
 gb|EKF41690.1| 50S ribosomal protein L20 [Nitratireductor indicus C115]
Length=133

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVMKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWIQRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG  + GL K  I+++RKVL+++++HEP +F A+V  ++ A    K   P
Sbjct  75   TYGRLIDGLNKAGIEIDRKVLADMAVHEPQAFAAIVGKAKEALVYLKDTTP  125



>ref|XP_003385334.1| PREDICTED: 50S ribosomal protein L20-like [Amphimedon queenslandica]
Length=163

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  113  EVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVN  292
            +V  + KGFRGRA NC  +A    +KALQ++Y+ R+ KKRDMRS+WIQRIN G+R+HG+ 
Sbjct  15   KVFAITKGFRGRANNCYSLAVRAAQKALQHAYKGRKQKKRDMRSMWIQRINLGSREHGMP  74

Query  293  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR  409
            Y   M+GL K +IQLNRKVLSE+++HEP +FKALVDI++
Sbjct  75   YNYLMNGLAKSSIQLNRKVLSEIAVHEPRTFKALVDIAQ  113



>ref|WP_024161173.1| 50S ribosomal protein L20 [Holospora obtusa]
 gb|ETZ07107.1| 50S ribosomal protein L20 [Holospora obtusa F1]
Length=133

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++K+AKG+RGR+K+C RIA +RVEKALQY YRDRR KKRD RSLWIQRINA  R+HG+
Sbjct  15   KKIIKMAKGYRGRSKSCFRIALQRVEKALQYMYRDRRCKKRDFRSLWIQRINAAVRRHGI  74

Query  290  NYGNFMHGL----MKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTV  436
             Y +F+HGL      E   LNRK+L+++++  P SF ALV+  +   P  + V
Sbjct  75   VYSDFIHGLGLLQKDEGDVLNRKILADMAIQAPESFSALVERVKQVIPEYRCV  127



>ref|WP_015587849.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
simulans]
 ref|YP_007885557.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
simulans wNo]
 gb|AGJ98681.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila 
simulans wNo]
Length=121

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAKNC RIA +RVEKALQY+YRDRR  KRD R LWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKNCYRIALQRVEKALQYAYRDRRTCKRDFRGLWIIRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             YG FMHGL    I LNRK+L+E++++    F  LV+   +    N
Sbjct  75   TYGRFMHGLKLAEIDLNRKILAEMAVNYKDDFAKLVETVNSKLAEN  120



>ref|WP_032112258.1| 50S ribosomal protein L20 [Candidatus Paracaedibacter symbiosus]
Length=123

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK+AKG+RGR+  C R A +RVEKALQY+YRDRRNKKR+ R+LWIQRINA  R+ G+
Sbjct  15   KKVLKMAKGYRGRSSTCFRPAIQRVEKALQYAYRDRRNKKREFRALWIQRINAAVRECGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y  FM+G+ K  I L+RK L+ L+MH P S KALV  ++ A  GN
Sbjct  75   TYSRFMNGIAKAGITLDRKALAVLAMHNPESIKALVAQAQDAL-GN  119



>ref|WP_014869313.1| MULTISPECIES: 50S ribosomal protein L20 [Wolbachia]
 ref|YP_006556345.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Onchocerca 
ochengi]
 emb|CCF78528.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Onchocerca 
ochengi]
Length=121

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRAKNC RIA ++VEKAL YSYRDR+N+KRD RSLWI RINA  R+HG+
Sbjct  15   KKILKLAKGYRGRAKNCYRIALQKVEKALLYSYRDRKNRKRDFRSLWIIRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y  F+HGLM   I LNRK+L+E++++    F  LV+   +    N
Sbjct  75   TYSRFIHGLMLAGIDLNRKILAEMAVNYKDDFTKLVEAVSSKLVEN  120



>ref|WP_019834127.1| 50S ribosomal protein L20 [Sphingomonas sp. PR090111-T3T-6A]
Length=125

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  116  VLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVNY  295
            +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR  R+LWIQRINA  R  G+ Y
Sbjct  17   ILDAAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRALWIQRINAAVRTEGLTY  76

Query  296  GNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            G FMHGL   NI+L+RKVL++L+MHE  +FKA+V  ++ A P
Sbjct  77   GVFMHGLKLANIELDRKVLADLAMHEGEAFKAIVAQAKAALP  118



>ref|WP_019403890.1| 50S ribosomal protein L20 [Chelatococcus sp. GW1]
Length=120

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IR A+  V++A+QY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRTAKAAVDRAMQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  F+ GL K  I+++RKVLS++++ EP SFK++V+ ++ A P 
Sbjct  75   TYSRFIDGLGKAGIEIDRKVLSDIAIREPESFKSIVEKAKAALPA  119



>ref|WP_029349792.1| 50S ribosomal protein L20 [Bosea sp. 117]
Length=122

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ KKR+ R+LWIQRINA TR+ G 
Sbjct  15   KKVLKAAKGYFGRRKNTIRVAKQAVEKAQQYAYRDRKVKKRNFRALWIQRINAATRELGF  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             YG F+ GL K  I+++RKVLS++++HEP +FKALV+ ++ A 
Sbjct  75   TYGRFIDGLGKAGIEVDRKVLSDIAIHEPDAFKALVEQAKAAL  117



>ref|WP_029012315.1| 50S ribosomal protein L20 [Niveispirillum irakense]
Length=121

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGR   C R+A E+VEKAL+Y+YRDRRNKKRD R LWIQRINAG R HG+
Sbjct  15   KKILKLAKGYRGRGSKCYRVAIEKVEKALRYAYRDRRNKKRDFRRLWIQRINAGARLHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALV  397
             Y   +HGL +  I+L+RKVLS+++  EP +FK L 
Sbjct  75   KYSTLVHGLKRAGIELDRKVLSDIAAREPDTFKDLC  110



>ref|WP_022006321.1| 50S ribosomal protein L20 [Proteobacteria bacterium CAG:495]
 emb|CCZ30800.1| 50S ribosomal protein L20 [Proteobacteria bacterium CAG:495]
Length=119

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V  +AKG+RGR+KN  R+A E+VEKALQY+YRDRR KKR+ RSLWIQRINA +R H +
Sbjct  15   KKVFSMAKGYRGRSKNVFRVAIEKVEKALQYAYRDRRTKKRNFRSLWIQRINAASRLHDM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FM GL K  I+L+RKVL+++++ EP +F  LVD  + A  
Sbjct  75   TYSRFMSGLAKAGIELDRKVLADIAVKEPETFAKLVDQVKAALS  118



>ref|WP_013951076.1| 50S ribosomal protein L20 [Candidatus Midichloria mitochondrii]
 ref|YP_004679550.1| 50S ribosomal protein L20 [Candidatus Midichloria mitochondrii 
IricVA]
 gb|AEI88864.1| ribosomal protein L20 [Candidatus Midichloria mitochondrii IricVA]
 emb|CBJ36213.1| 50S ribosomal protein L20 [Candidatus Midichloria mitochondrii]
Length=120

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L +AKG+RGR+KNC R+A E+VEK LQY+YRDR+NKKRD R +WIQRINA  R HG+
Sbjct  15   KKILDMAKGYRGRSKNCFRVAIEKVEKGLQYAYRDRKNKKRDFRGIWIQRINAAARLHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  F+ GL   N+ LNRK+L+E+++H+P +F +LV+
Sbjct  75   VYSQFIRGLNLANVGLNRKMLAEIAIHQPETFASLVE  111



>ref|WP_008553032.1| MULTISPECIES: 50S ribosomal protein L20 [Pseudovibrio]
 ref|YP_005079542.1| 50S ribosomal protein L20 [Pseudovibrio sp. FO-BEG1]
 gb|EEA91820.1| ribosomal protein L20 [Pseudovibrio sp. JE062]
 gb|AEV35520.1| Ribosomal protein L20, bacterial-type [Pseudovibrio sp. FO-BEG1]
Length=118

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKG+ GR KN IR+A++ VEKA QY+YRDR+ +KR+ R+LWIQRINA TR+HG+
Sbjct  15   KKVIKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKARKRNFRALWIQRINAATREHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG F+ GL K  I+++RKVLS+L++++P +FKALV+ ++ A  
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVEKAQAAVA  118



>emb|CCQ72711.1| 50S ribosomal subunit protein L20 [Magnetospira sp. QH-2]
Length=117

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKG++GR     R+A E+VEK LQY+YRDRR KKR  RSLWIQRINA  R H +
Sbjct  15   KKVLKLAKGYQGRNSTAYRVALEKVEKGLQYAYRDRRAKKRSFRSLWIQRINAAARLHDM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM+GL K  ++L+RKVL++L++HEP +F +LV+ +R+A 
Sbjct  75   TYSQFMNGLTKAGVELDRKVLADLAVHEPEAFGSLVEQARSAL  117



>ref|WP_036117896.1| 50S ribosomal protein L20 [Mangrovimonas yunxiaonensis]
 gb|KFB02188.1| 50S ribosomal protein L20 [Mangrovimonas yunxiaonensis]
Length=114

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K+VLK AKG+ GR KN   +A+  V+KA+QYSYRDRRNKKR  R+LWIQRINAG RQHG
Sbjct  14   RKKVLKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRRNKKRTFRALWIQRINAGARQHG  73

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            ++Y  FM  L   NI+LNRKVL++L+M+ P +FKA+VD
Sbjct  74   MSYSKFMGQLKANNIELNRKVLADLAMNHPEAFKAIVD  111



>ref|WP_027834228.1| 50S ribosomal protein L20 [Maritalea myrionectae]
Length=133

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ +KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVLKSAKGYYGRRKNTIRVAKQAVEKAGQYAYRDRKARKRNFRALWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTP  448
             YG F+ GL K  + ++RKVL++L++ EP SFKALV+ ++ A    K V  T 
Sbjct  75   TYGRFIDGLSKAEVAVDRKVLADLAVREPESFKALVETAKKALGYLKDVDATT  127



>emb|CBJ48761.1| 50S ribosomal protein L20P [Ectocarpus siliculosus]
Length=115

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGR+K+  +IA +RVEKALQ +YRDR+NKKR+ R LWI+RINAG RQHG+
Sbjct  9    KKILKLAKGYRGRSKSVFKIAIQRVEKALQQAYRDRKNKKREFRRLWIERINAGVRQHGM  68

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  F++   K +++LNRKVL+E+++ EPYSF+A+V+
Sbjct  69   PYSVFVNKARKADVELNRKVLAEMAVTEPYSFRAVVE  105



>ref|WP_014238729.1| 50S ribosomal protein L20 [Azospirillum brasilense]
 ref|YP_005029891.1| 50S ribosomal subunit protein L20 [Azospirillum brasilense Sp245]
 emb|CCC96405.1| 50S ribosomal subunit protein L20 [Azospirillum brasilense Sp245]
 gb|EZQ07486.1| 50S ribosomal protein L20 [Azospirillum brasilense]
 gb|AIB10497.1| 50S ribosomal protein L20 [Azospirillum brasilense]
Length=123

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            +++LKLAKG+RGR     RIA E+VEKALQY+YRDRRNKKRD R LWIQRINAG RQ+G+
Sbjct  15   RKILKLAKGYRGRNSKNFRIAIEKVEKALQYAYRDRRNKKRDFRGLWIQRINAGVRQYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  F++G+    I+++RKVLS+L+  EP +FKA+VD
Sbjct  75   TYSRFINGIKLAGIEIDRKVLSDLAAREPEAFKAIVD  111



>ref|WP_015333358.1| 50S ribosomal protein L20 [Fibrella aestuarina]
 ref|YP_007322852.1| ribosomal protein L20 [Fibrella aestuarina BUZ 2]
 emb|CCH02259.1| ribosomal protein L20 [Fibrella aestuarina BUZ 2]
Length=142

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K++LKLAKGF GR KN   +A+  VEKAL Y+YRDR+ KKRD R+LWIQRINAG RQHG
Sbjct  42   RKKILKLAKGFYGRRKNVWTVAKNAVEKALGYAYRDRKAKKRDFRALWIQRINAGARQHG  101

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            ++Y  FM  L K  I+LNRKVL++L+M+ P +FKA+VD
Sbjct  102  MSYSAFMGALHKSGIELNRKVLADLAMNHPEAFKAVVD  139



>dbj|GAK32500.1| 50S ribosomal protein L20 [alpha proteobacterium Q-1]
Length=121

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+  A GFRGR KN  R A + VEK+LQY+YRDRR KKR+ R+LWIQRINAG R +G+
Sbjct  15   KKVIDQAAGFRGRRKNTFRTATQAVEKSLQYAYRDRRTKKRNFRALWIQRINAGVRAYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             YG FMHGL    I+L+RKVLS+L++ E  +FKALVD +  A 
Sbjct  75   TYGRFMHGLKLAGIELDRKVLSDLAIREADAFKALVDQAEAAL  117



>ref|WP_014743716.1| 50S ribosomal protein L20 [Tistrella mobilis]
 ref|YP_006369620.1| 50S ribosomal protein L20 [Tistrella mobilis KA081020-065]
 gb|AFK52036.1| ribosomal protein L20 [Tistrella mobilis KA081020-065]
Length=122

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLA+G RGR+   IR A++RV+K LQY+YRDRR +KR  R+LWIQRINAGTR+ G+
Sbjct  15   KKVLKLAEGARGRSSKTIRAAKQRVDKNLQYAYRDRRVRKRQFRALWIQRINAGTRELGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FM GL    I+++RKVLS+L++HEP +FK+LV+ +++A  
Sbjct  75   TYSQFMAGLKAAAIEMDRKVLSDLAVHEPAAFKSLVEQAQSALA  118



>ref|WP_029936734.1| 50S ribosomal protein L20 [Sphingomonas sp. UNC305MFCol5.2]
Length=121

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L+ AKG+RGR KN IRIAR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KNILEQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    I+L+RKVL++++MHE  +F A+V  ++ A P
Sbjct  75   TYSQFMHGLKLAGIELDRKVLADIAMHEGEAFSAIVAQAKAALP  118



>ref|WP_029062762.1| 50S ribosomal protein L20 [Labrenzia sp. DG1229]
Length=119

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEKA QY+YRDR+ KKR  RSLWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKAGQYAYRDRKAKKRTFRSLWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F+ GL K  ++++RKVLS+L++++P +FK LV+ ++ A   
Sbjct  75   TYGRFIDGLNKAGVEVDRKVLSDLAINQPDAFKVLVEKAQGALTA  119



>ref|WP_026480374.1| 50S ribosomal protein L20 [Ahrensia sp. 13_GOM-1096m]
Length=133

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKGF G  KN IRIA++ VEKA QY+YRDR+ +KR+ RSLWIQRINA  R+HG+
Sbjct  15   KKVIKAAKGFMGSRKNTIRIAKQAVEKADQYAYRDRKVRKRNFRSLWIQRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+L+RKV+S++++HEP +F  LV+ S+      K   P
Sbjct  75   TYGRFIDGLAKAGIELDRKVMSDMAIHEPEAFAKLVEQSKAKLSYLKDTTP  125



>ref|WP_018689708.1| 50S ribosomal protein L20 [Ahrensia kielensis]
Length=133

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKGF G  KN IRIA++ VEKA QY+YRDR+ +KR+ RSLWIQRINA  R+HG+
Sbjct  15   KKVIKAAKGFMGSRKNTIRIAKQAVEKADQYAYRDRKVRKRNFRSLWIQRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             YG F+ GL K  I+L+RKV+S++++HEP +F  LV+ S+      K   P
Sbjct  75   TYGRFIDGLAKAGIELDRKVMSDMAIHEPEAFAKLVEQSKAKLSYLKDTTP  125



>ref|WP_007068518.1| 50S ribosomal protein L20 [Fulvimarina pelagi]
 gb|EAU42150.1| 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506]
Length=140

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IR A+  V+++ QY+ RDRR KKR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRAAKAAVDRSKQYATRDRRAKKRNFRALWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             YG F+ GL K  I+++RKVLS++++HEP +FKAL D S+TA 
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDIAIHEPEAFKALCDQSKTAL  117



>ref|WP_023786089.1| 50S ribosomal protein L20 [Hyphomicrobium nitrativorans]
 ref|YP_008865453.1| 50S ribosomal protein L20 [Hyphomicrobium nitrativorans NL23]
 gb|AHB47673.1| 50S ribosomal protein L20 [Hyphomicrobium nitrativorans NL23]
Length=124

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKALQY YRDR+ KKR  R+LWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRVAKQAVEKALQYGYRDRKRKKRTFRALWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTV  436
             YG F+ GL K  I ++RKVL+++++ +  +FKALV+ +  A   +K  
Sbjct  75   TYGRFIFGLSKAGIDIDRKVLADIAVRDAAAFKALVEQAAAAVKDSKAA  123



>ref|WP_019965303.1| 50S ribosomal protein L20 [Pannonibacter phragmitetus]
Length=119

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V+K AKG+ GR KN IR+A++ VEKA QY+YRDR+ +KR+ RSLWIQRINA TR+ G+
Sbjct  15   KKVIKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKVRKRNFRSLWIQRINAATRELGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG F+ GL K  I+++RKVLS+L++H+P +FKALV+ ++ A   
Sbjct  75   TYGRFIDGLNKAGIEVDRKVLSDLAIHQPEAFKALVEKAQGALAA  119



>ref|WP_029640755.1| 50S ribosomal protein L20 [alpha proteobacterium Mf 1.05b.01]
Length=118

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            ++V+K AKGF GR KN  RIA + VEKA QY+YRDR+ KKR+ RSLWIQRINA +R HG+
Sbjct  15   RKVIKKAKGFYGRRKNTFRIANQAVEKAGQYAYRDRKAKKRNFRSLWIQRINAASRSHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             YG F++GL +  I+++RKVL++L++HEP +FK+LVD +  A 
Sbjct  75   TYGRFINGLGRAGIEVDRKVLADLAVHEPEAFKSLVDQAEAAL  117



>emb|CCA14914.1| 50S ribosomal protein L20 putative [Albugo laibachii Nc14]
Length=108

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L + KG+RGRA +C  +A  R+EKALQY YRDR+ KKRDMR++WIQ+INAG+RQ G+
Sbjct  7    KKILAMTKGYRGRANSCYTVAINRLEKALQYQYRDRKQKKRDMRTMWIQQINAGSRQEGI  66

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
            +Y   +  L   NI+LNRKVL++L+  EP+SFK+L++I +T
Sbjct  67   SYSKLIPRLNASNIELNRKVLADLAATEPFSFKSLMEIVKT  107



>ref|WP_013165152.1| 50S ribosomal protein L20 [Starkeya novella]
 ref|YP_003692266.1| 50S ribosomal protein L20 [Starkeya novella DSM 506]
 gb|ADH87647.1| ribosomal protein L20 [Starkeya novella DSM 506]
Length=122

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IR+A++ VEKA QY+YRDR+ KKR+ R+LWIQRINA TR+ G 
Sbjct  15   KKVLKAAKGYFGRRKNTIRVAKQAVEKAQQYAYRDRKVKKRNFRALWIQRINAATRELGF  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             YG F+ GL K  I+++RKVLS++++HEP +F ALV+ ++ A 
Sbjct  75   TYGRFIDGLGKAGIEVDRKVLSDIAIHEPAAFAALVEQAKAAL  117



>ref|WP_033925474.1| 50S ribosomal protein L20 [Sphingomonas sp. 35-24ZXX]
Length=120

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR+ R+LWIQRINA TR  G+
Sbjct  15   KRILVQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKAKKRNFRALWIQRINAATRMEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG FMHGL    I+L+RKVL++L+MHE   FK LV  ++ A P 
Sbjct  75   TYGRFMHGLKLAGIELDRKVLADLAMHEADVFKGLVKQAQDALPA  119



>ref|WP_018430571.1| 50S ribosomal protein L20 [Hoeflea sp. 108]
Length=133

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL+ AKGFRGR KN IRIA++ VEK+LQY+YRDR+N+KR+ R+LW+QRINA  R+HG+
Sbjct  15   KKVLEQAKGFRGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRALWVQRINAAAREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K +I+++RK+LS++++HEP +F
Sbjct  75   TYGRFIDGLNKASIEIDRKILSDMAIHEPQAF  106



>ref|WP_038465301.1| 50S ribosomal protein L20 [Candidatus Paracaedibacter acanthamoebae]
 gb|AIK96685.1| 50S ribosomal protein L20 [Candidatus Paracaedibacter acanthamoebae]
Length=119

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++K+AKG+RGR+  C R A +RVEK LQY+YRDRR KKR  R+LWIQRINAG R++G+
Sbjct  15   KKIIKMAKGYRGRSGTCFRPAIQRVEKGLQYAYRDRRAKKRTFRALWIQRINAGVREYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            NY  FM GL+K  I ++RKVL+ L+M  P +FK++V+
Sbjct  75   NYSTFMGGLIKAGIDMDRKVLAGLAMSNPETFKSIVE  111



>ref|WP_010161044.1| MULTISPECIES: 50S ribosomal protein L20 [Sphingomonas]
Length=121

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L LAKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR+ R+LWIQRINA  R  G+
Sbjct  15   KRILNLAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRNFRALWIQRINAAVRVEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG FMHGL    ++L+RKVL++L+MHE  +F A++  ++ A P
Sbjct  75   TYGVFMHGLKLAGVELDRKVLADLAMHEGAAFSAIIAQAKAALP  118



>ref|WP_027288222.1| 50S ribosomal protein L20 [Rhodovibrio salinarum]
Length=132

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  EVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVN  292
            +VLK AKG RGR KN IR+AR+RVEK LQY+YRDR+ +KR+ RSLWIQRINAG R +G+ 
Sbjct  16   KVLKAAKGARGRQKNTIRVARQRVEKNLQYAYRDRKQRKREFRSLWIQRINAGARNNGLT  75

Query  293  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
            Y   M GL +  ++L+RKVL+++++ EP SF  LV+ +R A P 
Sbjct  76   YSQLMAGLREAGVELDRKVLADIAVREPESFANLVEQARKALPA  119



>ref|WP_027298591.1| 50S ribosomal protein L20 [Rhodospirillales bacterium URHD0088]
Length=120

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL+LAKG+RGR+    RIA E+VEK LQY+YRDRRNKKR  R+LWI RINAG R+HG+
Sbjct  15   KKVLELAKGYRGRSSTNYRIAIEKVEKGLQYAYRDRRNKKRSFRALWIVRINAGVREHGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALV  397
             Y  FM G+ +  I+L+RKVLS+L++ EP +FKA+V
Sbjct  75   TYSQFMSGVKRAGIELDRKVLSDLAIREPAAFKAIV  110



>ref|WP_019515416.1| 50S ribosomal protein L20 [Sphingomonas sp. Mn802worker]
Length=123

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L+ AKG+RGR KN IR+AR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KNILEQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            +Y  FMHGL    I+L+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   SYSQFMHGLKLAGIELDRKVLADIAMHEGEAFSAIIAQAKAALP  118



>emb|CDX18537.1| 50S ribosomal subunit protein L20 [Mesorhizobium sp. ORS3359]
Length=133

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RKVLS++++HEP +F
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAF  106



>ref|WP_023796882.1| MULTISPECIES: 50S ribosomal protein L20 [Mesorhizobium]
 gb|ESZ22606.1| 50S ribosomal protein L20 [Mesorhizobium sp. L48C026A00]
Length=133

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RKVLS++++HEP +F
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAF  106



>ref|WP_018389391.1| 50S ribosomal protein L20 [Ancylobacter sp. FA202]
Length=127

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEKA QY+YRDR+ KKR+ R+LWIQRINA TR+ G 
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKAQQYAYRDRKVKKRNFRALWIQRINAATRELGF  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG F+ GL K  I+++RKVLS++++HEP +F ALV+
Sbjct  75   TYGRFIDGLSKAGIEVDRKVLSDIAIHEPAAFAALVE  111



>ref|WP_038665948.1| 50S ribosomal protein L20 [Sphingomonas taxi]
 gb|AIT07848.1| 50S ribosomal protein L20 [Sphingomonas taxi]
Length=121

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L+ AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KRILEQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    +QL+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYSQFMHGLKLAGVQLDRKVLADIAMHESAAFSAIIAQAKAALP  118



>emb|CCI43200.1| unnamed protein product [Albugo candida]
Length=108

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L + KG+RGRA +C  +A  R+EKALQY YRDR+ KKRDMR++WIQ+INAG+RQ G+
Sbjct  7    KKILAMTKGYRGRANSCYTVAINRLEKALQYQYRDRKQKKRDMRTMWIQQINAGSRQEGM  66

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
            +Y   +  L   NI+LNRKVL++L+  EP+SFK+L++I +T
Sbjct  67   SYSKLIPRLNASNIELNRKVLADLAATEPFSFKSLMEIVKT  107



>ref|WP_034157821.1| 50S ribosomal protein L20 [Sphingomonas sp. ERG5]
Length=121

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K VL+ AKGF GR KN IRIAR+ VEKA QY+YRDR+ KKR  R+LWIQRINA  R  G+
Sbjct  15   KRVLEQAKGFYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRALWIQRINAAVRVEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG FMHGL    + L+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYGTFMHGLKLAGVDLDRKVLADIAMHEGAAFSAIIAQAKAALP  118



>ref|WP_022687966.1| 50S ribosomal protein L20 [Sphingomonas phyllosphaerae]
Length=121

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L+ AKG+RGR KN IR+AR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KNILEQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    ++L+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAIIAQAKAALP  118



>ref|WP_020084061.1| 50S ribosomal protein L20 [Hyphomicrobium zavarzinii]
Length=121

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR K+ IR+A++ VEKALQY YRDR+ +KR  R+LWIQRINA TR+HG+
Sbjct  15   KKVLKAAKGYYGRRKSTIRVAKQAVEKALQYGYRDRKRRKRTFRALWIQRINAATREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             YG F+HGL K  I ++RKVL++L++ +  +FKALV+
Sbjct  75   TYGRFIHGLSKAGIDIDRKVLADLAVRDAAAFKALVE  111



>ref|WP_013528310.1| MULTISPECIES: 50S ribosomal protein L20 [Mesorhizobium]
 ref|YP_004139662.1| 50S ribosomal protein L20 [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
 gb|ADV09612.1| ribosomal protein L20 [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
Length=133

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RK+LS++++HEP +F
Sbjct  75   TYGRFIDGLNKSGIEIDRKILSDMAIHEPQAF  106



>ref|WP_014791450.1| 50S ribosomal protein L20 [Ornithobacterium rhinotracheale]
 ref|YP_006427720.1| 50S ribosomal protein L20 [Ornithobacterium rhinotracheale DSM 
15997]
 gb|AFL97926.1| LSU ribosomal protein L20P [Ornithobacterium rhinotracheale DSM 
15997]
 gb|AIP99721.1| 50S ribosomal protein L20 [Ornithobacterium rhinotracheale ORT-UMN 
88]
 gb|KGB65946.1| 50S ribosomal protein L20 [Ornithobacterium rhinotracheale H06-030791]
Length=114

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K+++KLAKG+ GR KN   +A+  VEKA+ Y+YRDRR KKR+ R+LWIQRINAG RQHG
Sbjct  14   RKKIIKLAKGYFGRRKNVWTVAKNAVEKAMVYAYRDRRQKKRNFRALWIQRINAGARQHG  73

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            ++Y  FM  L   NI+LNRKVL++L+M+ P +FKA+VD
Sbjct  74   MSYSKFMGALKSNNIELNRKVLADLAMNHPEAFKAIVD  111



>ref|WP_027053776.1| 50S ribosomal protein L20 [Mesorhizobium loti]
Length=133

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RK+LS++++HEP +F
Sbjct  75   TYGRFIDGLNKAGIEIDRKILSDMAIHEPQAF  106



>ref|WP_019231063.1| 50S ribosomal protein L20 [Rickettsiaceae bacterium Os18]
Length=119

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  95   GIMNK---KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRIN  265
            G +NK   K++LKLA G+RGRAKNC  IA E+VEKALQYSYRDRRN+KR+ R+LWIQRIN
Sbjct  7    GKVNKNRHKKILKLASGYRGRAKNCFTIAVEKVEKALQYSYRDRRNRKREFRALWIQRIN  66

Query  266  AGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
            A TRQH + Y  F++GL K NI ++RKVL++L++     F  LV  ++ +   
Sbjct  67   AATRQHNLIYSQFINGLKKANINIDRKVLADLAVRNNEVFVHLVQQAKDSLAS  119



>ref|WP_006201247.1| MULTISPECIES: 50S ribosomal protein L20 [Mesorhizobium]
 ref|NP_105787.1| 50S ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 ref|YP_004609015.1| 50S ribosomal protein L20 [Mesorhizobium opportunistum WSM2075]
 ref|YP_007302282.1| ribosomal protein L20 [Mesorhizobium australicum WSM2073]
 sp|Q98CP8.1|RL20_RHILO RecName: Full=50S ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 dbj|BAB51573.1| ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 gb|AEH84921.1| ribosomal protein L20 [Mesorhizobium opportunistum WSM2075]
 gb|EHH12356.1| 50S ribosomal protein L20 [Mesorhizobium amorphae CCNWGS0123]
 gb|AGB42906.1| ribosomal protein L20 [Mesorhizobium australicum WSM2073]
 emb|CCV03774.1| 50S ribosomal subunit protein L20 [Mesorhizobium metallidurans 
STM 2683]
 emb|CCV09950.1| 50S ribosomal subunit protein L20 [Mesorhizobium sp. STM 4661]
 gb|ESW83676.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC280B00]
 gb|ESX81173.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC420B00]
 gb|ESY67813.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNHC232B00]
 gb|ESY69355.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNHC252B00]
 gb|ESY83740.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNHC221B00]
 gb|ESY87505.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNHC220B00]
 gb|ESY93515.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNHC229A00]
 gb|ESZ00548.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNHC209A00]
 gb|AID33912.1| ribosomal protein L20 [Mesorhizobium huakuii 7653R]
Length=133

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RK+LS++++HEP +F
Sbjct  75   TYGRFIDGLNKAGIEIDRKILSDMAIHEPQAF  106



>ref|WP_037532450.1| 50S ribosomal protein L20 [Sphingomonas sp. RIT328]
 gb|EZP54947.1| 50S ribosomal protein L20 [Sphingomonas sp. RIT328]
Length=121

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L+ AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KRILEQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    +QL+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYSQFMHGLKLAGVQLDRKVLADIAMHEGAAFSAIIAQAKAALP  118



>dbj|GAM01434.1| 50S ribosomal protein L20 [Sphingomonas parapaucimobilis NBRC 
15100]
Length=121

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    ++L+RKVL++++MHE  +FKA+V  ++ A P
Sbjct  75   TYSQFMHGLKLAGVELDRKVLADIAMHEGEAFKAIVAQAKAALP  118



>ref|WP_010302273.1| 50S ribosomal protein L20 [Candidatus Odyssella thessalonicensis]
Length=119

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++K+AKG+RGR+  C R A +RVEK LQY+YRDRR KKR+ R+LWIQRINAG R++G+
Sbjct  15   KKIIKMAKGYRGRSSTCFRPAIQRVEKGLQYAYRDRRVKKRNFRALWIQRINAGVREYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            NY  FM GL+K  I ++RK+L+ L+M  P +FK++V+
Sbjct  75   NYSTFMGGLIKAGINVDRKILAGLAMSYPETFKSIVE  111



>ref|WP_010184217.1| 50S ribosomal protein L20 [Sphingomonas sp. PAMC 26605]
Length=121

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L LAKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR+ R+LWIQRINA  R  G+
Sbjct  15   KRILNLAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRNFRALWIQRINAAVRVEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG FMHGL    ++L+RKVL++L+MHE  +F  ++  ++ A P
Sbjct  75   TYGVFMHGLKLAGVELDRKVLADLAMHEAAAFSVIIAQAKAALP  118



>ref|XP_008605363.1| 50S ribosomal protein L20 [Saprolegnia diclina VS20]
 gb|EQC41649.1| 50S ribosomal protein L20 [Saprolegnia diclina VS20]
 gb|KDO34568.1| 50S ribosomal protein L20 [Saprolegnia parasitica CBS 223.65]
Length=109

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L +AKG+RGRA +C R A  RVEK LQY YRDR+ KKRD RSLWI++INAGTRQ G+
Sbjct  7    KKILAMAKGYRGRANSCYRTAINRVEKGLQYQYRDRKQKKRDFRSLWIEKINAGTRQEGL  66

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDI  403
            +Y  F   L    IQLNRKVL++++  EP+SFK+++++
Sbjct  67   SYSKFFGVLNASEIQLNRKVLADIAATEPFSFKSILEV  104



>ref|WP_010682315.1| 50S ribosomal protein L20 [Methylobacterium mesophilicum]
 gb|EMS43972.1| 50S ribosomal protein L20 [Methylobacterium mesophilicum SR1.6/6]
Length=125

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEK LQY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y  F+ GL K  I ++RK LSEL++HEP SF A+V+ ++ A P N
Sbjct  75   TYSRFIDGLAKSGIVVDRKALSELAIHEPASFAAVVEKAKAALPQN  120



>ref|WP_027049077.1| 50S ribosomal protein L20 [Mesorhizobium sp. URHB0007]
Length=133

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK++QY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSMQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
            +YG F+ GL K  I+++RK+LS++++HEP +F
Sbjct  75   SYGRFIDGLNKSGIEIDRKILSDMAIHEPQAF  106



>ref|WP_010406000.1| MULTISPECIES: 50S ribosomal protein L20 [Sphingomonas]
Length=121

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR+ R+LWIQRINA  R  G+
Sbjct  15   KRILNQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRNFRALWIQRINAAVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG FMHGL    +QL+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYGVFMHGLKLAGVQLDRKVLADIAMHEGAAFSAIIAQAKAALP  118



>ref|WP_012975157.1| 50S ribosomal protein L20 [Azospirillum lipoferum]
 ref|YP_003449782.1| 50S ribosomal protein L20 [Azospirillum sp. B510]
 ref|YP_005037781.1| 50S ribosomal protein L20 [Azospirillum lipoferum 4B]
 dbj|BAI73238.1| large subunit ribosomal protein L20 [Azospirillum sp. B510]
 emb|CBS85525.1| 50S ribosomal subunit protein L20 [Azospirillum lipoferum 4B]
Length=123

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            +++LKLAKG+RGR     RIA E+VEKAL+Y+YRDRRNKKRD R LWIQRINAG RQ+G+
Sbjct  15   RKILKLAKGYRGRNSKNFRIAIEKVEKALRYAYRDRRNKKRDFRGLWIQRINAGVRQYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  F++G+    I+++RKVLS+L+  EP +FK LVD
Sbjct  75   TYSRFINGIKLAGIEIDRKVLSDLAAREPEAFKTLVD  111



>ref|WP_028467119.1| 50S ribosomal protein L20 [Nisaea denitrificans]
Length=121

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V    KG+ GR KN  R+A + +EKA QY+YRDRR +KRD R+LWIQRINAG R +G+
Sbjct  15   KKVTDKTKGYYGRRKNVFRVAVQAMEKAAQYAYRDRRVRKRDFRALWIQRINAGARSYGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM+GL K  I+L+RKVLS+L++HEP +FK+LVD ++ A 
Sbjct  75   TYSKFMNGLKKAGIELDRKVLSDLAIHEPVAFKSLVDQAQAAL  117



>ref|WP_027230884.1| 50S ribosomal protein L20 [Phyllobacterium sp. UNC302MFCol5.2]
Length=133

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK A+GFRGR KN IR A+  V+++ QY+YRDR+NKKR  R+LW QRINA  R+HG+
Sbjct  15   KKVLKQAEGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNKKRTFRALWTQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIP  442
             Y  F+ GL K  I+++RKVLS+L++HEP +F ALV  ++ A    K   P
Sbjct  75   TYSRFIDGLSKSGIEVDRKVLSDLAIHEPEAFGALVASAKKALEYLKNTTP  125



>ref|WP_017669465.1| 50S ribosomal protein L20 [Blastomonas sp. AAP53]
Length=120

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR+ R+LWI RINA TR  G+
Sbjct  15   KRILVQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKAKKRNFRALWIVRINAATRMEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YG FMHGL    I+L+RKVL++L+MHE   FK LV  ++ A P 
Sbjct  75   TYGQFMHGLKLAGIELDRKVLADLAMHEAEVFKGLVKQAQDALPA  119



>ref|WP_028967241.1| 50S ribosomal protein L20 [Sphingomonas phyllosphaerae]
Length=121

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L+ AKG+RGR KN IR+AR+ VEKA QY+YRDR+ KKR  R LWIQRINAG R  G+
Sbjct  15   KNILEQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRGLWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    + L+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYSQFMHGLKLAGVDLDRKVLADIAMHEGEAFTAIIAQAKAALP  118



>ref|WP_027372212.1| MULTISPECIES: 50S ribosomal protein L20 [Chryseobacterium]
 dbj|GAE66925.1| 50S ribosomal protein L20 [Chryseobacterium indologenes NBRC 
14944]
Length=114

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K+VLK AKGF GR KN   +A+  VEKA+QY+YR R+ KKR+ R+LWI RINAGTR+HG
Sbjct  14   RKKVLKQAKGFFGRRKNVWTVAKNAVEKAMQYAYRGRKEKKRNFRALWITRINAGTREHG  73

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            ++Y  FM  L K NI+LNRKVL++L+M+ P +FKA+VD
Sbjct  74   MSYSQFMGALKKNNIELNRKVLADLAMNHPEAFKAVVD  111



>ref|WP_023672281.1| MULTISPECIES: 50S ribosomal protein L20 [Mesorhizobium]
 gb|ESW73326.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC277A00]
 gb|ESW76646.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC285A00]
 gb|ESW90654.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC269B00]
 gb|ESX03374.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC268A00]
 gb|ESX12455.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC265A00]
 gb|ESX19125.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC264A00]
 gb|ESX22047.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSJC255A00]
 gb|ESX30290.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC440B00]
 gb|ESX36922.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC432A00]
 gb|ESX40921.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC440A00]
 gb|ESX49578.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC424B00]
 gb|ESX51243.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC426A00]
 gb|ESX61670.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC422A00]
 gb|ESX65610.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC416B00]
 gb|ESX77499.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC414A00]
 gb|ESX89005.1| 50S ribosomal protein L20 [Mesorhizobium sp. LSHC412B00]
 gb|ESX94783.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC403B00]
 gb|ESX99962.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC399B00]
 gb|ESY01253.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC405B00]
 gb|ESY07125.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC398B00]
 gb|ESY20807.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC395A00]
 gb|ESY21205.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC394B00]
 gb|ESY27261.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC391B00]
 gb|ESY34860.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC386A00]
 gb|ESY35887.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC384A00]
 gb|ESY46450.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC380A00]
 gb|ESY51121.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC374B00]
 gb|ESY54606.1| 50S ribosomal protein L20 [Mesorhizobium sp. LNJC372A00]
 gb|ESZ05039.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C089B000]
 gb|ESZ13731.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C085B000]
 gb|ESZ27076.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C084A000]
 gb|ESZ32366.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C066B000]
 gb|ESZ46165.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C054A000]
 gb|ESZ50628.1| 50S ribosomal protein L20 [Mesorhizobium sp. L103C565B0]
 gb|ESZ54901.1| 50S ribosomal protein L20 [Mesorhizobium sp. L103C131B0]
 gb|ESZ61206.1| 50S ribosomal protein L20 [Mesorhizobium sp. L103C120A0]
 gb|ESZ66702.1| 50S ribosomal protein L20 [Mesorhizobium sp. L103C119B0]
 gb|ESZ74885.1| 50S ribosomal protein L20 [Mesorhizobium sp. L103C105A0]
Length=133

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK++QY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSMQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RK+LS++++HEP +F
Sbjct  75   TYGRFIDGLNKSGIEIDRKILSDMAIHEPQAF  106



>ref|WP_023837523.1| 50S ribosomal protein L20 [Blastomonas sp. CACIA14H2]
 gb|ESZ87642.1| 50S ribosomal protein L20 [Blastomonas sp. CACIA14H2]
Length=120

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR+ R+LWIQRINA TR  G+
Sbjct  15   KRILAQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKAKKRNFRALWIQRINAATRMEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             YG FMHGL    I+L+RKVL++L+M+E   FK LV  ++ A P
Sbjct  75   TYGRFMHGLKLAGIELDRKVLADLAMNEGEVFKGLVKQAQAALP  118



>ref|WP_023814515.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C067A000]
 gb|ESZ36878.1| 50S ribosomal protein L20 [Mesorhizobium sp. L2C067A000]
Length=133

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK++QY+YRDR+N+KR  R+LWIQRINA T +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSMQYAYRDRKNRKRSFRALWIQRINAATHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RK+LS++++HEP +F
Sbjct  75   TYGRFIDGLNKSGIEIDRKILSDMAIHEPQAF  106



>ref|WP_035543838.1| MULTISPECIES: 50S ribosomal protein L20, partial [Holospora]
Length=117

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+++K+AKG+RGR+ +C RIA +RVEKALQY YRDRR KKRD R+LWIQRINA  R HG+
Sbjct  15   KKIIKMAKGYRGRSGSCFRIALQRVEKALQYMYRDRRCKKRDFRALWIQRINAAVRHHGI  74

Query  290  NYGNFMHG---LMKENIQ-LNRKVLSELSMHEPYSFKALVD  400
             Y +FMHG   L KE  + LNRK+LS++++H P +  AL++
Sbjct  75   VYSDFMHGLSLLQKEAGEVLNRKILSDMAVHSPETLSALIE  115



>ref|WP_034962397.1| 50S ribosomal protein L20 [Erythrobacter longus]
 gb|KEO87772.1| 50S ribosomal protein L20 [Erythrobacter longus]
Length=119

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+RGR KN IRIAR+ VEKA QY+YRDR+ KKR  R+LWIQRINA  R  G+
Sbjct  15   KRLLDQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRKAKKRSFRALWIQRINAAVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  FMHG+    I+L+RKV+++L+MHE  +FKA++  ++ A P 
Sbjct  75   TYSQFMHGVKLAGIELDRKVMADLAMHEEAAFKAIIVQAKDALPA  119



>ref|XP_001630524.1| predicted protein [Nematostella vectensis]
 gb|EDO38461.1| predicted protein [Nematostella vectensis]
Length=125

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  101  MNKKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQ  280
            + +  +  LAKGFRGR+KNC  IA  RV+KALQY Y  RR KKRDMRSLWI RIN   R+
Sbjct  11   VKRARIFALAKGFRGRSKNCYSIAIRRVQKALQYQYTSRRLKKRDMRSLWITRINIAGRE  70

Query  281  HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISR  409
            H +NY   +H + K +IQLNRK+LSE+++HEP SFK L  +++
Sbjct  71   HNINYSTLVHKMAKLDIQLNRKMLSEIAIHEPRSFKGLASLAK  113



>ref|WP_032138857.1| 50S ribosomal protein L20 [Rickettsia tamurae]
Length=117

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA +C R+A E+VEKALQY+YRDRRN+KRD R LWIQRINA  R+HG+
Sbjct  15   KKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGLWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
             Y  FM  L K  I ++RKVL+EL+++    F ++V+ ++ 
Sbjct  75   VYSQFMGALKKAEIDIDRKVLAELAVNNSDGFASIVEQAKA  115



>ref|WP_011995133.1| 50S ribosomal protein L20 [Parvibaculum lavamentivorans]
 ref|YP_001411499.1| 50S ribosomal protein L20 [Parvibaculum lavamentivorans DS-1]
 sp|A7HPK9.1|RL20_PARL1 RecName: Full=50S ribosomal protein L20 [Parvibaculum lavamentivorans 
DS-1]
 gb|ABS61842.1| ribosomal protein L20 [Parvibaculum lavamentivorans DS-1]
Length=118

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            ++++K AKG+ GR KN  R A + VEKA QY+YRDRR +KR+ R+LWIQRINAG R+HG+
Sbjct  15   RKIIKKAKGYYGRRKNAFRTANQAVEKAGQYAYRDRRTRKRNFRALWIQRINAGVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  F+ GL K  I+++RKVLS++++HEP +FKALV+ ++ A 
Sbjct  75   TYSRFIDGLAKAGIEVDRKVLSDIAIHEPEAFKALVEQAQAAL  117



>ref|WP_010543146.1| MULTISPECIES: 50S ribosomal protein L20 [Sphingomonas]
Length=121

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K +L  AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR  R+LWIQRINAG R  G+
Sbjct  15   KRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRALWIQRINAGVRAEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FMHGL    I+L+RKVL++++MHE  +F A++  ++ A P
Sbjct  75   TYSQFMHGLKLAGIELDRKVLADIAMHEGEAFTAIIAQAKAALP  118



>ref|WP_040256020.1| MULTISPECIES: 50S ribosomal protein L20 [spotted fever group]
 gb|KIJ88589.1| 50S ribosomal protein L20 [Candidatus Rickettsia asemboensis]
Length=117

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA +C R+A E+VEKALQY+YRDRRN+KRD R LWIQRINA  R+HG+
Sbjct  15   KKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGLWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  FM  L K  I ++RKVL+EL+++    F ++V+
Sbjct  75   VYSQFMGALKKAEIDIDRKVLAELAVNNSDGFASIVE  111



>ref|WP_014273660.1| 50S ribosomal protein L20 [Rickettsia slovaca]
 ref|YP_005066043.1| 50S ribosomal protein L20 [Rickettsia slovaca 13-B]
 gb|AEV92475.1| 50S ribosomal protein L20 [Rickettsia slovaca 13-B]
Length=117

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K++LKLAKG+RGRA +C R+A E+VEKALQY+YRDRRN+KRD R LWIQRINA  R+HG
Sbjct  14   QKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGLWIQRINAAVREHG  73

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            + Y  FM  L K  I ++RKVL+EL+++    F ++V+
Sbjct  74   LVYSQFMGALKKTEIDIDRKVLAELAVNNSDGFVSIVE  111



>ref|WP_028795849.1| 50S ribosomal protein L20 [Thalassobaculum salexigens]
Length=119

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+V   AKG+ GR KN  RIA + VEK  QY+YRDRR +KRD R+LWIQRINAG RQ+G+
Sbjct  15   KKVTDAAKGYYGRRKNVFRIAVQAVEKGQQYAYRDRRVRKRDFRALWIQRINAGVRQYGM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  FM+GL    I+L+RKVLS+L++HEP +FK++VD +  A 
Sbjct  75   TYSRFMNGLKLAGIELDRKVLSDLAIHEPAAFKSIVDQAEAAL  117



>ref|WP_023450274.1| 50S ribosomal protein L20 [Asticcacaulis sp. AC402]
 gb|ESQ74537.1| 50S ribosomal protein L20 [Asticcacaulis sp. AC402]
Length=119

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLKLAKGF GR KN IR A+  V+KA QY+YRDRR KKR+ RSLWIQRINA  R  G 
Sbjct  15   KKVLKLAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRRTKKRNFRSLWIQRINAAARIEGF  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             Y  F+HGL    I ++RK+LS+++MH+   FKA+V   RTA   
Sbjct  75   TYSQFIHGLTVAGIDMDRKILSDVAMHDEAGFKAIVAQVRTALAA  119



>ref|WP_035029382.1| MULTISPECIES: 50S ribosomal protein L20 [Devosia]
 emb|CDP50529.1| LSU ribosomal protein L20p [Devosia sp. DBB001]
 gb|KFL25250.1| 50S ribosomal protein L20 [Devosia sp. 17-2-E-8]
Length=133

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK A+G+ GR KN IR+A++ VEKA QY+YRDRR  KR+ R+LWIQRINA  R+HG+
Sbjct  15   KKVLKAAEGYYGRRKNTIRVAKQAVEKAGQYAYRDRRINKRNFRALWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGNKTVIPTP  448
             YG F+ GL K  + ++RKVLS+L++HEP +F  LV+ ++ A    K V  T 
Sbjct  75   TYGRFIDGLSKAEVAVDRKVLSDLAIHEPAAFGVLVEKAKAALGYLKGVEDTT  127



>ref|WP_039195539.1| 50S ribosomal protein L20 [Aureimonas altamirensis]
 gb|KHJ53413.1| 50S ribosomal protein L20 [Aureimonas altamirensis]
Length=138

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IR A+  V++A QY+ RDRR KKR+ R+LWIQRINAG R+HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRAAKAAVDRAKQYATRDRRVKKRNFRALWIQRINAGVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  FM GL K  I+++RKVLS++++HEP +F  LV+ +++A  
Sbjct  75   TYARFMDGLTKAGIEVDRKVLSDIAIHEPEAFAVLVEQAKSALA  118



>ref|WP_040968947.1| 50S ribosomal protein L20 [Mesorhizobium sp. ORS3324]
 emb|CDX10931.1| 50S ribosomal subunit protein L20 [Mesorhizobium sp. ORS3324]
Length=133

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKGF GR KN IRIA++ VEK+LQY+YRDR+N+KR  R+LWIQRINA   +HG+
Sbjct  15   KKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRALWIQRINAAVHEHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSF  385
             YG F+ GL K  I+++RKVLS++++HEP +F
Sbjct  75   TYGRFIDGLNKAGIEIDRKVLSDMAIHEPQAF  106



>ref|WP_022195251.1| 50S ribosomal protein L20 [Azospirillum sp. CAG:239]
 emb|CDB53613.1| 50S ribosomal protein L20 [Azospirillum sp. CAG:239]
Length=119

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L +AKG+RGR KN  R+A E+VEKALQY+YRDRR KKR+ RSLWIQRINA TR H +
Sbjct  15   KKILNMAKGYRGRNKNVFRVAVEKVEKALQYAYRDRRAKKRNFRSLWIQRINAATRLHDM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F+ GL K  I+L+RKVL+++++ EP +F  LV+ ++ A  
Sbjct  75   TYSRFISGLNKAGIELDRKVLADIALKEPANFAKLVEAAKGALS  118



>ref|WP_008518753.1| 50S ribosomal protein L20 [alpha proteobacterium IMCC14465]
 gb|EJW20918.1| rplT protein [alpha proteobacterium IMCC14465]
Length=118

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L  AKG+ GR KN I++A++ V KA QY+YRDRR +KR+ RSLWIQRINA  RQHG+
Sbjct  15   KKILDKAKGYYGRRKNTIKVAKQAVTKAGQYAYRDRRVRKRNFRSLWIQRINAAARQHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             YG  + GL K  I+++RKVL++L++HEP +F+ALV+ +R A 
Sbjct  75   TYGRMIDGLTKSGIEIDRKVLADLAVHEPVAFEALVEKARGAL  117



>ref|WP_012320099.1| MULTISPECIES: 50S ribosomal protein L20 [Methylobacterium]
 ref|YP_001755818.1| 50S ribosomal protein L20 [Methylobacterium radiotolerans JCM 
2831]
 sp|B1M6P4.1|RL20_METRJ RecName: Full=50S ribosomal protein L20 [Methylobacterium radiotolerans 
JCM 2831]
 gb|ACB25135.1| ribosomal protein L20 [Methylobacterium radiotolerans JCM 2831]
Length=125

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VLK AKG+ GR KN IRIA++ VEK +QY+YRDR+NKKR  R+LWIQR+NA  R+HG+
Sbjct  15   KKVLKAAKGYYGRRKNTIRIAKQAVEKGMQYAYRDRKNKKRTFRALWIQRLNAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPGN  427
             Y  F+ GL K  I ++RK LSEL++HEP SF A+V+ ++ A P N
Sbjct  75   TYSRFIDGLAKSGIVVDRKALSELAIHEPASFAAVVEKAKAALPQN  120



>ref|WP_015459072.1| 50S ribosomal protein L20 [Sphingomonas sp. MM-1]
 ref|YP_007616671.1| 50S ribosomal protein L20 [Sphingomonas sp. MM-1]
 gb|AGH50075.1| 50S ribosomal protein L20 [Sphingomonas sp. MM-1]
Length=125

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  116  VLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVNY  295
            +L+ AKG+ GR KN IRIAR+ VEKA QY+YRDR+ KKR  R+LWIQRINA  R  G+ Y
Sbjct  17   ILESAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRALWIQRINAAVRAEGLTY  76

Query  296  GNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            G FMHGL    I+L+RKVL++++MHE  +F A+V  ++ A P
Sbjct  77   GVFMHGLKLAGIELDRKVLADMAMHEGAAFSAIVAQAKAALP  118



>ref|WP_014415279.1| 50S ribosomal protein L20 [Rhodospirillum photometricum]
 ref|YP_005417615.1| 50S ribosomal protein L20 [Rhodospirillum photometricum DSM 122]
 emb|CCG08645.1| 50S ribosomal protein L20 [Rhodospirillum photometricum DSM 122]
Length=121

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++L LAKG+RGR     RIA E+VEK LQY+YRDRRNKKR+ R+LWIQRINAG R HG+
Sbjct  15   KKILDLAKGYRGRNSTNYRIAIEKVEKGLQYAYRDRRNKKREFRALWIQRINAGARLHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALV  397
             Y  FM GL K  I+L+RK+L++L++ EP +F ALV
Sbjct  75   TYSRFMDGLNKAGIELDRKILADLAVREPEAFAALV  110



>ref|WP_014014575.1| MULTISPECIES: 50S ribosomal protein L20 [spotted fever group]
 ref|YP_004764612.1| 50S ribosomal protein L20 [Rickettsia heilongjiangensis 054]
 ref|YP_004885043.1| 50S ribosomal protein L20 [Rickettsia japonica YH]
 gb|AEK74934.1| 50S ribosomal protein L20 [Rickettsia heilongjiangensis 054]
 dbj|BAK96904.1| 50S ribosomal protein L20 [Rickettsia japonica YH]
Length=117

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA +C R+A E+VEKALQY+YRDRRN+KRD R LWIQRINA  R+HG+
Sbjct  15   KKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGLWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  FM  L K  I ++RKVL+EL+++    F ++V+
Sbjct  75   VYSQFMGALKKAEIDIDRKVLAELAVNNSDGFVSIVE  111



>ref|WP_022187282.1| 50S ribosomal protein L20 [Azospirillum sp. CAG:260]
 emb|CDB40860.1| 50S ribosomal protein L20 [Azospirillum sp. CAG:260]
Length=119

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL +AKG+RGR+KN  R+A E+VEK LQY+YRDR+ KKR  R+LWIQRINA TR H +
Sbjct  15   KKVLAMAKGYRGRSKNVFRVAVEKVEKGLQYAYRDRKAKKRSFRALWIQRINAATRLHDM  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
             Y  F+ GL K  I+L+RKVL+++++ EP +F  LV+ +++A  
Sbjct  75   TYSRFISGLNKAGIELDRKVLADIALKEPANFAKLVEAAKSALS  118



>ref|WP_037524701.1| 50S ribosomal protein L20 [Sphingomonas wittichii]
Length=125

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  95   GIMNK---KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRIN  265
            G+  K   K VL+ AKG+ GR KN IRIA++ VEKA QY+YRDR+ KKR  R+LWIQRIN
Sbjct  7    GVTTKARHKRVLEQAKGYYGRRKNTIRIAKQAVEKAGQYAYRDRKVKKRSFRALWIQRIN  66

Query  266  AGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFP  421
            A  R  G+ YG FMHGL    ++L+RKVL++L+MHE  +F A++  ++ A P
Sbjct  67   AAVRAEGLTYGVFMHGLKLAGVELDRKVLADLAMHEGGAFSAIIAQAKAALP  118



>dbj|GAL69034.1| LSU ribosomal protein L20p [Jejuia pallidilutea]
 dbj|GAL72805.1| LSU ribosomal protein L20p [Jejuia pallidilutea]
 dbj|GAL90137.1| LSU ribosomal protein L20p [Jejuia pallidilutea]
Length=114

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  KKEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG  286
            +K+VLK AKG+ GR KN   +A+  V+KA+QYSYRDRRNKKR  R+LWI RINAG R+HG
Sbjct  14   RKKVLKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRRNKKRTFRALWITRINAGAREHG  73

Query  287  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
            ++Y  FM  L   NI+LNRKVL++L+M+ P +FKA++D
Sbjct  74   LSYSQFMGKLKANNIELNRKVLADLAMNNPEAFKAVID  111



>ref|WP_010421917.1| 50S ribosomal protein L20 [Rickettsia helvetica]
Length=117

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA +C R+A E+VEKALQY+YRDRRN+KRD R LWIQRINA  R+HG+
Sbjct  15   KKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGLWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRT  412
             Y  FM  L K  I ++RKVL+EL+++    F ++++ ++ 
Sbjct  75   VYSQFMGALKKAEIDIDRKVLAELAVNNSDGFASIIEKAKA  115



>ref|WP_019647061.1| 50S ribosomal protein L20 [Novispirillum itersonii]
Length=118

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL+LAKG+RGR     RIA E+VEK LQY+YRDRRNKKRD R LWIQRINAG R+ G+
Sbjct  15   KKVLELAKGYRGRNSTNFRIAIEKVEKGLQYAYRDRRNKKRDFRGLWIQRINAGARELGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAF  418
             Y  F+ GL K  I+L+RKVL++L++ EP +F  LV+ ++ A 
Sbjct  75   TYSRFIDGLNKAGIELDRKVLADLAVREPEAFGKLVEKAKAAL  117



>ref|WP_027135300.1| 50S ribosomal protein L20 [Geminicoccus roseus]
Length=119

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K+VL   KG RGR   CIR A + +EKALQY+YRDRRNKKRD R+LWIQRINA  RQ G+
Sbjct  15   KKVLDQVKGHRGRRSTCIRTAMQSMEKALQYAYRDRRNKKRDFRALWIQRINAAARQEGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRTAFPG  424
             YGN +HGL    ++L+RKVLS++++H+  +F  +V  ++ A   
Sbjct  75   TYGNLIHGLSLAGVELDRKVLSDIAVHDAAAFAGIVAQAKGALAA  119



>ref|WP_011270689.1| 50S ribosomal protein L20 [Rickettsia felis]
 ref|YP_246365.1| 50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
 sp|Q4UMK8.1|RL20_RICFE RecName: Full=50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
 gb|AAY61200.1| 50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
 gb|KHO03893.1| 50S ribosomal protein L20 [Rickettsia felis]
Length=117

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KEVLKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV  289
            K++LKLAKG+RGRA +C R+A E+VEKALQY+YRDRRN+KRD R LWIQRINA  R+HG+
Sbjct  15   KKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGLWIQRINAAVREHGL  74

Query  290  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVD  400
             Y  FM  L K  I ++RKVL+EL+++    F ++++
Sbjct  75   VYSQFMGALKKAEIDIDRKVLAELAVNNSDGFASIIE  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6800208445350