BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25075_g1_i3 len=1365 path=[2533:0-213 2747:214-225 2759:226-279
1603:280-306 1630:307-343 8586:344-424 2956:425-460 2007:461-633
2180:634-683 8040:684-759 3286:760-857 25:858-1005 173:1006-1364]

Length=1365
                                                                      Score     E

emb|CDP14569.1|  unnamed protein product                                446   1e-145   
emb|CDP14572.1|  unnamed protein product                                443   1e-144   
ref|XP_009604279.1|  PREDICTED: subtilisin-like protease                439   7e-143   
ref|XP_009768078.1|  PREDICTED: subtilisin-like protease SBT5.3         436   1e-141   
ref|XP_006355622.1|  PREDICTED: subtilisin-like protease-like           432   2e-140   
ref|XP_006355566.1|  PREDICTED: subtilisin-like protease-like           432   3e-140   
ref|XP_004232982.1|  PREDICTED: subtilisin-like protease                431   2e-139   
ref|XP_006355621.1|  PREDICTED: subtilisin-like protease-like           423   1e-136   
ref|XP_008803738.1|  PREDICTED: subtilisin-like protease SBT5.3         415   1e-135   
ref|XP_011102273.1|  PREDICTED: subtilisin-like protease SBT5.3         419   8e-135   
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4         419   8e-135   
emb|CDP14563.1|  unnamed protein product                                417   1e-134   
ref|XP_010272679.1|  PREDICTED: subtilisin-like protease SBT5.4         416   6e-134   
ref|XP_009407016.1|  PREDICTED: subtilisin-like protease SBT5.3         408   6e-131   
ref|XP_010916217.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    400   9e-129   
ref|NP_001044124.1|  Os01g0727800                                       390   1e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010916207.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    402   3e-128   
gb|EYU28148.1|  hypothetical protein MIMGU_mgv1a026974mg                399   1e-127   
ref|XP_004969820.1|  PREDICTED: subtilisin-like protease-like           393   1e-124   
emb|CDM84099.1|  unnamed protein product                                393   2e-124   
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3         390   1e-123   
dbj|BAB21149.1|  subtilisin-like proteinase-like                        390   1e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71416.1|  hypothetical protein OsI_03596                          390   1e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease                384   2e-122   
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like           386   3e-122   
ref|XP_002458431.1|  hypothetical protein SORBIDRAFT_03g033440          386   5e-122   Sorghum bicolor [broomcorn]
ref|XP_010232258.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    383   7e-122   
gb|EYU28147.1|  hypothetical protein MIMGU_mgv1a018442mg                385   7e-122   
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease                385   1e-121   
gb|EYU28149.1|  hypothetical protein MIMGU_mgv1a018291mg                383   1e-121   
ref|XP_003569718.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    384   4e-121   
emb|CBI30770.3|  unnamed protein product                                382   4e-121   
dbj|BAJ86327.1|  predicted protein                                      377   8e-121   
dbj|BAJ94880.1|  predicted protein                                      377   1e-120   
ref|XP_002269375.1|  PREDICTED: subtilisin-like protease SBT5.3         382   1e-120   Vitis vinifera
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3         382   1e-120   
ref|XP_010529231.1|  PREDICTED: subtilisin-like protease                380   4e-120   
emb|CBI30775.3|  unnamed protein product                                379   5e-120   
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3         379   1e-119   
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3         379   1e-119   
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg                379   2e-119   
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3         379   2e-119   Vitis vinifera
ref|NP_199378.1|  subtilase family protein                              379   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025243.1|  Subtilase family protein isoform 2                 378   3e-119   
ref|XP_007025242.1|  Subtilase family protein, putative isoform 1       378   4e-119   
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease                376   2e-118   
dbj|BAK03173.1|  predicted protein                                      374   2e-118   
ref|XP_002863463.1|  subtilase family protein                           377   2e-118   
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like           374   1e-117   
ref|XP_010095116.1|  Subtilisin-like protease                           374   1e-117   
ref|XP_006280186.1|  hypothetical protein CARUB_v10026090mg             369   1e-117   
ref|XP_010518867.1|  PREDICTED: subtilisin-like protease SBT5.3         373   4e-117   
ref|XP_006449588.1|  hypothetical protein CICLE_v10014347mg             366   4e-117   
dbj|BAJ85613.1|  predicted protein                                      371   2e-116   
gb|KDO77991.1|  hypothetical protein CISIN_1g0040471mg                  364   2e-116   
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like           370   3e-116   
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease                370   4e-116   
gb|KDO77986.1|  hypothetical protein CISIN_1g0040471mg                  364   4e-116   
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940          369   8e-116   
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease                369   9e-116   
gb|EYU28146.1|  hypothetical protein MIMGU_mgv1a001696mg                369   1e-115   
ref|XP_010665649.1|  PREDICTED: subtilisin-like protease SBT5.3         369   2e-115   
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg             368   4e-115   
ref|XP_009114399.1|  PREDICTED: subtilisin-like protease SBT5.3         368   4e-115   
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg             367   5e-115   
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                    367   5e-115   
ref|XP_009385357.1|  PREDICTED: subtilisin-like protease SBT5.3         360   6e-115   
emb|CDY23110.1|  BnaC09g18640D                                          367   8e-115   
emb|CDY13044.1|  BnaA09g17730D                                          366   1e-114   
ref|XP_006398246.1|  hypothetical protein EUTSA_v10000784mg             366   1e-114   
ref|XP_004134922.1|  PREDICTED: subtilisin-like protease-like           365   3e-114   
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3         365   3e-114   
emb|CAN61728.1|  hypothetical protein VITISV_036029                     367   4e-114   Vitis vinifera
gb|EYU28145.1|  hypothetical protein MIMGU_mgv1a021952mg                365   5e-114   
gb|KDP21172.1|  hypothetical protein JCGZ_21643                         365   5e-114   
ref|XP_006467568.1|  PREDICTED: subtilisin-like protease-like           364   8e-114   
gb|KHG30296.1|  Subtilisin-like protease                                363   1e-113   
ref|XP_010481547.1|  PREDICTED: subtilisin-like protease SBT5.3         363   2e-113   
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative      361   9e-113   Ricinus communis
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3         360   2e-112   
ref|XP_010441687.1|  PREDICTED: subtilisin-like protease SBT5.3         360   3e-112   
ref|XP_010494682.1|  PREDICTED: subtilisin-like protease SBT5.3         360   3e-112   
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                     353   9e-110   
ref|XP_010052138.1|  PREDICTED: subtilisin-like protease SBT5.3         352   4e-109   
tpg|DAA57792.1|  TPA: putative subtilase family protein                 352   6e-109   
ref|XP_002317314.1|  subtilase family protein                           351   8e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011010424.1|  PREDICTED: subtilisin-like protease SBT5.3         350   2e-108   
ref|XP_008675086.1|  PREDICTED: subtilisin-like protease isoform X3     351   3e-108   
ref|XP_011045349.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    349   3e-108   
ref|XP_008439697.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    348   1e-107   
ref|XP_011045348.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    346   8e-107   
ref|XP_008675085.1|  PREDICTED: subtilisin-like protease isoform X2     346   3e-106   
ref|XP_008675084.1|  PREDICTED: subtilisin-like protease isoform X1     346   4e-106   
gb|EMS59680.1|  Subtilisin-like protease                                336   2e-105   
gb|EPS68445.1|  hypothetical protein M569_06321                         337   8e-105   
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              332   2e-101   
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             332   9e-101   
gb|AIC80766.1|  subtilase                                               327   8e-100   
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like           327   1e-99    
gb|KEH36678.1|  subtilisin-like serine protease                         320   7e-97    
ref|XP_003541678.1|  PREDICTED: subtilisin-like protease-like iso...    320   1e-96    
ref|XP_006594524.1|  PREDICTED: subtilisin-like protease-like iso...    319   1e-96    
ref|XP_007147961.1|  hypothetical protein PHAVU_006G168800g             318   5e-96    
gb|KEH36679.1|  subtilisin-like serine protease                         314   8e-95    
gb|EMT06792.1|  hypothetical protein F775_43030                         309   8e-95    
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4         313   3e-94    
ref|XP_002299063.2|  hypothetical protein POPTR_0001s47290g             307   5e-92    Populus trichocarpa [western balsam poplar]
ref|XP_010494681.1|  PREDICTED: subtilisin-like protease SBT5.4         306   2e-91    
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    304   1e-90    
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         300   2e-89    
ref|XP_002863464.1|  subtilase family protein                           300   2e-89    
ref|XP_006279865.1|  hypothetical protein CARUB_v10028532mg             299   6e-89    
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      298   6e-89    Ricinus communis
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      297   1e-88    Ricinus communis
ref|XP_002269456.2|  PREDICTED: subtilisin-like protease SBT5.4         293   1e-88    Vitis vinifera
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3         297   2e-88    
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         296   4e-88    
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    295   4e-88    
gb|KEH35215.1|  subtilisin-like serine protease                         292   9e-88    
emb|CBI39824.3|  unnamed protein product                                296   1e-87    
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    295   1e-87    
gb|KEH35216.1|  subtilisin-like serine protease                         292   1e-87    
emb|CBI38460.3|  unnamed protein product                                295   1e-87    
ref|XP_006447864.1|  hypothetical protein CICLE_v10017839mg             293   3e-87    
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           294   3e-87    
ref|XP_010096499.1|  Subtilisin-like protease                           293   6e-87    
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      293   7e-87    Ricinus communis
ref|XP_010107369.1|  Subtilisin-like protease                           292   8e-87    
ref|XP_010693559.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    298   9e-87    
gb|EYU27629.1|  hypothetical protein MIMGU_mgv1a001914mg                292   1e-86    
ref|XP_006469398.1|  PREDICTED: subtilisin-like protease-like iso...    289   1e-86    
ref|XP_003601486.1|  Subtilisin-like protease                           292   2e-86    
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         291   2e-86    
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             291   3e-86    
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         291   3e-86    
ref|XP_010647520.1|  PREDICTED: subtilisin-like protease SBT5.3         289   7e-86    
ref|XP_011039832.1|  PREDICTED: subtilisin-like protease SBT5.4         290   7e-86    
gb|AFV08661.1|  subtilisin-like protease                                290   9e-86    
ref|NP_001267495.1|  SUB1 homolog precursor                             290   9e-86    
ref|XP_002530614.1|  Cucumisin precursor, putative                      290   1e-85    Ricinus communis
ref|XP_001777292.1|  predicted protein                                  288   2e-85    
ref|XP_006469397.1|  PREDICTED: subtilisin-like protease-like iso...    289   2e-85    
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         289   2e-85    
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         288   5e-85    
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    288   5e-85    
ref|XP_006447869.1|  hypothetical protein CICLE_v10014351mg             288   6e-85    
ref|XP_002299062.1|  hypothetical protein POPTR_0001s47280g             288   7e-85    Populus trichocarpa [western balsam poplar]
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661              287   7e-85    
ref|XP_010092360.1|  Subtilisin-like protease                           286   8e-85    
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             288   9e-85    
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         287   1e-84    
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           287   1e-84    
ref|XP_004967192.1|  PREDICTED: subtilisin-like protease-like           287   2e-84    
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         286   2e-84    
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             286   2e-84    
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478             285   3e-84    
ref|XP_007049441.1|  Subtilisin-like serine endopeptidase family ...    282   3e-84    
gb|KDP45154.1|  hypothetical protein JCGZ_15019                         285   5e-84    
gb|KDO42093.1|  hypothetical protein CISIN_1g038881mg                   286   6e-84    
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         285   7e-84    
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     284   1e-83    
ref|XP_006602865.1|  PREDICTED: subtilisin-like protease-like           285   1e-83    
ref|NP_199377.2|  Subtilisin-like serine endopeptidase family pro...    284   1e-83    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01624.1|  predicted protein                                      285   1e-83    
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4         284   2e-83    Vitis vinifera
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690          284   2e-83    
emb|CBI38462.3|  unnamed protein product                                284   2e-83    
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             284   2e-83    Populus trichocarpa [western balsam poplar]
emb|CDP06171.1|  unnamed protein product                                283   2e-83    
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         284   2e-83    
ref|XP_010483626.1|  PREDICTED: subtilisin-like protease SBT5.4         275   2e-83    
ref|XP_002320540.2|  subtilisin-like protease family protein            283   2e-83    Populus trichocarpa [western balsam poplar]
gb|KHN40540.1|  Subtilisin-like protease                                284   3e-83    
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                283   3e-83    
ref|XP_009611073.1|  PREDICTED: subtilisin-like protease SBT5.3         283   3e-83    
gb|KDO51018.1|  hypothetical protein CISIN_1g015812mg                   273   4e-83    
gb|KCW88587.1|  hypothetical protein EUGRSUZ_A00964                     274   4e-83    
ref|XP_011039899.1|  PREDICTED: subtilisin-like protease SBT5.4         285   5e-83    
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         283   5e-83    
ref|XP_009759676.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    279   6e-83    
ref|XP_004167057.1|  PREDICTED: subtilisin-like protease-like           280   6e-83    
ref|XP_009374900.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    283   7e-83    
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         282   7e-83    
emb|CAN62337.1|  hypothetical protein VITISV_004299                     278   7e-83    Vitis vinifera
gb|KDP29035.1|  hypothetical protein JCGZ_16424                         287   7e-83    
ref|XP_007049440.1|  Subtilisin-like serine endopeptidase family ...    283   8e-83    
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         282   8e-83    
ref|XP_008224681.1|  PREDICTED: subtilisin-like protease                282   1e-82    
ref|XP_002299064.1|  hypothetical protein POPTR_0001s47300g             283   1e-82    Populus trichocarpa [western balsam poplar]
ref|XP_007213363.1|  hypothetical protein PRUPE_ppa026835mg             281   1e-82    
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease-like           281   1e-82    
ref|XP_008661010.1|  PREDICTED: subtilisin-like protease SBT5.3         282   2e-82    
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    278   2e-82    
ref|XP_010048342.1|  PREDICTED: subtilisin-like protease SBT5.3         281   2e-82    
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             281   2e-82    
ref|XP_004243217.1|  PREDICTED: subtilisin-like protease SBT5.3         281   2e-82    
gb|KHM99088.1|  Subtilisin-like protease                                281   2e-82    
gb|KGN43389.1|  hypothetical protein Csa_7G030520                       280   2e-82    
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         281   3e-82    
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             280   3e-82    
ref|XP_003545192.1|  PREDICTED: subtilisin-like protease-like           281   3e-82    
ref|XP_007141639.1|  hypothetical protein PHAVU_008G213000g             281   3e-82    
ref|XP_004144624.1|  PREDICTED: subtilisin-like protease-like           280   3e-82    
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    281   3e-82    
gb|KGN55997.1|  hypothetical protein Csa_3G045110                       277   5e-82    
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    280   5e-82    
emb|CBI38458.3|  unnamed protein product                                280   5e-82    
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                280   6e-82    
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                280   6e-82    
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         280   7e-82    
gb|ACP18876.1|  subtilisin-like serine protease                         280   7e-82    Carica papaya [mamon]
emb|CDY63300.1|  BnaCnng41800D                                          278   8e-82    
gb|KCW75459.1|  hypothetical protein EUGRSUZ_E04225                     279   1e-81    
ref|XP_002437266.1|  hypothetical protein SORBIDRAFT_10g023870          280   1e-81    Sorghum bicolor [broomcorn]
ref|XP_009759675.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    279   2e-81    
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         279   2e-81    
ref|XP_010059708.1|  PREDICTED: subtilisin-like protease SBT5.4         279   2e-81    
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg             278   2e-81    
ref|XP_002453487.1|  hypothetical protein SORBIDRAFT_04g006740          275   2e-81    Sorghum bicolor [broomcorn]
gb|KDP32632.1|  hypothetical protein JCGZ_13182                         278   2e-81    
emb|CAA59963.1|  subtilisin-like protease                               278   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         278   2e-81    
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             278   2e-81    
ref|XP_009794911.1|  PREDICTED: subtilisin-like protease SBT5.3         268   2e-81    
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         278   3e-81    
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                278   3e-81    
ref|XP_006377976.1|  hypothetical protein POPTR_0011s16870g             278   3e-81    
ref|XP_006648425.1|  PREDICTED: subtilisin-like protease-like           277   3e-81    
emb|CBI38463.3|  unnamed protein product                                279   3e-81    
ref|XP_010647023.1|  PREDICTED: subtilisin-like protease SBT5.4         266   3e-81    
ref|XP_008462020.1|  PREDICTED: subtilisin-like protease isoform X2     275   4e-81    
ref|XP_010108994.1|  Subtilisin-like protease                           279   4e-81    
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    278   4e-81    Vitis vinifera
ref|XP_003571633.1|  PREDICTED: subtilisin-like protease SBT5.3         278   4e-81    
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         277   5e-81    
ref|XP_010092373.1|  Subtilisin-like protease                           277   5e-81    
gb|EAZ22112.1|  hypothetical protein OsJ_05774                          271   5e-81    Oryza sativa Japonica Group [Japonica rice]
ref|NP_569048.1|  subtilisin-like protease                              277   5e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KGN55998.1|  hypothetical protein Csa_3G045120                       277   5e-81    
ref|XP_006601388.1|  PREDICTED: subtilisin-like protease-like           272   7e-81    
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease                273   7e-81    
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                276   1e-80    
ref|XP_006660048.1|  PREDICTED: subtilisin-like protease-like           276   1e-80    
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                276   1e-80    
emb|CDY12840.1|  BnaC07g15930D                                          276   1e-80    
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                276   2e-80    
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                276   2e-80    
ref|XP_011000330.1|  PREDICTED: subtilisin-like protease SBT5.4         276   2e-80    
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             276   2e-80    Musa acuminata [banana]
ref|XP_006350127.1|  PREDICTED: subtilisin-like protease-like           275   3e-80    
ref|XP_008462019.1|  PREDICTED: subtilisin-like protease isoform X1     275   3e-80    
ref|XP_003608826.1|  Subtilisin-like protease                           275   4e-80    
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             275   5e-80    
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             274   7e-80    
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             274   8e-80    
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         274   9e-80    
gb|KHN44005.1|  Subtilisin-like protease                                266   9e-80    
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             274   1e-79    
ref|XP_008344750.1|  PREDICTED: subtilisin-like protease                271   1e-79    
gb|EMT26574.1|  Subtilisin-like protease                                271   1e-79    
dbj|BAC22315.1|  putative subtilisin-like serine protease AIR3          273   2e-79    Oryza sativa Japonica Group [Japonica rice]
emb|CDY18653.1|  BnaA09g07420D                                          272   2e-79    
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    280   2e-79    
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           273   2e-79    
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         273   3e-79    
gb|AES91027.2|  subtilisin-like serine protease                         273   3e-79    
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                273   3e-79    
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                273   3e-79    
ref|XP_004515893.1|  PREDICTED: subtilisin-like protease-like           273   3e-79    
ref|XP_011095872.1|  PREDICTED: subtilisin-like protease SBT5.4         273   3e-79    
gb|AAM10321.1|  AT5g67360/K8K14_8                                       272   3e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    268   5e-79    
ref|XP_006468177.1|  PREDICTED: subtilisin-like protease-like           272   6e-79    
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         272   7e-79    
ref|XP_006282063.1|  hypothetical protein CARUB_v10028308mg             272   7e-79    
gb|KDO78650.1|  hypothetical protein CISIN_1g048642mg                   272   8e-79    
ref|XP_011088876.1|  PREDICTED: subtilisin-like protease SBT5.3         271   8e-79    
ref|XP_010906270.1|  PREDICTED: subtilisin-like protease                266   8e-79    
gb|AFW70718.1|  putative subtilase family protein                       267   8e-79    
emb|CBI29567.3|  unnamed protein product                                268   8e-79    
ref|XP_006469402.1|  PREDICTED: subtilisin-like protease-like           271   9e-79    
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                271   1e-78    
ref|XP_006602868.1|  PREDICTED: subtilisin-like protease-like           272   1e-78    
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                271   1e-78    
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                271   1e-78    
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           271   1e-78    
gb|KHN40225.1|  Subtilisin-like protease                                270   1e-78    
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    270   1e-78    
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                270   2e-78    
ref|XP_003614591.1|  Subtilisin-like protease                           268   2e-78    
gb|KHN40543.1|  Subtilisin-like protease                                270   2e-78    
ref|XP_003528716.1|  PREDICTED: subtilisin-like protease-like           271   2e-78    
gb|EPS59495.1|  hypothetical protein M569_15309                         270   2e-78    
gb|ADE76648.1|  unknown                                                 260   3e-78    
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                270   3e-78    
ref|NP_001046210.1|  Os02g0198700                                       270   3e-78    
gb|AES91026.2|  subtilisin-like serine protease                         270   3e-78    
emb|CDX75757.1|  BnaC03g38400D                                          260   3e-78    
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         272   3e-78    
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                270   3e-78    
ref|XP_007139650.1|  hypothetical protein PHAVU_008G047700g             269   4e-78    
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                269   4e-78    
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                270   4e-78    
emb|CDY65695.1|  BnaA02g06820D                                          264   4e-78    
dbj|BAJ34472.1|  unnamed protein product                                261   5e-78    
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         269   5e-78    
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         270   5e-78    
gb|AES91025.2|  subtilisin-like serine protease                         269   5e-78    
gb|EAY84890.1|  hypothetical protein OsI_06255                          270   6e-78    
emb|CDY63219.1|  BnaAnng18730D                                          268   7e-78    
ref|XP_006447860.1|  hypothetical protein CICLE_v10014355mg             269   7e-78    
ref|XP_006857622.1|  hypothetical protein AMTR_s00061p00122710          269   8e-78    
gb|EAY90937.1|  hypothetical protein OsI_12551                          261   9e-78    
emb|CDY22001.1|  BnaC09g01070D                                          268   1e-77    
ref|XP_009587856.1|  PREDICTED: subtilisin-like protease SBT5.4         268   1e-77    
ref|XP_006851499.1|  hypothetical protein AMTR_s00040p00151440          268   1e-77    
ref|XP_004951554.1|  PREDICTED: subtilisin-like protease-like iso...    268   1e-77    
gb|ADE77855.1|  unknown                                                 258   1e-77    
gb|KGN64982.1|  hypothetical protein Csa_1G171040                       268   2e-77    
ref|XP_004296128.1|  PREDICTED: subtilisin-like protease-like           267   2e-77    
ref|XP_004951553.1|  PREDICTED: subtilisin-like protease-like iso...    268   2e-77    
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842              267   2e-77    
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like           268   2e-77    
ref|XP_009620721.1|  PREDICTED: subtilisin-like protease Glyma18g...    252   2e-77    
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           262   2e-77    
gb|EEC83379.1|  hypothetical protein OsI_28793                          273   2e-77    
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           268   2e-77    
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                267   2e-77    
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         268   2e-77    
emb|CDP06146.1|  unnamed protein product                                268   2e-77    
gb|EAZ42320.1|  hypothetical protein OsJ_26892                          272   3e-77    
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                267   3e-77    
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                267   3e-77    
ref|XP_009107091.1|  PREDICTED: subtilisin-like protease SBT5.4         267   3e-77    
ref|XP_009591665.1|  PREDICTED: subtilisin-like protease SBT5.3         273   3e-77    
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     267   3e-77    
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                267   3e-77    
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     267   3e-77    
ref|XP_008380083.1|  PREDICTED: subtilisin-like protease                263   4e-77    
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    267   4e-77    
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                267   4e-77    
emb|CAN62640.1|  hypothetical protein VITISV_010210                     262   4e-77    
ref|XP_002463463.1|  hypothetical protein SORBIDRAFT_01g000350          267   4e-77    
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             267   4e-77    
emb|CDY63302.1|  BnaCnng41810D                                          266   4e-77    
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    266   5e-77    
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                266   5e-77    
gb|EYU44465.1|  hypothetical protein MIMGU_mgv1a0020562mg               258   5e-77    
ref|XP_010252985.1|  PREDICTED: subtilisin-like protease SBT5.4         266   5e-77    
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease                266   6e-77    
ref|XP_002517380.1|  Xylem serine proteinase 1 precursor, putative      266   6e-77    
emb|CAN77862.1|  hypothetical protein VITISV_022393                     266   6e-77    
emb|CDY65487.1|  BnaA03g57660D                                          266   7e-77    
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           266   7e-77    
ref|XP_010455547.1|  PREDICTED: subtilisin-like protease SBT5.4         266   7e-77    
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             266   8e-77    
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         266   8e-77    
emb|CBI33725.3|  unnamed protein product                                262   8e-77    
ref|XP_002988851.1|  hypothetical protein SELMODRAFT_128873             266   8e-77    
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    266   9e-77    
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                266   9e-77    
gb|AES70685.2|  subtilisin-like serine protease                         266   9e-77    
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          266   9e-77    
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           266   1e-76    
ref|XP_010443761.1|  PREDICTED: subtilisin-like protease SBT5.4         266   1e-76    
ref|XP_003600434.1|  Subtilisin-like protease                           265   1e-76    
ref|XP_003608829.1|  Subtilisin-like serine protease                    266   1e-76    
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like           266   1e-76    
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                265   1e-76    
ref|XP_003533568.1|  PREDICTED: subtilisin-like protease-like           266   1e-76    
ref|XP_008645398.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    266   2e-76    
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       261   2e-76    
gb|KCW88582.1|  hypothetical protein EUGRSUZ_A00959                     266   2e-76    
ref|XP_008645399.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    266   2e-76    
emb|CDY57437.1|  BnaAnng14520D                                          265   2e-76    
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    265   2e-76    
gb|KHN04600.1|  Subtilisin-like protease                                264   2e-76    
gb|EAY87746.1|  hypothetical protein OsI_09161                          259   2e-76    
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                265   2e-76    
ref|XP_009759335.1|  PREDICTED: subtilisin-like protease SBT5.4         265   2e-76    
ref|XP_004172226.1|  PREDICTED: subtilisin-like protease-like           256   2e-76    
ref|XP_002866352.1|  subtilase family protein                           265   2e-76    
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    264   3e-76    
emb|CDY66924.1|  BnaAnng23240D                                          260   3e-76    
ref|NP_001151755.1|  subtilisin-like protease precursor                 265   3e-76    
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    265   3e-76    
tpg|DAA52605.1|  TPA: putative subtilase family protein                 265   3e-76    
gb|KHN11556.1|  Subtilisin-like protease                                265   3e-76    
ref|XP_010090327.1|  Subtilisin-like protease                           265   3e-76    
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    265   3e-76    
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                265   3e-76    
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                265   3e-76    
emb|CDY40408.1|  BnaA02g27220D                                          265   3e-76    
ref|XP_004164572.1|  PREDICTED: subtilisin-like protease-like           265   3e-76    
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           265   3e-76    
ref|XP_006646283.1|  PREDICTED: subtilisin-like protease-like           256   3e-76    
ref|XP_003608828.1|  Subtilisin-like serine protease                    265   4e-76    
gb|KGN55995.1|  hypothetical protein Csa_3G045090                       264   4e-76    
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           264   4e-76    
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             264   4e-76    
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                264   4e-76    
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             264   4e-76    
ref|XP_009784573.1|  PREDICTED: subtilisin-like protease SBT5.4         264   5e-76    
ref|XP_004491111.1|  PREDICTED: subtilisin-like protease-like           264   5e-76    
gb|KHN03560.1|  Subtilisin-like protease                                260   5e-76    
ref|XP_003616914.1|  Subtilisin-like protease                           264   5e-76    
ref|XP_002974964.1|  hypothetical protein SELMODRAFT_415194             264   5e-76    
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                264   5e-76    
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    264   6e-76    
ref|XP_004296137.1|  PREDICTED: subtilisin-like protease-like           264   6e-76    
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3         264   7e-76    
ref|XP_003571078.1|  PREDICTED: subtilisin-like protease SBT5.3         264   8e-76    
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           263   8e-76    
ref|XP_006380388.1|  hypothetical protein POPTR_0007s04520g             265   9e-76    
gb|EMS67510.1|  Subtilisin-like protease                                259   9e-76    
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      263   9e-76    
emb|CDY18654.1|  BnaA09g07410D                                          263   9e-76    
ref|XP_008448997.1|  PREDICTED: subtilisin-like protease                263   9e-76    
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         263   1e-75    
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                263   1e-75    
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                263   1e-75    
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      263   1e-75    
ref|XP_010692332.1|  PREDICTED: subtilisin-like protease                262   1e-75    
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             263   1e-75    
gb|KHN15704.1|  Subtilisin-like protease                                262   1e-75    
ref|XP_002525223.1|  Xylem serine proteinase 1 precursor, putative      263   1e-75    
emb|CDY65693.1|  BnaA02g06800D                                          263   1e-75    
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                263   1e-75    
ref|XP_002309930.2|  hypothetical protein POPTR_0007s04500g             262   1e-75    
emb|CDY37334.1|  BnaC02g33520D                                          263   1e-75    
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           263   2e-75    
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    263   2e-75    
gb|EMT31638.1|  Subtilisin-like protease                                261   2e-75    
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             262   2e-75    
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         262   2e-75    
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                263   2e-75    
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                262   2e-75    
ref|XP_002977384.1|  hypothetical protein SELMODRAFT_417382             262   2e-75    
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                262   2e-75    
ref|XP_009610677.1|  PREDICTED: subtilisin-like protease SBT5.4         263   2e-75    
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                261   2e-75    
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                262   2e-75    
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                262   2e-75    
ref|XP_011005797.1|  PREDICTED: subtilisin-like protease SBT5.4         262   2e-75    
ref|XP_003608830.1|  Subtilisin-like serine protease                    268   2e-75    
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           262   2e-75    
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    262   2e-75    
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    262   2e-75    
gb|EMT07781.1|  Subtilisin-like protease                                258   3e-75    
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             262   3e-75    
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease                262   3e-75    
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           262   3e-75    
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                262   3e-75    
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    262   4e-75    
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                261   4e-75    
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                261   4e-75    
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                261   4e-75    
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             261   5e-75    
ref|XP_006475104.1|  PREDICTED: subtilisin-like protease-like           261   5e-75    
ref|XP_002308740.2|  hypothetical protein POPTR_0006s00370g             259   6e-75    
ref|XP_010227516.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    261   7e-75    
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                261   7e-75    
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    261   7e-75    
gb|ACN28035.1|  unknown                                                 251   7e-75    
ref|NP_001152427.1|  LOC100286067 precursor                             261   7e-75    
ref|XP_003560594.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    261   8e-75    
ref|XP_007139652.1|  hypothetical protein PHAVU_008G047900g             261   8e-75    
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             260   9e-75    
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3         261   9e-75    
ref|NP_001146035.1|  uncharacterized protein LOC100279566               254   9e-75    
ref|XP_010063229.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    260   9e-75    
gb|ACN28204.1|  unknown                                                 260   1e-74    
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                260   1e-74    
gb|KHN12283.1|  Subtilisin-like protease                                252   1e-74    
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                260   1e-74    
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    260   1e-74    
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                260   1e-74    
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    260   1e-74    
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                260   1e-74    
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           260   1e-74    
dbj|BAK07347.1|  predicted protein                                      261   1e-74    
gb|EAY78354.1|  hypothetical protein OsI_33442                          260   1e-74    
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   260   2e-74    
ref|XP_008794758.1|  PREDICTED: subtilisin-like protease SBT5.3         259   2e-74    
dbj|BAJ87780.1|  predicted protein                                      260   2e-74    
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             260   2e-74    
ref|XP_007047459.1|  Subtilase family protein                           259   2e-74    
gb|AIC80772.1|  subtilase                                               259   2e-74    
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                259   2e-74    
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           259   2e-74    
ref|XP_001757585.1|  predicted protein                                  259   2e-74    
emb|CDY15084.1|  BnaC03g44450D                                          259   2e-74    
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     259   2e-74    
gb|EMS46826.1|  Subtilisin-like protease                                252   2e-74    
gb|ACN27710.1|  unknown                                                 258   2e-74    
ref|XP_009126659.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    259   2e-74    
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    259   2e-74    
ref|XP_004500162.1|  PREDICTED: subtilisin-like protease-like           259   2e-74    
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                259   2e-74    
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    259   2e-74    



>emb|CDP14569.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   446 bits (1148),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 243/395 (62%), Positives = 291/395 (74%), Gaps = 7/395 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFP-GFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
              +++  +K + +PLVYA DVE+PG +TN   G C P TLS + VKGKVVFC VG +Y++ 
Sbjct  374   RTVTPFRKTKKYPLVYAVDVEIPGKTTNLTTGGCFPGTLSKKLVKGKVVFCWVGYIYQAL  433

Query  1189  EVERAGGAAVILGNI--GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             EV RAGG A I GN   G  V    FL+PGT +   ++   I+ YI  N+NP ATL PG+
Sbjct  434   EVRRAGGVAAIFGNPYGGKGVVESPFLLPGTTVLQ-NDRATIVSYILNNENPTATLFPGR  492

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             T+ G  P+P MAPFT+LGP+ +EPNILKPDITAPGLNILAAW+EAS P    QDHR VKY
Sbjct  493   TIIGTGPAPFMAPFTALGPNGIEPNILKPDITAPGLNILAAWTEASPPTQLLQDHRVVKY  552

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
             NI SGTSMSCPHVSAV ALLKAIHP WS AAI+S++MTTA   N     I DA G +A P
Sbjct  553   NIASGTSMSCPHVSAVAALLKAIHPDWSSAAIRSSLMTTARRVNNVQIPITDAAGNIATP  612

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
             FHYGAGHFQPSKAADPGLVYD++YTDYLLF+C+     LD SFKCPK     PS+LNYPS
Sbjct  613   FHYGAGHFQPSKAADPGLVYDASYTDYLLFLCSSGTAFLDPSFKCPKH-VPPPSDLNYPS  671

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             LAIA L G+M V RTVTNVG+ N+TY+V +  P G++VKI PT L F + GEKQSFSI+V
Sbjct  672   LAIAKLNGNMTVSRTVTNVGTGNSTYTVIIVPPPGYTVKILPTKLYFSKTGEKQSFSITV  731

Query  295   KAGSVKKVGEFEFGWYKWSDGI-HMVKSPIVVSSA  194
             K  +  K  +FEFGWY WSDG  H+V+SPIVVS+A
Sbjct  732   KVAASIKETKFEFGWYAWSDGAGHVVRSPIVVSAA  766



>emb|CDP14572.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   443 bits (1139),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 239/395 (61%), Positives = 291/395 (74%), Gaps = 7/395 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFP-GFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
              +++  +K + +PLVYA  VE+PG +TN   G+C P TLS + VKGKVVFC VG + ++ 
Sbjct  354   RTVTPFRKTKKYPLVYAVHVEIPGKTTNLTTGWCFPGTLSKKHVKGKVVFCRVGFISQAL  413

Query  1189  EVERAGGAAVILGN--IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             EV RAGG A I GN  +G  V    FL+PGT +   ++   I+ YI  N+NP ATL PG+
Sbjct  414   EVRRAGGVAAIFGNPYVGKGVYEIPFLLPGTTVLQ-NDRATIVSYILNNENPTATLFPGR  472

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             T+ G  P+P MAPFT+LGP+ +EPNILKPDITAPGLNILAAW+EAS P    QDHR VKY
Sbjct  473   TIIGTGPAPFMAPFTALGPNGIEPNILKPDITAPGLNILAAWTEASPPTHLHQDHRVVKY  532

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
             NI SGTSMSCPH SAV ALLKAIHP WS AAI+S++MTTA   N     I DA G +A P
Sbjct  533   NIASGTSMSCPHASAVAALLKAIHPDWSSAAIRSSLMTTARRVNNVQIPITDAVGNIATP  592

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
             FHYGAGHFQPSKAADPGLVYD++YTDYLLF+C+     LD SFKCPK     PS+LNYPS
Sbjct  593   FHYGAGHFQPSKAADPGLVYDASYTDYLLFLCSSGTAFLDPSFKCPKH-VPPPSDLNYPS  651

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             LAIA L G+M V RTVTNVG+ N+TY+V +  P G++V+I PT L F ++GEKQSFSI+V
Sbjct  652   LAIAKLNGTMTVSRTVTNVGTGNSTYTVSIVPPPGYTVEILPTKLYFSKIGEKQSFSITV  711

Query  295   KAGSVKKVGEFEFGWYKWSDGI-HMVKSPIVVSSA  194
             K  +  K  +FEFGWY WSDG+ H+V SPIVVS+A
Sbjct  712   KVAASIKETKFEFGWYTWSDGVGHVVSSPIVVSAA  746



>ref|XP_009604279.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   439 bits (1129),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 289/392 (74%), Gaps = 5/392 (1%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++++ I++    PLVYAGDVE+ G+T  N  G C P TLS   V+GKVV C   S+  S 
Sbjct  378   QTVTPIRRNRLHPLVYAGDVEIRGTTASNTTGGCFPGTLSRNLVRGKVVLCRGSSMQASM  437

Query  1189  EVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             EV+RAGG A ILG   +E+ V  FL   T + +      I  YI+T KNP+ATL+PG+T+
Sbjct  438   EVKRAGGVAAILGTPFNEIQVTPFL-DSTTVAFSYGLHTIRTYIQTEKNPMATLLPGQTL  496

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G KP+P MAPFTS GP+ V+PNILKPDITAPGLNILAAWSEASSP   P+D R VKYN+
Sbjct  497   IGTKPAPVMAPFTSKGPNIVDPNILKPDITAPGLNILAAWSEASSPLKLPEDRRVVKYNM  556

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVSAV+ALLK+IHP WS AAI+SA+MTT+T  NV G  I +A G+ A PF 
Sbjct  557   QSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMTTSTINNVVGRPITNATGDDANPFE  616

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YGAGHF+PS+A DPGL+YD+TY DYLL++C+    SLD+SF CP ++    SNLNYPSLA
Sbjct  617   YGAGHFRPSRAVDPGLIYDATYEDYLLYLCS-QNISLDSSFNCP-EEVPEASNLNYPSLA  674

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             IA +KGS  V+R VTNVG  ++TY + +++P G+ V I P  L+F ++GEK SF+I+V+A
Sbjct  675   IANIKGSRTVRRVVTNVGKDSSTYILAMRSPPGYVVDIIPKTLRFSKLGEKLSFNITVRA  734

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
              SV++  EF FGWY WSDG+H+V+SPI  SSA
Sbjct  735   QSVERRNEFAFGWYTWSDGVHVVQSPIAASSA  766



>ref|XP_009768078.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   436 bits (1122),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 288/392 (73%), Gaps = 5/392 (1%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++++ I++    PLVYAGDVE+ G+T  N  G C P TLS   V+GKVV C   S+  S 
Sbjct  381   QTVTPIRRSRLHPLVYAGDVEIRGTTASNTTGLCFPGTLSRNLVRGKVVVCRGSSMQASM  440

Query  1189  EVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             EV+RAGG A ILG   +E+ V  FL   T + +    + I  YI+T KNP+ATL+PG+T+
Sbjct  441   EVKRAGGVAAILGTPFNEIQVTPFL-DSTTVAFSYGLNTIRTYIQTEKNPMATLLPGQTL  499

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G K +P MAPFTS GP+ V+PNILKPDITAPGLNILAAWSEASSP + P+D R VKYN+
Sbjct  500   IGTKSAPVMAPFTSKGPNIVDPNILKPDITAPGLNILAAWSEASSPLNLPEDRRVVKYNM  559

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVSAV+ALLK+IHP WS AAI+SA+MTT+T  N+ G  I +A G  A PF 
Sbjct  560   QSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMTTSTINNLVGRPITNATGNDANPFE  619

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YGAGHF+PS+A DPGL+YD+TY DYLL++C+    SLD+SF CP ++    SNLNYPSLA
Sbjct  620   YGAGHFRPSRAVDPGLIYDATYEDYLLYLCS-QNISLDSSFNCP-EEVPEASNLNYPSLA  677

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             IA +KGS  V+R VTNVG  N+TY + +++P G+ V I P  L+F ++GEK SF+I+++A
Sbjct  678   IANIKGSRTVRRVVTNVGKDNSTYVLAMRSPPGYDVDIIPKTLRFSKLGEKLSFNITIRA  737

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
              SV++  EF FG Y WSDG+H+V+SPI  SSA
Sbjct  738   QSVERRNEFAFGRYTWSDGVHVVQSPIAASSA  769



>ref|XP_006355622.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   432 bits (1112),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 292/393 (74%), Gaps = 7/393 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++ + I++    PLVYAGDVE+ G+T  N  G CLP TLS + V+GKVV C+   +  S 
Sbjct  367   QTATPIRRRRLHPLVYAGDVEIRGTTASNTTGTCLPGTLSRKLVRGKVVLCINSDIQASM  426

Query  1189  EVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             EV+RAGG A ILGN  +E+ V  FL P T +F  S    I+ YI+T K P+ATL+PG T+
Sbjct  427   EVKRAGGVAAILGNSFNEIQVTPFLDPTTVVFSYSLI-TIMTYIRTEKYPMATLVPGNTL  485

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G K +P MA F+S GP+ V+ NILKPDITAPG NILAAWSEASSP + P+D R VKYNI
Sbjct  486   IGTKTAPVMAHFSSKGPNIVDLNILKPDITAPGFNILAAWSEASSPLNIPEDRRVVKYNI  545

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVSAV+ALLK+IHP WS AA++SA+MTT+T  NV G  I++A G+ A PF 
Sbjct  546   DSGTSMSCPHVSAVIALLKSIHPDWSSAAVRSALMTTSTINNVVGRPIKNATGDDANPFE  605

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+PS+A DPGLVYD+TYTDYLL++C+    SLD+SF CP+K   + SNLNYPSLA
Sbjct  606   YGSGHFRPSRAVDPGLVYDATYTDYLLYLCS-QNVSLDSSFSCPEK-VPTASNLNYPSLA  663

Query  469   IAGLKGS-MVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
             IA ++GS   V+R VTNVG  N+TY + V++P G+ V I P  L+F ++GEK SF+I+V+
Sbjct  664   IANIRGSGRTVRRVVTNVGRDNSTYFLVVRSPPGYVVDIVPKSLRFNKLGEKSSFNITVR  723

Query  292   A-GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             A  SV++  EF FGWY WSDG+H+V+SPI VSS
Sbjct  724   AQSSVERRNEFSFGWYTWSDGVHVVRSPIAVSS  756



>ref|XP_006355566.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   432 bits (1112),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 227/395 (57%), Positives = 289/395 (73%), Gaps = 8/395 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++I+ I++    PLVYAGDVE+ G+T  N  G CLP TLS   V+GKVV CL   +  S 
Sbjct  385   QTITQIRRRRLHPLVYAGDVEIRGTTASNTTGACLPGTLSRNLVRGKVVLCLNSDIQASM  444

Query  1189  EVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             EV+RAGG A ILGN  +E+ V  FL P T + +    + +L YI+T K+P ATL+PG T+
Sbjct  445   EVKRAGGVAAILGNPFNEIQVIPFLNP-TTVTFLDGLNTLLTYIRTEKHPTATLVPGNTM  503

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G K +P MAPF+S GP+ V+PNILKPDITAPG NILAAWSEASSP + P+DHR VKYNI
Sbjct  504   IGTKTAPVMAPFSSKGPNVVDPNILKPDITAPGFNILAAWSEASSPLNIPEDHRVVKYNI  563

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVSAV+ALLK+IHP WS AA++SA+MTT+T  NV G  I++A G+ A PF 
Sbjct  564   DSGTSMSCPHVSAVIALLKSIHPDWSSAAVRSALMTTSTINNVVGRPIKNATGDDANPFE  623

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+PSKAADPGL+YD+TYTDYLL++C+      D S+ CP K   + SNLNYPSLA
Sbjct  624   YGSGHFRPSKAADPGLIYDATYTDYLLYLCS-QNIRPDLSYNCPAK-VPAASNLNYPSLA  681

Query  469   IAGLKG-SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV-  296
             IA ++G S  V R VTNVG  N+TY V V++P G++V I P  L+F ++GEK SF+I++ 
Sbjct  682   IANMRGSSKTVTRVVTNVGKDNSTYVVAVRSPPGYAVDIVPKSLRFSKLGEKHSFNITII  741

Query  295   -KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                 SV +  EF FG Y WSDG+H+V+SPI VSS+
Sbjct  742   RAQSSVDRRNEFSFGRYTWSDGVHVVQSPIAVSSS  776



>ref|XP_004232982.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=773

 Score =   431 bits (1107),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/394 (58%), Positives = 288/394 (73%), Gaps = 9/394 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++++ I++    PLVYAGDVE+ G T  N  G CLP TLS   V+GKVV C    +  S 
Sbjct  385   QTVTPIRRRRLHPLVYAGDVEIRGITASNTTGTCLPGTLSRNLVRGKVVLCGNTGIQASM  444

Query  1189  EVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             EV+RAGG A ILGN  +E+ V  +L P T +F  S    IL YI+T KNP+ATL+PG T+
Sbjct  445   EVKRAGGVAAILGNPFNEIKVTPYLDPTTVVFSYSLA-TILTYIRTEKNPMATLVPGNTL  503

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G KP+P MA FTS GP+ V+PNILKPDITAPG NILAAWSEASSP   P+D R VKYN+
Sbjct  504   IGTKPAPVMASFTSKGPNVVDPNILKPDITAPGFNILAAWSEASSPLKMPEDRRVVKYNM  563

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVS V+ALLK++HP WS AAI+SA+MTT+T  NV G+ I++A G+ A PF 
Sbjct  564   QSGTSMSCPHVSGVIALLKSVHPDWSSAAIRSALMTTSTMNNVVGQPIKNATGDDASPFE  623

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+PS+A DPGLVYD+TYTDYLL++CT    SLD+SF CP+K   + SNLNYPSLA
Sbjct  624   YGSGHFRPSRAVDPGLVYDATYTDYLLYLCT-QNVSLDSSFSCPEK-IPTASNLNYPSLA  681

Query  469   IAGLKGSMV--VKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             IA ++G  +  V R VTNVG  N+TY + V +P G+ V I P  L F ++GEK SF+I++
Sbjct  682   IANMRGGSIRSVTRVVTNVGKDNSTYVLGVSSPPGYVVDIVPKRLHFSKLGEKHSFNITI  741

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                SV++  +F FGWY WSDG+H+V+SPI VSSA
Sbjct  742   T--SVQRRNDFSFGWYTWSDGVHVVRSPIAVSSA  773



>ref|XP_006355621.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=758

 Score =   423 bits (1087),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 226/394 (57%), Positives = 288/394 (73%), Gaps = 8/394 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGSTNFPGF--CLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++++ I++    PLVYAGDVE+ G+T       CLP TLS   V+GKVV C+      S 
Sbjct  367   QTVTPIRRRRLHPLVYAGDVEIRGTTTNNTSGTCLPGTLSRNLVRGKVVLCINNLRAASM  426

Query  1189  EVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             EV+RAGG A ILGN  +E+ V  FL   T +F  S  + +L YI+T KNP+ATL+PG T+
Sbjct  427   EVKRAGGVAAILGNRFNEIQVTPFLDTTTVVFSYS-LNTLLTYIRTEKNPMATLVPGNTL  485

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G KP+P MA FTS GP+ V+PNILKPDITAPG NILAAWSEASSP   P+D R VKYN+
Sbjct  486   IGTKPAPVMASFTSKGPNIVDPNILKPDITAPGFNILAAWSEASSPLKMPEDRRVVKYNM  545

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVSAV+ALLK+IHP WS AAI+SA+MTT+T  NV G  I++A G+ A PF 
Sbjct  546   QSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMTTSTINNVVGRPIKNATGDDANPFE  605

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+PS+A DPGLVYD+TYTDYLL++C+    SLD+SF CP+K   + SNLNYPSLA
Sbjct  606   YGSGHFRPSRAVDPGLVYDATYTDYLLYLCS-QNISLDSSFSCPEK-VPTASNLNYPSLA  663

Query  469   IAGLKGSM-VVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV-  296
             IA ++GS+  V R VTNVG  N+TY + V++P G+ V I P  L F ++GEK SF+I++ 
Sbjct  664   IANMRGSIRTVTRVVTNVGKDNSTYVLGVRSPPGYVVDIVPKSLHFSKLGEKHSFNITII  723

Query  295   -KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
                 SV++  EF FGWY W+DG+H+V+SPI VSS
Sbjct  724   RAQSSVERRNEFSFGWYTWNDGVHVVRSPIAVSS  757



>ref|XP_008803738.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=600

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 221/394 (56%), Positives = 280/394 (71%), Gaps = 11/394 (3%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST---EVE  1181
             +K  E +PLVYAGD  +PG+ +N  G CLP+TLS +KV+GK+V CL GS  R+    EV+
Sbjct  209   LKGNELYPLVYAGDAVVPGTPSNVSGQCLPNTLSAKKVRGKIVLCLRGSGLRAAKGLEVK  268

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGGAA+ILGN    G E+PV S ++PGT +    +  AILKYI + + P AT+   +T+
Sbjct  269   RAGGAAIILGNAPPNGKEIPVDSHVLPGTAV-SSDDAIAILKYINSTRRPSATIGRARTI  327

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                +P+P M  F+S GP+ V+PNILKPDITAPGLNILAAWSE+SSP     DHRSVKYN+
Sbjct  328   LDVRPAPVMTAFSSRGPNRVDPNILKPDITAPGLNILAAWSESSSPTKLEDDHRSVKYNL  387

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
             +SGTSMSCPHVSA   LLK++HP+WS AAI+SAIMTTAT  N KG  I +A GE AGP  
Sbjct  388   LSGTSMSCPHVSATATLLKSMHPYWSSAAIRSAIMTTATVRNAKGGLIANAAGEEAGPLD  447

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GH +P+ A+DPGLVY+++Y DYLLF C+  G  +D +F CPK    S  NLNYPS++
Sbjct  448   YGSGHVRPTHASDPGLVYEASYRDYLLFACSSIGVQMDPTFPCPKS-PPSTFNLNYPSVS  506

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             ++ L GS+ V RTVTNVG   A Y V V  P+G SVKISP +LKF  VGE++SF+I ++ 
Sbjct  507   VSNLNGSIDVHRTVTNVGQQKAWYRVSVVEPSGVSVKISPNILKFERVGEEKSFTIKLQV  566

Query  289   GSVKKVGEFEF--GWYKWSDGIHMVKSPIVVSSA  194
                K  G  E+  G Y WSDG H V+SPIVVS A
Sbjct  567   DGRKGAGSGEYVAGSYTWSDGTHDVRSPIVVSVA  600



>ref|XP_011102273.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=776

 Score =   419 bits (1076),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 233/394 (59%), Positives = 284/394 (72%), Gaps = 7/394 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGSTNFP--GFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             +SI+  KK  T+PLVYA DVE+PG+T     G CL  TLSP  V+GK VFC  G  +++ 
Sbjct  386   QSITPFKK-GTYPLVYAADVEIPGTTTTLTNGLCLNGTLSPRLVRGKAVFCWRGDTFQAL  444

Query  1189  EVERAGGAAVILGNIGSEVPV--GSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             EV+RAGG A +LGN+   + V    +LIPGT +   ++T  I  YI T+ NP ATL P K
Sbjct  445   EVQRAGGVATVLGNVFDGIGVIGRPYLIPGT-VVPSNQTLGIYNYIATHLNPTATLTPAK  503

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             T+ G KP+P MA FTS GP+ +EPNILKPDITAPGLNILAAWSEASSP + P D R VK+
Sbjct  504   TLIGTKPAPFMAAFTSRGPNFIEPNILKPDITAPGLNILAAWSEASSPLNVPSDRRVVKF  563

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
              I SGTSM+CPHV+AV ALLKAIHP WS AAI+SA+MTTA   N  G+ I D+ G  A P
Sbjct  564   QIDSGTSMACPHVAAVAALLKAIHPDWSSAAIRSALMTTAKLSNNVGKPITDSLGNTATP  623

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
             F YGAGH QPSKAADPGLVYD++YTDYLLF+C+ +   LD SF CP+    SPSN NYPS
Sbjct  624   FQYGAGHIQPSKAADPGLVYDASYTDYLLFLCSSSSNLLDPSFTCPQV-LPSPSNFNYPS  682

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             LAI+ L+  + V+R+VTNVG  N+TYSV +  P G+SV+ISP  L F   GEKQ+FSI+V
Sbjct  683   LAISNLRSVLTVRRSVTNVGMGNSTYSVTINPPPGYSVRISPATLYFGAAGEKQNFSITV  742

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +AG   +   F FGWY WSDGIH+V+SPI VS A
Sbjct  743   RAGRAARRNVFAFGWYSWSDGIHLVRSPISVSKA  776



>ref|XP_010273518.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=779

 Score =   419 bits (1076),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 229/395 (58%), Positives = 283/395 (72%), Gaps = 16/395 (4%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGSTN-FPGFCLPDTLSPEKVKGKVVFCL--VGS-VYRSTEVERAGG  1169
             + +PLVYAGD  +PG  N     CLP +LSPEKVKGK+V CL  +G+ V +  EV RAGG
Sbjct  387   KMYPLVYAGDAVVPGVNNSVADQCLPGSLSPEKVKGKIVLCLRRLGTRVGKGLEVRRAGG  446

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA+ LGN    G+E+P+ S+ +PGT + +   T+ IL YI + KNP A ++PG TV   K
Sbjct  447   AAIFLGNSRLNGNELPIDSYFLPGTAVAFEDATN-ILSYINSTKNPTAKVVPGMTVINVK  505

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P+MA F+S GP+ +EPNILKPDITAPG+NILA+WSE SSP     DHR VKYN  SGT
Sbjct  506   PAPSMASFSSRGPNVIEPNILKPDITAPGINILASWSEKSSPTKLLSDHRRVKYNFDSGT  565

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHV+ + ALLKAIHP WS AAI+SAIMTTA T N  G  + DA G+ A PF YG+G
Sbjct  566   SMSCPHVAGIAALLKAIHPSWSSAAIRSAIMTTARTRNNMGMPLTDATGDTANPFSYGSG  625

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTG-TSLDTSFKCPKKDssspsnlnypsLAIAG  461
             H  P+  ADPGLVYD++YTDYLLF+C  +G   LD+SFKCPKK S S SNLNYPSL+I+ 
Sbjct  626   HLDPTNVADPGLVYDASYTDYLLFLCGSSGLKGLDSSFKCPKK-SPSASNLNYPSLSISK  684

Query  460   LKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSV  281
             L G+M VKRTVTNVG   + Y V ++ PAG SVKI+P VL F  VGEK+SF+I+VKA   
Sbjct  685   LNGTMTVKRTVTNVGDGESVYLVTIRPPAGVSVKIAPRVLNFSRVGEKKSFTITVKAKKD  744

Query  280   KKVG------EFEFGWYKWSDGIHMVKSPIVVSSA  194
              +V       +F FG Y W+DGIH V+SP+ VS A
Sbjct  745   SQVDWRGTEEKFAFGSYTWTDGIHHVRSPMAVSLA  779



>emb|CDP14563.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   417 bits (1073),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 280/393 (71%), Gaps = 8/393 (2%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGSTN--FPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ++I+   +M   PLVYAGDVE+PG+T+    GFCL  TLS   V+GKVV C  G V +S 
Sbjct  359   QTITPFSQMRNQPLVYAGDVEVPGTTSSSTRGFCLNGTLSRSLVRGKVVICRFGGVDQSA  418

Query  1189  EVERAGGAAVILGNIGSEV-PVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKT  1013
             EV RAGG A +LG    ++  V   L+PG  I Y    +AI  Y +T++NP  TL PG T
Sbjct  419   EVGRAGGVAAVLGKPPIDIFQVAPLLLPGLTITYADVNNAI-SYTRTSRNPTVTLNPGTT  477

Query  1012  VFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYN  833
             V    P+P MA FTSLGP+ +EPNILKPDITAPGLNILAAWSEAS P  +P D+R VKYN
Sbjct  478   VVNVSPAPFMAVFTSLGPNGIEPNILKPDITAPGLNILAAWSEASPPTSSPYDNRIVKYN  537

Query  832   IISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPF  653
             I+SGTSMSCPHVSAV AL+KAIHP WS AAI+SAIMTTA T N  G  I DA G VA PF
Sbjct  538   IVSGTSMSCPHVSAVAALIKAIHPDWSSAAIRSAIMTTARTTNNVGNPITDARGNVANPF  597

Query  652   HYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsL  473
             HYG+GHFQPSKAADPGLVY++TY DYLLF+C      +     CP     SPSNLNYPSL
Sbjct  598   HYGSGHFQPSKAADPGLVYNATYNDYLLFLCYARSRLVS---NCPNV-VPSPSNLNYPSL  653

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
             AIA L   + V+R+VTNVG+ N+TY V+++ P G+SV I P+ L+F ++GE +SF+I+V+
Sbjct  654   AIANLNRPITVRRSVTNVGAANSTYQVKIEQPLGYSVNIFPSTLRFSQIGEIKSFNITVQ  713

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             A +  +   F FG + WSDG+H+V+SPI VSS+
Sbjct  714   ATNTAQRNVFTFGSFTWSDGVHLVRSPIAVSSS  746



>ref|XP_010272679.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=773

 Score =   416 bits (1070),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 230/391 (59%), Positives = 282/391 (72%), Gaps = 12/391 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
             + +PLVYAGD  +PG   N  G CLPD+LS EKVKGK+V CL G+   V +  EV+RAGG
Sbjct  385   KMYPLVYAGDAVVPGVPKNIVGQCLPDSLSSEKVKGKIVLCLRGNGTRVGKGLEVKRAGG  444

Query  1168  AAVILGNIG---SEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA+ILGN G   +E+ + S+L+PGT + +  +   IL YI + K P+A ++PGK+V  AK
Sbjct  445   AAIILGNSGLNGNELTMDSYLLPGTAVGF-DDAKRILDYINSTKKPMAKIVPGKSVLNAK  503

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP+ +EPNI+KPDITAPG+NILA WSE SSP     DHRSVKYN  SGT
Sbjct  504   PAPYMAGFSSTGPNVIEPNIIKPDITAPGVNILATWSEKSSPTKLLADHRSVKYNFDSGT  563

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHV+A  ALLKAIHP WS AAI+SAIMTTATT N  G+ + +A G  A PF+YG+G
Sbjct  564   SMSCPHVAATAALLKAIHPSWSSAAIRSAIMTTATTRNNMGKPLTNAAGTSANPFNYGSG  623

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTG-TSLDTSFKCPKKDssspsnlnypsLAIAG  461
             H  P+KAADPGLVYD++YTDYLLF+C  +G   LD +FKCPK  S S SNLNYPSLAI+ 
Sbjct  624   HLDPTKAADPGLVYDASYTDYLLFLCGSSGLKGLDPAFKCPKV-SPSASNLNYPSLAISK  682

Query  460   LKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA--G  287
             L G+M V RTVTNVG   + Y   +  P G SVKI P VL F  VGEK+SF+I+VKA   
Sbjct  683   LNGTMTVNRTVTNVGGGKSVYFASIIPPLGVSVKIYPRVLSFSRVGEKKSFTITVKAKDS  742

Query  286   SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
              V    E+ FGWY WSDGIH V+SP+ +S A
Sbjct  743   QVHIRDEYVFGWYIWSDGIHHVRSPMAISLA  773



>ref|XP_009407016.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score =   408 bits (1048),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 216/388 (56%), Positives = 274/388 (71%), Gaps = 11/388 (3%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVYA D  LPG+ +N  G CLP++L  +KV+GKVV CL GS   V +  EV+RAGGAA
Sbjct  365   YPLVYARDAVLPGTPSNISGQCLPNSLDGDKVRGKVVLCLRGSGSRVAKGLEVKRAGGAA  424

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +ILGN    G+E+PV + ++PGT +    +  AILKYI   + P A +   +TV    P+
Sbjct  425   IILGNAVANGNEIPVDAHVLPGTAV-SSDDAIAILKYIDATRRPRAKVGSARTVLSVTPA  483

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             PAMA F+S GP+ VEPNILKPDITAPGLNILAAWSE+SSP     DHR VKY++ SGTSM
Sbjct  484   PAMAAFSSRGPNRVEPNILKPDITAPGLNILAAWSESSSPTKLEDDHRRVKYDLSSGTSM  543

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVSAV AL+K++HP WS AAI+SA+MTTAT EN +GEA+ DA G VAGP  YG+GH 
Sbjct  544   SCPHVSAVAALIKSLHPDWSSAAIRSAMMTTATVENARGEALTDASGRVAGPMDYGSGHI  603

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKG  452
             +P+ A+DPGLVYD+ Y DYLLF C+  G  +D SF CP+      S+LNYPS+A++ L G
Sbjct  604   RPTHASDPGLVYDAGYEDYLLFACSSIGAQMDPSFPCPET-PPPTSDLNYPSIAVSNLNG  662

Query  451   SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSIS--VKAGSVK  278
             S+ V+RTVTNVG  +A Y V    P G SV ISP  L+F   GE++ FS++  V+    K
Sbjct  663   SVTVRRTVTNVGRGSARYRVTATEPTGVSVHISPQKLRFKRSGERRRFSVTLKVRGRRDK  722

Query  277   KVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
               G++  G Y WSDG H+V+SPIVVS A
Sbjct  723   PSGDYVAGSYTWSDGTHVVRSPIVVSLA  750



>ref|XP_010916217.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Elaeis 
guineensis]
Length=681

 Score =   400 bits (1028),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 215/396 (54%), Positives = 279/396 (70%), Gaps = 16/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST---EVE  1181
             +K  E++PLVYAGD  +P + +N  G CLP++LS  KV+GK+V CL GS  R+    EV+
Sbjct  291   LKGNESYPLVYAGDAVVPATPSNVSGQCLPNSLSARKVRGKIVLCLRGSGLRAAKGLEVK  350

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAI--LKYIKTNKNPVATLIPGK  1016
             RAGGAA+ILGN    G+E+PV   ++PG+ +   S  DAI  LKYI +   P AT+   +
Sbjct  351   RAGGAAIILGNAPANGNEIPVDCHVLPGSAV---SSDDAITILKYINSTGQPSATIGRAR  407

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             T    +P+P M  F+S GP+ VEPNILKPDITAPGLNILAAWSE+SSP     DHRSV Y
Sbjct  408   TTLDVRPAPVMTAFSSRGPNRVEPNILKPDITAPGLNILAAWSESSSPTKLEDDHRSVAY  467

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
             N++SGTSMSCPHVSA  +LLK++HPHWS AAI+SA+MTTAT  N +   I++A GEVAGP
Sbjct  468   NLLSGTSMSCPHVSATASLLKSMHPHWSSAAIRSAMMTTATVRNAQKGLIKNAAGEVAGP  527

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
               YG+GH +P+ A+DPGLVY+++Y DYLLF C+  G  +D +F CP+    S  +LNYPS
Sbjct  528   LEYGSGHLRPTHASDPGLVYEASYRDYLLFACSSIGVQMDPTFPCPES-PPSTFDLNYPS  586

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             ++++ L GS+ V RTVTNVG   A Y V +  P+G SVKISP +LKF E GE++SF I +
Sbjct  587   VSVSNLNGSITVHRTVTNVGQWKARYHVSIVEPSGVSVKISPKILKFKE-GEEKSFRIKL  645

Query  295   KAGSVK--KVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +    K  + GE+  G Y WSDG H V+SPIVVS A
Sbjct  646   QVDGSKGARSGEYVAGSYTWSDGTHDVRSPIVVSVA  681



>ref|NP_001044124.1| Os01g0727800 [Oryza sativa Japonica Group]
 dbj|BAF06038.1| Os01g0727800, partial [Oryza sativa Japonica Group]
Length=387

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 265/386 (69%), Gaps = 13/386 (3%)
 Frame = -3

Query  1327  PLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAV  1160
             PLVYA D  +PG+  N    CLP +L+PEKV+GK+V CL G+   V +  EV+ AGGAA+
Sbjct  1     PLVYAADAVVPGTPANVSNQCLPKSLAPEKVRGKIVVCLRGTGLRVEKGLEVKLAGGAAI  60

Query  1159  ILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             ILGN    G EVPV + ++PGT +    + +AI++YI ++ +P A L P +TV   KPSP
Sbjct  61    ILGNPPAFGGEVPVDAHVLPGTAVSS-VDVNAIIRYINSSSSPTAVLDPSRTVVDVKPSP  119

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              MA F+S GP+  EPNILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGTSMS
Sbjct  120   VMAQFSSRGPNVNEPNILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMS  179

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQ  629
             CPHVSA   LLK+ HP WS AAI+SAIMTTATT N +G  + DA G VAGP  YG+GH +
Sbjct  180   CPHVSATAVLLKSAHPGWSSAAIRSAIMTTATTSNAEGGPMMDADGTVAGPIDYGSGHIR  239

Query  628   PSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGS  449
             P  A DPGLVYD++Y DYLLF C   G  LD S  C       P  LN+PSLAI GL GS
Sbjct  240   PKHALDPGLVYDASYQDYLLFACASGGAQLDHSLPC-PATPPPPYQLNHPSLAIHGLNGS  298

Query  448   MVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA----GSV  281
             + V+RTVTNVG  +A YSV V  P G SVK+SP  L F   GEK+SF I ++A    G  
Sbjct  299   VTVQRTVTNVGQGSARYSVAVVEPMGVSVKVSPRSLSFARTGEKKSFRIKIEATKGRGGW  358

Query  280   KKVGEFEFGWYKWSDGIHMVKSPIVV  203
             +  G+F  G Y WSDG+H+V+SP+VV
Sbjct  359   RVNGQFVAGSYTWSDGVHVVRSPLVV  384



>ref|XP_010916207.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Elaeis 
guineensis]
Length=776

 Score =   402 bits (1032),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 215/396 (54%), Positives = 279/396 (70%), Gaps = 16/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST---EVE  1181
             +K  E++PLVYAGD  +P + +N  G CLP++LS  KV+GK+V CL GS  R+    EV+
Sbjct  386   LKGNESYPLVYAGDAVVPATPSNVSGQCLPNSLSARKVRGKIVLCLRGSGLRAAKGLEVK  445

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAI--LKYIKTNKNPVATLIPGK  1016
             RAGGAA+ILGN    G+E+PV   ++PG+ +   S  DAI  LKYI +   P AT+   +
Sbjct  446   RAGGAAIILGNAPANGNEIPVDCHVLPGSAV---SSDDAITILKYINSTGQPSATIGRAR  502

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             T    +P+P M  F+S GP+ VEPNILKPDITAPGLNILAAWSE+SSP     DHRSV Y
Sbjct  503   TTLDVRPAPVMTAFSSRGPNRVEPNILKPDITAPGLNILAAWSESSSPTKLEDDHRSVAY  562

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
             N++SGTSMSCPHVSA  +LLK++HPHWS AAI+SA+MTTAT  N +   I++A GEVAGP
Sbjct  563   NLLSGTSMSCPHVSATASLLKSMHPHWSSAAIRSAMMTTATVRNAQKGLIKNAAGEVAGP  622

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
               YG+GH +P+ A+DPGLVY+++Y DYLLF C+  G  +D +F CP+    S  +LNYPS
Sbjct  623   LEYGSGHLRPTHASDPGLVYEASYRDYLLFACSSIGVQMDPTFPCPES-PPSTFDLNYPS  681

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             ++++ L GS+ V RTVTNVG   A Y V +  P+G SVKISP +LKF E GE++SF I +
Sbjct  682   VSVSNLNGSITVHRTVTNVGQWKARYHVSIVEPSGVSVKISPKILKFKE-GEEKSFRIKL  740

Query  295   KAGSVK--KVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +    K  + GE+  G Y WSDG H V+SPIVVS A
Sbjct  741   QVDGSKGARSGEYVAGSYTWSDGTHDVRSPIVVSVA  776



>gb|EYU28148.1| hypothetical protein MIMGU_mgv1a026974mg [Erythranthe guttata]
Length=726

 Score =   399 bits (1024),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 222/385 (58%), Positives = 266/385 (69%), Gaps = 11/385 (3%)
 Frame = -3

Query  1333  TFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERAGGAAV  1160
             T+PLVYA DVE+PG+T  +  G CL  TLSP    GK VFC  G   ++ EV+RAGG AV
Sbjct  345   TYPLVYASDVEIPGTTTDDTSGLCLAGTLSPALTVGKAVFCWSGGTRQALEVQRAGGVAV  404

Query  1159  ILGNIGSEVPVGS--FLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG---AKP  995
             +LGN    V V S  FLIPGT I    +  ++ +Y +T+  P ATL P  T+ G   + P
Sbjct  405   VLGNNHDGVGVSSRPFLIPGTVILSDGKL-SVYEYTQTDLAPTATLTPAITLIGGTTSTP  463

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +P MAPFTS GP+ +EPNILKPDITAPG NILAAWSE SSPF  P D+R  K+NIISGTS
Sbjct  464   TPFMAPFTSRGPNVIEPNILKPDITAPGFNILAAWSEVSSPFGVPTDNRVAKFNIISGTS  523

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHV+ V ALLKA+HP WS AAI+SA+MTTAT  N  G+ I D  G  A P  +GAGH
Sbjct  524   MSCPHVAGVAALLKAVHPDWSSAAIRSALMTTATANNNLGKLITDVEGNYATPLQFGAGH  583

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLK  455
              QP+KAADPGLVYD++Y DYLLF+C+ TG  LD +F CP     SPSN NYPS+ I  L 
Sbjct  584   IQPAKAADPGLVYDASYEDYLLFLCSTTGNLLDPTFACPLI-LPSPSNFNYPSVTITKLT  642

Query  454   GSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKK  275
             G + V+RT+TNVG  NATY+V V  P GFSV ISP  L F   GEKQSFSI+V+A  +  
Sbjct  643   GVVTVQRTLTNVGVGNATYTVTVATPPGFSVTISPATLFFSATGEKQSFSITVQATEIAP  702

Query  274   VGEFEFGWYKWSDGIHMVKSPIVVS  200
             V    FGW+ WSD IH V SPI++S
Sbjct  703   VD--AFGWFYWSDEIHQVVSPILLS  725



>ref|XP_004969820.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=785

 Score =   393 bits (1009),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 214/390 (55%), Positives = 271/390 (69%), Gaps = 17/390 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +P+VYA D  +PG+  N    CLP++LS +KV+GK+V CL GS   V +  EV+RAGGAA
Sbjct  396   YPMVYAADAVVPGTPANVSNQCLPNSLSADKVRGKIVVCLRGSGLRVGKGLEVKRAGGAA  455

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++LGN    GSEVPV + ++PGT +   ++   IL YI ++ +P A L+P +TV   +PS
Sbjct  456   ILLGNPPASGSEVPVDAHILPGTAV-SAADAKTILGYINSSSSPTAVLVPSRTVVDVRPS  514

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ +EPNILKPDITAPGLNILAAWSEASSP     DHR V+YNI+SGTSM
Sbjct  515   PVMAQFSSRGPNVLEPNILKPDITAPGLNILAAWSEASSPTKLDGDHRVVQYNIMSGTSM  574

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVSA V LLKA HP WS AAI+SAIMTTATT N +G  I +  G V GP  YG+GH 
Sbjct  575   SCPHVSAAVLLLKAAHPDWSAAAIRSAIMTTATTNNAEGGPIMNGDGSVGGPMDYGSGHI  634

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKG  452
             +P+ A DPGLVYD++Y DYL F C   G+ LD S  C       P  LN+PS+A+ GL G
Sbjct  635   RPNHALDPGLVYDASYEDYLSFACASAGSQLDRSVPC-PARPPPPYQLNHPSVAVHGLNG  693

Query  451   SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA------  290
             ++ V+RTVTNVGS  A Y+V V  PAG SVK+SP  L+F   GEK+ F+I ++A      
Sbjct  694   TVTVRRTVTNVGSGEARYAVAVAEPAGVSVKVSPRRLRFARAGEKKVFTIRMEARATGTS  753

Query  289   -GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              G V + G+F  G Y WSDG+H+V+SPIVV
Sbjct  754   NGGVVR-GQFVAGSYAWSDGVHVVRSPIVV  782



>emb|CDM84099.1| unnamed protein product [Triticum aestivum]
Length=813

 Score =   393 bits (1009),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 215/388 (55%), Positives = 267/388 (69%), Gaps = 12/388 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
              T+P+VYA    +PG+  N    CLP++LSP+KV+GK+V CL GS   V +  EV+RAGG
Sbjct  425   RTYPMVYAAQAVVPGTPANVTNQCLPNSLSPQKVRGKIVVCLRGSGLRVGKGLEVKRAGG  484

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA++LGN    GSEVPV + ++PGT +   ++ + ILKYI ++ NP A L   +TV   K
Sbjct  485   AAIVLGNPPLYGSEVPVDAHVLPGTAVSM-ADVNTILKYINSSANPTAYLERSRTVVDVK  543

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             PSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNIISGT
Sbjct  544   PSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIISGT  603

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLK+ HP WS AAI+SAIMTTAT  N +   I +A G VAGP  YG+G
Sbjct  604   SMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANNAESGPIMNADGTVAGPMDYGSG  663

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             H +P  A DPGLVYD+++ DYLL+ C   G  LD SF CP      P  LNYPS+AI GL
Sbjct  664   HIRPRHALDPGLVYDASFQDYLLYACASGGAQLDRSFPCPAT-PPRPHELNYPSVAIHGL  722

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA---G  287
              GS  V+RTVTNVG   A YSV V  P GFSVK+SPT L F   GEK++F+I + A    
Sbjct  723   NGSATVRRTVTNVGEHGAHYSVAVVEPMGFSVKVSPTSLAFARAGEKKTFTIKIAATEKR  782

Query  286   SVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             S +   ++  G Y WSDG+H V+SP+VV
Sbjct  783   SRRPKRKYLAGSYTWSDGVHAVRSPVVV  810



>ref|XP_004232973.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=775

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 219/394 (56%), Positives = 273/394 (69%), Gaps = 13/394 (3%)
 Frame = -3

Query  1342  KMETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERA  1175
             K + +PLVYAG+V     T +  G CLP +LSPEK KGK+V CL G+   V +  EV+RA
Sbjct  384   KKKMYPLVYAGEVINTNVTKDLAGQCLPGSLSPEKAKGKIVMCLRGNGTRVGKGGEVKRA  443

Query  1174  GGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG   ILGN    G+E+   + L+P T + Y S    IL YI + K+PVA +IP KTV  
Sbjct  444   GGIGYILGNSKANGAELAADAHLLPATAVDYKSGVQ-ILNYISSTKSPVAYIIPAKTVLH  502

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
             AKP+P MA FTS GPS+V P+ILKPDITAPGLNILAAWS  SSP     D R V+YNI+S
Sbjct  503   AKPAPYMASFTSRGPSAVAPDILKPDITAPGLNILAAWSGGSSPTKLDIDKRVVEYNILS  562

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYG  644
             GTSMSCPHV    ALLKAIHP WS AAI+SA++T+A  +N  GE I DA G+ A PF +G
Sbjct  563   GTSMSCPHVGGAAALLKAIHPTWSSAAIRSALITSAELQNNVGEQITDASGKPADPFQFG  622

Query  643   AGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIA  464
              GHF+PSKAADPGLVYD++Y DYLLF+C      LD SFKCPKK S SP +LNYPSLAI 
Sbjct  623   GGHFRPSKAADPGLVYDASYQDYLLFLCASGVKHLDKSFKCPKK-SHSPRDLNYPSLAIP  681

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGS  284
              L G++  +R +TNVG+  + Y   VK P GFS++ISP +L F  VG K++F+I+VKA  
Sbjct  682   NLNGTVTARRRLTNVGAPKSVYFASVKPPLGFSIEISPPILSFNHVGSKKTFTITVKAHR  741

Query  283   --VKKV--GEFEFGWYKWSDGIHMVKSPIVVSSA  194
               + ++   ++ FGWY W+DGIH V+SPI V  A
Sbjct  742   DMMHRIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  775



>dbj|BAB21149.1| subtilisin-like proteinase-like [Oryza sativa Japonica Group]
 dbj|BAB90087.1| subtilisin-like proteinase-like [Oryza sativa Japonica Group]
Length=778

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 216/387 (56%), Positives = 266/387 (69%), Gaps = 13/387 (3%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVYA D  +PG+  N    CLP +L+PEKV+GK+V CL G+   V +  EV+ AGGAA
Sbjct  391   YPLVYAADAVVPGTPANVSNQCLPKSLAPEKVRGKIVVCLRGTGLRVEKGLEVKLAGGAA  450

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +ILGN    G EVPV + ++PGT +    + +AI++YI ++ +P A L P +TV   KPS
Sbjct  451   IILGNPPAFGGEVPVDAHVLPGTAV-SSVDVNAIIRYINSSSSPTAVLDPSRTVVDVKPS  509

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+  EPNILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGTSM
Sbjct  510   PVMAQFSSRGPNVNEPNILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSM  569

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVSA   LLK+ HP WS AAI+SAIMTTATT N +G  + DA G VAGP  YG+GH 
Sbjct  570   SCPHVSATAVLLKSAHPGWSSAAIRSAIMTTATTSNAEGGPMMDADGTVAGPIDYGSGHI  629

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKG  452
             +P  A DPGLVYD++Y DYLLF C   G  LD S  C       P  LN+PSLAI GL G
Sbjct  630   RPKHALDPGLVYDASYQDYLLFACASGGAQLDHSLPC-PATPPPPYQLNHPSLAIHGLNG  688

Query  451   SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA----GS  284
             S+ V+RTVTNVG  +A YSV V  P G SVK+SP  L F   GEK+SF I ++A    G 
Sbjct  689   SVTVQRTVTNVGQGSARYSVAVVEPMGVSVKVSPRSLSFARTGEKKSFRIKIEATKGRGG  748

Query  283   VKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              +  G+F  G Y WSDG+H+V+SP+VV
Sbjct  749   WRVNGQFVAGSYTWSDGVHVVRSPLVV  775



>gb|EEC71416.1| hypothetical protein OsI_03596 [Oryza sativa Indica Group]
Length=778

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/387 (56%), Positives = 267/387 (69%), Gaps = 13/387 (3%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVYA D  +PG+  N    CLP +L+PEKV+GK+V CL G+   V +  EV++AGGAA
Sbjct  391   YPLVYAADAVVPGTPANVSNQCLPKSLAPEKVRGKIVVCLRGTGLRVEKGLEVKQAGGAA  450

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +ILGN    G EVPV + ++PGT +    + ++I++YI ++ +P A L P +TV   KPS
Sbjct  451   IILGNPPAFGGEVPVDAHVLPGTAV-SSVDVNSIIRYINSSSSPTAVLDPSRTVVDVKPS  509

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+  EPNILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGTSM
Sbjct  510   PVMAQFSSRGPNVNEPNILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSM  569

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVSA   LLK+ HP WS AAI+SAIMTTATT N +G  + DA G VAGP  YG+GH 
Sbjct  570   SCPHVSATAVLLKSAHPGWSSAAIRSAIMTTATTSNAEGGPMMDADGTVAGPIDYGSGHI  629

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKG  452
             +P  A DPGLVYD++Y DYLLF C   G  LD S  C       P  LN+PSLAI GL G
Sbjct  630   RPKHALDPGLVYDASYQDYLLFACASGGAQLDHSLPC-PATPPPPYQLNHPSLAIHGLNG  688

Query  451   SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA----GS  284
             S+ V+RTVTNVG  +A YSV V  P G SVK+SP  L F   GEK+SF I ++A    G 
Sbjct  689   SVTVQRTVTNVGQGSARYSVAVVEPMGVSVKVSPRSLSFARTGEKKSFRIKIEATKGRGG  748

Query  283   VKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              +  G+F  G Y WSDG+H+V+SP+VV
Sbjct  749   WRVNGQFVAGSYTWSDGVHVVRSPLVV  775



>ref|XP_011096454.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=686

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 222/396 (56%), Positives = 279/396 (70%), Gaps = 20/396 (5%)
 Frame = -3

Query  1336  ETFPLVYAGDV---ELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERA  1175
             + +PLVYA  V   ++P   N  G CLP +LSPEK KGK+V CL G+   V +  EV+RA
Sbjct  296   KLYPLVYAAQVTNSDVP--NNISGQCLPGSLSPEKAKGKIVLCLRGNGTRVGKGMEVKRA  353

Query  1174  GGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG   ILGN    G E+   + L+P T + Y  +   IL YI++ K P A +   KTV G
Sbjct  354   GGIGFILGNSKANGDELAADAHLLPATAVNY-GDALKILNYIESAKAPKAHIERAKTVLG  412

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
             A+P+P MA F+S GP+++ P+ILKPDITAPGLNILAAWSEASSP    +DHR VKYNI+S
Sbjct  413   AQPAPFMAAFSSRGPNTISPDILKPDITAPGLNILAAWSEASSPTKMAEDHRVVKYNILS  472

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYG  644
             GTSMSCPHV+A  ALLKAIHP WS AAI+SA++T+A   N +   I DA G  A PF +G
Sbjct  473   GTSMSCPHVAAASALLKAIHPSWSSAAIRSALITSAGLNNNEHNLITDASGNSADPFQFG  532

Query  643   AGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIA  464
             +GHF+P+KAADPGLVYD++Y DYLLF+C+    SLD+SFKCP K+S SP NLNYPSLAI 
Sbjct  533   SGHFRPTKAADPGLVYDASYKDYLLFLCSSGSKSLDSSFKCP-KNSPSPVNLNYPSLAIP  591

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK---  293
              L GS+   RTVTNVG +N+ Y V VK P G SVK+SP +L F   G+K+SF+I+VK   
Sbjct  592   KLNGSVSAIRTVTNVGGSNSVYFVSVKPPPGISVKVSPPILFFNRAGQKKSFTITVKLDN  651

Query  292   ---AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                A S++K  ++ FGWY WSDGIH V+SP+ VS A
Sbjct  652   GITADSIEK-DKYAFGWYTWSDGIHNVRSPMAVSVA  686



>ref|XP_006355620.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=775

 Score =   386 bits (991),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 216/394 (55%), Positives = 272/394 (69%), Gaps = 13/394 (3%)
 Frame = -3

Query  1342  KMETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERA  1175
             K + +PLVYAG+V     T +  G CLP +LSPEK KGK+V CL G+   V +  EV+RA
Sbjct  384   KKKMYPLVYAGEVINTNVTKDLAGQCLPGSLSPEKAKGKIVMCLRGNGTRVGKGGEVKRA  443

Query  1174  GGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG   ILGN    G+E+   + L+P T + Y S    IL YI + K+PVA ++P KTV  
Sbjct  444   GGIGYILGNSKANGAELAADAHLLPATAVDYKSGVQ-ILNYISSTKSPVAYIVPAKTVLH  502

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
             AKP+P MA FTS GPS+V P+ILKPDITAPGLNILAAWS  SSP     D+R V+YNI+S
Sbjct  503   AKPAPYMASFTSRGPSAVAPDILKPDITAPGLNILAAWSGGSSPTKLDIDNRVVEYNILS  562

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYG  644
             GTSMSCPHV    ALLKAIHP WS AAI+SA++T+A  +N  GE I DA G+ A PF +G
Sbjct  563   GTSMSCPHVGGAAALLKAIHPTWSSAAIRSALITSAELQNNVGEQITDASGKPADPFQFG  622

Query  643   AGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIA  464
              GHF+PSKAADPGLVYD++Y DYLLF+C      LD SFKCPKK S SP +LNYPSLAI 
Sbjct  623   GGHFRPSKAADPGLVYDASYQDYLLFLCASGVKDLDKSFKCPKK-SHSPRDLNYPSLAIP  681

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGS  284
              L  ++  +R +TNVG+  + Y    K P GFS++ISP VL F  VG +++F+I+VKA  
Sbjct  682   NLNDTVTARRRLTNVGAPKSIYYASAKPPLGFSIEISPPVLAFNHVGSERTFTITVKAHR  741

Query  283   --VKKV--GEFEFGWYKWSDGIHMVKSPIVVSSA  194
               + ++   ++ FGWY W+DGIH V+SPI V  A
Sbjct  742   DMMHRIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  775



>ref|XP_002458431.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
 gb|EES03551.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
Length=785

 Score =   386 bits (991),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 215/388 (55%), Positives = 271/388 (70%), Gaps = 14/388 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVYA D  +PG+  N    CLP++LS +KV+GK+V CL G+   V +  EV+RAGGAA
Sbjct  397   YPLVYAADAVVPGTAANVSNQCLPNSLSSDKVRGKIVVCLRGAGLRVEKGLEVKRAGGAA  456

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++LGN    GSEVPV + ++PGT +   ++ + IL YIK++ +P A L P +TV   +PS
Sbjct  457   ILLGNPAASGSEVPVDAHVLPGTAVA-AADANTILSYIKSSSSPTAVLDPSRTVVDVRPS  515

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ +EP+ILKPDITAPGLNILAAWS+ASSP     DHR V+YNI+SGTSM
Sbjct  516   PVMAQFSSRGPNVLEPSILKPDITAPGLNILAAWSQASSPTKLDGDHRVVQYNIMSGTSM  575

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVSA   L+KA HP WS AAI+SAIMTTATT N +G  + +  G VAGP  YG+GH 
Sbjct  576   SCPHVSAAAVLVKAAHPDWSSAAIRSAIMTTATTNNAEGGPLMNGDGSVAGPMDYGSGHI  635

Query  631   QPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             +P  A DPGLVYD++Y DYLLF C    +G+ LD SF C       P  LN+PS+A+ GL
Sbjct  636   RPKHALDPGLVYDASYQDYLLFACASAGSGSQLDPSFPC-PARPPPPYQLNHPSVAVHGL  694

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV--KAGS  284
              GS+ V RTVTNVGS  A Y+V V  PAG SVK+SP  L F   GEK++F I++  KAGS
Sbjct  695   NGSVTVHRTVTNVGSGEARYTVAVVEPAGVSVKVSPKRLSFARTGEKKAFRITMEAKAGS  754

Query  283   VKKVGEFEFGWYKWSD-GIHMVKSPIVV  203
                 G+F  G Y WSD G H+V+SPIVV
Sbjct  755   SVVRGQFVAGSYAWSDGGAHVVRSPIVV  782



>ref|XP_010232258.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brachypodium 
distachyon]
Length=691

 Score =   383 bits (983),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 215/392 (55%), Positives = 263/392 (67%), Gaps = 12/392 (3%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVE  1181
             ++    +P+VYA    +PG+  N    CLP++L+ EKV+GK+V CL G+   V +  EV+
Sbjct  299   LQGNRAYPMVYAAHAVVPGTPANVSDQCLPNSLAAEKVRGKIVVCLRGAGLRVAKGLEVK  358

Query  1180  RAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGGAAV+LGN    GSEVPV + ++PGT +   +  + ILKYI +   P A L    TV
Sbjct  359   RAGGAAVVLGNPPMYGSEVPVDAHVLPGTAVSM-ANVNTILKYINSTAKPTAYLDSSTTV  417

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                KPSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNI
Sbjct  418   LDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNI  477

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
             +SGTSMSCPHVSA   LLK+ HP WS AAI+SAIMTTATT N +G  I +A G VAGP  
Sbjct  478   MSGTSMSCPHVSAAAVLLKSAHPDWSPAAIRSAIMTTATTHNAEGSPIMNADGTVAGPMD  537

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GH +P  A  PGLVYD++Y DYLLF C   G  LD SF+CPKK    P  LNYPSLA
Sbjct  538   YGSGHIRPKHALGPGLVYDASYQDYLLFACASGGAQLDHSFRCPKK-PPRPYELNYPSLA  596

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             + GL GS+ V RTVTNVG   A Y V V  P G SVK+SP  L F   GEK++F I + A
Sbjct  597   VHGLNGSITVHRTVTNVGQHEAHYRVAVVEPKGVSVKVSPKRLSFSSKGEKKAFVIKIVA  656

Query  289   ---GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                 S +   ++  G Y WSDGIH V+SPIVV
Sbjct  657   RGRRSARVNRKYLAGSYTWSDGIHAVRSPIVV  688



>gb|EYU28147.1| hypothetical protein MIMGU_mgv1a018442mg [Erythranthe guttata]
Length=773

 Score =   385 bits (989),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 263/385 (68%), Gaps = 11/385 (3%)
 Frame = -3

Query  1333  TFPLVYAGDVELPGST--NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERAGGAAV  1160
             T+PLVYA DVE+PG+T  +  G C   TLSP    GK VFC  G   ++ EV+RAGG AV
Sbjct  392   TYPLVYASDVEIPGTTTSDTSGRCFAGTLSPALTVGKAVFCWSGDTTQALEVQRAGGVAV  451

Query  1159  ILGNIGSEVPV--GSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK---P  995
             +LGN  + V V    +LIPGT I    +  ++ +Y + +  P ATL P  T+ G     P
Sbjct  452   VLGNRYNGVGVVGRPYLIPGTVILSGGKW-SVYRYTQNDLAPTATLTPAITLIGGNTSSP  510

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +P MA FTS GP+ +EPNILKPDITAPGLNILAAWSEA+SP   P D+R VK+ I SGTS
Sbjct  511   TPFMAAFTSRGPNVIEPNILKPDITAPGLNILAAWSEAASPLRVPSDNRVVKFQIDSGTS  570

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             M+CPHV+ V AL+KA+HP WS AAI+SA+MTTAT  N  G+ I D  G  A P  YGAGH
Sbjct  571   MACPHVAGVAALIKAVHPDWSSAAIRSALMTTATANNNLGKLITDVVGNFATPLQYGAGH  630

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLK  455
              QP+KAADPGLVYD++Y DYLLF+C+ TG  LD +F CP     SPSN NYPS+ I  L 
Sbjct  631   IQPAKAADPGLVYDASYEDYLLFLCSTTGNLLDPTFVCPLI-LPSPSNFNYPSVTITKLT  689

Query  454   GSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKK  275
             G + V+RT+TNVG  NATY+V V  P GFSV ISP  L F   GEKQSFSI+V+A  +  
Sbjct  690   GVVTVQRTLTNVGVGNATYTVTVATPPGFSVTISPATLFFSATGEKQSFSITVQAMVIAP  749

Query  274   VGEFEFGWYKWSDGIHMVKSPIVVS  200
             V    FGW+ WSDGIH V SPI++S
Sbjct  750   VD--AFGWFYWSDGIHQVISPILLS  772



>ref|XP_011102178.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=787

 Score =   385 bits (988),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 222/394 (56%), Positives = 278/394 (71%), Gaps = 20/394 (5%)
 Frame = -3

Query  1330  FPLVYAGDV---ELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
             +PLVYA  V   ++P   N  G CLP +LSPEK KGK+V CL G+   V +  EV+RAGG
Sbjct  399   YPLVYAAQVTNSDVP--NNISGQCLPGSLSPEKAKGKIVLCLRGNGTRVGKGMEVKRAGG  456

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
                ILGN    G E+   + L+P T + Y  +   IL YI++ K P A +   KTV GA+
Sbjct  457   IGFILGNSKANGDELAADAHLLPATAVNY-GDALKILNYIESAKAPKAHIERAKTVLGAQ  515

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP+++ P+ILKPDITAPGLNILAAWSEASSP    +DHR VKYNI+SGT
Sbjct  516   PAPFMAAFSSRGPNTISPDILKPDITAPGLNILAAWSEASSPTKMAEDHRVVKYNILSGT  575

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHV+A  ALLKAIHP WS AAI+SA++T+A   N +   I DA G  A PF +G+G
Sbjct  576   SMSCPHVAAASALLKAIHPSWSSAAIRSALITSAGLNNNEHNLITDASGNSADPFQFGSG  635

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             HF+P+KAADPGLVYD++Y DYLLF+C+    SLD+SFKCP K+S SP NLNYPSLAI  L
Sbjct  636   HFRPTKAADPGLVYDASYKDYLLFLCSSGSKSLDSSFKCP-KNSPSPVNLNYPSLAIPKL  694

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK-----  293
              GS+   RTVTNVG +N+ Y V VK P G SVK+SP +L F   G+K+SF+I+VK     
Sbjct  695   NGSVSAIRTVTNVGGSNSVYFVSVKPPPGISVKVSPPILFFNRAGQKKSFTITVKLDNGI  754

Query  292   -AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
              A S++K  ++ FGWY WSDGIH V+SP+ VS A
Sbjct  755   TADSIEK-DKYAFGWYTWSDGIHNVRSPMAVSVA  787



>gb|EYU28149.1| hypothetical protein MIMGU_mgv1a018291mg [Erythranthe guttata]
Length=721

 Score =   383 bits (983),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/376 (56%), Positives = 262/376 (70%), Gaps = 11/376 (3%)
 Frame = -3

Query  1333  TFPLVYAGDVELPGSTNFPGF--CLPDTLSPEKVKGKVVFCLVGSVYRSTEVERAGGAAV  1160
             T+PLVYA +VE+PG+T       C   TLSPE V GK VFC  G  +++ EV+RAGG A 
Sbjct  340   TYPLVYAANVEIPGTTTNLTTGLCRNGTLSPELVVGKAVFCWTGDTFQALEVQRAGGVAA  399

Query  1159  ILGNI--GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGA---KP  995
             +LGN+  G  V    +LIPGT +    E   I  Y +T+  P  TL P  T+ G     P
Sbjct  400   VLGNLYPGVGVIGRPYLIPGT-VVLSDERMKIYNYTQTDPTPTVTLTPATTLIGGTTNSP  458

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +P MAPF+S GP+++EPNILKPDITAPGLNILAAWSEA+ P   P D+R  KY + SGTS
Sbjct  459   TPFMAPFSSRGPNAIEPNILKPDITAPGLNILAAWSEAAPPLVIPSDNRVTKYQLASGTS  518

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHV+ V AL+KAIHP WS AAI+SA+MTTA   N  G  + DA G +A PF YG GH
Sbjct  519   MSCPHVAGVAALIKAIHPDWSSAAIRSALMTTANPNNNLGNIMTDAVGNIATPFQYGGGH  578

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLK  455
              QPSKAADPGLVY+++Y+DYLLF+C+  G  LDT+F CP     SPSNLNYPSLAIA L 
Sbjct  579   IQPSKAADPGLVYNASYSDYLLFLCSSIGNVLDTTFNCPTT-LPSPSNLNYPSLAIANLN  637

Query  454   GSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKK  275
             G + V+RTVTNVG+ NATY+V++  P G++V ISP  L F   GEKQ+F+I+V+A +V+ 
Sbjct  638   GVLTVERTVTNVGAGNATYTVQIVNPQGYTVGISPPTLFFNATGEKQTFNITVQA-TVRP  696

Query  274   VGEFEFGWYKWSDGIH  227
              G   FGWY WSDGIH
Sbjct  697   CGN-AFGWYVWSDGIH  711



>ref|XP_003569718.2| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brachypodium 
distachyon]
Length=786

 Score =   384 bits (985),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 215/392 (55%), Positives = 263/392 (67%), Gaps = 12/392 (3%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVE  1181
             ++    +P+VYA    +PG+  N    CLP++L+ EKV+GK+V CL G+   V +  EV+
Sbjct  394   LQGNRAYPMVYAAHAVVPGTPANVSDQCLPNSLAAEKVRGKIVVCLRGAGLRVAKGLEVK  453

Query  1180  RAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGGAAV+LGN    GSEVPV + ++PGT +   +  + ILKYI +   P A L    TV
Sbjct  454   RAGGAAVVLGNPPMYGSEVPVDAHVLPGTAVSM-ANVNTILKYINSTAKPTAYLDSSTTV  512

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                KPSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNI
Sbjct  513   LDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNI  572

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
             +SGTSMSCPHVSA   LLK+ HP WS AAI+SAIMTTATT N +G  I +A G VAGP  
Sbjct  573   MSGTSMSCPHVSAAAVLLKSAHPDWSPAAIRSAIMTTATTHNAEGSPIMNADGTVAGPMD  632

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GH +P  A  PGLVYD++Y DYLLF C   G  LD SF+CPKK    P  LNYPSLA
Sbjct  633   YGSGHIRPKHALGPGLVYDASYQDYLLFACASGGAQLDHSFRCPKK-PPRPYELNYPSLA  691

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             + GL GS+ V RTVTNVG   A Y V V  P G SVK+SP  L F   GEK++F I + A
Sbjct  692   VHGLNGSITVHRTVTNVGQHEAHYRVAVVEPKGVSVKVSPKRLSFSSKGEKKAFVIKIVA  751

Query  289   ---GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                 S +   ++  G Y WSDGIH V+SPIVV
Sbjct  752   RGRRSARVNRKYLAGSYTWSDGIHAVRSPIVV  783



>emb|CBI30770.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   382 bits (981),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 220/405 (54%), Positives = 280/405 (69%), Gaps = 17/405 (4%)
 Frame = -3

Query  1363  ESISAIK-KMETFPLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVG----S  1205
             ES++  K K + +PLV+A DV +PG    N    C   +L P+KVKGK+V CL G     
Sbjct  338   ESVTPYKLKKKMYPLVFAADVVVPGVPKNNTAANCNFGSLDPKKVKGKLVLCLRGGIALR  397

Query  1204  VYRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVA  1034
             + +  EV+RAGG   ILGN    G ++P    L+P T +    +   I  YIK+ K P+A
Sbjct  398   IEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAV-SSEDVTKIRNYIKSTKKPMA  456

Query  1033  TLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQD  854
             T+IPG+TV  AKP+P MA FTS GP++++PNILKPDIT PGLNILAAWSE SSP  +  D
Sbjct  457   TIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDITGPGLNILAAWSEGSSPTRSELD  516

Query  853   HRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAY  674
              R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MTTA   N  G+ I D+ 
Sbjct  517   PRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMTTAGLVNNIGKPITDSS  576

Query  673   GEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDsssps  494
             G  A PF YG+GHF+P+KAADPGLVYD+TYTDYLL++C +   SLD+SF CPK    S +
Sbjct  577   GNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVKSLDSSFNCPKVS-PSSN  635

Query  493   nlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
             NLNYPSL I+ LK  + + RTVTNVGS  + Y   VK+P GFSV++ P++L F  VG+K+
Sbjct  636   NLNYPSLQISKLKRKVTITRTVTNVGSARSIYFSSVKSPVGFSVRVEPSILYFNHVGQKK  695

Query  313   SFSISVKAGSVK-----KVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             SF I+V+A + K        E+ FGWY W+DGIH V+SP+ VS A
Sbjct  696   SFCITVEARNPKASKKNDAEEYAFGWYTWNDGIHNVRSPMAVSLA  740



>dbj|BAJ86327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   377 bits (967),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 259/378 (69%), Gaps = 12/378 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
              T+P+VYA    +PG+  N    CLP++LSP+KV+GK+V CL GS   V +  EV+RAGG
Sbjct  202   RTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGG  261

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA++LGN    GSEVPV + ++PGT +   ++ + ILKYI ++ NP A L   +TV   K
Sbjct  262   AAIVLGNPPMYGSEVPVDAHVLPGTAVSM-ADVNTILKYINSSANPTAYLERSRTVVDVK  320

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             PSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGT
Sbjct  321   PSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGT  380

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLK+ HP WS AAI+SAIMTTAT  N +G  I +  G VAGP  YG+G
Sbjct  381   SMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSG  440

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             H +P  A DPGLVYD+++ DYL+F C   G  LD SF CP   +  P  LNYPS+AI GL
Sbjct  441   HIRPRHALDPGLVYDASFQDYLIFACASGGAQLDHSFPCPAS-TPRPYELNYPSVAIHGL  499

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
               S  V+RTVTNVG   A Y+V V  PAGFSVK+SPT L F   GEK++F+I ++A   +
Sbjct  500   NRSATVRRTVTNVGQHEARYTVAVVEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKR  559

Query  277   KV---GEFEFGWYKWSDG  233
                   ++  G Y WSDG
Sbjct  560   GRRLDRKYPAGSYTWSDG  577



>dbj|BAJ94880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 259/378 (69%), Gaps = 12/378 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
              T+P+VYA    +PG+  N    CLP++LSP+KV+GK+V CL GS   V +  EV+RAGG
Sbjct  202   RTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGG  261

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA++LGN    GSEVPV + ++PGT +   ++ + ILKYI ++ NP A L   +TV   K
Sbjct  262   AAIVLGNPPMYGSEVPVDAHVLPGTAVSM-ADVNTILKYINSSANPTAYLERSRTVVDVK  320

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             PSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGT
Sbjct  321   PSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGT  380

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLK+ HP WS AAI+SAIMTTAT  N +G  I +  G VAGP  YG+G
Sbjct  381   SMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSG  440

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             H +P  A DPGLVYD+++ DYL+F C   G  LD SF CP   +  P  LNYPS+AI GL
Sbjct  441   HIRPRHALDPGLVYDASFQDYLIFACASGGAQLDHSFPCPAS-TPRPYELNYPSVAIHGL  499

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
               S  V+RTVTNVG   A Y+V V  PAGFSVK+SPT L F   GEK++F+I ++A   +
Sbjct  500   NRSATVRRTVTNVGQHEARYTVAVVEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKR  559

Query  277   KV---GEFEFGWYKWSDG  233
                   ++  G Y WSDG
Sbjct  560   GRRLDRKYPAGSYTWSDG  577



>ref|XP_002269375.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=778

 Score =   382 bits (981),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 281/405 (69%), Gaps = 17/405 (4%)
 Frame = -3

Query  1363  ESISAIK-KMETFPLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVG----S  1205
             ES++  K K + +PLV+A DV +PG    N    C   +L P+KVKGK+V CL G     
Sbjct  376   ESVTPYKLKKKMYPLVFAADVVVPGVPKNNTAANCNFGSLDPKKVKGKLVLCLRGGIALR  435

Query  1204  VYRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVA  1034
             + +  EV+RAGG   ILGN    G ++P    L+P T +    +   I  YIK+ K P+A
Sbjct  436   IEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAV-SSEDVTKIRNYIKSTKKPMA  494

Query  1033  TLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQD  854
             T+IPG+TV  AKP+P MA FTS GP++++PNILKPDIT PGLNILAAWSE SSP  +  D
Sbjct  495   TIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDITGPGLNILAAWSEGSSPTRSELD  554

Query  853   HRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAY  674
              R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MTTA   N  G+ I D+ 
Sbjct  555   PRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMTTAGLVNNIGKPITDSS  614

Query  673   GEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDsssps  494
             G  A PF YG+GHF+P+KAADPGLVYD+TYTDYLL++C +   SLD+SF CPK  S S +
Sbjct  615   GNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVKSLDSSFNCPKV-SPSSN  673

Query  493   nlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
             NLNYPSL I+ LK  + + RTVTNVGS  + Y   VK+P GFSV++ P++L F  VG+K+
Sbjct  674   NLNYPSLQISKLKRKVTITRTVTNVGSARSIYFSSVKSPVGFSVRVEPSILYFNHVGQKK  733

Query  313   SFSISVKAGSVK-----KVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             SF I+V+A + K        E+ FGWY W+DGIH V+SP+ VS A
Sbjct  734   SFCITVEARNPKASKKNDAEEYAFGWYTWNDGIHNVRSPMAVSLA  778



>ref|XP_009604273.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=775

 Score =   382 bits (980),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 221/395 (56%), Positives = 269/395 (68%), Gaps = 15/395 (4%)
 Frame = -3

Query  1345  KKMETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVER  1178
             KKM  +PLVYAG V     T +  G CLP +LSP+K KGK+V CL G+   V +  EV+R
Sbjct  385   KKM--YPLVYAGQVINSNVTKDVAGQCLPGSLSPKKAKGKIVICLRGNGTRVGKGGEVKR  442

Query  1177  AGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVF  1007
             AGG   ILGN    G+E+      +P T + Y S    IL YI + K+PVA ++P KTV 
Sbjct  443   AGGIGYILGNNKANGAELVADPHFLPATAVDYKSAMQ-ILNYINSTKSPVAYIVPAKTVL  501

Query  1006  GAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNII  827
              +KP+P MA FTS GPS+V P+ILKPDITAPGLNILAAWS  SSP     D R V+YNII
Sbjct  502   HSKPAPYMASFTSRGPSAVAPDILKPDITAPGLNILAAWSGGSSPTKLDIDDRVVEYNII  561

Query  826   SGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHY  647
             SGTSMSCPHV    ALLKAIHP WS AAI+SA++T+A   N  GE I DA G+ A PF +
Sbjct  562   SGTSMSCPHVGGAAALLKAIHPTWSSAAIRSALITSAGLRNNVGEQITDASGKPADPFQF  621

Query  646   GAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAI  467
             G GHF+PSKAADPGLVYD++Y DYLLF+C      LD SFKCPKK S  P+NLNYPSLAI
Sbjct  622   GGGHFRPSKAADPGLVYDASYQDYLLFLCASGIKDLDKSFKCPKK-SHLPNNLNYPSLAI  680

Query  466   AGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAG  287
               L G++ V R +TNVG+  + Y    K P GFSV+ISP VL F  VG K++F+I+VKA 
Sbjct  681   PNLNGTVTVSRRLTNVGAPKSVYFASAKPPLGFSVEISPPVLSFKHVGSKRTFTITVKAR  740

Query  286   S--VKKV--GEFEFGWYKWSDGIHMVKSPIVVSSA  194
             S  +  +   ++ FGWY W+DGIH V+SPI V  A
Sbjct  741   SDMIDSIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  775



>ref|XP_010529231.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=783

 Score =   380 bits (977),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 214/406 (53%), Positives = 279/406 (69%), Gaps = 19/406 (5%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VY  1199
             ESI++ K     PLVYA DV +PG  + N    CLP++LSPE VKGKVV C+ G+   V 
Sbjct  381   ESITSYKMDNFAPLVYAADVVIPGVVAANDTSQCLPNSLSPELVKGKVVMCMRGTGSRVG  440

Query  1198  RSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             +S EV+RAGGA +ILGN    G ++PV +  IP   +  PS  D IL YIKT+KNPVA +
Sbjct  441   KSLEVKRAGGAGLILGNSPANGDDIPVDAHFIPAAGVI-PSVVDKILHYIKTDKNPVAFI  499

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
              PGKTV+ +KP+P +  F+S GP+ ++PNILKPDI+APGLNILAAWS A SP     D R
Sbjct  500   KPGKTVYRSKPAPFVTGFSSRGPNVIDPNILKPDISAPGLNILAAWSGADSPTKISADRR  559

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
             +V++N+ SGTSMSCPHVS  +AL+KAIHP WS AAI+SAIMTTA   N + + I+D  G 
Sbjct  560   TVEFNLFSGTSMSCPHVSGAIALIKAIHPSWSSAAIRSAIMTTAWMTNDEKKPIQDINGL  619

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnl  488
              A PF  G+GHF+P+KAADPGLVYD++Y +YLL+ C+V+ T +D  FKCPKK      NL
Sbjct  620   PANPFAIGSGHFRPTKAADPGLVYDASYKEYLLYCCSVSLTDVDPEFKCPKK-PPPGYNL  678

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
             NYPS++I  L  ++ ++R VTNVGS+N  +TY    K P G SV   P +L F   G+K+
Sbjct  679   NYPSISIPNLNRTVKIQRRVTNVGSSNGTSTYFFSAKPPLGVSVTAKPNILTFSRAGQKK  738

Query  313   SFSISVK------AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
              F+I+VK       G V+K G++ FG Y W+D  H+V+SPI VS A
Sbjct  739   RFTITVKPRTEQLRGKVQK-GQYIFGRYTWTDSYHVVRSPIAVSLA  783



>emb|CBI30775.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   379 bits (973),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 216/396 (55%), Positives = 272/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1342  KMETFPLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVG----SVYRSTEVE  1181
             K + +PLV+A D  +PG    N    C   +L P+KVKGK+V CL G     + +  EV+
Sbjct  331   KKKMYPLVFAADAVVPGVPKNNTAANCNFGSLDPKKVKGKIVLCLRGGMTLRIEKGIEVK  390

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG   ILGN    G ++P    L+P T +    +   I  YIK+ K P+AT+IPG+TV
Sbjct  391   RAGGVGFILGNTPENGFDLPADPHLLPATAV-SSEDVTKIRNYIKSTKKPMATIIPGRTV  449

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
               AKP+P MA F S GP++++PNILKPDIT PGLNILAAWSE SSP  +  D R VKYNI
Sbjct  450   LHAKPAPFMASFISRGPNTIDPNILKPDITGPGLNILAAWSEGSSPTRSELDPRVVKYNI  509

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MTTA   N  G+ I D+ G    PF 
Sbjct  510   FSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMTTAGLVNNIGKPITDSSGNPTNPFQ  569

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+P+KAADPGLVYD+TYTDYLL++C +   SLD+SFKCPK    S +NLNYPSL 
Sbjct  570   YGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVKSLDSSFKCPKVS-PSSNNLNYPSLQ  628

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I+ LK  + V RT TNVGS  + Y   VK+P GFSV++ P++L F  VG+K+SF I+V+A
Sbjct  629   ISKLKRKVTVTRTATNVGSARSIYFSSVKSPVGFSVRVEPSILYFNHVGQKKSFDITVEA  688

Query  289   ----GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                  S K   E+ FGWY W+DGIH V+SP+ VS A
Sbjct  689   RNPKASKKNDTEYAFGWYTWNDGIHNVRSPMAVSLA  724



>ref|XP_009803454.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=776

 Score =   379 bits (973),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 220/396 (56%), Positives = 267/396 (67%), Gaps = 17/396 (4%)
 Frame = -3

Query  1345  KKMETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVER  1178
             KKM  +PLVYAG V     T +  G CLP +L P+K KGK+V CL G+   V +  EV+R
Sbjct  386   KKM--YPLVYAGQVINSNVTKDVAGQCLPGSLLPKKAKGKIVICLRGNGTRVGKGGEVKR  443

Query  1177  AGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVF  1007
             AGG   ILGN    G+E+      +P T + Y S    IL YI + K+PVA ++P KTV 
Sbjct  444   AGGIGYILGNNKANGAELVADPHFLPATAVDYKSAVQ-ILNYINSTKSPVAYIVPAKTVL  502

Query  1006  GAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNII  827
              +KP+P MA FTS GPS+V P+ILKPDITAPGLNILAAWS  SSP     D R V+YNII
Sbjct  503   HSKPAPYMASFTSRGPSAVAPHILKPDITAPGLNILAAWSGGSSPTKLDIDDRVVEYNII  562

Query  826   SGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHY  647
             SGTSMSCPHV    ALLKAIHP WS AAI+SA++T+A   N  GE I DA G+ A PF +
Sbjct  563   SGTSMSCPHVGGAAALLKAIHPTWSSAAIRSALITSAGLRNNVGEQITDASGKPADPFQF  622

Query  646   GAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAI  467
             G GHF+PSKAADPGLVYD++Y DYLLF+C      LD SFKCPKK S  P++LNYPSLAI
Sbjct  623   GGGHFRPSKAADPGLVYDASYQDYLLFLCASGIKDLDKSFKCPKK-SHLPNSLNYPSLAI  681

Query  466   AGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA-  290
               L G++ V R +TNVG   + Y    K P GFSV+ISP VL F  VG K++F+I+VKA 
Sbjct  682   PNLNGTVTVSRRLTNVGGPKSVYFASAKPPLGFSVEISPPVLSFKRVGSKRTFTITVKAR  741

Query  289   ----GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                  S+ K  ++ FGWY W+DGIH V+SPI V  A
Sbjct  742   SDMSDSIPK-DQYVFGWYSWNDGIHNVRSPIAVKLA  776



>ref|XP_009351978.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score =   379 bits (973),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 214/400 (54%), Positives = 273/400 (68%), Gaps = 15/400 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +++ + +PLVYA DV   G   +  G CLP +LSPEKVKGK+V C+ GS   V +  E
Sbjct  384   SKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGKIVLCMRGSGMRVVKGME  443

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGN    G E+   + +IP T++ Y  + + IL+YI + K P AT+IP +
Sbjct  444   VKRAGGVGFILGNSAENGVEIACDAHVIPATSVLY-KDANRILQYINSTKIPTATIIPAR  502

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ-DHRSVK  839
             TV   KP+P MA FTS GP+ ++PN LKPDITAPGLNILAAW+EA  P      D R V+
Sbjct  503   TVLNRKPAPFMAAFTSRGPNIIDPNFLKPDITAPGLNILAAWTEADPPTKLSGIDRRVVQ  562

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNI SGTSMSCPHV+A  AL+KAIHP WSGAAI+SAIMTTA   N  G  + D  G VA 
Sbjct  563   YNIYSGTSMSCPHVAAAAALVKAIHPTWSGAAIRSAIMTTAGIRNNLGLPLNDESGSVAT  622

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGT-SLDTSFKCPKKDssspsnlny  482
             PF YGAGHF+P+KAADPGLVYD++Y DYL +IC++ G    D +FKCP     +  NLNY
Sbjct  623   PFAYGAGHFRPTKAADPGLVYDASYKDYLQYICSIGGAKDFDPTFKCPTS-PPAAINLNY  681

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+AI  LK +M++KRTVTNVG++ + Y    K P G SVK SP++L F  VG+K+SF+I
Sbjct  682   PSIAIPKLKDAMIIKRTVTNVGNSKSIYFFTAKPPLGISVKASPSILFFDNVGQKKSFTI  741

Query  301   SVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +VKA     S     E+ FGWY W+DG++ V+S I VS A
Sbjct  742   TVKARREVLSKHSKDEYVFGWYTWTDGLYTVRSAIAVSLA  781



>gb|EYU28144.1| hypothetical protein MIMGU_mgv1a001682mg [Erythranthe guttata]
Length=773

 Score =   379 bits (973),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 215/393 (55%), Positives = 268/393 (68%), Gaps = 12/393 (3%)
 Frame = -3

Query  1342  KMET--FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVE  1181
             K+E   +PLVYAG V  P    N  G CLP +LSP K KGK+V CL G+   V +  EV+
Sbjct  383   KLENRLYPLVYAGQVINPDVQKNLSGQCLPGSLSPSKAKGKIVLCLRGNGTRVGKGMEVK  442

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG   ILGN    G E+   + L+P T + + +  + ILKYI + + P A + P KTV
Sbjct  443   RAGGIGFILGNSEANGDELAADAHLLPATAVNHVNALE-ILKYINSTRAPKAYIEPAKTV  501

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                KP+P MA F+S GPS+V P+ILKPDITAPG+NILAAWSEASSP     D+R VKYNI
Sbjct  502   LDTKPAPFMAAFSSRGPSTVSPDILKPDITAPGINILAAWSEASSPTKLAADNRIVKYNI  561

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
             +SGTSMSCPH+    AL+KAIHP WS AAI+SA++T+A   N +G  I DA G  A PF 
Sbjct  562   LSGTSMSCPHIGGASALIKAIHPTWSSAAIRSALVTSAGLTNNEGNPISDASGNPADPFQ  621

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +G+GHF+P+KAADPGLVYD++Y DYLLF+C     +LD+SFKCPKK S S  +LNYPSLA
Sbjct  622   FGSGHFRPTKAADPGLVYDASYKDYLLFLCGNGIKNLDSSFKCPKK-SPSMGDLNYPSLA  680

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK-  293
             I  L G+    RTVTNVG   + Y V VK P G SVKISP ++ F   G+K+SF+I+VK 
Sbjct  681   IPKLNGTYTTVRTVTNVGGGKSVYFVSVKPPPGISVKISPPIIYFSRAGQKRSFTITVKI  740

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
               S  +  ++ FGWY W DGIH V+SPI VS A
Sbjct  741   ETSTVEKDKYVFGWYTWFDGIHNVRSPIAVSVA  773



>ref|XP_002269555.2| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=777

 Score =   379 bits (973),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 273/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1342  KMETFPLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVG----SVYRSTEVE  1181
             K + +PLV+A D  +PG    N    C   +L P+KVKGK+V CL G     + +  EV+
Sbjct  384   KKKMYPLVFAADAVVPGVPKNNTAANCNFGSLDPKKVKGKIVLCLRGGMTLRIEKGIEVK  443

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG   ILGN    G ++P    L+P T +    +   I  YIK+ K P+AT+IPG+TV
Sbjct  444   RAGGVGFILGNTPENGFDLPADPHLLPATAV-SSEDVTKIRNYIKSTKKPMATIIPGRTV  502

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
               AKP+P MA F S GP++++PNILKPDIT PGLNILAAWSE SSP  +  D R VKYNI
Sbjct  503   LHAKPAPFMASFISRGPNTIDPNILKPDITGPGLNILAAWSEGSSPTRSELDPRVVKYNI  562

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MTTA   N  G+ I D+ G    PF 
Sbjct  563   FSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMTTAGLVNNIGKPITDSSGNPTNPFQ  622

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+P+KAADPGLVYD+TYTDYLL++C +   SLD+SFKCPK  S S +NLNYPSL 
Sbjct  623   YGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVKSLDSSFKCPKV-SPSSNNLNYPSLQ  681

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I+ LK  + V RT TNVGS  + Y   VK+P GFSV++ P++L F  VG+K+SF I+V+A
Sbjct  682   ISKLKRKVTVTRTATNVGSARSIYFSSVKSPVGFSVRVEPSILYFNHVGQKKSFDITVEA  741

Query  289   ----GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                  S K   E+ FGWY W+DGIH V+SP+ VS A
Sbjct  742   RNPKASKKNDTEYAFGWYTWNDGIHNVRSPMAVSLA  777



>ref|NP_199378.1| subtilase family protein [Arabidopsis thaliana]
 dbj|BAB09208.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAC42684.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AAO64099.1| putative subtilisin [Arabidopsis thaliana]
 gb|AED95280.1| subtilase family protein [Arabidopsis thaliana]
Length=791

 Score =   379 bits (973),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 275/404 (68%), Gaps = 16/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             +SI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  390   DSITAFKMDKFAPLVYASNVVVPGIALNETSQCLPNSLKPELVSGKVVLCLRGAGSRIGK  449

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGGA +ILGNI   G+EVP  S  +P   +  P+  D IL+YIKT+KNP A + 
Sbjct  450   GMEVKRAGGAGMILGNIAANGNEVPSDSHFVPTAGV-TPTVVDKILEYIKTDKNPKAFIK  508

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PGKTV+  + +P+M  F+S GP+ V+PNILKPDITAPGL ILAAWS A SP     D R 
Sbjct  509   PGKTVYKYQAAPSMTGFSSRGPNVVDPNILKPDITAPGLYILAAWSGADSPSKMSVDQRV  568

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               YNI SGTSMSCPHV+  +ALLKAIHP WS AAI+SA+MTTA   N K + I+D  G  
Sbjct  569   AGYNIYSGTSMSCPHVAGAIALLKAIHPKWSSAAIRSALMTTAWMTNDKKKPIQDTTGLP  628

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T++D +FKCP K      N N
Sbjct  629   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNITNIDPTFKCPSK-IPPGYNHN  687

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+A+  LK ++ VKRTVTNVG+ N  +TY   VK P+G SVK  P +L F  +G+KQ 
Sbjct  688   YPSIAVPNLKKTVTVKRTVTNVGTGNSTSTYLFSVKPPSGISVKAIPNILSFNRIGQKQR  747

Query  310   FSISVK-----AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I +K       +  + G+++FGW+ W+D +H+V+SPI VS A
Sbjct  748   FKIVIKPLKNQVMNATEKGQYQFGWFSWTDKVHVVRSPIAVSLA  791



>ref|XP_007025243.1| Subtilase family protein isoform 2 [Theobroma cacao]
 gb|EOY27865.1| Subtilase family protein isoform 2 [Theobroma cacao]
Length=754

 Score =   378 bits (970),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 205/388 (53%), Positives = 264/388 (68%), Gaps = 12/388 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGG  1169
             E +PLVYAGD   P    N  G CLP +L+P+ VKGK+V C+ G+  R     EV+RAGG
Sbjct  366   EMYPLVYAGDAVFPDVPQNSTGQCLPGSLNPDMVKGKIVVCMRGAGRRLDKGLEVKRAGG  425

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
               +ILGN    G+ +      +P + + Y ++   IL+YI++ +NP+AT+ P +TV   K
Sbjct  426   VGLILGNAEANGNRLSCDPHFLPASAVSY-NDATKILEYIRSTENPMATISPAQTVMHYK  484

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA FTS GP+ ++ NILKPDITAPG+ ILAAWSEASSP     DHR VKYN  SGT
Sbjct  485   PAPFMAGFTSQGPNVIDLNILKPDITAPGIQILAAWSEASSPTKLEYDHRIVKYNFDSGT  544

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SM+CPHVS   ALLKAIHP WS AAI+SA+MTTA   N   + I D  G  A PF YGAG
Sbjct  545   SMACPHVSGAAALLKAIHPDWSVAAIRSALMTTARITNNLDQLIRDEVGNTATPFQYGAG  604

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             HFQP KAADPGL+YD++Y DYLL++C++    LD++FKCP +D  SP NLNYPS AI  L
Sbjct  605   HFQPIKAADPGLIYDASYDDYLLYLCSLGLNKLDSTFKCP-EDPPSPVNLNYPSFAIPNL  663

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA---G  287
              G++ + RTVTNVGS+N+ Y   VK P G  VK SP++L F  +G+KQSFSI+V     G
Sbjct  664   NGTVTITRTVTNVGSSNSKYYFSVKPPPGVHVKASPSILFFDHIGQKQSFSITVSPKDFG  723

Query  286   SVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              + K   + FG+Y W+DG + V+SP+ V
Sbjct  724   PIAKRSAYGFGFYTWTDGFYRVRSPMAV  751



>ref|XP_007025242.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY27864.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=780

 Score =   378 bits (971),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 206/388 (53%), Positives = 263/388 (68%), Gaps = 12/388 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGG  1169
             E +PLVYAGD   P    N  G CLP +L+P+ VKGK+V C+ G+  R     EV+RAGG
Sbjct  392   EMYPLVYAGDAVFPDVPQNSTGQCLPGSLNPDMVKGKIVVCMRGAGRRLDKGLEVKRAGG  451

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
               +ILGN    G+ +      +P + + Y   T  IL+YI++ +NP+AT+ P +TV   K
Sbjct  452   VGLILGNAEANGNRLSCDPHFLPASAVSYNDAT-KILEYIRSTENPMATISPAQTVMHYK  510

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA FTS GP+ ++ NILKPDITAPG+ ILAAWSEASSP     DHR VKYN  SGT
Sbjct  511   PAPFMAGFTSQGPNVIDLNILKPDITAPGIQILAAWSEASSPTKLEYDHRIVKYNFDSGT  570

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SM+CPHVS   ALLKAIHP WS AAI+SA+MTTA   N   + I D  G  A PF YGAG
Sbjct  571   SMACPHVSGAAALLKAIHPDWSVAAIRSALMTTARITNNLDQLIRDEVGNTATPFQYGAG  630

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             HFQP KAADPGL+YD++Y DYLL++C++    LD++FKCP +D  SP NLNYPS AI  L
Sbjct  631   HFQPIKAADPGLIYDASYDDYLLYLCSLGLNKLDSTFKCP-EDPPSPVNLNYPSFAIPNL  689

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA---G  287
              G++ + RTVTNVGS+N+ Y   VK P G  VK SP++L F  +G+KQSFSI+V     G
Sbjct  690   NGTVTITRTVTNVGSSNSKYYFSVKPPPGVHVKASPSILFFDHIGQKQSFSITVSPKDFG  749

Query  286   SVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              + K   + FG+Y W+DG + V+SP+ V
Sbjct  750   PIAKRSAYGFGFYTWTDGFYRVRSPMAV  777



>ref|XP_008371534.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=780

 Score =   376 bits (966),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 213/400 (53%), Positives = 271/400 (68%), Gaps = 15/400 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +++ + +PLVYA DV   G   +  G CLP +LSPEKVKGK+V C+ GS   V +  E
Sbjct  383   SKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGKIVLCMRGSGMRVVKGME  442

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGN    G E+   + +IP T++ Y  + + IL+YI + K P AT+IP +
Sbjct  443   VKRAGGVGFILGNSAENGVEIACDAHVIPATSVLY-KDANRILQYINSTKIPTATIIPAR  501

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ-DHRSVK  839
             TV   KP+P MA FTS GP+ ++PN LKPDITAPGLNILAAW+EA  P      DHR V 
Sbjct  502   TVLNRKPAPFMAAFTSRGPNIIDPNFLKPDITAPGLNILAAWTEADPPTKLSGIDHRVVL  561

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNI SGTSMSCPHV+A  AL+KAIHP WSGAAI+SAIMTTA   N     + D  G VA 
Sbjct  562   YNIHSGTSMSCPHVAAAAALVKAIHPTWSGAAIRSAIMTTAGIRNNVXLPLNDESGSVAT  621

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSFKCPKKDssspsnlny  482
             PF YGA HF+P+KAADPGLVYD++Y DYL +IC++      D +FKCPK    +  NLNY
Sbjct  622   PFAYGAXHFRPTKAADPGLVYDASYKDYLQYICSIGEAKDFDPTFKCPKS-PPAAINLNY  680

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+AI  LK +M++KRTVTNVG++ + Y    K P G SVK SP++L F  VG+K+SF+I
Sbjct  681   PSIAIPKLKDAMIIKRTVTNVGNSKSIYFFTAKPPLGISVKASPSILFFDHVGQKKSFTI  740

Query  301   SVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +VKA     S     ++ FGWY W+DG + V+SPI VS A
Sbjct  741   TVKARREMLSKHSTDDYVFGWYTWTDGFYTVRSPIAVSLA  780



>dbj|BAK03173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 259/378 (69%), Gaps = 12/378 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
              T+P+VYA    +PG+  N    CLP++LSP+KV+GK+V CL GS   V +  EV+RAGG
Sbjct  306   RTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGG  365

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA++LGN    GSEVPV + ++PGT +   ++ + ILKYI ++ NP A L   +TV   K
Sbjct  366   AAIVLGNPPMYGSEVPVDAHVLPGTAVSM-ADVNTILKYINSSANPTAYLERSRTVVDVK  424

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             PSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGT
Sbjct  425   PSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGT  484

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLK+ HP WS AAI+SAIMTTAT  N +G  I +  G VAGP  YG+G
Sbjct  485   SMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSG  544

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             H +P  A DPGLVYD+++ DYL+F C   G  LD SF CP   +  P  LNYPS+AI GL
Sbjct  545   HIRPRHALDPGLVYDASFQDYLIFACASGGAQLDHSFPCPAS-TPRPYELNYPSVAIHGL  603

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
               S  V+RTVTNVG   A Y+V V  PAGFSVK+SPT L F   GEK++F+I ++A   +
Sbjct  604   NRSATVRRTVTNVGQHEARYTVAVVEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKR  663

Query  277   KV---GEFEFGWYKWSDG  233
                   ++  G Y WSDG
Sbjct  664   GRRLDRKYPAGSYTWSDG  681



>ref|XP_002863463.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39722.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=791

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 274/404 (68%), Gaps = 16/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
              SI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  390   NSITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSLKPELVTGKVVLCLRGAGTRIGK  449

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGGA +ILGN+   G+E+P  S  +P   +  P+  D IL+YIKT+KNP+A + 
Sbjct  450   GIEVKRAGGAGMILGNVAANGNEIPTDSHFVPTAGV-TPTVVDKILEYIKTDKNPMAFIK  508

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PGKTV+  + +P+M  F+S GP+ ++PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  509   PGKTVYKYQAAPSMTGFSSRGPNVLDPNILKPDITAPGLNILAAWSGADSPSKMSVDQRV  568

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               YNI SGTSMSCPHV+  +ALLKAIHP WS AAI+SA+MT+A   N K + I+D  G  
Sbjct  569   ADYNIYSGTSMSCPHVAGAIALLKAIHPKWSSAAIRSALMTSAWMTNDKKKPIQDTTGLP  628

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T++D +FKCP K      N N
Sbjct  629   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNITNIDPTFKCPSK-IPPGYNHN  687

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+A+  L  ++ VKRTVTNVG+ N  +TY    K P+G SVK  P VL F  +G+KQ 
Sbjct  688   YPSIAVPNLNKTVTVKRTVTNVGNGNSTSTYLFSAKPPSGVSVKAIPNVLFFNRIGQKQR  747

Query  310   FSISVK-----AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I +K       +  + G+++FGW+ W+D +H+V+SPI VS A
Sbjct  748   FKIVIKPLKNQVMNATEKGQYQFGWFSWTDKVHVVRSPIAVSLA  791



>ref|XP_004295413.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   374 bits (961),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 211/401 (53%), Positives = 274/401 (68%), Gaps = 18/401 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTE  1187
             S +++ + +PLVYAGDV  PG + N  G CL  +LSP+KVKGK+VFCL G    V +  E
Sbjct  384   SKLEENKKYPLVYAGDVVNPGVAQNLTGQCLAGSLSPDKVKGKIVFCLRGVGMRVSKGME  443

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGGA  ILGN    G E+ V   ++P T + Y S  + I++YI + +NP AT+IP +
Sbjct  444   VKRAGGAGFILGNSKANGGEISVDPHVLPATAVTY-SNANRIMEYINSTENPEATIIPAR  502

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             TV   KP+P M  FTS GPS ++PNILKPDITAPGLNILAAW+   +P     DHR  +Y
Sbjct  503   TVLHTKPAPYMTAFTSRGPSVIDPNILKPDITAPGLNILAAWTGGEAPTKLAMDHRVAQY  562

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
              I SGTSMSCPH++A  ALLKAIHP WS AAIKSA+MTTA  +N     + D  G  A P
Sbjct  563   TIESGTSMSCPHIAAAAALLKAIHPTWSSAAIKSALMTTAGIKNNLHMPLNDESGNAATP  622

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
             F YGAGHF+P+KAADPGLVYD++Y DYLL+ C++   + D +FKCP +   +  NLNYPS
Sbjct  623   FAYGAGHFRPTKAADPGLVYDASYKDYLLYFCSIGVKNFDPNFKCP-RSPPTAVNLNYPS  681

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             +AI  L G++ +KRTVTNVG+  + Y    K P G SVK SP++L F  VG+++SF+I+V
Sbjct  682   IAIPKLNGTITIKRTVTNVGNAKSVYFFTSKPPLGISVKASPSILFFDHVGQRKSFTITV  741

Query  295   KAGS-------VKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             KA +       +K   E+ FGWY W+DG H+V+SPI VS A
Sbjct  742   KARTEMLNEKPLKD--EYAFGWYTWTDGPHIVRSPIAVSLA  780



>ref|XP_010095116.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB58282.1| Subtilisin-like protease [Morus notabilis]
Length=784

 Score =   374 bits (960),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 267/399 (67%), Gaps = 19/399 (5%)
 Frame = -3

Query  1345  KKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VER  1178
             KKM  +PL YA D+  PG   +    CLPD+LSP+K KGK+V C+ G+  R  +   V+ 
Sbjct  390   KKM--YPLAYATDLAEPGVLRDNASLCLPDSLSPKKTKGKIVLCMRGNNSRVGKGLVVKS  447

Query  1177  AGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVF  1007
             AGG   IL N    G+E+P    L+P T + Y +    IL+YI + K P A ++PG TV 
Sbjct  448   AGGVGFILANTRANGAEIPCDPHLLPATAVTYKNAMR-ILEYINSTKWPRANILPGMTVL  506

Query  1006  GAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNII  827
               KP+P MA FTS GP+ +EPNILKPDITAPGLNILAAW+E  SP   P D R VKYN++
Sbjct  507   HTKPAPFMAAFTSRGPNVIEPNILKPDITAPGLNILAAWTEEDSPTKLPNDPRIVKYNLV  566

Query  826   SGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHY  647
             SGTSM+CPHV+A  ALLKAIHP WS AAI+SAIMTTA  +N  G    +  G +A  F Y
Sbjct  567   SGTSMACPHVAATAALLKAIHPTWSSAAIRSAIMTTAIQKNNLGLPFNEEDGNLANSFSY  626

Query  646   GAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAI  467
             G+GHF+P+K ADPGLVYD++YTDYLL++C++    +D+SF CP K   +  +LNYPSLAI
Sbjct  627   GSGHFRPAKVADPGLVYDASYTDYLLYLCSIGVKVVDSSFSCPVK-PPTAMDLNYPSLAI  685

Query  466   AGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAG  287
             + L G++ VKRTVTNVG   +TY      P+  SVK  P++L F  VG+K+SF+I+V+A 
Sbjct  686   SKLNGTVTVKRTVTNVGQPKSTYFFSSTPPSRVSVKAKPSILFFNHVGQKKSFTITVEAT  745

Query  286   SVK--------KVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             S K        K  E+ FGWY W+DG H V+SPI VS A
Sbjct  746   SEKPVTSKNDEKEEEYAFGWYSWTDGPHNVRSPIAVSLA  784



>ref|XP_006280186.1| hypothetical protein CARUB_v10026090mg [Capsella rubella]
 gb|EOA13084.1| hypothetical protein CARUB_v10026090mg [Capsella rubella]
Length=618

 Score =   369 bits (948),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 210/405 (52%), Positives = 272/405 (67%), Gaps = 17/405 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  216   ESITAFKMDKFAPLVYAANVVVPGIALNDTSQCLPNSLKPELVAGKVVLCLRGAGSRIGK  275

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGGA +ILGN    G+E+P  S  +  T    P+  + IL+YIKT+KNP A + 
Sbjct  276   GIEVKRAGGAGMILGNSPANGNEIPSDSHFV-ATAPVTPAVVEKILEYIKTDKNPKALIK  334

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PGKTV+  + +P M  F+S GP+ ++PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  335   PGKTVYKYQAAPLMTGFSSRGPNVIDPNILKPDITAPGLNILAAWSGADSPSKVAVDQRV  394

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               +NI +GTSMSCPHVS  VALLKAIHP WS AAI+SA+MTTA   N + + I+DA G  
Sbjct  395   ADFNIYTGTSMSCPHVSGAVALLKAIHPKWSSAAIRSALMTTAWMTNDENKPIQDANGLP  454

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T++D +FKCP K      NLN
Sbjct  455   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNLTNIDPTFKCPSK-IPPGYNLN  513

Query  484   ypsLAIAGLKGSMVVKRTVTNVG---STNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
             YPS+++  L  ++ VKRTVTNVG   ST +TY    K P+G SVK  P VL F  +G+K+
Sbjct  514   YPSISVPNLTKTVTVKRTVTNVGIGNSTTSTYLFNAKPPSGVSVKAIPNVLSFNRIGQKK  573

Query  313   SFSISVK--AGSVKKV---GEFEFGWYKWSDGIHMVKSPIVVSSA  194
              F I +K   G V      G+++FGW+ W+D  H+V+SPI VS A
Sbjct  574   RFKIVIKPRTGQVMNATEKGQYQFGWFSWTDSDHVVRSPIAVSLA  618



>ref|XP_010518867.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=785

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 213/406 (52%), Positives = 279/406 (69%), Gaps = 19/406 (5%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGS--TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VY  1199
             ES+++ K     PLVYA DV +PG+   N    CLP++LSP+ VKGKVV CL G+   + 
Sbjct  383   ESVTSYKMDNFAPLVYAADVTIPGAVAANNTAQCLPNSLSPKLVKGKVVLCLRGAGSRIG  442

Query  1198  RSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             +  EV+RAGGA +ILGN    G +VP+    +P   +  PS  D IL YI+T+K P+A +
Sbjct  443   KGLEVKRAGGAGLILGNALANGDDVPLDPHFVPAAGVI-PSIVDKILYYIRTDKKPIALI  501

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
              PG+TV+ ++P+P +  F+S GP+ ++PNILKPDITAPGLNILAAWS A SP     D R
Sbjct  502   KPGETVYQSQPAPFVTGFSSRGPNVIDPNILKPDITAPGLNILAAWSGADSPTKISVDRR  561

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              V++N+ SGTSMSCPHVS  +ALLKAIHP+WS AAI+SAIMTTA   N + + I+D  G 
Sbjct  562   VVEFNLYSGTSMSCPHVSGAIALLKAIHPNWSSAAIRSAIMTTAWMTNDQEKPIQDVNGL  621

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnl  488
              A PF  G+GHF+P+KAADPGLVYD++Y DYLL+ C+V  T++D  FKCPKK      NL
Sbjct  622   PANPFAIGSGHFRPTKAADPGLVYDASYQDYLLYCCSVGLTNVDPEFKCPKK-PPPGYNL  680

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
             NYPS++I  L   + V+R+VTNVGS+N  +TY    K P G SV   P+++KF  VG+ +
Sbjct  681   NYPSISIPNLSRRIRVRRSVTNVGSSNGTSTYFFSAKPPLGVSVTAKPSIMKFNRVGQIK  740

Query  313   SFSISVK------AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
              F+I+VK      AG V+K GEF FGWY W+D  H V+SPI VS A
Sbjct  741   RFTITVKLQKGQLAGEVQK-GEFLFGWYTWTDNHHTVRSPIAVSLA  785



>ref|XP_006449588.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 ref|XP_006449589.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62828.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62829.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=557

 Score =   366 bits (940),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 208/396 (53%), Positives = 275/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVE  1181
             +KKM   PLVYA DV +PG   N    CLP +L+PEKVKGK+V C+ GS ++     EV+
Sbjct  166   LKKMH--PLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVK  223

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG  +ILGN    G+E    +  +P T + Y  +   I +YIK+  NP A +   +TV
Sbjct  224   RAGGVGLILGNSPANGNEYSYDAHYLPATAVLY-DDAIKIHEYIKSTNNPTAIIKQARTV  282

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                +P+P MA FTS GP++++P ILKPDITAPGLNILAAWSEASSP     D R VKY I
Sbjct  283   LHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTI  342

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA  +N KG  I +A G +A PF 
Sbjct  343   FSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTAWMKNNKGLPITNADGSIATPFS  402

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +G+GHF+P+KAADPGLVYD++Y DYLL++C+   +  +  F+CP K   S  NLNYPS+A
Sbjct  403   FGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTNPVFRCPNK-PPSALNLNYPSIA  461

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I  L G+++VKRTVTNVG + + Y    K P G SVK +P++L F  +G+K+SF+I+V+ 
Sbjct  462   IPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRL  521

Query  289   GS-VKKVG---EFEFGWYKWSDGIHMVKSPIVVSSA  194
             GS   + G   ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  522   GSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  557



>dbj|BAJ85613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=785

 Score =   371 bits (953),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 260/378 (69%), Gaps = 12/378 (3%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
              T+P+VYA    +PG+  N    CLP++LSP+KV+GK+V CL GS   V +  EV+RAGG
Sbjct  397   RTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGG  456

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA++LGN    GSEV V + ++PGT +   ++ + ILKYI ++ NP A L   +TV   K
Sbjct  457   AAIVLGNPPMYGSEVRVDAHVLPGTAVSM-ADVNTILKYINSSANPTAYLERSRTVVDVK  515

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             PSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VKYNI+SGT
Sbjct  516   PSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGT  575

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLK+ HP WS AAI+SAIMTTAT  N +G  I +  G VAGP  YG+G
Sbjct  576   SMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSG  635

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             H +P  A DPGLVYD+++ DYL+F C   G  LD SF CP   +  P  LNYPS+AI GL
Sbjct  636   HIRPRHALDPGLVYDASFQDYLIFACASGGAQLDHSFPCPAS-TPRPYELNYPSVAIHGL  694

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA-GSV  281
               S  V+RTVTNVG   A Y+V V  PAGFSVK+SPT L F   GEK++F+I ++A G  
Sbjct  695   NRSATVRRTVTNVGQHEARYTVAVVEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKR  754

Query  280   KKVGEFEF--GWYKWSDG  233
              +  + ++  G Y WSDG
Sbjct  755   GRRLDRKYPAGSYTWSDG  772



>gb|KDO77991.1| hypothetical protein CISIN_1g0040471mg [Citrus sinensis]
Length=557

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 274/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVE  1181
             +KKM   PLVYA DV +PG   N    CLP +L+PEKVKGK+V C+ GS ++     EV+
Sbjct  166   LKKMH--PLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVK  223

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG  +ILGN    G+E    +  +P T + Y  +   I +YIK+  NP A +   +TV
Sbjct  224   RAGGVGLILGNSPANGNEYSYDAHYLPATAVLY-DDAIKIHEYIKSTNNPTAIIKQARTV  282

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                +P+P MA FTS GP++++P ILKPDITAPGLNILAAWSEASSP     D R VKY I
Sbjct  283   LHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTI  342

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA  +N K   I +A G +A PF 
Sbjct  343   FSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTAWMKNNKALPITNADGSIATPFS  402

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +G+GHF+P+KAADPGLVYD++Y DYLL++C+   +  +  F+CP K   S  NLNYPS+A
Sbjct  403   FGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTNPVFRCPNK-PPSALNLNYPSIA  461

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I  L G+++VKRTVTNVG + + Y    K P G SVK +P++L F  +G+K+SF+I+V+ 
Sbjct  462   IPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRL  521

Query  289   GS-VKKVG---EFEFGWYKWSDGIHMVKSPIVVSSA  194
             GS   + G   ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  522   GSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  557



>ref|XP_004309900.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=778

 Score =   370 bits (950),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 207/397 (52%), Positives = 271/397 (68%), Gaps = 14/397 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +++ + +PLVYAGDV  PG + N  G CL  +LSP+KVKGK+VFCL G+   V +  E
Sbjct  383   SKLEENKKYPLVYAGDVVNPGVAQNLTGQCLAGSLSPDKVKGKIVFCLRGAGMRVSKGME  442

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGNI   G E+ V   ++P T + Y S  + I++YI + KNP AT+IP +
Sbjct  443   VKRAGGVGFILGNIKANGGEISVDPHVLPATAVAY-SNANRIMEYINSTKNPEATIIPAR  501

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             TV   KP+P M  FTS GPS ++PNILKPDITAPGLNILAAW+EA +P     DHR  +Y
Sbjct  502   TVLHTKPAPYMTAFTSRGPSVIDPNILKPDITAPGLNILAAWTEAEAPTKLAMDHRVAQY  561

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
              I SGTSMSCPH++A  ALLKAIHP WS AAIKSA+MTTA  +N     + D  G  A P
Sbjct  562   TIESGTSMSCPHIAAAAALLKAIHPTWSSAAIKSALMTTAGIKNNLDMPLNDESGNAATP  621

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
             F YGAGHF+P+KAA PGLVYD++Y DYLL+ C++   + D +FKCP +   + +NLNYPS
Sbjct  622   FAYGAGHFRPTKAAYPGLVYDASYKDYLLYFCSIGVKNFDPNFKCP-RSPPTAANLNYPS  680

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + I  L G++ +KRT+ NVG+  + Y    K P   SVK SP++L F  VG+++SF+I+V
Sbjct  681   IEIPKLNGTITIKRTLKNVGNAKSVYFFTSKPPLEISVKASPSILFFDHVGQRKSFTITV  740

Query  295   KAGSVKK-----VGEFEFGWYKWSDGIHMVKSPIVVS  200
             KA +          E+ FGWY W+DG H+V+SPI VS
Sbjct  741   KARTEMPNEKPLKDEYAFGWYTWTDGPHIVRSPIAVS  777



>ref|XP_008225402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=780

 Score =   370 bits (950),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 210/400 (53%), Positives = 275/400 (69%), Gaps = 15/400 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +++   +PLVYA DV   G   +  G CLP +LSPEKVKGK+V C+ GS   V +  E
Sbjct  383   SKLEENNMYPLVYAADVINTGVPKDMAGQCLPGSLSPEKVKGKIVLCMRGSGVRVGKGME  442

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGN    G E+   + ++P T++ +  + + IL+YIK+ K+P+AT+IP +
Sbjct  443   VKRAGGVGFILGNSAANGIEIACDAHVLPATSVLH-KDANRILQYIKSTKHPIATIIPAR  501

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ-DHRSVK  839
             TV   KP+P MA F+S GP+ ++PNILKPDITAPGLNILAAWSEA  P      DHR  +
Sbjct  502   TVLHTKPAPFMASFSSRGPNVIDPNILKPDITAPGLNILAAWSEADPPSKLNGIDHRVAQ  561

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNI SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA   N     + D  G  A 
Sbjct  562   YNIYSGTSMSCPHVAAAAALLKAIHPSWSSAAIRSALMTTAEIRNNLDMPLNDESGNAAT  621

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTG-TSLDTSFKCPKKDssspsnlny  482
             PF YG+GHF+P+KAADPGLVYD++Y DYLL++C++ G   +D  FKCP+    + +NLNY
Sbjct  622   PFAYGSGHFRPTKAADPGLVYDASYRDYLLYMCSIGGFKDVDPKFKCPRS-PPTATNLNY  680

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+AI+ L  ++ +KRTVTNVG+  + Y    K P G SVK SP++L F  VG+K+SF+I
Sbjct  681   PSIAISKLNSAITIKRTVTNVGAGKSIYFFTSKPPLGISVKASPSMLFFDHVGQKKSFTI  740

Query  301   SVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +VKA     S     E+ FGWY W+DG+H V+SPI VS A
Sbjct  741   TVKARKEMLSEHDKDEYVFGWYTWTDGLHTVRSPIAVSLA  780



>gb|KDO77986.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
 gb|KDO77987.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
Length=587

 Score =   364 bits (935),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 274/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVE  1181
             +KKM   PLVYA DV +PG   N    CLP +L+PEKVKGK+V C+ GS ++     EV+
Sbjct  196   LKKMH--PLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVK  253

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG  +ILGN    G+E    +  +P T + Y  +   I +YIK+  NP A +   +TV
Sbjct  254   RAGGVGLILGNSPANGNEYSYDAHYLPATAVLY-DDAIKIHEYIKSTNNPTAIIKQARTV  312

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                +P+P MA FTS GP++++P ILKPDITAPGLNILAAWSEASSP     D R VKY I
Sbjct  313   LHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTI  372

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA  +N K   I +A G +A PF 
Sbjct  373   FSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTAWMKNNKALPITNADGSIATPFS  432

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +G+GHF+P+KAADPGLVYD++Y DYLL++C+   +  +  F+CP K   S  NLNYPS+A
Sbjct  433   FGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTNPVFRCPNK-PPSALNLNYPSIA  491

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I  L G+++VKRTVTNVG + + Y    K P G SVK +P++L F  +G+K+SF+I+V+ 
Sbjct  492   IPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRL  551

Query  289   GS-VKKVG---EFEFGWYKWSDGIHMVKSPIVVSSA  194
             GS   + G   ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  552   GSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  587



>ref|XP_006859003.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
 gb|ERN20470.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
Length=766

 Score =   369 bits (947),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 204/403 (51%), Positives = 278/403 (69%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISAIK-KMETFPLVYAGDVELPGSTNF--PGFCLPDTLSPEKVKGKVVFCLVGS---V  1202
             ++I++ K K   +P+V+A +  +PG+      G CLP++L P+KV+GK+VFCL G+   V
Sbjct  368   QTITSFKLKKRFYPIVFAANAVVPGTPKNISAGQCLPNSLDPKKVEGKIVFCLRGNGARV  427

Query  1201  YRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +  EV+RAGGAA+ILGN+   G+E+ V + ++PGT +   ++  +IL Y+ ++KNP A 
Sbjct  428   GKGFEVKRAGGAALILGNLPTNGAEISVDAHVLPGTALI-STDATSILHYLNSSKNPTAK  486

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +IP  TV G KP+P MA F+S GP+ ++PNILKPDITAPGLNILAAWS+ASSP     D 
Sbjct  487   IIPATTVNGYKPAPVMAAFSSTGPNVLDPNILKPDITAPGLNILAAWSKASSPTKLAADK  546

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R VKYN++SGTSMSCPHV+ V ALLKAIHP    + +K   +  + T N+ G+ +EDA G
Sbjct  547   RRVKYNVLSGTSMSCPHVAGVAALLKAIHPRCL-SNLKPHSLAASLTNNM-GKPLEDASG  604

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsn  491
               AGPF+YG+GH  P+ AADPGLVYD++Y DYL+F+C  +G  +D S+ CP K   +PS+
Sbjct  605   SPAGPFNYGSGHLNPAMAADPGLVYDASYIDYLVFLCK-SGIKIDRSYTCP-KSPPNPSD  662

Query  490   lnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             LN  S+ I+ LKG+  V RTVTNVG+  A YS+ + +P G  V I P  L F   GEK+S
Sbjct  663   LNLASVTISKLKGTKTVTRTVTNVGAKKALYSLSLASPNGVLVDIEPKELYFRRDGEKKS  722

Query  310   FSISVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             FS++ K G       K G + FGWY WSDG+H V+SPIVVS A
Sbjct  723   FSLTFKVGPRVPRSMKNGSYSFGWYMWSDGMHKVRSPIVVSLA  765



>ref|XP_008383532.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=778

 Score =   369 bits (948),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 270/399 (68%), Gaps = 14/399 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +++ + +PLVYA DV   G   +  G CLP +LSPEKVKG +V C+ GS   V +  E
Sbjct  382   SKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGNIVLCMRGSGMRVGKGME  441

Query  1186  VERAGGAAVILGNIGS---EVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGN  +   E+   + +IP T + Y  + + IL+YI + K P AT+IP +
Sbjct  442   VKRAGGVGFILGNSAANXVEISCDAHVIPATAVLY-EDABRILQYINSTKIPTATIIPAR  500

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ-DHRSVK  839
             TVF  KP+P M  FTS GP+ ++PN LKPDITAPGLNILAAW+EA  P      DHR V 
Sbjct  501   TVFNRKPAPFMXAFTSRGPNLIDPNFLKPDITAPGLNILAAWTEADPPTKLSGIDHRVVX  560

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNI SGTSMSCPHV+A   L+KAIHP WS AAI+SAIMTTA   N  G  ++D  G VA 
Sbjct  561   YNIYSGTSMSCPHVAAAAVLVKAIHPTWSSAAIRSAIMTTAEIRNKLGLPLKDESGSVAT  620

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSFKCPKKDssspsnlny  482
             PF YGAGHF+P+KAADPGLVYD++Y DYL +IC++    ++D +F CPK    +  NLNY
Sbjct  621   PFAYGAGHFRPTKAADPGLVYDASYKDYLQYICSIGVAKNVDPTFNCPKS-PPTAINLNY  679

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+AI  LK +M +KRTVTNVG + + Y    K P G S+K SP++L F   G+K+SF++
Sbjct  680   PSIAIPKLKDTMTIKRTVTNVGDSKSIYFFTXKPPLGISIKASPSMLFFDHFGQKKSFTV  739

Query  301   SVKAGS---VKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +VKA      K+  E+ FGWY W+DG+H V+SPI VS A
Sbjct  740   TVKARREMLSKQGNEYVFGWYTWTDGLHTVRSPIAVSLA  778



>gb|EYU28146.1| hypothetical protein MIMGU_mgv1a001696mg [Erythranthe guttata]
Length=772

 Score =   369 bits (946),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 211/384 (55%), Positives = 261/384 (68%), Gaps = 9/384 (2%)
 Frame = -3

Query  1333  TFPLVYAGDVELPGST-NFP-GFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERAGGAAV  1160
             TFPLVYA DVE+PG+T N   G C P TLSP  V GK VFC  GS   + EV+RAGG AV
Sbjct  392   TFPLVYAADVEIPGTTTNLTFGLCNPGTLSPALVAGKAVFCWRGSTAEALEVQRAGGVAV  451

Query  1159  ILGNIGSEVPVGS--FLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG-AKPSP  989
             +LGN    V V    ++IP + +    +   I  Y ++   P ATL P +T+ G + P+P
Sbjct  452   VLGNPDDGVGVSQTPYVIPAS-VVLSDQKLKIFNYTQSTATPTATLTPARTLIGGSSPTP  510

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              MAPFTS GP+ +EPN+LKPDITAPG NILAAWSE +SPF  P D+R  K+NIISGTSM+
Sbjct  511   FMAPFTSRGPNVIEPNLLKPDITAPGFNILAAWSEVASPFGVPSDNRVAKFNIISGTSMA  570

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQ  629
             CPHV+ V AL+KAIHP WS AAI+SA+MTT +  N  G  I DA G  A P  YG+GH Q
Sbjct  571   CPHVAGVAALIKAIHPDWSSAAIRSALMTTTSPVNNLGNLITDALGNFATPLQYGSGHIQ  630

Query  628   PSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGS  449
             PSKAADPGLVYD+TY+DYLLF+C+  G  LD +F CP     S SN NYPSLAI  L G+
Sbjct  631   PSKAADPGLVYDATYSDYLLFLCSSIGNFLDPTFTCPIV-PPSASNFNYPSLAITNLIGA  689

Query  448   MVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVG  269
             + V+RTVTNVG+ N TY+V    P G++  ISP+ L F   GEKQSFSI+V A +     
Sbjct  690   VTVERTVTNVGAGNTTYTVSTSVPRGYTFTISPSTLHFSATGEKQSFSITVAAAAGAPGN  749

Query  268   EFEFGWYKWSDGIHMVKSPIVVSS  197
              F   WY W DG H+V+SP+V+++
Sbjct  750   AFG--WYTWFDGTHVVRSPVVINT  771



>ref|XP_010665649.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=780

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 212/392 (54%), Positives = 263/392 (67%), Gaps = 14/392 (4%)
 Frame = -3

Query  1333  TFPLVYAGDVELPGSTN-FPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGA  1166
             ++PLVYAG++ +P  T    G CLP++LS EK  GK+VFC  G+   V +  EV+RAGG 
Sbjct  391   SYPLVYAGEITIPNVTRELSGQCLPNSLSSEKANGKIVFCFRGNGTRVGKGMEVKRAGGI  450

Query  1165  AVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
               ILGN    G E+     ++P T++    E   I KYIK+ K PVA ++P  TV G  P
Sbjct  451   GYILGNAKGQGEEIVADPHVLPATSVG-EHEAMKIYKYIKSTKFPVAKILPAATVVGTSP  509

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +P MA FTS GP+ V+P ILKPDITAPGLNILAAWS A SP     D R V++NI SGTS
Sbjct  510   APFMASFTSRGPNVVDPTILKPDITAPGLNILAAWSGADSPSKLASDDRIVEWNIYSGTS  569

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHV+A  ALLKAIHP WS AAI+S++MTTA  EN  G  I DA G  A PF YGAGH
Sbjct  570   MSCPHVAAAAALLKAIHPTWSSAAIRSSLMTTAGLENNNGTLITDAMGNPANPFQYGAGH  629

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLK  455
              QP+KAADPGLVYD++YTDYL ++C++     D+SFKCPK      ++LN PSLAI+ L 
Sbjct  630   LQPTKAADPGLVYDTSYTDYLTYLCSIGMPGFDSSFKCPKV-LPKTNDLNTPSLAISKLN  688

Query  454   GSMVVKRTVTNVGSTNAT-YSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
             GS+ V RTVTNVG    T Y   VK P G+ VKISP++L F   G+K+SF I+V+     
Sbjct  689   GSLTVTRTVTNVGHPGKTSYFASVKPPMGYRVKISPSILIFKHKGQKKSFKITVEKERDV  748

Query  277   KVG----EFEFGWYKWSDGIHMVKSPIVVSSA  194
               G    E+EFGW  W DG+H V+SP+VVSSA
Sbjct  749   IQGVSAQEYEFGWLSWFDGVHTVRSPMVVSSA  780



>ref|XP_007213640.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
 gb|EMJ14839.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
Length=779

 Score =   368 bits (944),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 210/400 (53%), Positives = 271/400 (68%), Gaps = 15/400 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STE  1187
             S +++   +PLVYA DV   G   +  G CLP +LSPEKVKGK+V C+ GS  R     E
Sbjct  382   SKLEENNMYPLVYAADVINTGVPKDMAGQCLPGSLSPEKVKGKIVLCMRGSGLRIGKGME  441

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGN    G E+   + ++P T++ Y  + + ILKYI + K+P+AT+IP +
Sbjct  442   VKRAGGVGFILGNSAANGIEIACDAHVLPATSVLY-KDANRILKYINSTKHPIATIIPAR  500

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ-DHRSVK  839
             TV   KP+P MA F+S GP+ ++ NILKPDITAPGLNILAAWSEA  P      DHR  +
Sbjct  501   TVLHTKPAPFMASFSSRGPNVIDSNILKPDITAPGLNILAAWSEADPPTKLNGIDHRVAQ  560

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNI SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA   N     + D  G  A 
Sbjct  561   YNIYSGTSMSCPHVAAAAALLKAIHPSWSSAAIRSALMTTAEIRNNLDMPLNDESGNAAT  620

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTG-TSLDTSFKCPKKDssspsnlny  482
             PF YG+GHF+P+KAADPGLVYD++Y DYLL++C++ G   +D  FKCP+    + +NLNY
Sbjct  621   PFAYGSGHFRPTKAADPGLVYDASYRDYLLYMCSIGGFKDVDPKFKCPRS-PPTATNLNY  679

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+AI+ L  ++ +KRTVTNVG   + Y    K P G SVK SP++L F  VG+K+SF+I
Sbjct  680   PSIAISKLNRAITIKRTVTNVGEGKSIYFFTSKPPLGISVKASPSMLFFDHVGQKKSFTI  739

Query  301   SVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +VKA     S     E+ FGWY W+DG+H V+SPI VS A
Sbjct  740   TVKARKEMLSKHDKDEYVFGWYTWTDGLHTVRSPIAVSLA  779



>ref|XP_009114399.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=790

 Score =   368 bits (944),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 206/403 (51%), Positives = 271/403 (67%), Gaps = 15/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  390   ESITAFKMDKFAPLVYAANVAVPGIALNNTSQCLPNSLKPELVNGKVVLCLRGAGSRIGK  449

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGG  +ILGN    G+E+P  S  +  T    P+  + IL YIKT+KNP+A + 
Sbjct  450   GMEVKRAGGVGMILGNSLANGNEIPSDSHFV-ATAAVTPTVVEKILDYIKTDKNPIAFIK  508

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PG TV+  +P+P M  F+S GP+ V+PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  509   PGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPGLNILAAWSGADSPSKLWVDQRV  568

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               YNI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  569   ADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDISGLP  628

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T++D +FKCP K      NLN
Sbjct  629   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVGFTNIDPTFKCPSK-IPPGYNLN  687

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS++I  L  ++ VKRTVTNVG+ N  +TY    ++P G SVK  P+VL F  +G+K+ 
Sbjct  688   YPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFSARSPLGVSVKAKPSVLSFNRIGQKKR  747

Query  310   FSISV----KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I V       +V + G+++FGW+ W+D  H+V+SPI +S A
Sbjct  748   FKIMVTIRKDKMNVTEKGQYQFGWFSWTDKYHVVRSPIAISLA  790



>ref|XP_006449587.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62827.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=777

 Score =   367 bits (942),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 208/396 (53%), Positives = 275/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVE  1181
             +KKM   PLVYA DV +PG   N    CLP +L+PEKVKGK+V C+ GS ++     EV+
Sbjct  386   LKKMH--PLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVK  443

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG  +ILGN    G+E    +  +P T + Y  +   I +YIK+  NP A +   +TV
Sbjct  444   RAGGVGLILGNSPANGNEYSYDAHYLPATAVLY-DDAIKIHEYIKSTNNPTAIIKQARTV  502

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                +P+P MA FTS GP++++P ILKPDITAPGLNILAAWSEASSP     D R VKY I
Sbjct  503   LHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTI  562

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA  +N KG  I +A G +A PF 
Sbjct  563   FSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTAWMKNNKGLPITNADGSIATPFS  622

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +G+GHF+P+KAADPGLVYD++Y DYLL++C+   +  +  F+CP K   S  NLNYPS+A
Sbjct  623   FGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTNPVFRCPNK-PPSALNLNYPSIA  681

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I  L G+++VKRTVTNVG + + Y    K P G SVK +P++L F  +G+K+SF+I+V+ 
Sbjct  682   IPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRL  741

Query  289   GS-VKKVG---EFEFGWYKWSDGIHMVKSPIVVSSA  194
             GS   + G   ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  742   GSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  777



>gb|KFK31536.1| hypothetical protein AALP_AA6G125100 [Arabis alpina]
Length=788

 Score =   367 bits (943),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 268/404 (66%), Gaps = 16/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V  PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  387   ESITAFKMDKFAPLVYAANVVAPGIALNNSAQCLPNSLKPELVSGKVVLCLRGAGSRIGK  446

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGG  +ILGN    G+E    S  +  T    P+  D IL+YIKT+K P+A + 
Sbjct  447   GIEVKRAGGVGMILGNSPANGNETMPDSHFV-ATAAVTPTVVDKILQYIKTDKKPIAFIK  505

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PG+TV+  KP+P +  F+S GPS ++PNILKPDITAPGLNILAAWS A  P     D R 
Sbjct  506   PGETVYKNKPAPFVTGFSSRGPSMIDPNILKPDITAPGLNILAAWSGADGPSKISVDQRV  565

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
              +YN +SGTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  566   AEYNFVSGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDTNGLP  625

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+G F+P+KAADPGLVYD++Y  YLL+ C V  T +D +FKCP K      NLN
Sbjct  626   ANPFALGSGQFRPTKAADPGLVYDASYRAYLLYGCLVGLTKIDPTFKCPSK-IPPGYNLN  684

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+AI  L G++ VKRTVTNVG+ N  +TY    +AP GFSVK  P+VL F  +G+K+ 
Sbjct  685   YPSIAIPNLNGTVTVKRTVTNVGNGNSTSTYLFSAQAPLGFSVKAKPSVLSFNRIGQKKR  744

Query  310   FSISVKAG-----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I V A      +V + G ++FGW+ W+D  H+VKSP+ VS A
Sbjct  745   FKIVVTAQKEKMMNVTEKGHYQFGWFSWTDRYHVVKSPVAVSLA  788



>ref|XP_009385357.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Musa acuminata 
subsp. malaccensis]
Length=545

 Score =   360 bits (924),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 247/342 (72%), Gaps = 9/342 (3%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +K  E +PLVYAGD  +PG+  N  G CLP++L  +KV+GK+V CL GS   V +  E
Sbjct  205   SVLKSSEFYPLVYAGDAVVPGTPGNVSGQCLPNSLDAKKVRGKIVVCLRGSGLRVAKGLE  264

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGGAA+ILGN    G+E+PV + ++PGT +    +  AILKYI+  + P A +   +
Sbjct  265   VKRAGGAAIILGNAVANGNEIPVDAHVLPGTAVS-SDDAIAILKYIEAARRPSAKIGSAR  323

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKY  836
             TV G  P+P MA F+S GP+ VEPNILKPDITAPGLNILAAWSE+SSP     DHRSVKY
Sbjct  324   TVLGVTPAPVMAAFSSRGPNRVEPNILKPDITAPGLNILAAWSESSSPTKLEDDHRSVKY  383

Query  835   NIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGP  656
             N+ SGTSMSCPHVSAV ALLK++HP WS AAI+SA+MTTA   N +G  + DA G+ AGP
Sbjct  384   NLYSGTSMSCPHVSAVAALLKSLHPSWSSAAIRSAMMTTAAVVNTRGGPLTDAAGQAAGP  443

Query  655   FHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyps  476
               +G+GH +P+ A+DPGLVYD++Y DYLLF C+  G  +D SF CP+  S SPS+LNYPS
Sbjct  444   LEFGSGHVRPNHASDPGLVYDASYEDYLLFACSSIGAQMDPSFPCPET-SPSPSDLNYPS  502

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISP  350
             +A++ L GS+ V+RTVTNVG   A Y V V  P G SV+ISP
Sbjct  503   IAVSDLNGSVTVRRTVTNVGRGPARYRVTVTEPTGVSVRISP  544



>emb|CDY23110.1| BnaC09g18640D [Brassica napus]
Length=776

 Score =   367 bits (941),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 205/403 (51%), Positives = 270/403 (67%), Gaps = 15/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  376   ESITAFKMDKFAPLVYAANVAVPGIALNNTSQCLPNSLKPELVNGKVVLCLRGAGSRIGK  435

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGG  +ILGN    G+E+P  S  +  T    P+  + IL YIK +KNP+A + 
Sbjct  436   GMEVKRAGGVGMILGNSLANGNEIPSDSHFV-ATAAVTPTVVEKILDYIKIDKNPIAFIK  494

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PG TV+  +P+P M  F+S GP+ V+PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  495   PGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPGLNILAAWSGADSPSKLWVDQRV  554

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               YNI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  555   ADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDISGLP  614

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T++D +FKCP K      NLN
Sbjct  615   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVGFTNIDPTFKCPSK-IPPGYNLN  673

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS++I  L  ++ VKRTVTNVG+ N  +TY    ++P G SVK  P+VL F  +G+K+ 
Sbjct  674   YPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFSARSPLGVSVKAKPSVLSFNRIGQKKR  733

Query  310   FSISVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I V       +V + G+++FGW+ W+D  H+V+SPI +S A
Sbjct  734   FKIMVTVRMDKMNVTEKGQYQFGWFSWTDKYHVVRSPIAISLA  776



>emb|CDY13044.1| BnaA09g17730D [Brassica napus]
Length=776

 Score =   366 bits (940),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 205/403 (51%), Positives = 270/403 (67%), Gaps = 15/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  376   ESITAFKMDKFAPLVYAANVAVPGIALNNTSQCLPNSLKPELVNGKVVLCLRGAGSRIGK  435

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGG  +ILGN    G+E+P  S  +  T    P+  + IL YIK +KNP+A + 
Sbjct  436   GMEVKRAGGVGMILGNSLANGNEIPSDSHFV-ATAAVTPTVVEKILDYIKIDKNPIAFIK  494

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PG TV+  +P+P M  F+S GP+ V+PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  495   PGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPGLNILAAWSGADSPSKLWVDQRV  554

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               YNI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  555   ADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDISGLP  614

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T++D +FKCP K      NLN
Sbjct  615   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVGFTNIDPTFKCPSK-IPPGYNLN  673

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS++I  L  ++ VKRTVTNVG+ N  +TY    ++P G SVK  P+VL F  +G+K+ 
Sbjct  674   YPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFSARSPLGVSVKAKPSVLSFNRIGQKKR  733

Query  310   FSISV----KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I V       +V + G+++FGW+ W+D  H+V+SPI +S A
Sbjct  734   FKIMVTIRKDKMNVTEKGQYQFGWFSWTDKYHVVRSPIAISLA  776



>ref|XP_006398246.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
 gb|ESQ39699.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
Length=792

 Score =   366 bits (940),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 206/402 (51%), Positives = 267/402 (66%), Gaps = 16/402 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  391   ESITAFKMDKFAPLVYASNVTVPGIALNNTSQCLPNSLKPELVTGKVVLCLRGTGSRIGK  450

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGG  +ILGN    G+++P  S  +  T    PS  + IL+YIKT+KNP+A + 
Sbjct  451   GMEVKRAGGVGMILGNSLANGNDIPSDSHFV-ATAAVTPSSVEKILEYIKTDKNPIAFIK  509

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PG TV+  +P+P M  F+S GPS ++ NILKPDITAPGLNILAAWS A SP     D R 
Sbjct  510   PGTTVYKNQPAPLMTGFSSRGPSLIDANILKPDITAPGLNILAAWSGADSPSKVSLDQRV  569

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               YNI +GTSMSCPHVS  +ALLKA HP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  570   AAYNIYTGTSMSCPHVSGAIALLKATHPKWSSAAIRSALMTTAWMTNDEKKPIQDTNGLP  629

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V    +D +FKCP K      NLN
Sbjct  630   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVGFIDIDPTFKCPSK-IPPGYNLN  688

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+AI  L  ++ VKRTVTNVG  N  +TY    K+P G SVK  P+VL F  +G+K+ 
Sbjct  689   YPSIAIPNLNRTVTVKRTVTNVGDGNSTSTYIFSAKSPPGVSVKAKPSVLSFNRIGQKKR  748

Query  310   FSISV-----KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
             F I V     K  +V + G+++FGW+ W+D  H+V+SPI VS
Sbjct  749   FKIVVTARRDKMMNVTEKGQYQFGWFSWTDNYHVVRSPIAVS  790



>ref|XP_004134922.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004169531.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN49345.1| hypothetical protein Csa_6G520430 [Cucumis sativus]
Length=791

 Score =   365 bits (938),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 203/406 (50%), Positives = 273/406 (67%), Gaps = 22/406 (5%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS-VYR---ST  1190
             S +++ + +PLVYAGD+  P +  N  G C+  +LS EK KGK+V C  G  + R   S 
Sbjct  387   SKLERKKMYPLVYAGDIMNPHAPRNQSGLCVAGSLSHEKAKGKIVLCFRGEGISRFAGSL  446

Query  1189  EVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPG  1019
             EV+R+GGA +ILGN+   G         +P T + Y  + + ILKYIK+ KNP AT++P 
Sbjct  447   EVQRSGGAGMILGNVPAVGRRPHADPHFVPATAVSY-EDANIILKYIKSRKNPTATIVPP  505

Query  1018  KTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ--DHRS  845
              T++G++P+PAMA F+S GP+ ++P+ LKPDITAPG++ILAAWSE  SP   P+  D R 
Sbjct  506   VTIYGSRPAPAMANFSSRGPNPIDPHFLKPDITAPGVDILAAWSEQDSPTKLPKYLDPRI  565

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAY---  674
             V+YN+ SGTSMSCPHVSA  ALL+AIHP WS AAI+SA+MTT+TT N  G+ I D     
Sbjct  566   VQYNLYSGTSMSCPHVSAAAALLRAIHPTWSQAAIRSALMTTSTTNNKYGQPITDDSTLD  625

Query  673   GEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDsssps  494
                A PF +G+GHF+PSKAADPGLVYDS YTDYL ++C +   S+D SFKCP + +  P 
Sbjct  626   NSPATPFSFGSGHFRPSKAADPGLVYDSNYTDYLHYLCGLKMNSIDPSFKCPPR-ALHPH  684

Query  493   nlnypsLAIAGLKGSMVVKRTVTNVGSTNAT-YSVEVKAPAGFSVKISPTVLKFMEVGEK  317
             +LNYPS+A+  L+  + +KRTVTNVG      Y  + +AP G +V  SP +L F  VGE+
Sbjct  685   DLNYPSIAVPQLRNVVRIKRTVTNVGGGGKNVYFFKSEAPRGVAVSASPNILYFNRVGER  744

Query  316   QSFSISV------KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             + F+I++         S KK  ++ FGW+ WSDGIH V+SPI VSS
Sbjct  745   KKFTITISRKVNNNNRSSKKGEDYSFGWFAWSDGIHYVRSPIAVSS  790



>ref|XP_009360803.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score =   365 bits (937),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 269/399 (67%), Gaps = 14/399 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTE  1187
             S +++ + +PLVYA DV   G   +  G CLP +LSPEKVKGK+V C+ GS   V +  E
Sbjct  382   SKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGKIVLCMRGSGMRVGKGME  441

Query  1186  VERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGK  1016
             V+RAGG   ILGN    G E+   + +IP T + Y  + + IL+YI + K P A +IP +
Sbjct  442   VKRAGGVGFILGNSAANGVEISCDAHVIPATAVLY-EDANRILQYINSTKIPTAAIIPAR  500

Query  1015  TVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ-DHRSVK  839
             TV   KP+P MA FTS GP+ ++PN LKPDITAPGLNILAAW+EA  P      DHR V+
Sbjct  501   TVLNRKPAPFMAAFTSRGPNLIDPNFLKPDITAPGLNILAAWTEADPPTKLSGIDHRVVQ  560

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNI SGTSMSCPHV+A   L+KAIHP WS AAI+SAIMTTA   N  G  + D  G VA 
Sbjct  561   YNIDSGTSMSCPHVAAAAVLVKAIHPTWSSAAIRSAIMTTAEIRNNLGLPLNDESGSVAT  620

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSFKCPKKDssspsnlny  482
             PF YGAGHF+P+KAADPGLVYD++Y DYL +IC++    ++D +F CPK    +  NLNY
Sbjct  621   PFAYGAGHFRPTKAADPGLVYDASYKDYLQYICSIGVAKNVDPTFHCPKS-PPTAINLNY  679

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+AI  L+ +M +KRTVTNVG + + Y    K P G S+K  P++L F  VG+K+SF+I
Sbjct  680   PSIAIPKLEDTMTIKRTVTNVGDSKSIYFFTAKPPLGISIKAFPSMLFFDHVGQKKSFTI  739

Query  301   SVKAGS---VKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +VKA      K+  E+ FGWY W+D +H V+SPI VS A
Sbjct  740   TVKARREMLSKQGNEYVFGWYTWTDRLHTVRSPIAVSLA  778



>emb|CAN61728.1| hypothetical protein VITISV_036029 [Vitis vinifera]
Length=860

 Score =   367 bits (942),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 264/385 (69%), Gaps = 15/385 (4%)
 Frame = -3

Query  1342  KMETFPLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVG----SVYRSTEVE  1181
             K + +PLV+A D  +PG    N    C   +L P+KVKGK+V CL G     + +  EV+
Sbjct  411   KKKMYPLVFAADAVVPGVPKNNTAANCNFGSLDPKKVKGKIVLCLRGGMTLRIEKGIEVK  470

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG   ILGN    G ++P    L+P T +    +   I  YIK+ K P+AT+IPG TV
Sbjct  471   RAGGVGFILGNTPENGFDLPADPHLLPATAV-SSEDVTKIRNYIKSTKKPMATIIPGXTV  529

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
               AKP+P MA F S GP++++PNILKPDIT PGLNILAAWSE SSP  +  D R VKYNI
Sbjct  530   LHAKPAPFMASFXSRGPNTIDPNILKPDITGPGLNILAAWSEGSSPTRSELDPRVVKYNI  589

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MTTA   N  G+ I D+ G  A PF 
Sbjct  590   FSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMTTAGLVNNIGKPITDSSGNPANPFQ  649

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             YG+GHF+P+KAADPGLVYD+TYTDYLL+ C +   SLD+SFKCPK  S S +NLNYPSL 
Sbjct  650   YGSGHFRPTKAADPGLVYDTTYTDYLLYHCNIGVKSLDSSFKCPKV-SPSSNNLNYPSLQ  708

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I+ LK  + V RT TNVGS  + Y   VK+P GFSV++ P++L F  VG+K+SF I+V+A
Sbjct  709   ISKLKRKVTVTRTATNVGSARSIYFSSVKSPVGFSVRVEPSILYFNHVGQKKSFDITVEA  768

Query  289   ----GSVKKVGEFEFGWYKWSDGIH  227
                  S K   E+ FGWY W+DGIH
Sbjct  769   RNPKASKKNDTEYAFGWYTWNDGIH  793



>gb|EYU28145.1| hypothetical protein MIMGU_mgv1a021952mg [Erythranthe guttata]
Length=775

 Score =   365 bits (936),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 210/384 (55%), Positives = 262/384 (68%), Gaps = 9/384 (2%)
 Frame = -3

Query  1333  TFPLVYAGDVELPGSTNFP--GFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERAGGAAV  1160
             T+PLVYA DVE+PG+T     G CLP TLSP  V GK VFC  G    + EV+RAGG A 
Sbjct  394   TYPLVYAADVEIPGTTTADTFGLCLPGTLSPALVAGKAVFCWKGDTVSALEVQRAGGVAA  453

Query  1159  ILGNIGSEVPVGS--FLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG-AKPSP  989
             +LGN    V V    ++IP + +    +   I  YI++   P ATL P +T+ G + P+P
Sbjct  454   VLGNPKEGVGVSQTPYVIPAS-VVLSDQKLKIYNYIRSTATPTATLTPARTLIGGSSPTP  512

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              MAPFTS GP+++EPN+LKPDITAPG NILAAWSE +SPF    D+R  KYNIISGTSMS
Sbjct  513   FMAPFTSRGPNAIEPNLLKPDITAPGFNILAAWSEVASPFGVASDNRVAKYNIISGTSMS  572

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQ  629
             CPHV+ V AL+KAIHP WS AAI+SA+MTT +  N     I DA G  A P  YG+GH Q
Sbjct  573   CPHVAGVAALIKAIHPDWSSAAIRSALMTTTSPINNLDNLITDALGIFATPLQYGSGHIQ  632

Query  628   PSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGS  449
             PSKAADPGLVYD++Y+DYLLF+C+ TG  LD +F CP     S SNLNYPSLAI  L G+
Sbjct  633   PSKAADPGLVYDASYSDYLLFLCSSTGNFLDPTFNCPII-PPSASNLNYPSLAITNLIGA  691

Query  448   MVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVG  269
             + V+RTVTNVG+ N TY+V    P G++  ISP++L F   GEKQSF+I+V A +     
Sbjct  692   VTVERTVTNVGAGNTTYTVSTSVPRGYTFTISPSILHFSATGEKQSFTITVAAAATASGN  751

Query  268   EFEFGWYKWSDGIHMVKSPIVVSS  197
                FGWY W DG H+V SP+V+++
Sbjct  752   --AFGWYVWFDGTHVVTSPVVINT  773



>gb|KDP21172.1| hypothetical protein JCGZ_21643 [Jatropha curcas]
Length=782

 Score =   365 bits (936),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 267/401 (67%), Gaps = 14/401 (3%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ++++  K  +  PLVYAGDV   G   N    CLP++LSP+KVKGK+V C+ G+   + +
Sbjct  381   QTVTPGKLDKAHPLVYAGDVAAHGVLRNQTNQCLPNSLSPKKVKGKIVLCIRGAGTRIEK  440

Query  1195  STEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV RAGGA  ILGN    G+++P  + ++P T + Y ++   +LKYI++ KNP A + 
Sbjct  441   GMEVRRAGGAGFILGNSKAYGNDIPADAHVLPATALGY-NDALKVLKYIRSTKNPTAIIE  499

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
                T+    P+P+MA FTS GP++V+PNILKPDITAPG+NILAAWS  SSP     DHR 
Sbjct  500   KAHTLLRHTPAPSMASFTSRGPNTVDPNILKPDITAPGVNILAAWSGGSSPTKLSSDHRI  559

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
             V+YNI SGTSM+ PHV+A  ALLKAIHP WS AAI+SAIMTTA T+N +G  I D++G++
Sbjct  560   VEYNIESGTSMATPHVAATAALLKAIHPTWSSAAIRSAIMTTAWTKNNEGNPITDSFGKI  619

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGT-SLDTSFKCPKKDssspsnl  488
             A PF  G+GHF+P+KAADPGLVYD+++ DY+ ++C      +    F CPKK   + +  
Sbjct  620   ADPFQLGSGHFRPAKAADPGLVYDASFKDYVQYLCGYDHDGTHKKRFGCPKKPEPTYNLN  679

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
                       + ++++KR+VTNVG  N+ Y    K P GFS++ SP+VL F  + +K+SF
Sbjct  680   YPSIAVSKIKETAVIIKRSVTNVGDENSIYFFTAKPPFGFSIEASPSVLYFDRIDQKKSF  739

Query  307   SISVKA---GSVKKV--GEFEFGWYKWSDGIHMVKSPIVVS  200
             +I+V+A   G  KK+   ++ FGWY W+D  H V+SPI VS
Sbjct  740   NITVRARNFGMAKKIYKDDYAFGWYTWTDNYHYVRSPIAVS  780



>ref|XP_006467568.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=777

 Score =   364 bits (934),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 274/396 (69%), Gaps = 15/396 (4%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVE  1181
             +KKM   PLVYA DV +PG   N    CLP +L+PEKVKGK+V C+ GS ++     EV+
Sbjct  386   LKKMH--PLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVK  443

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG  +ILGN    G+E    +  +P T + Y  +   I +YIK+  NP A +   +TV
Sbjct  444   RAGGVGLILGNSPANGNEYSYDAHYLPATAVLY-DDAIKIHEYIKSTNNPTAIIKHARTV  502

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                +P+P MA FTS GP++++P ILKPDITAPGLNILAAWSEASSP     D R VKY I
Sbjct  503   LHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTI  562

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA  +N K   I +A G +A PF 
Sbjct  563   FSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTAWMKNNKALPITNADGSIATPFS  622

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +G+GHF+P+KAADPGLVYD++Y DYLL++C+   +  +  F+CP K   S  NLNYPS+A
Sbjct  623   FGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTNPVFRCPNK-PPSALNLNYPSIA  681

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             I  L G+++VKRTVTNVG + + Y    K P G SVK +P++L F  +G+K+SF+I+V+ 
Sbjct  682   IPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRL  741

Query  289   GS-VKKVG---EFEFGWYKWSDGIHMVKSPIVVSSA  194
             GS   + G   ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  742   GSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  777



>gb|KHG30296.1| Subtilisin-like protease [Gossypium arboreum]
Length=778

 Score =   363 bits (933),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 216/395 (55%), Positives = 265/395 (67%), Gaps = 18/395 (5%)
 Frame = -3

Query  1348  IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVE  1181
             +KKM   PLVYAGDV +PG   N  G CLP +L P KVKGK+V C  G+   V +  EV+
Sbjct  386   MKKMS--PLVYAGDVVVPGVPLNVTGQCLPGSLDPNKVKGKIVVCTRGAGLRVGKGLEVK  443

Query  1180  RAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             RAGG   +L N    G E+   + L+P T + Y S    IL+YI + KNP+A + PG+TV
Sbjct  444   RAGGVGFVLANAKANGDEIACDAHLLPATTLTYDSGIK-ILEYINSTKNPMAVVSPGRTV  502

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
                KP+P MA FTS GP+ V+PNILKPDITAPGLNILAAWSEASSP   P+D RSVKYNI
Sbjct  503   LKYKPAPFMAGFTSRGPNVVDPNILKPDITAPGLNILAAWSEASSPSKLPEDKRSVKYNI  562

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
              SGTSMSCPHVS   ALLKAIHP WS AAIKSA+MTTA   N  G+AI DA G  A PF 
Sbjct  563   YSGTSMSCPHVSGAAALLKAIHPDWSIAAIKSALMTTAAITNSLGKAITDAGGNNATPFQ  622

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTS---LDTSFKCPKKDssspsnlnyp  479
             +GAGHF+P KA DPGL+YD++Y DYLL++CT    S   L ++FKCP  +  S  NLNYP
Sbjct  623   FGAGHFRPIKAVDPGLIYDASYDDYLLYLCTAGPKSLIELSSTFKCP-PNPPSTLNLNYP  681

Query  478   sLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSIS  299
             S AI  L  ++ + RTVTN+G   +TY    K P G  VK SP++L+F  +GEK SF+I+
Sbjct  682   SFAIPNLNTTVTITRTVTNIGRPKSTYFFSAKPPPGVRVKASPSILQFKRIGEKLSFNIT  741

Query  298   VKAGS---VKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             V   +   VKK  E+ FGWY W    + V+SP+ V
Sbjct  742   VSPINDPPVKK-SEYGFGWYSWDGRYYHVRSPMAV  775



>ref|XP_010481547.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   363 bits (933),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 267/404 (66%), Gaps = 16/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  391   ESITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSLRPELVAGKVVLCLRGAGSRIGK  450

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGGA +ILGN    G+E+P  S  +  T    P+  + IL YIKT+KNP+A + 
Sbjct  451   GIEVKRAGGAGMILGNAPANGNEIPSDSHFV-ATATVTPTVVEKILDYIKTDKNPMAFIK  509

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PGKTV+    +P M  F+S GP+ V+PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  510   PGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITAPGLNILAAWSGADSPSKVSIDQRV  569

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               +NI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  570   ADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDVDGLP  629

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T +D +FKCP K      NLN
Sbjct  630   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNFTDIDPTFKCPSK-IPPGYNLN  688

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+AI  L  ++ VKRTVTNVG  N  +TY      P+G +VK  P VL F  +G+KQ 
Sbjct  689   YPSIAIPNLNRTVTVKRTVTNVGIGNWTSTYVFNANPPSGVTVKAIPNVLVFNRIGQKQR  748

Query  310   FSISVKAGS-----VKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I +K  +       + G+++FGW+ W+D  H+V+SPI VS A
Sbjct  749   FKIVIKPRTDLVLNATEKGQYQFGWFSWTDSDHVVRSPIAVSLA  792



>ref|XP_002522297.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF40155.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=776

 Score =   361 bits (927),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 203/401 (51%), Positives = 273/401 (68%), Gaps = 13/401 (3%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ++++  K  + +PLVYA D+  PG   N    CLP++LSP+KVKGK+V C+ G+   V +
Sbjct  378   QTVTPDKLDKMYPLVYAADMVAPGVLQNETNQCLPNSLSPDKVKGKIVLCMRGAGMRVGK  437

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGG   ILGN    G++V V + ++PGT +      + ILKYIK+ +NP AT+ 
Sbjct  438   GMEVKRAGGVGYILGNSPANGNDVSVDAHVLPGTAVTSDQAIE-ILKYIKSTENPTATIG  496

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
               KTV    P+P+MA F+S GP+ ++PNILKPDI+APG+NILAAWS AS P     D+R+
Sbjct  497   KAKTVLHYSPAPSMAAFSSRGPNVIDPNILKPDISAPGVNILAAWSGASPPTKLSTDNRT  556

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
             VK+NI SGTSM+CPHV+A  ALLKAIHP WS AAI+SAIMTTA  +N KG+ I D  GE 
Sbjct  557   VKFNIDSGTSMACPHVAAAAALLKAIHPTWSSAAIRSAIMTTAWMKNNKGQPITDPSGEP  616

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF +G+G F+P+KAADPGLVYD+TY DY+ ++C      +D  +KCP  + S   NLN
Sbjct  617   ATPFQFGSGQFRPAKAADPGLVYDATYKDYVHYLCNYGLKDIDPKYKCP-TELSPAYNLN  675

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFS  305
             YPS+AI  L G++ +KR+V NVG++N+ Y    K P GFSVK SP++L F  V +K+SF+
Sbjct  676   YPSIAIPRLNGTVTIKRSVRNVGASNSVYFFTAKPPMGFSVKASPSILNFNHVNQKKSFT  735

Query  304   ISVKAG----SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             I + A        +  E+ FGWY W+D  H V+SPI VS A
Sbjct  736   IRITANPEMAKKHQKDEYAFGWYTWTDSFHYVRSPIAVSLA  776



>ref|XP_010052139.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=776

 Score =   360 bits (925),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 271/402 (67%), Gaps = 16/402 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ++++       +PL+YAGD   P  S    G CLP++L+P KV+GK+V C+ G+   V +
Sbjct  379   QTVTPYHSNNMYPLIYAGDAVAPDVSKEDSGQCLPNSLNPNKVRGKIVLCIRGNGTRVGK  438

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV RAGGA  ILGN    G++    + ++P T + + S+   I  Y+++ K+P+A ++
Sbjct  439   GMEVRRAGGAGFILGNSPANGADQTCDAHVLPATAVTH-SDATRIYDYVRSTKSPMARIV  497

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             P +TV   KP+P MA FTS GP+ ++P+ILKPDI+APG+NILAAWSEA SP     D R 
Sbjct  498   PARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAPGVNILAAWSEADSPTKLESDPRI  557

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
             VKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA   + +G+ I DA G +
Sbjct  558   VKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRSALMTTAFHLDNRGKPITDAAGTL  617

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  GAGH  P + ADPGLVYD++Y+DY  ++C+  G   D SF+CP K+     NLN
Sbjct  618   ATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLCSF-GIK-DPSFQCP-KERIVSRNLN  674

Query  484   ypsLAIAGLKGSMVVKRTVTNVGST-NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             YP+L I+ L G++ VKRTVTNVG   N+ Y   VK P GF V I P++L F  +G+K+SF
Sbjct  675   YPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVKPPTGFLVTIRPSLLVFDRIGQKRSF  734

Query  307   SISVKAGS--VKKV--GEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +I+VKA +  VK++   ++ FGWY W+DGIH V SP+ +S A
Sbjct  735   TITVKARNSMVKRILGDDYAFGWYGWNDGIHNVNSPMAISLA  776



>ref|XP_010441687.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   360 bits (925),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 206/404 (51%), Positives = 267/404 (66%), Gaps = 16/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  391   ESITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSLKPELVAGKVVLCLRGAGPRIGK  450

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGGA +ILGN    G+E+P  S  +  T    P+  + IL YIKT+KNP+A + 
Sbjct  451   GIEVKRAGGAGMILGNAPANGNEIPSDSHFV-ATAAVTPTVVEKILDYIKTDKNPMAFIK  509

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PGKTV+    +P M  F+S GP+ V+PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  510   PGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITAPGLNILAAWSGADSPSKVSIDQRV  569

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               +NI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  570   ADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDTNGLP  629

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAA+PGLVYD++Y  YLL+ C+V  T +D +FKCP K      NLN
Sbjct  630   ANPFALGSGHFRPTKAANPGLVYDASYRAYLLYGCSVNFTDIDPTFKCPSK-IPPGYNLN  688

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+AI  L  ++ VKRTVTNVG  N  +TY      P+G SV+  P VL F  +G+KQ 
Sbjct  689   YPSIAIPNLNRTVTVKRTVTNVGIGNSTSTYVFNANPPSGVSVEAIPNVLVFDRIGQKQR  748

Query  310   FSISVKAGS-----VKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I +K  +       + G+++FGW+ W+D  H+V+SPI VS A
Sbjct  749   FKIVIKPRTDLVLNATEKGQYQFGWFSWADRDHVVRSPIAVSLA  792



>ref|XP_010494682.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   360 bits (925),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 206/404 (51%), Positives = 265/404 (66%), Gaps = 16/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ESI+A K  +  PLVYA +V +PG + N    CLP++L PE V GKVV CL G+   + +
Sbjct  391   ESITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSLRPELVAGKVVLCLRGAGSRIGK  450

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV+RAGGA +ILGN    G+E+P  S  +  T    P+  + IL YIKT+KNP+A + 
Sbjct  451   GIEVKRAGGAGMILGNAPANGNEIPSDSHFV-ATAAVTPTVVEKILDYIKTDKNPMAFIK  509

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             PGKTV+    +P M  F+S GP+ V+PNILKPDITAPGLNILAAWS A SP     D R 
Sbjct  510   PGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITAPGLNILAAWSGADSPSKVSVDQRV  569

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
               +NI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA+MTTA   N + + I+D  G  
Sbjct  570   ADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMTTAWMTNDEKKPIQDVDGLP  629

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  G+GHF+P+KAADPGLVYD++Y  YLL+ C+V  T +D +FKCP K      NLN
Sbjct  630   ANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNFTDIDPTFKCPSK-IPPGYNLN  688

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTN--ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             YPS+AI  L   + VKRTVTNVG  N  +TY      P+  SV+  P VL F  +G+KQ 
Sbjct  689   YPSVAIPNLNRMVTVKRTVTNVGIGNSTSTYLFNANPPSSVSVEAIPNVLVFNRIGQKQR  748

Query  310   FSISVKAGS-----VKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I +K  +       + G+++FGW+ W+D  H+V+SPI VS A
Sbjct  749   FKIVIKPRTDLVLNATEKGQYQFGWFSWTDSDHVVRSPIAVSLA  792



>gb|KCW76039.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
 gb|KCW76040.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
Length=771

 Score =   353 bits (906),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 266/402 (66%), Gaps = 21/402 (5%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ++++       +PL+YAGD   P  S    G CLP++L+P KV+GK+V C+ G+   V +
Sbjct  379   QTVTPYHSNNMYPLIYAGDAVAPDVSKEDSGQCLPNSLNPNKVRGKIVLCIRGNGTRVGK  438

Query  1195  STEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV RAGGA  ILGN    G++    + ++P T + + S+   I  Y+++ K+P+A ++
Sbjct  439   GMEVRRAGGAGFILGNSPANGADQTCDAHVLPATAVTH-SDATRIYDYVRSTKSPMARIV  497

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             P +TV   KP+P MA FTS GP+ ++P+ILKPDI+APG+NILAAWSEA SP     D R 
Sbjct  498   PARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAPGVNILAAWSEADSPTKLESDPRI  557

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
             VKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA   + +G  I DA G +
Sbjct  558   VKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRSALMTTAFQLDNRGRPITDAAGTL  617

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  GAGH  P + ADPGLVYD++Y+DY  ++C+          K PKK     SNLN
Sbjct  618   ATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLCSF-------GIKDPKK-RIVSSNLN  669

Query  484   ypsLAIAGLKGSMVVKRTVTNVGST-NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             YP+L I+ L G++ VKRTVTNVG   N+ Y   VK P GF V I P++L F  +G+K+SF
Sbjct  670   YPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVKPPTGFLVTIRPSLLVFDRIGQKRSF  729

Query  307   SISVKAGS--VKKV--GEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +I++KA +  VK++   ++ FGWY W+DGIH V SP+ +S A
Sbjct  730   TITIKARNSMVKRILGDDYAFGWYGWNDGIHNVNSPMAISLA  771



>ref|XP_010052138.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=771

 Score =   352 bits (902),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 267/402 (66%), Gaps = 21/402 (5%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYR  1196
             ++++     + +PL+YAGD   P  S    G CLP++L+P+KV+GK+V C+ G+   V +
Sbjct  379   QTVTPYHSNKMYPLIYAGDAVAPNVSKEDSGQCLPNSLNPKKVRGKIVLCISGNGPRVGK  438

Query  1195  STEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLI  1025
               EV RAGGA  ILGN    G+++   + ++P T + +   T  I  YI++ K+P A ++
Sbjct  439   GMEVRRAGGAGFILGNSPADGADLTCDAHVLPATAVTHYDAT-RIYDYIRSTKSPTARIV  497

Query  1024  PGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRS  845
             P +TV   KP+PA+A  TS GP+ ++P+ILKPDI+APG+NILAAWSEA SP     D R 
Sbjct  498   PARTVLYTKPAPAIAALTSRGPNVIDPDILKPDISAPGVNILAAWSEADSPTKLESDPRI  557

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV  665
             VKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA   + +G  I DA G +
Sbjct  558   VKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRSALMTTAFQLDNRGRPITDAAGTL  617

Query  664   AGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnln  485
             A PF  GAGH  P + ADPGLVYD++Y+DY  ++C+          K PKK     SNLN
Sbjct  618   ATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLCSF-------GIKDPKK-RIVSSNLN  669

Query  484   ypsLAIAGLKGSMVVKRTVTNVGST-NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             YP+L I+ L G++ VKRTVTNVG   N+ Y   VK P GF V I P++L F  +G+K+SF
Sbjct  670   YPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVKPPTGFLVTIRPSLLVFDRIGQKRSF  729

Query  307   SISVKAGS--VKKV--GEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +I++KA +  VK++   ++ FGWY W+DGIH V SP+ +S A
Sbjct  730   TITIKARNSMVKRILGDDYAFGWYGWNDGIHNVNSPMAISLA  771



>tpg|DAA57792.1| TPA: putative subtilase family protein [Zea mays]
Length=806

 Score =   352 bits (903),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 207/394 (53%), Positives = 267/394 (68%), Gaps = 20/394 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVYA D  +PG+  N    CLP++L+ +KV+GK+V CL G+   V +  EV+RAGGAA
Sbjct  412   YPLVYAADAVVPGTPANVSNQCLPNSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAA  471

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++LGN    GSEVPV + ++PGT +   ++ D IL+YI ++ +P A L P +TV   +PS
Sbjct  472   ILLGNPAASGSEVPVDAHVLPGTAVAA-ADADTILRYINSSSSPTAVLDPSRTVVDVRPS  530

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ +EP+ILKPDITAPGLNILAAWS ASSP     DHR V+YNI+SGTSM
Sbjct  531   PVMAQFSSRGPNVLEPSILKPDITAPGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSM  590

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPH SA  AL+KA HP WS AAI+SAIMTTATT + +G  + +  G VAGP  YG+GH 
Sbjct  591   SCPHASAAAALVKAAHPDWSSAAIRSAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHI  650

Query  631   QPSKAADPGLVYDSTYTDYLLFICTV----TGTSLDTSFKCPKKDssspsnlnypsLAIA  464
             +P  A DPGLVYD++Y DYLLF C      +G+ LD S  C       P  LN+PS+A+ 
Sbjct  651   RPRHALDPGLVYDTSYHDYLLFACAASSAGSGSQLDRSVPC-PPRPPPPHQLNHPSVAVR  709

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGS  284
             GL GS+ V+RTVTNVG   A Y+V V  PAG SV +SP  L+F   GEK++F I ++A S
Sbjct  710   GLNGSVTVRRTVTNVGPGAARYAVAVVEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAAS  769

Query  283   VKK------VGEFEFGWYKWSD-GIHMVKSPIVV  203
               +       G+   G Y WSD G H+V+SPIVV
Sbjct  770   RGRSGARVARGQVVAGSYAWSDGGAHVVRSPIVV  803



>ref|XP_002317314.1| subtilase family protein [Populus trichocarpa]
 gb|EEE97926.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   351 bits (900),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 275/404 (68%), Gaps = 18/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDV---ELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---V  1202
             ++++  K  +  PLV+A D     +P   N    CLP++LSP KVKGK+V C+ GS   V
Sbjct  376   QTVTPYKLDKDCPLVFAADAVASNVP--ENVTSQCLPNSLSPRKVKGKIVLCMRGSGMRV  433

Query  1201  YRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +  EV+RAGG   ILGN    G++V V + ++P T++ Y ++   IL YI++ KNP+A 
Sbjct  434   AKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATSVGY-NDAMKILNYIRSTKNPMAR  492

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +   +T+   +P+P MA FTS GP+ + P+ILKPDITAPG+NILAAWS A++P    +D 
Sbjct  493   IGIARTILQYRPAPVMASFTSRGPNVIHPSILKPDITAPGVNILAAWSGATAPSKLYEDK  552

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V+YNIISGTSM+CPHV+A  ALL+AIHP WS AAI+SA+MTTA  +N  G+ I D  G
Sbjct  553   RLVRYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIRSALMTTAWMKNNMGQPIADQSG  612

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsn  491
               A PF +G+GHF+P+KAADPGLVYD++YTDYLL++C+    ++   FKCP     S  N
Sbjct  613   NAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCSYGVKNVYPKFKCPAVS-PSIYN  671

Query  490   lnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
              NYPS+++  L G++ + RTVTNVG++++ Y    + P GF+VK SP+VL F  VG+K+S
Sbjct  672   FNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSARPPLGFAVKASPSVLFFNHVGQKKS  731

Query  310   FSISVKA-----GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F I++KA      +    GE+ FGWY WS+G H V+SP+ VS A
Sbjct  732   FIITIKAREDSMSNGHNKGEYAFGWYTWSNGHHYVRSPMAVSLA  775



>ref|XP_011010424.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=775

 Score =   350 bits (898),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 275/404 (68%), Gaps = 18/404 (4%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDV---ELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---V  1202
             ++++  K  +  PLV+A D     +P   N    CLP++LSP KV+GK+V C+ GS   V
Sbjct  376   QTVTPYKLDKDCPLVFAADAVASNVP--KNVTSQCLPNSLSPRKVRGKIVLCMRGSGMRV  433

Query  1201  YRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +  EV+RAGG   ILGN    G++V V + ++P T++ Y ++   IL YI++ KNP+A 
Sbjct  434   AKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATSVGY-NDAMKILNYIRSTKNPMAR  492

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +   +TV   +P+P MA FTS GP+ + P+ILKPDITAPG+NILAAWS A++P    +D 
Sbjct  493   IGLARTVLHYRPAPVMASFTSRGPNVIHPSILKPDITAPGVNILAAWSGATAPSKLYEDK  552

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R VKYNIISGTSM+CPHV+A  ALL+AIHP WS AAI+SA+MTTA  +N  G+ I D  G
Sbjct  553   RLVKYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIRSALMTTAWMKNNMGQPIADQSG  612

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsn  491
               A PF +G+GHF+P+KAADPGLVYD++YTDYLL++C+    ++   FKCP     S  N
Sbjct  613   NAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCSYGVENVYPKFKCPAVS-PSIYN  671

Query  490   lnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
              NYPS+++  L G++ + RTVTNVG++++ Y    + P GF+VK SP+VL F  VG+K+S
Sbjct  672   FNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSARPPLGFAVKASPSVLFFNHVGQKKS  731

Query  310   FSISVKA-----GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             F +++KA      +    GE+ FGWY WS+G H V+SP+ VS A
Sbjct  732   FIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHDVRSPMAVSLA  775



>ref|XP_008675086.1| PREDICTED: subtilisin-like protease isoform X3 [Zea mays]
Length=854

 Score =   351 bits (901),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 207/394 (53%), Positives = 267/394 (68%), Gaps = 20/394 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVYA D  +PG+  N    CLP++L+ +KV+GK+V CL G+   V +  EV+RAGGAA
Sbjct  460   YPLVYAADAVVPGTPANVSNQCLPNSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAA  519

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++LGN    GSEVPV + ++PGT +   ++ D IL+YI ++ +P A L P +TV   +PS
Sbjct  520   ILLGNPAASGSEVPVDAHVLPGTAVAA-ADADTILRYINSSSSPTAVLDPSRTVVDVRPS  578

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ +EP+ILKPDITAPGLNILAAWS ASSP     DHR V+YNI+SGTSM
Sbjct  579   PVMAQFSSRGPNVLEPSILKPDITAPGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSM  638

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPH SA  AL+KA HP WS AAI+SAIMTTATT + +G  + +  G VAGP  YG+GH 
Sbjct  639   SCPHASAAAALVKAAHPDWSSAAIRSAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHI  698

Query  631   QPSKAADPGLVYDSTYTDYLLFICTV----TGTSLDTSFKCPKKDssspsnlnypsLAIA  464
             +P  A DPGLVYD++Y DYLLF C      +G+ LD S  C       P  LN+PS+A+ 
Sbjct  699   RPRHALDPGLVYDTSYHDYLLFACAASSAGSGSQLDRSVPC-PPRPPPPHQLNHPSVAVR  757

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGS  284
             GL GS+ V+RTVTNVG   A Y+V V  PAG SV +SP  L+F   GEK++F I ++A S
Sbjct  758   GLNGSVTVRRTVTNVGPGAARYAVAVVEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAAS  817

Query  283   VKK------VGEFEFGWYKWSD-GIHMVKSPIVV  203
               +       G+   G Y WSD G H+V+SPIVV
Sbjct  818   RGRSGARVARGQVVAGSYAWSDGGAHVVRSPIVV  851



>ref|XP_011045349.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Populus 
euphratica]
Length=775

 Score =   349 bits (896),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 197/405 (49%), Positives = 276/405 (68%), Gaps = 20/405 (5%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPGSTNFP----GFCLPDTLSPEKVKGKVVFCLVGS---  1205
             ++++  K  +  PLV+A D     ++N P      CLP++LSP KV+GK+V C+ GS   
Sbjct  376   QTVTPYKLDKDCPLVFAADAV---ASNVPKNGTSQCLPNSLSPRKVRGKIVLCMRGSGMR  432

Query  1204  VYRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVA  1034
             V +  EV+RAGG   ILGN    G++V V + ++P T++ Y ++   IL YI++ KNP+A
Sbjct  433   VAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATSVGY-NDAMKILNYIRSTKNPMA  491

Query  1033  TLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQD  854
              +   +TV   +P+P MA FTS GP+ + P+ILKPDITAPG+NILAAWS A++P    +D
Sbjct  492   RIGLARTVLHYRPAPVMASFTSRGPNVIHPSILKPDITAPGVNILAAWSGATAPSKLYED  551

Query  853   HRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAY  674
              R VKYNIISGTSM+CPHV+A  ALL+AIHP WS AAI+SA+MTTA  +N  G+ I D  
Sbjct  552   KRLVKYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIRSALMTTAWMKNNMGQPIADQS  611

Query  673   GEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDsssps  494
             G  A PF +G+GHF+P+KAADPGLVYD++YTDYLL++C+    ++   FKCP     S  
Sbjct  612   GNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCSYGVENVYPKFKCPAVS-PSIY  670

Query  493   nlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
             N NYPS+++  L G++ + RTVTNVG++++ Y    + P GF+VK SP+VL F  VG+K+
Sbjct  671   NFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSARPPLGFAVKASPSVLFFNHVGQKK  730

Query  313   SFSISVKA-----GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             SF +++KA      +    GE+ FGWY WS+G H V+SP+ VS A
Sbjct  731   SFIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHDVRSPMAVSLA  775



>ref|XP_008439697.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=793

 Score =   348 bits (894),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 196/408 (48%), Positives = 265/408 (65%), Gaps = 24/408 (6%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS-VYR---ST  1190
             S +++ + +PLVYAGD+  P +  N  G C+  +LS EK KGK V C  G  + R   S 
Sbjct  388   SKLERKKMYPLVYAGDIMNPHAPRNQSGLCVAGSLSHEKAKGKXVLCFRGEGISRFAGSL  447

Query  1189  EVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPG  1019
             EV+R+GGA +ILGN+   G         +P T + Y  + + ILKYIK+  NP AT++P 
Sbjct  448   EVQRSGGAGMILGNVPAVGRRPHADPHFVPATAVSY-EDANVILKYIKSRTNPTATIVPP  506

Query  1018  KTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQ--DHRS  845
              T++G++P+PAMA F+S GP+ ++P+ LKPDITAPG++ILAAWSE  SP    +  D R 
Sbjct  507   VTIYGSRPAPAMANFSSRGPNPIDPHFLKPDITAPGVDILAAWSEQDSPTKLSKYLDPRI  566

Query  844   VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAY---  674
             V+YN+ SGTSMSCPHVSA  ALL+AIHP WS AAI+SA+MTT+TT N  G+ I D     
Sbjct  567   VQYNLYSGTSMSCPHVSAAAALLRAIHPTWSQAAIRSALMTTSTTNNKSGQPITDDSTPD  626

Query  673   GEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDsssps  494
                A PF +G+GHF+PSKAADPGLVYDS YTDYL ++C +   S+D SF CP +    P 
Sbjct  627   NSPATPFSFGSGHFRPSKAADPGLVYDSNYTDYLHYLCGLKMNSIDPSFTCPPR-PLHPH  685

Query  493   nlnypsLAIAGLKGSMVVKRTVTNV-GSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
             +LNYPS+A+  L+  + +KRTVTNV G   + Y  + +AP G +V  SP +L F  VGE+
Sbjct  686   DLNYPSIAVPQLRDVVRIKRTVTNVGGGGKSVYFFKSEAPPGVAVSASPNILYFNRVGER  745

Query  316   QSFSISVKAGSVKKVG--------EFEFGWYKWSDGIHMVKSPIVVSS  197
             + F+I++                 E+ FGW+ WSD IH V+SPI VS+
Sbjct  746   KKFTITISRKVNSSSSSRRSKKGEEYSFGWFAWSDEIHYVRSPIAVST  793



>ref|XP_011045348.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Populus 
euphratica]
Length=790

 Score =   346 bits (888),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 260/370 (70%), Gaps = 13/370 (4%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGNI---GSEVPVGSFLIP  1109
             CLP++LSP KV+GK+V C+ GS   V +  EV+RAGG   ILGN    G++V V + ++P
Sbjct  423   CLPNSLSPRKVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLP  482

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              T++ Y ++   IL YI++ KNP+A +   +TV   +P+P MA FTS GP+ + P+ILKP
Sbjct  483   ATSVGY-NDAMKILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGPNVIHPSILKP  541

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             DITAPG+NILAAWS A++P    +D R VKYNIISGTSM+CPHV+A  ALL+AIHP WS 
Sbjct  542   DITAPGVNILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAALLRAIHPEWSS  601

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             AAI+SA+MTTA  +N  G+ I D  G  A PF +G+GHF+P+KAADPGLVYD++YTDYLL
Sbjct  602   AAIRSALMTTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLL  661

Query  568   FICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVE  389
             ++C+    ++   FKCP     S  N NYPS+++  L G++ + RTVTNVG++++ Y   
Sbjct  662   YLCSYGVENVYPKFKCPAVS-PSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFS  720

Query  388   VKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA-----GSVKKVGEFEFGWYKWSDGIHM  224
              + P GF+VK SP+VL F  VG+K+SF +++KA      +    GE+ FGWY WS+G H 
Sbjct  721   ARPPLGFAVKASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHD  780

Query  223   VKSPIVVSSA  194
             V+SP+ VS A
Sbjct  781   VRSPMAVSLA  790



>ref|XP_008675085.1| PREDICTED: subtilisin-like protease isoform X2 [Zea mays]
Length=858

 Score =   346 bits (888),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 269/404 (67%), Gaps = 30/404 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS---TNFPGF--------CLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             +PLVYA D  +PG+    + PG         CLP++L+ +KV+GK+V CL G+   V + 
Sbjct  454   YPLVYAADAVVPGTPANVSNPGSTVHDRRSQCLPNSLASDKVRGKIVVCLRGAGLRVGKG  513

Query  1192  TEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              EV+RAGGAA++LGN    GSEVPV + ++PGT +   ++ D IL+YI ++ +P A L P
Sbjct  514   LEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTAVAA-ADADTILRYINSSSSPTAVLDP  572

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              +TV   +PSP MA F+S GP+ +EP+ILKPDITAPGLNILAAWS ASSP     DHR V
Sbjct  573   SRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITAPGLNILAAWSGASSPTKLDGDHRVV  632

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             +YNI+SGTSMSCPH SA  AL+KA HP WS AAI+SAIMTTATT + +G  + +  G VA
Sbjct  633   QYNIMSGTSMSCPHASAAAALVKAAHPDWSSAAIRSAIMTTATTSDAEGGPLMNGDGSVA  692

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV----TGTSLDTSFKCPKKDsssps  494
             GP  YG+GH +P  A DPGLVYD++Y DYLLF C      +G+ LD S  C       P 
Sbjct  693   GPMDYGSGHIRPRHALDPGLVYDTSYHDYLLFACAASSAGSGSQLDRSVPC-PPRPPPPH  751

Query  493   nlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
              LN+PS+A+ GL GS+ V+RTVTNVG   A Y+V V  PAG SV +SP  L+F   GEK+
Sbjct  752   QLNHPSVAVRGLNGSVTVRRTVTNVGPGAARYAVAVVEPAGVSVTVSPRRLRFARAGEKR  811

Query  313   SFSISVKAGSVKK------VGEFEFGWYKWSD-GIHMVKSPIVV  203
             +F I ++A S  +       G+   G Y WSD G H+V+SPIVV
Sbjct  812   AFRIKLEAASRGRSGARVARGQVVAGSYAWSDGGAHVVRSPIVV  855



>ref|XP_008675084.1| PREDICTED: subtilisin-like protease isoform X1 [Zea mays]
Length=864

 Score =   346 bits (887),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 269/404 (67%), Gaps = 30/404 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELPGS---TNFPGF--------CLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             +PLVYA D  +PG+    + PG         CLP++L+ +KV+GK+V CL G+   V + 
Sbjct  460   YPLVYAADAVVPGTPANVSNPGSTVHDRRSQCLPNSLASDKVRGKIVVCLRGAGLRVGKG  519

Query  1192  TEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              EV+RAGGAA++LGN    GSEVPV + ++PGT +   ++ D IL+YI ++ +P A L P
Sbjct  520   LEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTAVAA-ADADTILRYINSSSSPTAVLDP  578

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              +TV   +PSP MA F+S GP+ +EP+ILKPDITAPGLNILAAWS ASSP     DHR V
Sbjct  579   SRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITAPGLNILAAWSGASSPTKLDGDHRVV  638

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             +YNI+SGTSMSCPH SA  AL+KA HP WS AAI+SAIMTTATT + +G  + +  G VA
Sbjct  639   QYNIMSGTSMSCPHASAAAALVKAAHPDWSSAAIRSAIMTTATTSDAEGGPLMNGDGSVA  698

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV----TGTSLDTSFKCPKKDsssps  494
             GP  YG+GH +P  A DPGLVYD++Y DYLLF C      +G+ LD S  C       P 
Sbjct  699   GPMDYGSGHIRPRHALDPGLVYDTSYHDYLLFACAASSAGSGSQLDRSVPC-PPRPPPPH  757

Query  493   nlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQ  314
              LN+PS+A+ GL GS+ V+RTVTNVG   A Y+V V  PAG SV +SP  L+F   GEK+
Sbjct  758   QLNHPSVAVRGLNGSVTVRRTVTNVGPGAARYAVAVVEPAGVSVTVSPRRLRFARAGEKR  817

Query  313   SFSISVKAGSVKK------VGEFEFGWYKWSD-GIHMVKSPIVV  203
             +F I ++A S  +       G+   G Y WSD G H+V+SPIVV
Sbjct  818   AFRIKLEAASRGRSGARVARGQVVAGSYAWSDGGAHVVRSPIVV  861



>gb|EMS59680.1| Subtilisin-like protease [Triticum urartu]
Length=556

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 196/388 (51%), Positives = 242/388 (62%), Gaps = 48/388 (12%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGS-TNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
              T+P+VYA    +PG+  N    CLP++LSP+KV+GK+V CL GS   V +  EV+RAGG
Sbjct  204   RTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGG  263

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             AA++LGN    GSEVPV + ++PGT +   +  + ILKYI ++ NP A L   +TV   K
Sbjct  264   AAIVLGNPPMYGSEVPVDAHVLPGTAVSM-AGVNTILKYINSSANPTAYLDRSRTVVDVK  322

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             PSP MA F+S GP+++EP+ILKPD+TAPGLNILAAWSEASSP     D R VKYNIISGT
Sbjct  323   PSPVMAQFSSRGPNALEPSILKPDVTAPGLNILAAWSEASSPTKLDGDDRVVKYNIISGT  382

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLK+ HP WS AA                                   
Sbjct  383   SMSCPHVSATAVLLKSAHPDWSTAA-----------------------------------  407

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
              F+P  A DPGLVYD+++ DYLL+ C   G  LD SF CP      P  LNYPS+AI GL
Sbjct  408   -FRPRHALDPGLVYDASFQDYLLYACASEGAQLDHSFPCPA-SPPRPHELNYPSVAIHGL  465

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA-GSV  281
              GS  V RTVTNVG   A YSV V  P GFSVK+SPT L F   GEK+SF+I + A G  
Sbjct  466   NGSTTVHRTVTNVGEHGARYSVAVVEPMGFSVKVSPTSLAFARTGEKKSFTIKIAATGKR  525

Query  280   KKVGEFEF--GWYKWSDGIHMVKSPIVV  203
              +  + ++  G Y WSDG+H V+SP+VV
Sbjct  526   SRRLKMKYLAGSYTWSDGVHAVRSPVVV  553



>gb|EPS68445.1| hypothetical protein M569_06321, partial [Genlisea aurea]
Length=639

 Score =   337 bits (863),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 257/377 (68%), Gaps = 20/377 (5%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGNI---GSEVPVGSFLIP  1109
             C+P +LSPEK  GK++FCL G+   + +  EV+RAGG   ILGN    G  V V    +P
Sbjct  265   CMPGSLSPEKTAGKIIFCLRGNGTRIGKGMEVKRAGGIGYILGNSKLNGKLVAVDPHFLP  324

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              T + Y +    IL YI + ++P A +IP KTV G KP+P+MA FTS GP+++ P++LKP
Sbjct  325   ATAVTYENSLK-ILDYIDSTEDPRAYIIPAKTVVGTKPAPSMAVFTSRGPNTISPDVLKP  383

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             D+TAPG+NILAAWSEASSP     D R VKYNI+SGTSMSCPH++   ALLKA+H +W+ 
Sbjct  384   DVTAPGVNILAAWSEASSPTKMAVDSRVVKYNILSGTSMSCPHIAGAAALLKAVHRNWTS  443

Query  748   AAIKSAIMTTATTENVKGEAI-EDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
             AAI+SAI+TTATT N +G  I E   G  A PF +GAGHF+P+KA DPGLVYD++Y DY+
Sbjct  444   AAIRSAIVTTATTTNKEGAPITESMGGGPADPFQFGAGHFRPTKAVDPGLVYDASYEDYV  503

Query  571   LFICTVTGTSLD----TSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNA  404
             LF+C+  GT+ +    TS KCP ++  SP++LNYPSL I  L  S+ V RTVTNVG+ N+
Sbjct  504   LFLCSSNGTNNNITAFTSAKCP-ENPPSPADLNYPSLQIKQLNKSVTVVRTVTNVGNGNS  562

Query  403   TYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGE-------FEFGWYK  245
             TY  + K P G S++ISP VL+F   G+K SFSI V      +V         F FGWY 
Sbjct  563   TYFAKTKPPPGISIEISPPVLRFDSSGQKMSFSIVVSKNEQFRVNNGTNTNSTFVFGWYT  622

Query  244   WSDGIHMVKSPIVVSSA  194
             WSDGIH V SPI +++A
Sbjct  623   WSDGIHNVASPIAINAA  639



>ref|XP_002971605.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
 gb|EFJ27354.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
Length=800

 Score =   332 bits (852),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 187/372 (50%), Positives = 248/372 (67%), Gaps = 17/372 (5%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVPVGSFLIP  1109
             CLPDTL   KV GKVV CL G    V +S E  RAG A  ILGN     +EV V ++++P
Sbjct  430   CLPDTLDASKVAGKVVICLRGLGTRVGKSQEAIRAGAAGFILGNSAAQANEVSVDAYMLP  489

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
             GT I      +A+L YI +   P+  ++P +TV   KP+P+MA F+S GP+S+ P+ILKP
Sbjct  490   GTAI-NADNANAVLTYINSTNFPLVKIVPARTVLDFKPAPSMAAFSSQGPNSLNPDILKP  548

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             DI+APGLNILAAW+EA+SP   P D+R VKYNIISGTSMSCPHV+   ALL+AI+P WS 
Sbjct  549   DISAPGLNILAAWTEANSPTKLPIDNRIVKYNIISGTSMSCPHVAGTAALLRAIYPSWSP  608

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             AAIKSA+MTTA+  N   + I +  G  A PF++G G   P  AADPGLVYD++  DYLL
Sbjct  609   AAIKSALMTTASIVNNLQQPILNGSGATANPFNFGGGEMNPEAAADPGLVYDTSPRDYLL  668

Query  568   FICTVTGTS------LDT-SFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
             F+C+V   S       DT +F CP    SS +++NYPS+A+A L  +  ++RTVTNVGS 
Sbjct  669   FLCSVGYNSSTIQNVTDTANFTCPNT-LSSIADMNYPSVAVANLTAAKTIQRTVTNVGSQ  727

Query  409   N-ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDG  233
             + A Y    +AP G  + I+P  L F  +GEK+SF+I++      K G++ FG Y+WSDG
Sbjct  728   DTAVYIASFQAPDGIDIVITPNKLTFQSLGEKKSFNITLTPTKRSK-GDYVFGTYQWSDG  786

Query  232   IHMVKSPIVVSS  197
             +H+V+SPI V +
Sbjct  787   MHVVRSPIAVRT  798



>ref|XP_002965730.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
 gb|EFJ33150.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
Length=863

 Score =   332 bits (851),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 246/372 (66%), Gaps = 17/372 (5%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVPVGSFLIP  1109
             CLPDTL   KV G+VV CL G    V +S E  RAG A  ILGN     +EV V ++++P
Sbjct  493   CLPDTLDASKVAGRVVICLRGLGTRVGKSQEAIRAGAAGFILGNSAAQANEVSVDAYMLP  552

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
             GT I      +A+L YI +   P+  ++P +TV   KP+P+MA F+S GP+S+ P+ILKP
Sbjct  553   GTAI-NADNANAVLTYINSTNFPLVKIVPARTVLDFKPAPSMAAFSSQGPNSLNPDILKP  611

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             DI+APGLNILAAW+EA+SP   P D+R VKYNIISGTSMSCPHV+   ALL+AI+P WS 
Sbjct  612   DISAPGLNILAAWTEANSPTKLPIDNRIVKYNIISGTSMSCPHVAGTAALLRAIYPSWSP  671

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             AAIKSA+MTTA+  N   + I +  G  A PF++G G   P  AADPGLVYD++  DYLL
Sbjct  672   AAIKSALMTTASIVNNLQQPILNGSGATANPFNFGGGEMNPEAAADPGLVYDTSPRDYLL  731

Query  568   FIC-------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
             F+C       T+   +   +F CP    SS S++NYPS+A+A L  +  ++RTVTNVGS 
Sbjct  732   FLCSVGYNSSTIQNVTDTANFTCPNT-LSSISDMNYPSVAVANLTAAKTIQRTVTNVGSQ  790

Query  409   N-ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDG  233
             + A Y    +AP G  + I+P  L F  +GEK+SF+I++      K G++ FG Y+WSDG
Sbjct  791   DTAVYIASFQAPDGIDIVITPNKLTFQSLGEKKSFNITLTPTKRSK-GDYVFGTYQWSDG  849

Query  232   IHMVKSPIVVSS  197
             +H+V+SPI V +
Sbjct  850   MHVVRSPIAVRT  861



>gb|AIC80766.1| subtilase [Cicer arietinum]
Length=773

 Score =   327 bits (839),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 251/391 (64%), Gaps = 18/391 (5%)
 Frame = -3

Query  1327  PLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             PLV+A DVE P   S N   +CL +TL P KVKGK+V C+ G    + +  EV+RAGG  
Sbjct  384   PLVFASDVENPSVPSAN-SSYCLDNTLDPSKVKGKIVLCMRGQGTRMKKGLEVQRAGGVG  442

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +ILGN    G+++P     I  T + Y   T  +++YI ++ NP+A L+PG TV  +KP+
Sbjct  443   LILGNNKLYGNDLPSDPHFISATGVNY-DNTLKLIQYIHSSPNPMAQLLPGTTVLDSKPA  501

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFD-TPQDHRSVKYNIISGTS  815
             P+MA FTS GP+ ++PNILKPDITAPG++ILAAW+    P   T  D R VKYNI SGTS
Sbjct  502   PSMAVFTSRGPNIIDPNILKPDITAPGVDILAAWTAKDGPTRMTFNDKRVVKYNIFSGTS  561

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             M+CPHVSA   LLKA++P WS AAI+SAIMT+A   +  G+ I D  G+   PF  G+GH
Sbjct  562   MACPHVSAAAVLLKAMYPTWSPAAIRSAIMTSARANDNTGKPITDETGKPTTPFAMGSGH  621

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             F P +A +PGLVYD++YTDYLL++C + T  +L+ S+ CP      P +LNYPS+ I  L
Sbjct  622   FHPKRATNPGLVYDASYTDYLLYLCNLKTTQNLNLSYNCPNP-LPEPFDLNYPSIQIHKL  680

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAG---  287
               +  ++RTVTNVG   + Y    K P  F++   P+ LKF  +G+K+ F+I+V      
Sbjct  681   NYTKTIQRTVTNVGRNESVYKFIAKPPKEFNIIAFPSKLKFTHLGQKREFTITVTENKDH  740

Query  286   -SVKKVGE-FEFGWYKWSDGIHMVKSPIVVS  200
                K   E + FGWY W+D  H+VKSP+ VS
Sbjct  741   IRTKSDSEKYYFGWYTWTDRRHVVKSPVAVS  771



>ref|XP_004486283.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 251/391 (64%), Gaps = 18/391 (5%)
 Frame = -3

Query  1327  PLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             PLV+A DVE P   S N   +CL +TL P KVKGK+V C+ G    + +  EV+RAGG  
Sbjct  397   PLVFASDVENPSVPSAN-SSYCLDNTLDPSKVKGKIVLCMRGQGTRMKKGLEVQRAGGVG  455

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +ILGN    G+++P     I  T + Y   T  +++YI ++ NP+A L+PG TV  +KP+
Sbjct  456   LILGNNKLYGNDLPSDPHFISATGVNY-DNTLKLIQYIHSSPNPMAQLLPGTTVLDSKPA  514

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFD-TPQDHRSVKYNIISGTS  815
             P+MA FTS GP+ ++PNILKPDITAPG++ILAAW+    P   T  D R VKYNI SGTS
Sbjct  515   PSMAVFTSRGPNIIDPNILKPDITAPGVDILAAWTAKDGPTRMTFNDKRVVKYNIFSGTS  574

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             M+CPHVSA   LLKA++P WS AAI+SAIMT+A   +  G+ I D  G+   PF  G+GH
Sbjct  575   MACPHVSAAAVLLKAMYPTWSPAAIRSAIMTSARANDNTGKPITDETGKPTTPFAMGSGH  634

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSFKCPKKDssspsnlnypsLAIAGL  458
             F P +A +PGLVYD++YTDYLL++C + T  +L+ S+ CP      P +LNYPS+ I  L
Sbjct  635   FHPKRATNPGLVYDASYTDYLLYLCNLKTTQNLNLSYNCPNP-LPEPFDLNYPSIQIHKL  693

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAG---  287
               +  ++RTVTNVG   + Y    K P  F++   P+ LKF  +G+K+ F+I+V      
Sbjct  694   NYTKTIQRTVTNVGRNESVYKFIAKPPKEFNIIAFPSKLKFTHLGQKREFTITVTENKDH  753

Query  286   -SVKKVGE-FEFGWYKWSDGIHMVKSPIVVS  200
                K   E + FGWY W+D  H+VKSP+ VS
Sbjct  754   IRTKSDSEKYYFGWYTWTDRRHVVKSPVAVS  784



>gb|KEH36678.1| subtilisin-like serine protease [Medicago truncatula]
Length=786

 Score =   320 bits (819),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 260/404 (64%), Gaps = 19/404 (5%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPG--STNFPGFCLPDTLSPEKVKGKVVFCLVGS---V  1202
              SI+ ++   +F PLV A DVE  G  S N   +CL +TL P KVKGK+V C+ G    V
Sbjct  384   RSITPLRMGNSFCPLVLASDVEYAGILSAN-SSYCLDNTLDPSKVKGKIVLCMRGQGGRV  442

Query  1201  YRSTEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +S EV+RAGG  +ILGN     ++VP   + IP T + Y   T  +++YI ++ NP+A 
Sbjct  443   KKSLEVQRAGGVGLILGNNKVYANDVPSDPYFIPTTGVTY-ENTLKLVQYIHSSPNPMAQ  501

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFD-TPQD  854
             L+PG+TV   KP+P+MA F+S GP+ ++PNILKPDITAPG++ILAAW+    P   T QD
Sbjct  502   LLPGRTVLDTKPAPSMAIFSSRGPNIIDPNILKPDITAPGVDILAAWTAKDGPTRMTFQD  561

Query  853   HRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAY  674
              R VKYNI SGTSMSCPHVSA   LLKA+HP WS AAI+SA+MT+A   +  G  + D  
Sbjct  562   KRVVKYNIFSGTSMSCPHVSAASVLLKAMHPTWSPAAIRSALMTSARITDNTGNPMTDET  621

Query  673   GEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTS-LDTSFKCPKKDsssp  497
             G    PF  G+GHF P +A+DPGL+YD++Y DYLL++C +  T  ++ ++ CP      P
Sbjct  622   GNPTTPFAMGSGHFYPKRASDPGLIYDASYMDYLLYLCNLNLTQHINLTYNCPNP-LPQP  680

Query  496   snlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
              +LNYPS+ I  L  +  +KRTVTNVGS+ + Y      P  F++  + +VLKF  VG+K
Sbjct  681   FDLNYPSIQIHKLNYTKTIKRTVTNVGSSKSVYKFIANTPKEFNILATSSVLKFKHVGQK  740

Query  316   QSFSISVKAGSVK-----KVGEFEFGWYKWSDGIHMVKSPIVVS  200
             ++F I+V A   +        ++ FGWY W+D  H+V+SPI VS
Sbjct  741   RNFVITVTANRDQLPSKCDPDKYYFGWYIWTDNYHVVRSPIAVS  784



>ref|XP_003541678.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=789

 Score =   320 bits (819),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 186/391 (48%), Positives = 249/391 (64%), Gaps = 16/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLV A DVE PG  +N  GFCL +TL P K +GK+V C+ G    + +  EV+RAGG  
Sbjct  399   YPLVLARDVEHPGLPSNNSGFCLDNTLQPNKARGKIVLCMRGQGERLKKGLEVQRAGGVG  458

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
              ILGN    G +VP     IP T + Y +    +++Y+ +  NP+A ++PG TV   KP+
Sbjct  459   FILGNNKLNGKDVPSDPHFIPATGVSYENSLK-LIQYVHSTPNPMAQILPGTTVLETKPA  517

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFD-TPQDHRSVKYNIISGTS  815
             P+MA F+S GP+ V+PNILKPDITAPG++ILAAW+    P   T  D R VKYNI SGTS
Sbjct  518   PSMASFSSRGPNIVDPNILKPDITAPGVDILAAWTAEDGPTRMTFNDKRVVKYNIFSGTS  577

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHV+A   LLKAIHP WS AAI+SA+MTTA T +  G  + D  G  A PF  G+GH
Sbjct  578   MSCPHVAAAAVLLKAIHPTWSTAAIRSALMTTAMTTDNTGHPLTDETGNPATPFAMGSGH  637

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGT-SLDTSFKCPKKDssspsnlnypsLAIAGL  458
             F P +AADPGLVYD++Y  YLL+ C +  T + + ++ CPK     P  LNYPS+ I  L
Sbjct  638   FNPKRAADPGLVYDASYMGYLLYTCNLGVTQNFNITYNCPKS-FLEPFELNYPSIQIHRL  696

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
               +  +KRTVTNVG   + Y     +P  +S+  +P +LKF  VG+K +F+I+V A   +
Sbjct  697   YYTKTIKRTVTNVGRGRSVYKFSAVSPKEYSITATPNILKFNHVGQKINFAITVTANWSQ  756

Query  277   ---KVG--EFEFGWYKWSDGIHMVKSPIVVS  200
                K G  ++ FGWY W+   H+V+SP+ VS
Sbjct  757   IPTKHGPDKYYFGWYAWTHQHHIVRSPVAVS  787



>ref|XP_006594524.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=785

 Score =   319 bits (818),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 186/391 (48%), Positives = 249/391 (64%), Gaps = 16/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLV A DVE PG  +N  GFCL +TL P K +GK+V C+ G    + +  EV+RAGG  
Sbjct  395   YPLVLARDVEHPGLPSNNSGFCLDNTLQPNKARGKIVLCMRGQGERLKKGLEVQRAGGVG  454

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
              ILGN    G +VP     IP T + Y +    +++Y+ +  NP+A ++PG TV   KP+
Sbjct  455   FILGNNKLNGKDVPSDPHFIPATGVSYENSLK-LIQYVHSTPNPMAQILPGTTVLETKPA  513

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFD-TPQDHRSVKYNIISGTS  815
             P+MA F+S GP+ V+PNILKPDITAPG++ILAAW+    P   T  D R VKYNI SGTS
Sbjct  514   PSMASFSSRGPNIVDPNILKPDITAPGVDILAAWTAEDGPTRMTFNDKRVVKYNIFSGTS  573

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHV+A   LLKAIHP WS AAI+SA+MTTA T +  G  + D  G  A PF  G+GH
Sbjct  574   MSCPHVAAAAVLLKAIHPTWSTAAIRSALMTTAMTTDNTGHPLTDETGNPATPFAMGSGH  633

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGT-SLDTSFKCPKKDssspsnlnypsLAIAGL  458
             F P +AADPGLVYD++Y  YLL+ C +  T + + ++ CPK     P  LNYPS+ I  L
Sbjct  634   FNPKRAADPGLVYDASYMGYLLYTCNLGVTQNFNITYNCPKS-FLEPFELNYPSIQIHRL  692

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
               +  +KRTVTNVG   + Y     +P  +S+  +P +LKF  VG+K +F+I+V A   +
Sbjct  693   YYTKTIKRTVTNVGRGRSVYKFSAVSPKEYSITATPNILKFNHVGQKINFAITVTANWSQ  752

Query  277   ---KVG--EFEFGWYKWSDGIHMVKSPIVVS  200
                K G  ++ FGWY W+   H+V+SP+ VS
Sbjct  753   IPTKHGPDKYYFGWYAWTHQHHIVRSPVAVS  783



>ref|XP_007147961.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
 gb|ESW19955.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
Length=787

 Score =   318 bits (814),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 243/391 (62%), Gaps = 16/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLV A DVE PG   N  GFCL +TL P K +GK+V CL G    + +  E++RAGG  
Sbjct  397   YPLVLAHDVEHPGLPRNNSGFCLDNTLEPNKTRGKIVLCLRGQGGRLKKGLEIQRAGGVG  456

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++LGN    G++VP     IP T + Y +    ++ YI +  NP+   +PGKTV   +P+
Sbjct  457   LVLGNNQLNGNDVPSDPHFIPATGVSYHNAL-KLIHYIHSTPNPMVRFLPGKTVLKTRPA  515

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFD-TPQDHRSVKYNIISGTS  815
             P MA F+S GP+ ++ NILKPDITAPG++ILAAW+    P   T  D R VKYNI+SGTS
Sbjct  516   PFMASFSSRGPNIIDHNILKPDITAPGVDILAAWTAEDGPTRMTYNDKRVVKYNILSGTS  575

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHV+A   LLKAIHP WS  AI+SA+MTTA T +  G  + D  G +A PF  G+GH
Sbjct  576   MSCPHVAAAAVLLKAIHPTWSSVAIRSALMTTAITTDNTGHPMVDESGNLATPFAMGSGH  635

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVTGT-SLDTSFKCPKKDssspsnlnypsLAIAGL  458
             F P +AADPGLVYD++Y DY L+ C    T  L+ ++ CPK        LNYPS+ I  L
Sbjct  636   FNPKRAADPGLVYDASYNDYFLYTCRFGETKKLNITYNCPKS-LPESFELNYPSIQIHQL  694

Query  457   KGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK  278
               +  +KRTVTNVG   + Y     +P  FS+  +P +LKF +VG+K+ F I+V A   +
Sbjct  695   NYTRTIKRTVTNVGRRRSVYKFSAFSPKEFSITATPDILKFKDVGQKRKFIITVTANRGQ  754

Query  277   KV-----GEFEFGWYKWSDGIHMVKSPIVVS  200
              +      ++ FGWY W+    +V+SP+ VS
Sbjct  755   ILTNHGQDDYYFGWYAWTHEHTVVRSPVAVS  785



>gb|KEH36679.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   314 bits (805),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 254/392 (65%), Gaps = 19/392 (5%)
 Frame = -3

Query  1327  PLVYAGDVELPG---STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGA  1166
             PLV A DVE       TN  G+C  +TL P KVKGK+V C+ G    + +S EV+RAGG 
Sbjct  395   PLVLASDVEEYAGILKTN-SGYCQDNTLDPSKVKGKIVLCMRGQGGRLNKSFEVQRAGGV  453

Query  1165  AVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
              +ILGN     ++VP   + IP T + Y   T  +++YI ++ NP+A L+PG+TV   KP
Sbjct  454   GIILGNNKTHANDVPSDPYFIPATGVTY-ENTLKLVQYIHSSPNPMAQLLPGRTVLDTKP  512

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTP-QDHRSVKYNIISGT  818
             +P+MA F+S GP+ ++PNILKPDITAPG++ILAAW+    P     +D R VK+NIISGT
Sbjct  513   APSMAMFSSRGPNIIDPNILKPDITAPGVDILAAWTAKDGPTRMNFRDKRVVKFNIISGT  572

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVSA   LLKA+HP WS AAI+SA++T+A T +  G  I D  G  A PF  G+G
Sbjct  573   SMSCPHVSAASVLLKAMHPTWSPAAIRSALITSAKTTDNTGNPITDETGNPATPFAMGSG  632

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTS-LDTSFKCPKKDssspsnlnypsLAIAG  461
             HF P +A+DPGL+YD++Y DYLL++C +  T  ++ ++ CP      P +LNYPS+ I  
Sbjct  633   HFYPKRASDPGLIYDASYMDYLLYLCNLNLTQHINLTYNCPNP-LPQPFDLNYPSIQIHK  691

Query  460   LKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSV  281
             L  +  +KRTVTNVGS+ + Y      P  F++  +P VLKF  VG+K++F I+V A   
Sbjct  692   LNYTKTIKRTVTNVGSSKSVYKFIANTPKEFNILATPNVLKFKHVGQKRNFVITVTANKD  751

Query  280   KKVGEFE-----FGWYKWSDGIHMVKSPIVVS  200
             +   + +     FGWY W+D  H+V+SPI VS
Sbjct  752   QLPSKCDPENYFFGWYIWTDKYHVVRSPIAVS  783



>gb|EMT06792.1| hypothetical protein F775_43030 [Aegilops tauschii]
Length=580

 Score =   309 bits (791),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 210/335 (63%), Gaps = 38/335 (11%)
 Frame = -3

Query  1198  RSTEVERAGGAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPG  1019
             +  EV+RAGGAA++LGN                  Y SE                     
Sbjct  278   KGLEVKRAGGAAIVLGNP---------------PMYGSERS-------------------  303

Query  1018  KTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVK  839
             +TV   KPSP MA F+S GP+ +EP+ILKPD+TAPGLNILAAWSEASSP     D+R VK
Sbjct  304   RTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEASSPTKLDGDNRVVK  363

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             YNIISGTSMSCPHVSA+  LLK  HP WS AAI+SAIMTTATT N +G  I +A G  AG
Sbjct  364   YNIISGTSMSCPHVSAIAVLLKCAHPEWSAAAIRSAIMTTATTNNAEGGPITNADGTAAG  423

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnlnyp  479
             P  YG+GH +P  A DPGLVYD+++ DYLL+ C   G  LD SF CP      P  LNYP
Sbjct  424   PMDYGSGHIRPKHAMDPGLVYDASFQDYLLYACASGGAQLDRSFPCPAS-PPRPHELNYP  482

Query  478   sLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSIS  299
             S+AI GL GS  V RTVTNVG   A YSV V  P GFSVK+SPT L F   GEK++F+I 
Sbjct  483   SVAIHGLNGSTTVHRTVTNVGEHGAHYSVAVVEPMGFSVKVSPTSLAFARTGEKKTFTIK  542

Query  298   VKA---GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             + A    S +   ++  G Y WSDG+H V+SP+VV
Sbjct  543   IAATGKKSRRMKRKYLAGSYTWSDGVHAVRSPVVV  577



>ref|XP_011039898.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=794

 Score =   313 bits (802),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 177/389 (46%), Positives = 245/389 (63%), Gaps = 17/389 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAA  1163
             +PL+   +  L  +T      CL  TL P KV GK++ CL G   R     E ERAG   
Sbjct  407   YPLINGAEAALAEATPRDAQLCLDGTLDPNKVSGKIILCLRGQSPRLPKGYEAERAGAVG  466

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++L N    G E+ + ++ +P  +I Y ++ ++++ YIK  +NP A++ P  T FG KPS
Sbjct  467   MVLVNDIISGDELYLEAYELPSAHITY-ADGESVMDYIKATRNPTASISPAITNFGVKPS  525

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             PAMA F+S GPS +EP +LKPDITAPG++++AA++EA  P   P D R   Y ++SGTSM
Sbjct  526   PAMAKFSSRGPSKIEPAVLKPDITAPGVDVIAAFTEAMGPSRRPFDKRRTPYMVMSGTSM  585

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LL+AIHP WS AA+KSAIMTTA T++   + + D  G++A PF YGAGH 
Sbjct  586   SCPHVSGIVGLLRAIHPDWSPAALKSAIMTTAKTKSNNKKRMLDYDGQLATPFMYGAGHV  645

Query  631   QPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             QP+ AADPGLVYD+   DYL F+C      T+     D  + CP+    S ++ NYPS+ 
Sbjct  646   QPNLAADPGLVYDTNVNDYLSFLCAHGYNKTLLNAFSDGPYTCPEN--FSFADFNYPSIT  703

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  LKG + V R V NVG+   TY+V +KAPA  SV + P+ L+F + GE+Q F ++ K 
Sbjct  704   VPDLKGPVTVTRRVKNVGAP-GTYTVSIKAPAKVSVVVEPSSLEFKQAGEEQLFKLTFKP  762

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                    ++EFG   WSDG+H VKSP+VV
Sbjct  763   IMDGMPKDYEFGHLTWSDGLHRVKSPLVV  791



>ref|XP_002299063.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
 gb|EEE83868.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
Length=786

 Score =   307 bits (786),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 177/395 (45%), Positives = 245/395 (62%), Gaps = 23/395 (6%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAA  1163
             +PL+   +  L  +T      CL  TL P KV GK++ CL G   R     E ERAG   
Sbjct  393   YPLINGAEAALAEATPRDAQLCLDGTLDPNKVSGKIILCLRGQSPRLPKGYEAERAGAVG  452

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G E+ + ++ +P  +I Y ++ ++++ YIK  +NP A++ P  T FG KPS
Sbjct  453   MILANDIISGDELYLEAYELPSAHITY-ADGESVMDYIKATRNPTASISPAITNFGVKPS  511

Query  991   PAMAPFTSLGPSSVEPNILK------PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
             PAMA F+S GPS +EP +LK      PD+TAPG++++AA++EA  P   P D R   Y +
Sbjct  512   PAMAKFSSRGPSKIEPAVLKVSSASLPDVTAPGVDVIAAFTEAIGPSRRPFDKRRTPYMV  571

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
             +SGTSMSCPHVS +V LL+AIHP WS AA+KSAIMTTA T+    + + D  G++A PF 
Sbjct  572   MSGTSMSCPHVSGIVGLLRAIHPDWSPAALKSAIMTTAKTKCNNKKRMLDYDGQLATPFM  631

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnl  488
             YGAGH QP+ AADPGLVYD+   DYL F+C      T+     D  + CP+    S ++ 
Sbjct  632   YGAGHVQPNLAADPGLVYDTNVNDYLSFLCAHGYNKTLLNAFSDGPYTCPEN--FSFADF  689

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             NYPS+ +  LKG + V R V NVG+   TY+V +KAPA  SV + P+ L+F + GE+Q F
Sbjct  690   NYPSITVPDLKGPVTVTRRVKNVGAP-GTYTVSIKAPAKVSVVVEPSSLEFKQAGEEQLF  748

Query  307   SISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              +++K        ++EFG   WSDG+H VKSP+VV
Sbjct  749   KLTLKPIMDGMPKDYEFGHLTWSDGLHRVKSPLVV  783



>ref|XP_010494681.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=812

 Score =   306 bits (784),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 193/408 (47%), Positives = 254/408 (62%), Gaps = 29/408 (7%)
 Frame = -3

Query  1342  KMETF-PLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVG-----SVYRSTEV  1184
             KM+ F PLVYA DV +P GS N    CLP++LSP+ VKGKVV CL G     ++ +  EV
Sbjct  405   KMDNFAPLVYAPDVVVPWGSRNEASLCLPNSLSPDLVKGKVVLCLRGFGSGSTIGKGLEV  464

Query  1183  ERAGGAAVILGN--IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             +RAGG  +IL N        V S  +P T + + S  D IL YI  +  PVA + P +T+
Sbjct  465   KRAGGVGMILANSRDNDAFDVVSHFVP-TALVFSSTVDRILDYIYNDYEPVAFIKPAETI  523

Query  1009  ----------FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTP  860
                       +  KP+P M  F+S GP+ V+ NILKPDI APGLNILAAWS A S     
Sbjct  524   LYRNQPKDSFYPYKPAPFMTSFSSRGPNWVDANILKPDIIAPGLNILAAWSGADSASKDS  583

Query  859   QDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED  680
              D R   Y++ SGTSM+CPHV+  +ALLK++HP WS AAI+SA+MTTA+  N   E I+D
Sbjct  584   IDQRVSDYSLDSGTSMACPHVAGAIALLKSMHPTWSSAAIRSALMTTASMTNQDNEPIQD  643

Query  679   AYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDsss  500
               G  A PF  G+GHF+P+KAA PGLVYD++Y  YLL+ C+V  T++D +FKCP  +   
Sbjct  644   YDGSPANPFALGSGHFRPTKAASPGLVYDASYGSYLLYCCSVGLTNIDPTFKCP-SEIPP  702

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVG-STNAT--YSVEVKAPAGFSVKISPTVLKFME  329
               NLNYPS++I  L G++ V RTVT VG S N+T  Y  + + P G +VK  P VL F  
Sbjct  703   GYNLNYPSISIPYLIGTVTVTRTVTCVGRSANSTSVYVFKAQPPFGVNVKAEPNVLVFDR  762

Query  328   VGEKQSFSISVKAGSVKKVGE-----FEFGWYKWSDGIHMVKSPIVVS  200
             +G+K+ F+I       +  GE     + FGW+ WSDG H+V+SPI VS
Sbjct  763   IGQKKQFNIIFTTNPYEFTGEARRDRYRFGWFSWSDGHHVVRSPIAVS  810



>ref|XP_010256205.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3, 
partial [Nelumbo nucifera]
Length=803

 Score =   304 bits (778),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 180/393 (46%), Positives = 241/393 (61%), Gaps = 18/393 (5%)
 Frame = -3

Query  1336  ETFPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVE---RAGG  1169
             E +PL+ AGD +    STN    C    L PEKV+GK++ CL G   R  + E   RAG 
Sbjct  413   EFYPLISAGDAKAANASTNDALLCKAGALDPEKVRGKILTCLRGETARVDKGEQAARAGA  472

Query  1168  AAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
               +IL N     +E+   + ++P ++I Y ++  A+  YI + K+PVA L  G T+ G K
Sbjct  473   VGMILANDVTTANEIIADAHVLPASHITY-TDGLAVFAYINSTKSPVAYLTHGTTLLGVK  531

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP+ V P ILKPDITAPG+NI+AA++EA     +  D R V +NI+SGT
Sbjct  532   PAPFMASFSSKGPNLVTPEILKPDITAPGVNIIAAFTEAQGA-ASENDKRIVPFNIMSGT  590

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPHVS V  LLK +HP WS AA+KSAIMTTA   +  GE I ++    A PF YGAG
Sbjct  591   SMSCPHVSGVAGLLKTLHPDWSPAAVKSAIMTTAGARDNIGEQILNSSHVEATPFSYGAG  650

Query  637   HFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnyps  476
             H QP++A DPGLVYD T  DYL F+C      T   T  D  + CPK   ++  + NYPS
Sbjct  651   HVQPNRAMDPGLVYDLTVKDYLDFLCALGYNQTQIETFSDKPYTCPKS--ATLMDFNYPS  708

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + +  L GS  V RT+ NVG T  TY+  V AP G SV + P  LKF ++GE+++F +++
Sbjct  709   ITVPNLSGSATVTRTLKNVG-TPGTYTASVDAPNGISVSVEPASLKFEKMGEEKTFRLTL  767

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             K        ++ FG   WSDG+H V+SPIVV +
Sbjct  768   KTNKADAAMDYVFGQLIWSDGLHYVRSPIVVKA  800



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   300 bits (768),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 169/392 (43%), Positives = 241/392 (61%), Gaps = 17/392 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCL----VGSVYRSTEVERAGGA  1166
             +PL+   + + P S+    G+C P TL PEKV+GK+V C        V +  +V +AGGA
Sbjct  377   YPLIDGSNAKRPNSSAEEAGWCYPGTLDPEKVRGKIVVCTRDTSFARVEKGVDVLKAGGA  436

Query  1165  AVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
              +IL N    G+ +      +P + I Y  +   +  Y+K+ K+P AT+ P  TV G KP
Sbjct  437   GMILANSDEEGNSLLADPHFLPASMITY-KDALRLSSYLKSTKSPTATISPVTTVLGVKP  495

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +PAMA F+S GP+ + P ILKPDITAPG++ILAA++E   P     D R V++N++SGTS
Sbjct  496   APAMASFSSRGPNLINPEILKPDITAPGVDILAAFTEEVGPTMLDLDKRRVRFNVMSGTS  555

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPH+S V  LLK +HP WS A I+SA+MTTA T +     ++D   E A PF YGAGH
Sbjct  556   MSCPHISGVAGLLKKLHPRWSPAVIRSAVMTTARTRDNTRTPMKDDNREKAIPFDYGAGH  615

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnlnypsL  473
              +P++A DPGLVYD T+TDY+ F+C+           +   F CP K +    +LNYPS+
Sbjct  616   VRPNRAMDPGLVYDITFTDYVHFLCSRGYNASNMAQFIGKRFACPSK-TMRAEDLNYPSI  674

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              +  L+ S  V RTV NVG T  TY+V +KAP G  V + P  L+F +VGE+++F + ++
Sbjct  675   TVPNLQKSFTVSRTVRNVG-TPGTYNVRIKAPFGIHVSVKPQTLEFAKVGEEKTFQVRLR  733

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             + S      + FG   W+DG H V+SP+VV++
Sbjct  734   SRSESVGVGYVFGGLTWTDGKHYVRSPLVVNA  765



>ref|XP_002863464.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39723.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=797

 Score =   300 bits (769),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 238/404 (59%), Gaps = 25/404 (6%)
 Frame = -3

Query  1342  KMETF-PLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG-----SVYRSTEV  1184
             KM+ F PLVYA DV +PG S N    CLP++LSP+ V+GKVV CL G     ++ +  EV
Sbjct  394   KMDNFAPLVYAPDVVVPGVSRNDALLCLPNSLSPDLVRGKVVLCLRGYGSGSTIGKGIEV  453

Query  1183  ERAGGAAVILGNI--GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTV  1010
             +RAGG  +IL N        V S  +P T + + S  D IL YI     PVA + P +TV
Sbjct  454   KRAGGVGMILANARDNDAFDVESHFVP-TVLVFSSTVDRILDYIYNTYEPVAFIKPAETV  512

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILK------PDITAPGLNILAAWSEASSPFDTPQDHR  848
                             P     NILK      PDI APGLNILAAWS A S     +D R
Sbjct  513   LYRNQPEDSVYLYKPAPFMTNANILKVNSFVLPDIIAPGLNILAAWSGADSASKDSRDRR  572

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              + YN+ SGTSMSCPHV+  +ALLK++HP WS AAI+SA+MTTA+  N   E I+D  G 
Sbjct  573   VLGYNLDSGTSMSCPHVAGAIALLKSMHPSWSSAAIRSALMTTASMTNEDNEPIQDYDGS  632

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDssspsnl  488
              A PF  G+GHF P+KAA PGLVYD++Y  YLL+ C+V  T+LD +FKCP +      NL
Sbjct  633   PANPFALGSGHFSPTKAASPGLVYDASYQSYLLYCCSVGLTNLDPTFKCPSR-IPPGYNL  691

Query  487   nypsLAIAGLKGSMVVKRTVTNV---GSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
             NYPS++I  L G++ V RTVT V   G++ + Y    + P G  VK  P VL F  +G+K
Sbjct  692   NYPSISIPYLTGTVAVTRTVTCVGRPGNSTSVYVFNAQPPYGVIVKAEPNVLVFDRIGQK  751

Query  316   QSFSISVKAGSVKKVGE-----FEFGWYKWSDGIHMVKSPIVVS  200
             + F+I          GE     + FGW+ W+DG+H+V+SPI VS
Sbjct  752   KRFNIIFTTQGYGFTGEARRDRYRFGWFSWTDGLHVVRSPISVS  795



>ref|XP_006279865.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
 gb|EOA12763.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
Length=796

 Score =   299 bits (766),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 186/409 (45%), Positives = 252/409 (62%), Gaps = 30/409 (7%)
 Frame = -3

Query  1342  KMETF-PLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVG------SVYRSTE  1187
             KM+ F PLV + DV +PG T      C+P++LSP+  +GKV+ C+ G      ++ +S E
Sbjct  388   KMDNFAPLVNSLDVAVPGCTREEASQCVPNSLSPDLARGKVILCMRGFGSSRSTIGKSIE  447

Query  1186  VERAGGAAVILGN--IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKT  1013
             V+RAGG  +IL N   G    V S  +P T + + S    IL Y+  +  PVA + P +T
Sbjct  448   VKRAGGVGMILANSRAGDGFDVVSHFVP-TALVFSSTVGRILDYMYNDYEPVAFIKPAET  506

Query  1012  ----------VFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDT  863
                       V+  KP+P M  F+S GP+ V+ NILKPDI APGLNILAAWS A S    
Sbjct  507   ILYGYQPQDSVYPYKPAPFMTSFSSRGPNWVDANILKPDIIAPGLNILAAWSGADSASKA  566

Query  862   PQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIE  683
               D R + YN+ SGTSMSCPHV+  +ALLK++HP WS AAI+SA+MTTA+  N   E I+
Sbjct  567   SIDRRVIDYNLDSGTSMSCPHVAGAIALLKSMHPTWSSAAIRSALMTTASMTNEDNEPIQ  626

Query  682   DAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKKDss  503
             D  G  A PF  G+GHF+P+KA  PGLVYD++Y  YLL+ C+V  T+LD +F+CP +   
Sbjct  627   DFDGSPASPFALGSGHFRPTKAQSPGLVYDASYRSYLLYCCSVGLTNLDPTFRCPSQ-IP  685

Query  502   spsnlnypsLAIAGLKGSMVVKRTVTNVG-STNAT--YSVEVKAPAGFSVKISPTVLKFM  332
                NLNYPS++I  L G++ V RTVT VG S+N+T  Y    + P G +V   P VL F 
Sbjct  686   PGYNLNYPSVSIPDLIGTVTVTRTVTCVGRSSNSTSVYVFNAQPPFGVNVMAEPNVLVFD  745

Query  331   EVGEKQSFSISVKAGSVKKVGE-----FEFGWYKWSDGIHMVKSPIVVS  200
              +G+K+ F+I  +    +  GE     + FGW+ WSDG H+V+SPI VS
Sbjct  746   RIGQKKRFNIIFRTDRYEFTGEARRNQYRFGWFSWSDGHHVVRSPIAVS  794



>ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   298 bits (764),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 175/389 (45%), Positives = 243/389 (62%), Gaps = 16/389 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +PLVY+ D +    T +   FC P +L P K+KGK+V+C+ G    V +S  V +AGG  
Sbjct  378   YPLVYSLDAKAANDTFDEAQFCTPGSLEPSKIKGKIVYCVSGFNQDVEKSWVVAQAGGVG  437

Query  1162  VILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAM  983
             +IL +  +  P   FL   T++    +  ++L YI + K PVA  I G T FG   +P M
Sbjct  438   MILSSFHTSTPEAHFL--PTSVVSEHDGSSVLAYINSTKLPVA-YISGATEFGKTVAPVM  494

Query  982   APFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCP  803
             A F+S GP+++ P ILKPDITAPG++ILAA +EA  P     DHR + + I+SGTSMSCP
Sbjct  495   ALFSSPGPNAITPEILKPDITAPGVDILAANTEAKGPTSVRMDHRHLPFTILSGTSMSCP  554

Query  802   HVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPS  623
             HVS + ALLK++ P WS AAI+SAIMTTA T++  G +I +   E A PF YG+GH +PS
Sbjct  555   HVSGIAALLKSLRPDWSPAAIRSAIMTTARTKSNTGGSILNENLEEATPFDYGSGHIRPS  614

Query  622   KAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnlnypsLAIAG  461
                DPGLVYD +  DYL F+C++          +D S+ CP     S  + NYPS+ +  
Sbjct  615   HIVDPGLVYDLSSKDYLNFLCSIGYNNTQMSNFVDKSYNCPSA-KISLLDFNYPSITVPN  673

Query  460   LKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSV  281
             LKG++ + RT+ NVG T   Y+V ++AP G S+KI P  LKF +V E++SF +++KA   
Sbjct  674   LKGNVTLTRTLKNVG-TPGIYTVRIRAPKGISIKIDPMSLKFNKVNEERSFKVTLKAKKN  732

Query  280   KKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +  G + FG   WSDG+H V+SPIVV  A
Sbjct  733   QSQG-YVFGKLVWSDGMHNVRSPIVVKKA  760



>ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   297 bits (760),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 251/393 (64%), Gaps = 21/393 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFC---LVGSVYRSTEVERAGGAA  1163
             +PL+Y+G+ +    S +   FC+P +L P K+KGK+V+C   L+  + +S  V +AGG  
Sbjct  355   YPLIYSGNAKAANASVSHARFCVPGSLEPTKMKGKIVYCERGLIPDLQKSWVVAQAGGVG  414

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N     +  P   FL   T++    +  +IL YI + K+PV   I G T  G   +
Sbjct  415   MILANQFPTENISPQAHFL--PTSVVSADDGLSILAYIYSTKSPVG-YISGGTEVGEVAA  471

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F++ GP+++   ILKPDITAPG+NILAA++EAS P   P D+R + +NIISGTSM
Sbjct  472   PIMASFSAPGPNAINSEILKPDITAPGVNILAAYTEASGPSSLPVDNRHLPFNIISGTSM  531

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTE-NVKGEAIEDAYGEVAGPFHYGAGH  635
             SCPHVS +  LLK++HP WS AAIKSAIMTTA T  N++     D+  ++A PF+YG+GH
Sbjct  532   SCPHVSGIAGLLKSVHPDWSPAAIKSAIMTTARTRSNIRLPIFTDSL-DLASPFNYGSGH  590

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnlnypsL  473
               PS+A DPGLVYD +Y DYL F+C++          +D SF C + + +S  N NYPS+
Sbjct  591   IWPSRAMDPGLVYDLSYKDYLNFLCSIGYNKTQMSAFVDRSFNC-RSNKTSVLNFNYPSI  649

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              +  L G++ V RT+ NVG T   Y+V V AP G SVK+ P  LKF +V EK+SF ++++
Sbjct  650   TVPHLLGNVTVTRTLKNVG-TPGVYTVRVDAPEGISVKVEPMSLKFNKVNEKKSFRVTLE  708

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             A  ++  G + FG   WSDG+H V+SP+VV  A
Sbjct  709   AKIIES-GFYAFGGLVWSDGVHNVRSPLVVKQA  740



>ref|XP_002269456.2| PREDICTED: subtilisin-like protease SBT5.4, partial [Vitis vinifera]
Length=575

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 228/372 (61%), Gaps = 16/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              CL  TL PEKVKGK++ CL G    V +  +  R G   +IL N    G+ +      +
Sbjct  207   LCLEGTLDPEKVKGKILVCLRGVTDRVEKGLQAARVGAVGMILCNDEYDGNSLVADPHFL  266

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P T+I Y ++  A+L YI + KNP   + P K     KP+P MA F+S GP++V P ILK
Sbjct  267   PATHINY-TDGLAVLAYINSTKNPQGLITPPKGKIHTKPAPVMAAFSSRGPNTVTPEILK  325

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+AA++EA SP +   D R + +  +SGTSMSCPHV+ V  LLK IHPHWS
Sbjct  326   PDITAPGVDIIAAFTEAQSPTEQDFDERRLPFYSLSGTSMSCPHVAGVAGLLKTIHPHWS  385

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              +AIKSAIMTTA+T +     ++D+  + A P  YGAGH QP++AADPGLVYD T  DYL
Sbjct  386   PSAIKSAIMTTASTSDNTKSPMKDSSSDKATPLAYGAGHMQPNQAADPGLVYDLTVNDYL  445

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T+     D  +KCP     S  + NYPS+ +  L GS+ + R V NVG  
Sbjct  446   DFLCALGYNQTMLKAFSDNPYKCPAS--VSLLDFNYPSITVPNLSGSVTLTRRVKNVGFP  503

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
                Y+  +  P G SV + P++LKF  +GE++ F +++KA +  +  ++ FG   W+D  
Sbjct  504   -GIYAAHISQPTGVSVTVEPSILKFSRIGEEKKFKVTLKANTNGEAKDYVFGQLIWTDDK  562

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV++A
Sbjct  563   HHVRSPIVVAAA  574



>ref|XP_008810184.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=775

 Score =   297 bits (761),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 240/371 (65%), Gaps = 15/371 (4%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN---IGSEVPVGSFLIP  1109
             CL  +L P KV+GKVV CL G+   V +   V +AGG  +IL N    G+E+   + ++P
Sbjct  404   CLLGSLEPAKVRGKVVVCLRGNNGRVEKGEAVRQAGGVGMILANDESTGNEIIADAHVLP  463

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              T+I Y S+  A+L YI + K+P+  +   KT+    P+P MA F+S GP+++ P ILKP
Sbjct  464   ATHISY-SDGVALLSYINSTKSPLGYITTPKTMLDTYPAPFMAAFSSRGPNTINPEILKP  522

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             DITAPG++I+AA++ AS P   P D R V +N  SGTSMSCPHVS +  LLKA+HP WS 
Sbjct  523   DITAPGVSIIAAYTGASGPTGLPFDSRRVLFNSESGTSMSCPHVSGIAGLLKALHPDWSP  582

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             +AIKSAI+T+A T++   E + ++    A PF YG+GH +P++A DPGLVYD T  DYL 
Sbjct  583   SAIKSAIVTSARTQDNTLEPMSNSSFVKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLN  642

Query  568   FICTVTGTSLDTS------FKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTN  407
             F+C++   S   +      + CP +   +  +LNYPS++I  L G++ V RTV NVG T 
Sbjct  643   FLCSLGYNSTQNALFNVEPYLCPSR-PLNIGDLNYPSISIPYLSGAVSVIRTVKNVG-TP  700

Query  406   ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIH  227
              TY V V  PAG SV + PT LKFM+VGE++ F +++KA S    G++ FG   WSDG+H
Sbjct  701   GTYRVRVIEPAGISVSVKPTSLKFMKVGEEKKFKVTLKAKSRDAAGDYAFGKLIWSDGMH  760

Query  226   MVKSPIVVSSA  194
              V+SPIVV + 
Sbjct  761   YVRSPIVVKAG  771



>ref|XP_010644656.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=768

 Score =   296 bits (758),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 233/371 (63%), Gaps = 16/371 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVPVGSFLI  1112
              C P TL+P+KVKGK++ CL G   R  + E+A   G    IL N    G+E+     ++
Sbjct  402   LCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPHVL  461

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P +++ + S+  A+  YI + KNP+A L   +T  G KP+P MA F+S GP+++ P ILK
Sbjct  462   PASHVNF-SDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEILK  520

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA+SE+  P D   D R + +N  SGTSMSCPH+S +V LLK +HP WS
Sbjct  521   PDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDWS  580

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMT+A T +   E + ++    A PF YGAGH +P++A DPGLVYDST  DYL
Sbjct  581   PAAIKSAIMTSARTRDDNMEPMLNSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVNDYL  640

Query  571   LFICTV--TGTSL----DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C +    T L       +KCPK  S S +  NYPS+    L GS+ + RTV NVG T
Sbjct  641   NFLCAIGYNETQLQIFSQKPYKCPK--SFSLTGFNYPSITAPNLSGSVTISRTVKNVG-T  697

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY+  VKAP G SV + P  L+F E GE++SF +++KA   +   ++ FG   WSDG 
Sbjct  698   PGTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQ  757

Query  229   HMVKSPIVVSS  197
             H V+S IVV +
Sbjct  758   HYVRSSIVVKA  768



>ref|XP_010647021.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=725

 Score =   295 bits (755),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 184/397 (46%), Positives = 249/397 (63%), Gaps = 26/397 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG-------SVYRSTEVERA  1175
             +PLVY+ D      S      C   +L P+KVKGK+V+CLV        +V +S  V +A
Sbjct  331   YPLVYSVDARAANASARDAQLCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQA  390

Query  1174  GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG  +IL N     + +P   F +P T+    ++  AIL YI T K PVA  I G T  G
Sbjct  391   GGIGMILANHLTTATLIPQAHF-VP-TSRVSAADGLAILLYIHTTKYPVA-YISGATEVG  447

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
                +P MA F+S GP+++ P ILKPDITAPG+ I+AA++EA  P     DHR V +NI+S
Sbjct  448   TVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILS  507

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG--PFH  650
             GTSMSCPHVS  V LLK IHP+WS +AI+SAIMT+A T +   + I  A G +AG  PF+
Sbjct  508   GTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTSARTRSNLRQPI--ANGTLAGGNPFN  565

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnl  488
             YGAGH  P++A DPGLVYD T TDYL F+C++        T +D  ++CP K  + P +L
Sbjct  566   YGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNATQLSTFVDKKYECPSK-PTRPWDL  624

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             NYPS+ +  L G + V RT+ NVG T ATY+V +KAP+G SVK+ P  L+F ++ E++ F
Sbjct  625   NYPSITVPSLSGKVTVTRTLKNVG-TPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMF  683

Query  307   SISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
              ++++A      GE+ FG   WSDG H V SPIVV++
Sbjct  684   KVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  720



>gb|KEH35215.1| subtilisin-like serine protease [Medicago truncatula]
Length=634

 Score =   292 bits (747),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 172/403 (43%), Positives = 250/403 (62%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA +  + F P++ A D +L  +TN     C   TL P+KVKGK+V CL G   R  
Sbjct  235   ESLSAARLADKFYPIIKATDAKLASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVD  294

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + S+   +  Y+ ++K+PVA +
Sbjct  295   KGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINF-SDGVEVFHYVNSSKSPVAYI  353

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                 T    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D+R
Sbjct  354   THPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNR  413

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              +++N +SGTSMSCPH+S +V LL++++P W+ AAIKSAIMTTATT + K E I +A   
Sbjct  414   RIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPIMNATKS  473

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YGAGH QP+ A DPGLVYD T  DY  F+C +       S      +KC K   
Sbjct  474   QATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKN--  531

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
              S  NLNYPS+ +  L GS+ V RT+ NVG+   TY V V++P+G ++ + P +L+F +V
Sbjct  532   FSILNLNYPSITVPNLSGSVTVTRTLKNVGAP-GTYIVHVQSPSGITISVKPNILEFKKV  590

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++ F + +K    K    + FG   WSDG H VKSP+VV +
Sbjct  591   GEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVKA  633



>emb|CBI39824.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   296 bits (757),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 233/371 (63%), Gaps = 16/371 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVPVGSFLI  1112
              C P TL+P+KVKGK++ CL G   R  + E+A   G    IL N    G+E+     ++
Sbjct  437   LCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPHVL  496

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P +++ + S+  A+  YI + KNP+A L   +T  G KP+P MA F+S GP+++ P ILK
Sbjct  497   PASHVNF-SDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEILK  555

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA+SE+  P D   D R + +N  SGTSMSCPH+S +V LLK +HP WS
Sbjct  556   PDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDWS  615

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMT+A T +   E + ++    A PF YGAGH +P++A DPGLVYDST  DYL
Sbjct  616   PAAIKSAIMTSARTRDDNMEPMLNSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVNDYL  675

Query  571   LFICTV--TGTSL----DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C +    T L       +KCPK  S S +  NYPS+    L GS+ + RTV NVG T
Sbjct  676   NFLCAIGYNETQLQIFSQKPYKCPK--SFSLTGFNYPSITAPNLSGSVTISRTVKNVG-T  732

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY+  VKAP G SV + P  L+F E GE++SF +++KA   +   ++ FG   WSDG 
Sbjct  733   PGTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQ  792

Query  229   HMVKSPIVVSS  197
             H V+S IVV +
Sbjct  793   HYVRSSIVVKA  803



>ref|XP_010647020.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
Length=771

 Score =   295 bits (755),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 183/397 (46%), Positives = 249/397 (63%), Gaps = 26/397 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG-------SVYRSTEVERA  1175
             +PLVY+ D      S      C   +L P+KVKGK+V+CLV        +V +S  V +A
Sbjct  377   YPLVYSVDARAANASARDAQLCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQA  436

Query  1174  GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG  +IL N     + +P   F +P + +   ++  AIL YI T K PVA  I G T  G
Sbjct  437   GGIGMILANHLTTATLIPQAHF-VPTSRV-SAADGLAILLYIHTTKYPVA-YISGATEVG  493

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
                +P MA F+S GP+++ P ILKPDITAPG+ I+AA++EA  P     DHR V +NI+S
Sbjct  494   TVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILS  553

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG--PFH  650
             GTSMSCPHVS  V LLK IHP+WS +AI+SAIMT+A T +   + I  A G +AG  PF+
Sbjct  554   GTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTSARTRSNLRQPI--ANGTLAGGNPFN  611

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnl  488
             YGAGH  P++A DPGLVYD T TDYL F+C++        T +D  ++CP K  + P +L
Sbjct  612   YGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNATQLSTFVDKKYECPSK-PTRPWDL  670

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             NYPS+ +  L G + V RT+ NVG T ATY+V +KAP+G SVK+ P  L+F ++ E++ F
Sbjct  671   NYPSITVPSLSGKVTVTRTLKNVG-TPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMF  729

Query  307   SISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
              ++++A      GE+ FG   WSDG H V SPIVV++
Sbjct  730   KVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  766



>gb|KEH35216.1| subtilisin-like serine protease [Medicago truncatula]
Length=649

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 172/403 (43%), Positives = 250/403 (62%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA +  + F P++ A D +L  +TN     C   TL P+KVKGK+V CL G   R  
Sbjct  250   ESLSAARLADKFYPIIKATDAKLASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVD  309

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + S+   +  Y+ ++K+PVA +
Sbjct  310   KGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINF-SDGVEVFHYVNSSKSPVAYI  368

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                 T    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D+R
Sbjct  369   THPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNR  428

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              +++N +SGTSMSCPH+S +V LL++++P W+ AAIKSAIMTTATT + K E I +A   
Sbjct  429   RIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPIMNATKS  488

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YGAGH QP+ A DPGLVYD T  DY  F+C +       S      +KC K   
Sbjct  489   QATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKN--  546

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
              S  NLNYPS+ +  L GS+ V RT+ NVG+   TY V V++P+G ++ + P +L+F +V
Sbjct  547   FSILNLNYPSITVPNLSGSVTVTRTLKNVGAP-GTYIVHVQSPSGITISVKPNILEFKKV  605

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++ F + +K    K    + FG   WSDG H VKSP+VV +
Sbjct  606   GEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVKA  648



>emb|CBI38460.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   295 bits (755),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 183/397 (46%), Positives = 249/397 (63%), Gaps = 26/397 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG-------SVYRSTEVERA  1175
             +PLVY+ D      S      C   +L P+KVKGK+V+CLV        +V +S  V +A
Sbjct  389   YPLVYSVDARAANASARDAQLCSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQA  448

Query  1174  GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG  +IL N     + +P   F +P + +   ++  AIL YI T K PVA  I G T  G
Sbjct  449   GGIGMILANHLTTATLIPQAHF-VPTSRV-SAADGLAILLYIHTTKYPVA-YISGATEVG  505

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
                +P MA F+S GP+++ P ILKPDITAPG+ I+AA++EA  P     DHR V +NI+S
Sbjct  506   TVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILS  565

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG--PFH  650
             GTSMSCPHVS  V LLK IHP+WS +AI+SAIMT+A T +   + I  A G +AG  PF+
Sbjct  566   GTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTSARTRSNLRQPI--ANGTLAGGNPFN  623

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnl  488
             YGAGH  P++A DPGLVYD T TDYL F+C++        T +D  ++CP K  + P +L
Sbjct  624   YGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNATQLSTFVDKKYECPSK-PTRPWDL  682

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
             NYPS+ +  L G + V RT+ NVG T ATY+V +KAP+G SVK+ P  L+F ++ E++ F
Sbjct  683   NYPSITVPSLSGKVTVTRTLKNVG-TPATYTVRIKAPSGISVKVEPKRLRFEKINEEKMF  741

Query  307   SISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
              ++++A      GE+ FG   WSDG H V SPIVV++
Sbjct  742   KVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  778



>ref|XP_006447864.1| hypothetical protein CICLE_v10017839mg [Citrus clementina]
 gb|ESR61104.1| hypothetical protein CICLE_v10017839mg [Citrus clementina]
Length=716

 Score =   293 bits (749),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 178/394 (45%), Positives = 243/394 (62%), Gaps = 20/394 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGF-CLPDTLSPEKVKGKVVFCL---VGSVYRSTEVERAGGAA  1163
             FP + A D +L  ++    F C   TL P+KVKGK++ CL     SV +  +   AG   
Sbjct  326   FPFISAEDAKLANASIENAFECKKGTLDPKKVKGKILVCLDVNTSSVDKGLQAALAGAVG  385

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             V+L NI   G +      ++P + I + ++ D++L Y+ + K+PV  +    T FGAKPS
Sbjct  386   VVLINIQDFGYDRTADPHVLPASAISF-NDGDSLLGYVNSTKHPVGFITRPTTEFGAKPS  444

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ + P ILKPDITAPG NI+AA++EA SP +  +D   + +N ISGTSM
Sbjct  445   PFMAAFSSKGPNHITPEILKPDITAPGENIIAAYTEAESPTNLNEDKHRIPFNSISGTSM  504

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATT-ENVKGEAIEDAYGEVAGPFHYGAGH  635
             SCPH+S +  LLK +HP WS AAI+SAIMTTATT +N K + +  ++ E A PF YGAGH
Sbjct  505   SCPHISGIAGLLKTLHPDWSPAAIQSAIMTTATTLDNNKQQILNASFAE-ATPFSYGAGH  563

Query  634   FQPSKAADPGLVYDSTYTDYLLFICT-------VTGTSLDTSFKCPKKDssspsnlnyps  476
              QP+ A DPGLVYD T  DYL F+C        ++  S + S+ CP K++ S  N NYP+
Sbjct  564   VQPNLAMDPGLVYDLTVNDYLNFLCALGYNKNVISLFSTNCSYTCP-KNAISLVNFNYPA  622

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + +  L GS+ V R V NVGS   TY   VK P G SV I+P  LKF+ VGE++SF + +
Sbjct  623   ITVPKLSGSITVTRRVKNVGSP-GTYQARVKTPEGVSVTIAPKSLKFINVGEEKSFKVII  681

Query  295   KAGSVKKVGEFEFGWYKWSD-GIHMVKSPIVVSS  197
             KA +     ++ FG   WSD   H V+SPIVV +
Sbjct  682   KAKNASVTKDYAFGELIWSDEKQHRVRSPIVVKA  715



>ref|XP_004502100.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=772

 Score =   294 bits (752),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 247/401 (62%), Gaps = 14/401 (3%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA +  + F P + A D +L  +T      C+  TL P KVKGK+V CL G   R  
Sbjct  373   ESLSATRLADKFYPSILATDAKLGSATAEDAKLCMNRTLDPSKVKGKIVICLRGINARVD  432

Query  1189  EVERA---GGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+EV     ++P T+I + S+  A+  YI ++K+PV  +
Sbjct  433   KGEQALLAGAVGMVLVNDKINGNEVIADPHVLPATHITF-SDGLALFNYINSSKSPVVYI  491

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                 T    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D+R
Sbjct  492   THPTTRLHTKPAPFMAAFSSKGPNTIVPEILKPDITAPGVSVIAAYTEAEGPTNQEFDYR  551

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              + YN +SGTSMSCPH+S +  LLK +HP WS AAIKSAIMTTATT + + E I +A   
Sbjct  552   RIPYNSVSGTSMSCPHISGIAGLLKTLHPSWSPAAIKSAIMTTATTLDNEAEPILNATES  611

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV----TGTSLDTSFKCPKKDsss  500
              A PF YGAGH QP+KA DPGLVYD+T  DYL F+C +    T  S+ +    P   + S
Sbjct  612   QATPFSYGAGHVQPNKAMDPGLVYDTTVNDYLNFLCALGYDETQISVFSKAPHPCHKNFS  671

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               NLNYPS+ +  L GS+ V RT+ NVGS  ATY   V+ P G +V + P +L+F  VGE
Sbjct  672   LINLNYPSITVPNLSGSVTVTRTLKNVGSP-ATYIARVQNPNGITVSVKPNILEFKNVGE  730

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             ++ F I +K    K   ++ FG   WSDG H VKSPIVV +
Sbjct  731   EKRFEIRLKVRKGKGKEKYVFGKLIWSDGKHYVKSPIVVKA  771



>ref|XP_010096499.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB64619.1| Subtilisin-like protease [Morus notabilis]
Length=771

 Score =   293 bits (751),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 171/398 (43%), Positives = 236/398 (59%), Gaps = 17/398 (4%)
 Frame = -3

Query  1351  AIKKMETFPLVYAGDV-ELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEV  1184
             A++  + +PL+      E   S +    C   TL P KVKGK++ CL G    V +    
Sbjct  374   ALRAKKFYPLINGAQAKEANASIDDAILCKTGTLDPTKVKGKILACLRGENARVEKGLNA  433

Query  1183  ERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKT  1013
              RAG   +IL N    G+ V   +  +P +++ Y  +  ++L+YI T KNP ATL+P   
Sbjct  434   ARAGAVGMILCNDDLSGNGVLADAHFLPASHLTY-EDGQSLLQYINTTKNPQATLLPPIA  492

Query  1012  VFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYN  833
              FG+KP+P+MA F+S GP++V P ILKPDITAPG++I+AA+SEA SP     D R   +N
Sbjct  493   TFGSKPAPSMASFSSTGPNTVTPEILKPDITAPGVSIIAAYSEAVSPTGLEFDKRRFPFN  552

Query  832   IISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPF  653
             + SGTSMSCPHV+ VV LL+ IH  WS AAI+SAI+TTA T +  G + + A  + A PF
Sbjct  553   VESGTSMSCPHVAGVVGLLRTIHRDWSPAAIRSAIVTTARTRDNTGNSAKTALKQKASPF  612

Query  652   HYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV--TGTSL----DTSFKCPKKDssspsn  491
             +YG GH +P++A DPGLVYD    DYL F+C++    T +    D   KCP K+ +    
Sbjct  613   NYGNGHIRPNRAMDPGLVYDLGTNDYLNFLCSLGYNKTQIQALNDKPHKCPAKNVTVLDF  672

Query  490   lnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
                   A   L GS+ V RTV NVG    TY V+V  P G SV + P +L+F   GE++S
Sbjct  673   NYPSVTA-PNLSGSVTVTRTVKNVGQP-GTYVVKVHEPVGVSVSVEPKILEFKHHGEEKS  730

Query  310   FSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             F I++K       G + FG + W+DG H V+SPIVV +
Sbjct  731   FRITLKDRGYGLKG-YHFGVFVWTDGKHYVRSPIVVQT  767



>ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=771

 Score =   293 bits (750),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 231/369 (63%), Gaps = 14/369 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C   +L  +K KGK++ CL G    V +  +  RAG   ++L N    G+E+     ++
Sbjct  402   LCKAGSLDRKKAKGKILVCLRGVNARVDKGQQAARAGAVGMVLVNDKDSGNEILADVHIL  461

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P +++ Y +   AIL YI + K P+A +   +T  G KP+P MA F+S GP+++ P ILK
Sbjct  462   PASHLNYTNGV-AILNYINSTKYPIAHVTRPETHIGTKPAPFMAAFSSRGPNTITPEILK  520

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+AA+++A+ P +   D R V +N +SGTSMSCPHVS +V LLK +HP WS
Sbjct  521   PDITAPGVSIIAAYTQAAGPTNEDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKILHPTWS  580

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTA T +   E I +A    A PF YGAGH +P++A +PGLVYD T  DYL
Sbjct  581   PAAIKSAIMTTAMTRDNNREPILNATYSKANPFSYGAGHIRPNQAMEPGLVYDLTANDYL  640

Query  571   LFICTV--TGTSL----DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C +    T +       +KCP K   + +N NYPS+ +   KGS+ V R V NVGS 
Sbjct  641   NFLCALGYNETQILSFSQAPYKCPNK-LVNLANFNYPSITVPKFKGSITVTRRVKNVGSP  699

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
             ++TY V ++ P G SV + P +L F E+GE+++F +++K    K   E+ FG   WSD I
Sbjct  700   SSTYKVSIRKPTGISVSVEPEILNFREIGEEKTFKVTLKGKKFKARKEYVFGELTWSDSI  759

Query  229   HMVKSPIVV  203
             H V+SPIVV
Sbjct  760   HRVRSPIVV  768



>ref|XP_010107369.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC15620.1| Subtilisin-like protease [Morus notabilis]
Length=752

 Score =   292 bits (748),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 176/402 (44%), Positives = 245/402 (61%), Gaps = 17/402 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELPGSTNFPGF-CLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             S  A++  + +PLV A D +   ++      C P TL P+KV GK++ CL G    V + 
Sbjct  355   SAKALQIGKFYPLVSALDAKAANASAADALLCKPATLDPKKVTGKILVCLRGQNARVDKG  414

Query  1192  TEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              +   AG   +IL N    G+E+     ++P ++I Y    + +  YI + K+P   + P
Sbjct  415   QQALEAGAVGMILANNELTGNEIIADPHVLPASHINYNDGIN-VFTYINSTKSPKGYITP  473

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
               T  G KP+P MA F+S GP++V P ILKPDITAPG++I+AA++EA  P +   D R +
Sbjct  474   ATTKLGTKPAPFMAAFSSKGPNTVTPEILKPDITAPGVSIIAAYTEAQGPTNEEFDKRRI  533

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
              +N ISGTSMSCPHVS +V LLK +HP WS AAIKSAIMTTA T + + E + ++    A
Sbjct  534   SFNSISGTSMSCPHVSGIVGLLKTLHPDWSPAAIKSAIMTTARTRDNQMEPLLNSSNFKA  593

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDsss  500
              PF YGAGH  P+ A DPGLVYD ++ DYL F+C +   +       +  +KC KK   S
Sbjct  594   TPFSYGAGHVNPNGAMDPGLVYDLSFNDYLNFLCALRYNATQIEMFSEKPYKCSKK--IS  651

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
              +NLNYPS+ +  L GS+ V RT+ NVG T  TY   V+  AG SV + P  LKF  VGE
Sbjct  652   LTNLNYPSITVPKLSGSIAVTRTLKNVG-TPGTYRARVENQAGISVSVEPKSLKFKRVGE  710

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             ++SF++++KA + K   ++ FG   WSDG H V+SPIVV +A
Sbjct  711   EKSFTLTLKAKNPKAAKDYAFGKLIWSDGTHYVRSPIVVKAA  752



>ref|XP_010693559.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Beta vulgaris subsp. vulgaris]
Length=1098

 Score =   298 bits (763),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 245/404 (61%), Gaps = 24/404 (6%)
 Frame = -3

Query  1351  AIKKMETFPLVYAGDVELPGSTNFPGF-CLPDTLSPEKVKGKVVFCLVG---SVYRSTEV  1184
             A+ K   +PL+ A   +L  ++      C P TL  +KVKGK++ CL G    V +  + 
Sbjct  700   ALPKNTLYPLMSAAQAKLANASASDALLCKPGTLDEKKVKGKILACLRGGNARVDKGMQA  759

Query  1183  ERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKT  1013
             + AG A +IL N    G+EV     ++P  +I Y ++  A+ KYI +   P+  L   K 
Sbjct  760   KLAGAAGMILCNDELDGNEVIADLHVLPAAHISY-ADGSAVFKYINSTAKPMGYLTHSKA  818

Query  1012  VFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYN  833
              F  KP+P MA F+S GP++V P +LKPDITAPG++++AA+S+A SP D P DHR V Y 
Sbjct  819   TFDVKPAPYMAAFSSKGPNTVTPELLKPDITAPGVDVIAAYSQAVSPTDEPSDHRRVSYM  878

Query  832   IISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPF  653
             + SGTSMSCPH+S +V LLK +HP WS AAI+SAIMTTA T +     +EDA    A PF
Sbjct  879   MDSGTSMSCPHISGIVGLLKTLHPTWSPAAIRSAIMTTARTRDNTINPMEDANYAKATPF  938

Query  652   HYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsn  491
              YGAGH +P++A DPGL+YD   TDYL F+C++    T+++T    S KC K   +  + 
Sbjct  939   GYGAGHVRPTRAMDPGLIYDLNATDYLQFLCSIGYNKTTIETFYNGSHKCSKSSYNKENL  998

Query  490   lnypsLAIA--GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
             LN+   +I    L GS+ V RTV NVGS    Y   V+ P   SV ++P ++KF +VGE+
Sbjct  999   LNFNYPSITVPKLSGSVTVTRTVKNVGSP-GVYVARVRQPLRVSVTVTPKMMKFEKVGEE  1057

Query  316   QSFSIS----VKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             + F ++    V+ G   K  E+ FG   WSDG H V+SPIVV++
Sbjct  1058  KKFKVTLTSKVRGG---KSEEYRFGELLWSDGKHYVRSPIVVAA  1098



>gb|EYU27629.1| hypothetical protein MIMGU_mgv1a001914mg [Erythranthe guttata]
Length=740

 Score =   292 bits (747),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/374 (44%), Positives = 230/374 (61%), Gaps = 21/374 (6%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              C   TL  +K KGK+V CL G   R     E  RAG A +IL N    G+E+   + ++
Sbjct  370   LCKEKTLDSKKAKGKIVVCLRGENARLEKGEEALRAGAAGMILCNDESSGNELIADAHIL  429

Query  1111  PGTNIFYPSETDAIL--KYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNI  938
             P T + Y   TD ++   Y+K  KNP   +   K+V   KP+P MA F+S GP+++ P I
Sbjct  430   PATQLNY---TDGLIVFSYLKNTKNPQGLITEPKSVLNVKPAPFMASFSSRGPNAITPAI  486

Query  937   LKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPH  758
             LKPDITAPG+NI+AA+SE++SP + P D R+  + I SGTSM+CPHVS V  LLK +HP 
Sbjct  487   LKPDITAPGVNIMAAYSESTSPTEVPSDKRTTPFYIESGTSMACPHVSGVAGLLKTLHPD  546

Query  757   WSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTD  578
             WS  AI+SAIMTTA T +  G  ++DA  + A PF YG+GH +P++A +PGLVYD T  D
Sbjct  547   WSPGAIRSAIMTTARTRDNTGSPMKDADYQKATPFMYGSGHIRPNRAMNPGLVYDLTVND  606

Query  577   YLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVG  416
             YL F+C      T+ G      + CP     +  N N PS+++  L  S+VV R + NVG
Sbjct  607   YLDFLCGIGYNSTMVGQFAGAYYDCPNN--YNILNFNNPSISVPDLTRSVVVTRKLKNVG  664

Query  415   STNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGE-FEFGWYKWS  239
                 TY+  +++P G+SV + P +LKF ++GE++SF +S+K    +     F+FG   WS
Sbjct  665   KP-GTYAARIRSPPGYSVTVKPNLLKFEKIGEEKSFKLSIKVNGRRGAKSVFQFGELLWS  723

Query  238   DGIHMVKSPIVVSS  197
             DG H V+SPIVV+S
Sbjct  724   DGKHYVRSPIVVAS  737



>ref|XP_006469398.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=642

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 234/380 (62%), Gaps = 18/380 (5%)
 Frame = -3

Query  1291  STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVP  1130
             ST     C   TL P+KVKGK++ CL G   R  + ++A   G   ++L N    G+E+ 
Sbjct  267   STEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELL  326

Query  1129  VGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSV  950
                 L+P +++ Y    D + +Y+ + K PV  L    T  G KP+P MA F+S GPSS+
Sbjct  327   ADPHLLPASHVNYTDGAD-LFRYVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSI  385

Query  949   EPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKA  770
              P ILKPDITAPG+ I+AA++EA+ P +   D R + +N +SGTSMSCPHVS +V LLK 
Sbjct  386   APEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKT  445

Query  769   IHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDS  590
             +HP WS AAIKSAIMTTA+ ++     I +A    A PF YGAGH QP+ A DPGLVYD 
Sbjct  446   LHPEWSPAAIKSAIMTTASIQDNNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDL  505

Query  589   TYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTV  428
             T  DYL F+C +    T  +L  D +++CP  +  S +N NYPS+ +  L GS++V RTV
Sbjct  506   TENDYLNFLCALGYNKTQIALFSDKTYRCP--EYVSTANFNYPSITVPKLSGSIIVSRTV  563

Query  427   TNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK-KVGEFEFGW  251
              NVGS   TY   V+ P G SV + P  LKF+ VGE+++F +++K   V+    ++ FG 
Sbjct  564   RNVGSP-GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGD  622

Query  250   YKWSDG-IHMVKSPIVVSSA  194
               W+D   H V+SPIVV+ A
Sbjct  623   LVWADDKQHQVRSPIVVNPA  642



>ref|XP_003601486.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES71737.1| subtilisin-like serine protease [Medicago truncatula]
Length=772

 Score =   292 bits (747),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/403 (43%), Positives = 250/403 (62%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA +  + F P++ A D +L  +TN     C   TL P+KVKGK+V CL G   R  
Sbjct  373   ESLSAARLADKFYPIIKATDAKLASATNEDAVLCQNGTLDPKKVKGKIVLCLRGINARVD  432

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + S+   +  Y+ ++K+PVA +
Sbjct  433   KGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINF-SDGVEVFHYVNSSKSPVAYI  491

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                 T    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D+R
Sbjct  492   THPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIAAYTEAEGPTNQEFDNR  551

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              +++N +SGTSMSCPH+S +V LL++++P W+ AAIKSAIMTTATT + K E I +A   
Sbjct  552   RIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTATTLDNKAEPIMNATKS  611

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YGAGH QP+ A DPGLVYD T  DY  F+C +       S      +KC K   
Sbjct  612   QATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQMSLFSKGPYKCHKN--  669

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
              S  NLNYPS+ +  L GS+ V RT+ NVG+   TY V V++P+G ++ + P +L+F +V
Sbjct  670   FSILNLNYPSITVPNLSGSVTVTRTLKNVGAP-GTYIVHVQSPSGITISVKPNILEFKKV  728

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++ F + +K    K    + FG   WSDG H VKSP+VV +
Sbjct  729   GEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVKA  771



>ref|XP_011013808.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=749

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 175/392 (45%), Positives = 240/392 (61%), Gaps = 18/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +P+VY+ D +    S      C P++L P+KV+GK+V+CL G    V +S  V +AGG  
Sbjct  357   YPIVYSVDAKAANASAQLAQICYPESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVG  416

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL +     S  P G F +P T++    +  ++L YI + K+PVA  I G T  G   +
Sbjct  417   MILAHQFADSSSSPRG-FFVP-TSLVSAIDGLSVLSYIHSTKSPVA-YISGSTEIGKVVA  473

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MAPF+S GP+ + P ILKPDITAPG++ILAA+++A        D R + +NIISGTSM
Sbjct  474   PVMAPFSSTGPNEITPEILKPDITAPGVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSM  533

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +  LLK +HP WS AAIKSAIMTTA T +   + I  A    A PF+YG+GH 
Sbjct  534   SCPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTSSNARQPIAKASAAEATPFNYGSGHL  593

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsnlnypsLA  470
             +P++A DPGLVYD T TDYL F+C++   +   S      + CP K+  S  N NYPS+ 
Sbjct  594   RPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSIFNEEPYDCPPKN-ISLLNFNYPSIT  652

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G++ + RT+ NVG T   Y+V VK P G  VK+ P  LKF ++ E+++F + +KA
Sbjct  653   VPNLSGNVTLTRTLKNVG-TPGLYTVRVKKPDGILVKVEPKSLKFSKLNEEKTFKVMLKA  711

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                     + FG   WSDG+H VKSPIVV  A
Sbjct  712   KDDWFRRSYVFGGLTWSDGVHHVKSPIVVRKA  743



>ref|XP_006377332.1| hypothetical protein POPTR_0011s04980g [Populus trichocarpa]
 gb|ERP55129.1| hypothetical protein POPTR_0011s04980g [Populus trichocarpa]
Length=744

 Score =   291 bits (744),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 239/389 (61%), Gaps = 18/389 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +P+VY+ D +   +T      C P++L P KV+GK+V+CL G    V +S  V +AGG  
Sbjct  354   YPIVYSVDAKAANATAQLAQICYPESLDPTKVRGKIVYCLGGMIPDVEKSLVVAQAGGVG  413

Query  1162  VILGNIG---SEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL +     S +P G F +P T++    +  ++L YI + K+PVA  I G T  G   +
Sbjct  414   MILSDQSEDSSSMPQG-FFVP-TSLVSAIDGLSVLSYIYSTKSPVA-YISGSTEIGKVVA  470

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ + P ILKPDITAPG+NILAA+++A        D R + +NIISGTSM
Sbjct  471   PVMASFSSTGPNEITPEILKPDITAPGVNILAAYTKAPRRLSRLIDQRPLSFNIISGTSM  530

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +  LLK +HP WS AAIKSAIMTTA T +   + I DA    A PF+YG+GH 
Sbjct  531   SCPHVSGIAGLLKTMHPDWSAAAIKSAIMTTARTGSTARQPIADASAAEATPFNYGSGHL  590

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsnlnypsLA  470
             +P++  DPGLVYD T TDYL F+C++   +   S      + CP K+  S  N NYPS+ 
Sbjct  591   RPNREMDPGLVYDLTTTDYLNFLCSIGYNATQMSIFIEEPYACPPKN-ISLLNFNYPSIT  649

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G++ + RT+ NVG T   Y+V VK P G  VK+ P  LKF ++ E+++F + +KA
Sbjct  650   VPNLSGNVTLTRTLKNVG-TPGLYTVRVKKPDGILVKVEPESLKFSKLNEERTFKVILKA  708

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                     + FG   WSDG+H V+SPIVV
Sbjct  709   KDNWFSSSYVFGGLTWSDGVHHVRSPIVV  737



>ref|XP_011013366.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=770

 Score =   291 bits (745),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 175/392 (45%), Positives = 240/392 (61%), Gaps = 18/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +P+VY+ D +    S      C P++L P+KV+GK+V+CL G    V +S  V +AGG  
Sbjct  378   YPIVYSVDAKAANASAQLAQICYPESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVG  437

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL +     S  P G F +P T++    +  ++L YI + K+PVA  I G T  G   +
Sbjct  438   MILAHQFADSSSSPRG-FFVP-TSLVSAIDGLSVLSYIHSTKSPVA-YISGSTEIGKVVA  494

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MAPF+S GP+ + P ILKPDITAPG++ILAA+++A        D R + +NIISGTSM
Sbjct  495   PVMAPFSSTGPNEITPEILKPDITAPGVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSM  554

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +  LLK +HP WS AAIKSAIMTTA T +   + I  A    A PF+YG+GH 
Sbjct  555   SCPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTSSNARQPIAKASAAEATPFNYGSGHL  614

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsnlnypsLA  470
             +P++A DPGLVYD T TDYL F+C++   +   S      + CP K+  S  N NYPS+ 
Sbjct  615   RPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSIFNEEPYDCPPKN-ISLLNFNYPSIT  673

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G++ + RT+ NVG T   Y+V VK P G  VK+ P  LKF ++ E+++F + +KA
Sbjct  674   VPNLSGNVTLTRTLKNVG-TPGLYTVRVKKPDGILVKVEPKSLKFSKLNEEKTFKVMLKA  732

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                     + FG   WSDG+H VKSPIVV  A
Sbjct  733   KDDWFRRSYVFGGLTWSDGVHHVKSPIVVRKA  764



>ref|XP_010647520.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=698

 Score =   289 bits (739),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 180/396 (45%), Positives = 244/396 (62%), Gaps = 24/396 (6%)
 Frame = -3

Query  1330  FPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVG-------SVYRSTEVERA  1175
             +PLVY+ D      S      C   +L P+KVKGK+V+CLV        +V +S  V +A
Sbjct  304   YPLVYSVDARAANASARDAQICSVGSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQA  363

Query  1174  GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFG  1004
             GG  +IL N     + +P   F +P + +   ++  AIL YI T K PVA  I G T  G
Sbjct  364   GGIGMILANHLTTTTLIPQAHF-VPTSRV-SAADGLAILLYIHTTKYPVA-YISGATEVG  420

Query  1003  AKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIIS  824
                +P MA F+S GP+++ P ILKPDITAPG+ I+AA++EA  P     D R V +NI+S
Sbjct  421   TVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAAYTEARGPTFLQSDDRRVLFNIVS  480

Query  823   GTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTE-NVKGEAIEDAYGEVAGPFHY  647
             GTSMSCPHVS  V LLK IHP+WS +AI+SAIMT ATT  N++     D   E   PF+Y
Sbjct  481   GTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTLATTRSNLRQPIANDTLAE-GNPFNY  539

Query  646   GAGHFQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnln  485
             GAGH  P++A DPGLVYD T TDYL F+C++        T +D  ++CP K  + P +LN
Sbjct  540   GAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNATQLSTFVDKKYECPSK-PTRPWDLN  598

Query  484   ypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFS  305
             YPS+ +  L G + V RT+ NVG T +TY+V +KAP+G SVK+ P  L+F +  E++ F 
Sbjct  599   YPSITVPSLSGKVTVTRTLKNVG-TPSTYTVRIKAPSGISVKVEPKRLRFEKKNEEKMFK  657

Query  304   ISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             ++++A      GE+ FG   WSDG H V SPIVV++
Sbjct  658   VTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  693



>ref|XP_011039832.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=772

 Score =   290 bits (743),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 164/389 (42%), Positives = 237/389 (61%), Gaps = 17/389 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGF-CLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PL+ A D +    +      C P  L  +KVKGK++ CL G    V +  +   AG A 
Sbjct  385   YPLISAADAKAADQSEEDALLCKPGALDSKKVKGKILVCLRGENGRVDKGHQALLAGAAG  444

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+   + ++P  +I + ++ +A+  Y+K  K P+A L   +T    KP+
Sbjct  445   MILANDENSGNEIIADTHVLPAAHINF-TDGEAVFSYLKLTKEPMAFLTNVRTELATKPA  503

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ +E +ILKPDITAPG++++AA++EA  P D   D R   YN  SGTSM
Sbjct  504   PFMASFSSRGPNIIEESILKPDITAPGISVIAAFTEAIGPSDAEYDKRRTPYNTQSGTSM  563

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +  LLK +HP WS AAI+SAIMTTATT +  GE I D+    A PF  GAGH 
Sbjct  564   SCPHVSGIAGLLKTLHPKWSPAAIRSAIMTTATTRDNNGEPILDSTNTKATPFADGAGHV  623

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnypsLA  470
             QP++AADPGL+YD T  D+L F+C    T        D  + CPK  S S ++ NYPS+ 
Sbjct  624   QPNRAADPGLIYDLTVNDFLNFLCNRGNTKKNIKLFSDKPYTCPK--SFSLADFNYPSIT  681

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L  S+ V R V NVGS  +TY++ ++AP G +V ++P++L+F ++GE++ F ++ K 
Sbjct  682   VTNLNDSITVTRRVKNVGSP-STYNIHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKL  740

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                  + ++ FG   W DG H V+SP+VV
Sbjct  741   APNAVLTDYVFGMLTWGDGKHFVRSPLVV  769



>gb|AFV08661.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   290 bits (742),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 178/403 (44%), Positives = 243/403 (60%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA K    F P++ A D +L  +       C   TL P K KGK+V CL G   R  
Sbjct  370   ESLSATKLAHKFYPIIKATDAKLASARAEDAVLCQNGTLDPNKAKGKIVVCLRGINARVD  429

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + ++  A+  YI + K PVA +
Sbjct  430   KGEQAFLAGAVGMVLANDKTTGNEIIADPHVLPASHINF-TDGSAVFNYINSTKFPVAYI  488

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                KT    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D R
Sbjct  489   THPKTQLDTKPAPFMAAFSSKGPNTMVPEILKPDITAPGVSVIAAYTEAQGPTNQVFDKR  548

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              + +N +SGTSMSCPHVS +V LL+A++P WS AAIKSAIMTTATT + + E + +A   
Sbjct  549   RIPFNSVSGTSMSCPHVSGIVGLLRALYPTWSTAAIKSAIMTTATTLDNEVEPLLNATDG  608

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YGAGH QP++A DPGLVYD T  DYL F+C +       S      +KC KK  
Sbjct  609   KATPFSYGAGHVQPNRAMDPGLVYDITIDDYLNFLCALGYNETQISVFTEGPYKCRKK--  666

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
              S  NLNYP + +  L GS+ V RT+ NVGS   TY   V+ P G +V + P++LKF  V
Sbjct  667   FSLLNLNYPLITVPKLSGSVTVTRTLKNVGSP-GTYIAHVQNPYGITVSVKPSILKFKNV  725

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++SF ++ KA   K    + FG   WSDG H V SPIVV +
Sbjct  726   GEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKHYVTSPIVVKA  768



>ref|NP_001267495.1| SUB1 homolog precursor [Glycine max]
 gb|AAQ23176.1| subtilisin-like protease [Glycine max]
 gb|AFV08660.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   290 bits (742),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 179/403 (44%), Positives = 244/403 (61%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA K    F P++ A D +L  +       C   TL P K KGK+V CL G   R  
Sbjct  370   ESLSATKLAHKFYPIIKATDAKLASARAEDAVLCQNGTLDPNKAKGKIVVCLRGINARVD  429

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + ++  A+  YI + K PVA +
Sbjct  430   KGEQAFLAGAVGMVLANDKTTGNEIIADPHVLPASHINF-TDGSAVFNYINSTKFPVAYI  488

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                KT    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D R
Sbjct  489   THPKTQLDTKPAPFMAAFSSKGPNTMVPEILKPDITAPGVSVIAAYTEAQGPTNQVFDKR  548

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              + +N +SGTSMSCPHVS +V LL+A++P WS AAIKSAIMTTATT + + E + +A   
Sbjct  549   RIPFNSVSGTSMSCPHVSGIVGLLRALYPTWSTAAIKSAIMTTATTLDNEVEPLLNATDG  608

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YGAGH QP++A DPGLVYD T  DYL F+C +       S      +KC KK  
Sbjct  609   KATPFSYGAGHVQPNRAMDPGLVYDITIDDYLNFLCALGYNETQISVFTEGPYKCRKK--  666

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
              S  NLNYPS+ +  L GS+ V RT+ NVGS   TY   V+ P G +V + P++LKF  V
Sbjct  667   FSLLNLNYPSITVPKLSGSVTVTRTLKNVGSP-GTYIAHVQNPYGITVSVKPSILKFKNV  725

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++SF ++ KA   K    + FG   WSDG H V SPIVV +
Sbjct  726   GEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKHYVTSPIVVKA  768



>ref|XP_002530614.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF31757.1| Cucumisin precursor, putative [Ricinus communis]
Length=771

 Score =   290 bits (741),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/392 (44%), Positives = 235/392 (60%), Gaps = 17/392 (4%)
 Frame = -3

Query  1330  FPLVYAGDVE-LPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VERAGGAA  1163
             +PL+   D +    + +    C   +L   KV GK++ CL G   R  +   V   G   
Sbjct  384   YPLISGADAKSASANASDAQLCEEGSLDKAKVAGKIIVCLRGDSDRLAKGQVVASLGAVG  443

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N     +E+      +P ++I Y ++  A+  YIKT KNP A++ P KT  G KP+
Sbjct  444   MILANDQLSANELLADPHFLPASHITY-TDGQAVYNYIKTTKNPTASISPVKTEVGVKPA  502

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP++V P +LKPD+TAPG+NILAA+S A SP +   D R V + ++SGTSM
Sbjct  503   PVMASFSSRGPNAVFPGLLKPDVTAPGVNILAAYSGAISPSEEESDKRRVPFTVMSGTSM  562

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LLK+IHP WS AA+KSAIMTTA T    G +I D+ G+ A PF YGAGH 
Sbjct  563   SCPHVSGIVGLLKSIHPDWSPAAVKSAIMTTAKTRANNGRSILDSDGKTATPFAYGAGHV  622

Query  631   QPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             +P+ AADPGLVYD T TDY   +C      +V  + +  S+ CPK    + ++ NYPS+ 
Sbjct  623   RPNLAADPGLVYDLTITDYANSLCGFGYNESVVKSFIGESYTCPKN--FNMADFNYPSIT  680

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +A L  S+VV R   NVG T  TY+  VK P G SV + P  L F ++GE++ + +++KA
Sbjct  681   VANLNASIVVTRKAKNVG-TPGTYTAHVKVPGGISVTVEPAQLTFTKLGEEKEYKVNLKA  739

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                     + FG   WSDG H V+SP+VV  A
Sbjct  740   SVNGSPKNYVFGQLVWSDGKHKVRSPLVVKHA  771



>ref|XP_001777292.1| predicted protein [Physcomitrella patens]
 gb|EDQ57947.1| predicted protein [Physcomitrella patens]
Length=703

 Score =   288 bits (736),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 227/392 (58%), Gaps = 30/392 (8%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGA  1166
             E FPLV   D  L G       C+ +TL PEKV GK+V C+ G    V +   V+ AGG 
Sbjct  328   EYFPLVAGADAGLSGVEMLSALCMNNTLDPEKVAGKIVTCIRGVNGRVEKGGIVKEAGGT  387

Query  1165  AVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
              +IL N    G E+     L+P T I                 +P+A + P  T  G KP
Sbjct  388   GMILANNAASGEELLADPHLLPATMI----------------TSPMAKITPAYTKLGVKP  431

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +P MA F+S GP+++ P+ILKPD+TAPGLNILAAW+ A SP     D R VKYNIISGTS
Sbjct  432   APEMAAFSSQGPNTLNPDILKPDVTAPGLNILAAWTGAESPTGLAFDPRRVKYNIISGTS  491

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MS PHVS V ALLKA HP+WS AAIKSA++TTAT  +  G  + +   ++A PF YG G 
Sbjct  492   MSAPHVSGVAALLKARHPNWSPAAIKSALITTATQIDNTGHLVRNGSMKIATPFSYGGGQ  551

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsnlnypsL  473
               P+ A DPGLVYD T  DY LF+C +   GT L       F CP K   S S+LNYPS+
Sbjct  552   INPNAAHDPGLVYDLTPLDYTLFLCAIGYNGTFLQVFTIEPFTCPSK-VPSVSDLNYPSI  610

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              I+ L     V+RTV NVG    TY++ V  P G  V I+P  L F    EK++FS++  
Sbjct  611   TISDLSTRRAVRRTVLNVGKAKQTYNLTVVEPFGVRVDINPKQLVFSRKYEKKTFSVTFT  670

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
               +V   G ++FG + WSDG H V+SP+ + +
Sbjct  671   PRNVTTKG-YQFGSFTWSDGYHRVRSPLAIQN  701



>ref|XP_006469397.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
Length=773

 Score =   289 bits (740),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 234/380 (62%), Gaps = 18/380 (5%)
 Frame = -3

Query  1291  STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVP  1130
             ST     C   TL P+KVKGK++ CL G   R  + ++A   G   ++L N    G+E+ 
Sbjct  398   STEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELL  457

Query  1129  VGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSV  950
                 L+P +++ Y    D + +Y+ + K PV  L    T  G KP+P MA F+S GPSS+
Sbjct  458   ADPHLLPASHVNYTDGAD-LFRYVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSI  516

Query  949   EPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKA  770
              P ILKPDITAPG+ I+AA++EA+ P +   D R + +N +SGTSMSCPHVS +V LLK 
Sbjct  517   APEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKT  576

Query  769   IHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDS  590
             +HP WS AAIKSAIMTTA+ ++     I +A    A PF YGAGH QP+ A DPGLVYD 
Sbjct  577   LHPEWSPAAIKSAIMTTASIQDNNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDL  636

Query  589   TYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTV  428
             T  DYL F+C +    T  +L  D +++CP  +  S +N NYPS+ +  L GS++V RTV
Sbjct  637   TENDYLNFLCALGYNKTQIALFSDKTYRCP--EYVSTANFNYPSITVPKLSGSIIVSRTV  694

Query  427   TNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK-KVGEFEFGW  251
              NVGS   TY   V+ P G SV + P  LKF+ VGE+++F +++K   V+    ++ FG 
Sbjct  695   RNVGSP-GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGD  753

Query  250   YKWSDG-IHMVKSPIVVSSA  194
               W+D   H V+SPIVV+ A
Sbjct  754   LVWADDKQHQVRSPIVVNPA  773



>ref|XP_009394968.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   289 bits (740),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 229/369 (62%), Gaps = 15/369 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              CL  +L PEKV+GK+V CL G    V +   V +AGG  ++L N    G+E+   + ++
Sbjct  403   LCLKRSLDPEKVRGKIVVCLRGENARVEKGDVVHQAGGIGMVLANDESTGNEIIADAHVL  462

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P T+I Y  +  AIL Y+ ++K+    +   KT+ G KP+P MA F+S GP++V P ILK
Sbjct  463   PATHISY-DDGLAILSYLNSSKSLFGYITSPKTIIGTKPAPVMAAFSSQGPNTVNPEILK  521

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+AA+SEA+ P     D R V +N  SGTSMSCPH++ +  LLKA+HP WS
Sbjct  522   PDITAPGVSIIAAFSEATGPTGLTFDDRRVLFNSESGTSMSCPHIAGIAGLLKALHPDWS  581

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              +AIKSAIMTTA T +   E + ++      PF YG+GH QP++A DPGLVYD T  DYL
Sbjct  582   HSAIKSAIMTTARTRDNMKEPMFNSSFVKTSPFSYGSGHVQPNRAMDPGLVYDLTTNDYL  641

Query  571   LFICTVTGTSLDTS------FKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C +   S   +      F CP K      +LNYPS+ I  L G+  + RT+ NVG  
Sbjct  642   NFLCALGYNSTQIATFSTEPFVCPSK-PLKIEDLNYPSITIPNLSGASTITRTIKNVG-L  699

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
              +TY V V+ PAG SV + P  LKF ++GE++ F++++K        E+ FG   WSDG 
Sbjct  700   PSTYKVRVEEPAGVSVTVKPRKLKFKKLGEEKKFTVALKDKRSNLAREYTFGGLTWSDGK  759

Query  229   HMVKSPIVV  203
             H V+SPIVV
Sbjct  760   HYVRSPIVV  768



>gb|KDP29034.1| hypothetical protein JCGZ_16423 [Jatropha curcas]
Length=782

 Score =   288 bits (738),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 165/370 (45%), Positives = 230/370 (62%), Gaps = 15/370 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              CLP TL P KVKGK++ CL G   R     +   AG   +IL N    G  +   + L+
Sbjct  414   LCLPGTLDPAKVKGKILACLRGETARVDKGAQAALAGAVGMILCNDESDGDSINTDAHLL  473

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I Y  +  A+  YI + ++P+  + P   +FG KP+P MA F+S+GP++V P ILK
Sbjct  474   PASHITY-KDGLALFSYINSTRDPLGFITPTSEIFGTKPAPFMAAFSSVGPNTVTPQILK  532

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+A+++ +SSP     D R   +  +SGTSMSCPHV+ VVALLK +HP WS
Sbjct  533   PDITAPGVDIIASYTGSSSPTGLDFDKRRTPFITMSGTSMSCPHVAGVVALLKTLHPEWS  592

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTA T +   + + D     A PF+YG+GH +P++A +PGLVYD +  DYL
Sbjct  593   PAAIKSAIMTTARTRDNTPQPLLDGSSVKATPFNYGSGHIRPNRAMNPGLVYDLSVNDYL  652

Query  571   LFICTV--TGTSLD---TSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTN  407
              F+C +    +S+D      KCPK  S+S  + NYPS+ I  L GS+ V R + NVGS  
Sbjct  653   DFLCAIGYNQSSIDAFSADHKCPK--SASLLDFNYPSITIPKLSGSVTVSRKLKNVGSA-  709

Query  406   ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIH  227
               Y+V +K P G SV + P+ L F + GE++SF  + KA        +EFG   W+DG+H
Sbjct  710   GKYAVRIKEPYGISVSVEPSALTFEKTGEEKSFKATFKAKWEGAAKNYEFGGLTWTDGVH  769

Query  226   MVKSPIVVSS  197
              V+SPIVVS+
Sbjct  770   YVRSPIVVST  779



>ref|XP_008384293.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=775

 Score =   288 bits (737),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 237/377 (63%), Gaps = 22/377 (6%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              CL  +L P+KVKGK++ CL G    V +  +   AG A +IL N    G+E+     ++
Sbjct  401   LCLGGSLDPKKVKGKILACLRGLSARVDKGQQASLAGAAGMILCNDEASGNELIADPHVL  460

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P + I Y ++  A+  YI +  +P+  + P       KP+P MA F+S GP+++ P ILK
Sbjct  461   PASQINY-TDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEILK  519

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA+++A+SP D   D R V +N  SGTSMSCPHVS VV LLK ++PHWS
Sbjct  520   PDITAPGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHWS  579

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              +AI+SAIMTTA T +     +  A    A PF YG+GH +P++A DPGL+YD T  DYL
Sbjct  580   PSAIRSAIMTTARTRDNTXNPMMSASFVEATPFSYGSGHIRPNRAMDPGLIYDLTANDYL  639

Query  571   LFIC-------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGS  413
              F+C       T+   S   ++KCP  +S+S  + NYPS+++  L GS+ V R + NVGS
Sbjct  640   DFLCAIGYNKTTIQLFSEGPNYKCP--ESASLLDFNYPSISVPRLSGSVTVTRRLKNVGS  697

Query  412   TNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA----GSVKKVGEFEFGWYK  245
                TY+V +K   G SV + P VL+F  VGE++SF +++KA    G V K G++ FG   
Sbjct  698   P-GTYAVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAK-GDYVFGGLT  755

Query  244   WSDGIHMVKSPIVVSSA  194
             WSDG H V+SPIVV+SA
Sbjct  756   WSDGKHYVRSPIVVASA  772



>ref|XP_006447869.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
 gb|ESR61109.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
Length=773

 Score =   288 bits (737),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 233/380 (61%), Gaps = 18/380 (5%)
 Frame = -3

Query  1291  STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVP  1130
             ST     C   TL P+KVKGK++ CL G   R  + ++A   G   ++L N    G+E+ 
Sbjct  398   STEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELL  457

Query  1129  VGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSV  950
                 L+P +++ Y    D + +Y+ + K PV  L    T  G KP+P MA F+S GPSS+
Sbjct  458   ADPHLLPASHVNYTDGAD-LFRYVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSI  516

Query  949   EPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKA  770
              P ILKPDITAPG+ I+AA++EA  P +   D R + +N +SGTSMSCPHVS +V LLK 
Sbjct  517   APEILKPDITAPGVTIIAAYTEAVGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKT  576

Query  769   IHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDS  590
             +HP WS AAIKSAIMTTA+ ++     I +A    A PF YGAGH QP+ A DPGLVYD 
Sbjct  577   LHPEWSPAAIKSAIMTTASIQDNNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDL  636

Query  589   TYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTV  428
             T  DYL F+C +    T  +L  D +++CP  +  S +N NYPS+ +  L GS++V RTV
Sbjct  637   TENDYLNFLCALGYNKTQIALFSDKTYRCP--EYVSTANFNYPSITVPKLSGSIIVSRTV  694

Query  427   TNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK-KVGEFEFGW  251
              NVGS   TY   V+ P G SV + P  LKF+ VGE+++F +++K   V+    ++ FG 
Sbjct  695   RNVGSP-GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGD  753

Query  250   YKWSDG-IHMVKSPIVVSSA  194
               W+D   H V+SPIVV+ A
Sbjct  754   LVWADDKQHQVRSPIVVNPA  773



>ref|XP_002299062.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
 gb|EEE83867.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
Length=772

 Score =   288 bits (736),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 162/389 (42%), Positives = 235/389 (60%), Gaps = 17/389 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGF-CLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PL+ A D +    +      C P  L P+KVKGK++ CL G    V +  +   AG   
Sbjct  385   YPLISAADAKAADQSEEDALLCKPGALDPKKVKGKILVCLRGENGRVDKGHQALLAGAVG  444

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+   + ++P  ++ + ++ +A+  Y+   K P+A L   +T    KP+
Sbjct  445   MILANDENSGNEIIADTHVLPAAHVNF-TDGEAVFSYLNFTKEPMAFLTNVRTELATKPA  503

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ +E +ILKPDITAPG++++AA+++A  P D   D R   YN  SGTSM
Sbjct  504   PFMASFSSRGPNIIEESILKPDITAPGVSVIAAFTQAIGPSDAEYDKRRTPYNTQSGTSM  563

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LLK +HP WS AAI+SAIMTTATT +  GE I D+    A PF  GAGH 
Sbjct  564   SCPHVSGIVGLLKTLHPEWSPAAIRSAIMTTATTRDNNGEPIMDSTNTKATPFADGAGHV  623

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnypsLA  470
             QP+ AADPGL+YD T  D+L F+C    T        D  + CPK  S S ++ NYPS+ 
Sbjct  624   QPNHAADPGLIYDLTVNDFLNFLCNRGNTKKNIKLFSDKPYTCPK--SFSLADFNYPSIT  681

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L  S+ V R V NVGS   TY++ ++AP G +V ++P++L+F ++GE++ F ++ K 
Sbjct  682   VTNLNDSITVTRRVKNVGSP-GTYNIHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKL  740

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                  + ++ FG   W DG H V+SP+VV
Sbjct  741   APKAVLTDYVFGMLTWGDGKHFVRSPLVV  769



>ref|XP_002972619.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
 gb|EFJ26705.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
Length=747

 Score =   287 bits (735),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 252/405 (62%), Gaps = 22/405 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAAV  1160
             +P+V + DV    S      C   +L P+K +GK+V CL G   R    T V++AGGA +
Sbjct  345   YPIVASSDVGYRSSIGSL-LCTVGSLDPKKTEGKIVVCLRGVTTRLSKGTAVKQAGGAGL  403

Query  1159  ILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             +L N    G E+     ++P TN+   S  + I  Y+K  K+ V  + P KT+ G +PSP
Sbjct  404   VLANSDADGGELIADPHVLPATNVDAQSGKE-IYAYLKNTKSSVGYITPAKTLLGVEPSP  462

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              MA F+S GP+++ P+ILKPDIT PG+NILAA++ A++P     D R V++N+ SGTSMS
Sbjct  463   KMASFSSQGPNTLTPDILKPDITGPGMNILAAFTRATAP---AGDGRLVEFNVESGTSMS  519

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQ  629
             CPH++ +VALLKA+HP WS AAIKSAIMTTA T +  G  I D   +VAGPF+YGAGH  
Sbjct  520   CPHLAGIVALLKALHPDWSPAAIKSAIMTTAITYDNTGNKILDGSNKVAGPFNYGAGHVN  579

Query  628   PSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLAI  467
              + AADPGLVYD+   DY+ F+C +  +  +++T       CP     S S+ NYPS+ +
Sbjct  580   VNAAADPGLVYDAAIEDYIFFLCGLGYSSVAMETLTGYEVHCPDA-KLSLSDFNYPSVTL  638

Query  466   AGLKGSMVVKRTVTNVGST-NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             + LKGS  V RTVTNVG    A Y V +  P G SV I+P++LKF   GEK+SF+++  A
Sbjct  639   SNLKGSTTVTRTVTNVGGDGQAEYKVAINPPPGVSVSITPSILKFSSTGEKKSFTLTFTA  698

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*LSTFGFQLRRFP  155
                 K G + FG + WSDG H V+SPIVV +   +T G Q  + P
Sbjct  699   ERSSK-GAYVFGDFSWSDGKHQVRSPIVVKAT--ATSGIQDVQLP  740



>ref|XP_010092360.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51036.1| Subtilisin-like protease [Morus notabilis]
Length=732

 Score =   286 bits (733),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 229/371 (62%), Gaps = 17/371 (5%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGN---IGSEVPVGSFLI  1112
              C   TL P+KVKGK+V CL G + R+ + + A   G   +IL N    G+E+   + L+
Sbjct  362   LCKNGTLDPKKVKGKIVVCLRGDIARTEKGQYASLAGAVGMILANDLQSGNEIIADAHLL  421

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++ +++  Y+ + K P+A +   KT  G KP+P MA F+S GP+++E  +LK
Sbjct  422   PASHINF-TDGNSVFAYLNSTKTPMAYMTRVKTEVGIKPAPFMASFSSRGPNTIEEALLK  480

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA+++A+ P D   D R V +N  SGTSMSCPHVS +V LLK +HP WS
Sbjct  481   PDITAPGVNIIAAYTQAAGPTDQDFDKRRVPFNTESGTSMSCPHVSGIVGLLKTLHPDWS  540

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMT+A T +   E + D+  + A PF YGAGH QP+ A DPGLVYD T  DYL
Sbjct  541   PAAIKSAIMTSARTRDDNKEPLLDSSMKKATPFAYGAGHIQPNHAMDPGLVYDLTTDDYL  600

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T+     D    CPK  + +  N     +   G + S+VV R V NVG T
Sbjct  601   NFLCARGYNETLLKLFSDKPHNCPKSFTLANFNYPSIVVPNLGSE-SIVVSRRVKNVG-T  658

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGE--FEFGWYKWSD  236
                Y+V VK PAG SV + P  LKF ++GE++ F++ VK   V K  +  + FG  KWSD
Sbjct  659   PGIYTVYVKQPAGVSVSVWPKSLKFSKIGEEKKFNVFVKTKGVGKSTKDGYVFGHLKWSD  718

Query  235   GIHMVKSPIVV  203
             G H V+SPIVV
Sbjct  719   GKHNVRSPIVV  729



>ref|XP_007153620.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 ref|XP_007153621.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25615.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
Length=778

 Score =   288 bits (736),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 248/404 (61%), Gaps = 19/404 (5%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVEL-PGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA +  + F P++ A D +L    T     C   TL P+KVKGK+V CL G   R  
Sbjct  372   ESLSAARLAQKFYPIIKATDAQLGSARTEDAVLCQNGTLDPKKVKGKIVVCLRGINARVD  431

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + ++  A+  YI + + PVA +
Sbjct  432   KGEQALLAGAVGMVLANDKASGNEIIADPHVLPASHINF-TDGIAVFNYINSTRFPVAYI  490

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                KT    KP+P MA F+S GP++V P ILKPD+TAPG++++AA++EA  P +   D R
Sbjct  491   THPKTQLDTKPAPFMAAFSSKGPNTVVPEILKPDVTAPGVSVIAAYTEAQGPTNQVFDKR  550

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              + YN +SGTSMSCPHV+ +VALL+A +P WS AAIKSAIMTTATT + + E + +A   
Sbjct  551   RIPYNSVSGTSMSCPHVAGIVALLRASYPSWSPAAIKSAIMTTATTLDNEVEPLLNATDG  610

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT-----SFKCPKKD  509
              A PF YGAGH QP+ A DPGLVYD+T  DYL F+C +   GT +       S+ C KK 
Sbjct  611   RATPFSYGAGHVQPNTAMDPGLVYDTTIGDYLNFLCALGYNGTKISVFTEGPSYVCRKK-  669

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               S  NLNYPS+ +  L GS+ V RT+ NVGS   TY   V+ P G +V + P++L F +
Sbjct  670   -FSLLNLNYPSITVPNLSGSVTVTRTLKNVGSPR-TYIAHVQNPKGITVSVKPSILNFTK  727

Query  328   VGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             VGE++ F ++ K    K    + FG   WSDG H V+SPIVV +
Sbjct  728   VGEEKRFKVTFKIVKGKATNNYVFGKLIWSDGKHYVRSPIVVKA  771



>ref|XP_010942942.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=771

 Score =   287 bits (734),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 174/403 (43%), Positives = 249/403 (62%), Gaps = 17/403 (4%)
 Frame = -3

Query  1363  ESISAIKKMETF-PLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VY  1199
             +S+S +   + F PL+ + D   P  S      C+   L P KV GK+V C+ G+   V 
Sbjct  372   QSLSPVSLQQKFYPLIGSEDARNPNRSIADATQCISGALDPAKVTGKIVICIRGTNSRVE  431

Query  1198  RSTEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             +   V +AGG  +IL N    G+EV   + ++P T+I Y S+  ++L YIK+ K+P+  +
Sbjct  432   KGETVRQAGGTGMILANDESTGNEVLADAHVLPATHISY-SDGVSLLSYIKSAKSPLGYI  490

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                KT+    P+P MA F+S GP++V P ILKPDITAPG++I+AA++ +  P     D R
Sbjct  491   TDPKTMLDTFPAPFMAAFSSRGPNTVTPGILKPDITAPGVSIIAAYTGSLGPTSLDFDSR  550

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              V +N  SGTSMSCPHVS +  LLKA+HP WS +AIKSAI+T+A T++   E I ++  +
Sbjct  551   RVLFNSESGTSMSCPHVSGISGLLKALHPDWSPSAIKSAIITSARTQDNTLEPISNSTFQ  610

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YG+GH +P++A DPGLVYD T  DYL F+C++   S   +      + CP K  
Sbjct  611   KADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAGFNGEPYSCPSK-P  669

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
                 +LNYPS+AI+ L+G++ + RTV NVG T  TY V V  PAG SV + P  LKF +V
Sbjct  670   LKIEDLNYPSIAISNLRGAVSLIRTVKNVG-TPGTYKVRVMEPAGISVSVKPRKLKFDKV  728

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++ F +++KA S    G++ FG   WSDG H V++PI V +
Sbjct  729   GEEKKFVVTLKAKSRDVAGDYAFGKLVWSDGKHYVRTPIAVKA  771



>ref|XP_003524185.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   287 bits (734),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 176/403 (44%), Positives = 247/403 (61%), Gaps = 18/403 (4%)
 Frame = -3

Query  1363  ESISA-IKKMETFPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRST  1190
             ES+SA I   + +P++ A D +L  +       C   TL P KVKGK+V CL G   R  
Sbjct  370   ESLSATILAPKFYPIIKATDAKLASARAEDAVLCQNGTLDPNKVKGKIVVCLRGINARVD  429

Query  1189  EVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
             + E+A   G   ++L N    G+E+     ++P ++I + ++  A+  YI + K PVA +
Sbjct  430   KGEQAFLAGAVGMVLANDKTTGNEIIADPHVLPASHINF-TDGSAVFTYINSTKFPVAYI  488

Query  1027  IPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHR  848
                KT    KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D R
Sbjct  489   THPKTQLDTKPAPFMAAFSSKGPNTIVPEILKPDITAPGVSVIAAYTEAQGPTNQVFDKR  548

Query  847   SVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGE  668
              + +N +SGTSMSCPHVS +V LL+A++P WS AAIKSAIMTTATT + + E + +A   
Sbjct  549   RIPFNSVSGTSMSCPHVSGIVGLLRALYPTWSPAAIKSAIMTTATTLDNEVEPLLNATDG  608

Query  667   VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDs  506
              A PF YGAGH QP++A DPGLVYD+T  DYL F+C +   +   S      ++C KK  
Sbjct  609   KATPFSYGAGHVQPNRAMDPGLVYDTTIDDYLNFLCALGYNATQISVFTEGPYQCRKK--  666

Query  505   sspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
              S  NLNYPS+ +  L GS+ V R + NVGS   TY   V+ P G ++ + P++LKF  V
Sbjct  667   FSLLNLNYPSITVPKLSGSVTVTRRLKNVGSP-GTYIAHVQNPHGITISVKPSILKFKNV  725

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             GE++SF ++ KA   K    + FG   WSDG H V SPIVV +
Sbjct  726   GEEKSFKVTFKAMQGKATNNYVFGKLIWSDGKHYVTSPIVVKA  768



>ref|XP_004967192.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=788

 Score =   287 bits (734),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 231/391 (59%), Gaps = 16/391 (4%)
 Frame = -3

Query  1330  FPLVYAG-DVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VERAGGA  1166
             F L+ +G +   PGST      CL  +L PEK +GK+V C+ G++ R  +   V RAGGA
Sbjct  393   FYLIISGAEATAPGSTQKDAQACLLGSLDPEKARGKIVVCVRGTITRVEKGEAVRRAGGA  452

Query  1165  AVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
             A+IL N    G+++     ++P  +I Y ++   +  YIK  K P   +I GKT+   +P
Sbjct  453   AMILVNDEVSGNDLHADPHVLPAVHISY-ADGLTLSDYIKNTKIPCGFVIKGKTILETRP  511

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             +P MA F+S GP++V P ILKPDITAPG++++AAW+ A++P D P D R V +N++SGTS
Sbjct  512   APVMADFSSQGPNTVNPEILKPDITAPGVSVIAAWTGAAAPTDRPFDRRRVAFNVLSGTS  571

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHVS +  L+K +HP WS AAIKSAIMT+AT  + + + I ++    A PF YGAGH
Sbjct  572   MSCPHVSGIAGLIKTLHPEWSPAAIKSAIMTSATDLDAERKPILNSSHVAATPFSYGAGH  631

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsnlnypsL  473
               PS+A DPGLVYD T  DYL F+C +    T+++     SF CP    S          
Sbjct  632   VFPSRALDPGLVYDMTIVDYLDFLCALGYNATAMEVFNKGSFVCPNAAMSLQDLNYPSIT  691

Query  472   AIAGLKG-SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             A     G + +V+R V NVG      +  VK P G  V ++P +L F E GE++ F +S 
Sbjct  692   AHGLHAGTTTMVRRRVKNVGLPGTYTAAVVKEPEGVQVSVTPAMLVFREAGEEKEFDVSF  751

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                    V  + FG   WSDG H V+SP+VV
Sbjct  752   TVRDPVTVTGYTFGAMVWSDGSHQVRSPLVV  782



>ref|XP_011012624.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=769

 Score =   286 bits (732),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 245/402 (61%), Gaps = 19/402 (5%)
 Frame = -3

Query  1363  ESISA--IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SV  1202
             ES+SA  + K + FPL+ A D      S      C   +L PEK KGK++ CL G    V
Sbjct  369   ESLSAKALPKNKFFPLMSAADARATNASVENALLCKDGSLDPEKAKGKILVCLRGINARV  428

Query  1201  YRSTEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +  +   AG   ++L N    G+E+     ++P ++I Y S   AI KYI + + PVA 
Sbjct  429   DKGQQAALAGAVGMVLANNKDAGNEILADPHVLPVSHIKYTSGV-AIFKYINSTEYPVAY  487

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +    T  G KP+P +A F+S GP++V P ILKPDITAPG++++AA+++A  P +   D 
Sbjct  488   ITHPVTRIGMKPAPVVAAFSSKGPNTVTPEILKPDITAPGVSVIAAYTKAQGPTNQDFDT  547

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V +N +SGTSMSCPHVS +V LLK +HP WS A+IKSAIMTTA T++   E I +A  
Sbjct  548   RRVLFNAVSGTSMSCPHVSGIVGLLKTMHPTWSPASIKSAIMTTAMTQDNTMEPILNANH  607

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKD  509
               A PF YGAGH +P+KA DPGLVYD T  DYL F+C      T   T  D  ++CP K 
Sbjct  608   TKASPFSYGAGHIRPNKAMDPGLVYDLTVDDYLNFLCALGYNETQISTFSDAPYECPSK-  666

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               S +N NYPS+ +    GS+ + RTV NVGS N TY + ++ P G SV + P  L+F +
Sbjct  667   PISLANFNYPSITVPKFNGSITLSRTVKNVGSPN-TYKLRIRKPTGVSVYVEPKKLEFKK  725

Query  328   VGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             VGE+++F++++K G  K   ++ FG   WSD  H V+SPIVV
Sbjct  726   VGEEKAFTVTLK-GKGKAAKDYVFGELIWSDKKHHVRSPIVV  766



>ref|XP_006377331.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
 gb|ERP55128.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
Length=746

 Score =   286 bits (731),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 172/392 (44%), Positives = 241/392 (61%), Gaps = 18/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +P+VY+ D ++   S      C P++L P KV+GK+V+CL G    V +S  V +AGG  
Sbjct  354   YPIVYSVDAKVANASAQLAQLCYPESLDPTKVRGKIVYCLRGMIPDVEKSLVVAQAGGVG  413

Query  1162  VILGNIGSE---VPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL +  +E   +P G F +P T+I    +  ++L YI + K+PVA  I G T  G   +
Sbjct  414   MILADQSAESSSMPQG-FFVP-TSIVSAIDGLSVLSYIYSTKSPVA-YISGSTEIGKVVA  470

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ + P ILKPDITAPG++ILAA+++A        D R + +N+ISGTSM
Sbjct  471   PVMAFFSSTGPNEITPEILKPDITAPGVSILAAYTKAPRRLSRLIDQRPLSFNVISGTSM  530

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             +CPHVS +  LLK +HP WS AAIKSAIMTTA T +   + I  A    A PF+YG+GH 
Sbjct  531   ACPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTCSNARQPIVKASAAEATPFNYGSGHL  590

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsnlnypsLA  470
             +P++A DPGLVYD T TDYL F+C++   +   S      + CP K+  S  N NYPS+ 
Sbjct  591   RPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSIFIEEPYACPPKN-ISLLNFNYPSIT  649

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G++ + RT+ NVG T   Y+V VK P G  VK+ P  LKF ++ E+++F + +KA
Sbjct  650   VPNLSGNVTLTRTLKNVG-TPGLYTVRVKKPDGILVKVEPESLKFSKLNEEKTFKVMLKA  708

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                     + FG   WSDG+H V+SPIVV  A
Sbjct  709   MDNWFDSSYVFGGLTWSDGVHHVRSPIVVRKA  740



>ref|XP_002972076.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
 gb|EFJ26993.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
Length=742

 Score =   285 bits (730),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 251/405 (62%), Gaps = 22/405 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAAV  1160
             +P+V + DV    S      C   +L P+K +GK+V CL G   R    T V++AGGA +
Sbjct  341   YPIVASSDVGYRSSIGSL-LCTVGSLDPKKTEGKIVVCLRGVTTRLSKGTAVKQAGGAGL  399

Query  1159  ILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             +L N    G E+     ++P TN+   S  + I  Y+K  K+ V  + P KT+ G +PSP
Sbjct  400   VLANSDADGGELIADPHVLPATNVDAQSGKE-IYAYLKNTKSSVGYITPAKTLLGVEPSP  458

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              MA F+S GP+++ P+ILKPDIT PG+NILAA++ A++P     D R V++N+ SGTSMS
Sbjct  459   KMASFSSQGPNTLTPDILKPDITGPGMNILAAFTRATAP---AGDGRLVEFNVESGTSMS  515

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQ  629
             CPH++ +VALLKA+HP WS AAIKSAIMTTA T +  G  I D   +VAGPF+YGAGH  
Sbjct  516   CPHLAGIVALLKALHPDWSPAAIKSAIMTTAITYDNTGNKILDGSNKVAGPFNYGAGHVN  575

Query  628   PSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLAI  467
              + AADPGLVYD+   DY+ F+C +  +  +++T       CP     S S+ NYPS+ +
Sbjct  576   VNAAADPGLVYDAAIEDYIFFLCGLGYSSVAMETLTGYEVHCPDA-KLSLSDFNYPSVTL  634

Query  466   AGLKGSMVVKRTVTNVGST-NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             + LKGS  V RTVTNVG    A Y V +  P G SV I+P++LKF   GEK+SF+++  A
Sbjct  635   SNLKGSTTVTRTVTNVGGDGQAEYKVAINPPPGVSVSITPSILKFSSTGEKKSFTLTFTA  694

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*LSTFGFQLRRFP  155
                 K G + FG + WSDG H V+SPI V +   +T G Q  + P
Sbjct  695   ERSSK-GAYVFGDFSWSDGKHQVRSPIAVKAT--ATSGIQDVQLP  736



>ref|XP_007049441.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOX93598.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=624

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 233/371 (63%), Gaps = 16/371 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C   T+ PEK  GK + CL G    V +  +   AG   ++L N    G+E+   + ++
Sbjct  257   LCQAGTIDPEKASGKFLVCLRGQNARVDKGQQAALAGAVGMVLANNILAGNEIIADAHVL  316

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I Y ++  A+  YI + K P A + P  T  G KP+P MA F+S GP+++ P ILK
Sbjct  317   PASHINY-TDGLAVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEILK  375

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R V++N +SGTSMSCPHVS +V LLK ++P WS
Sbjct  376   PDITAPGVSVIAAYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDWS  435

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMT+ATT +   E I +A    AGPF YGAGH QP+ A DPGLVYD   TDYL
Sbjct  436   PAAIKSAIMTSATTWDNMKEPILNASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATDYL  495

Query  571   LFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+CT+    T  S+     +KCPK    S +N NYPS+A+  L GS+ V RTV NVGS 
Sbjct  496   NFLCTLGYNETLISMFSQNPYKCPKP--ISLANFNYPSIAVPNLVGSITVTRTVKNVGSP  553

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY  +V+ P G SV++ P  LKF +VGE+++FS+++       V E+ FG   WSD +
Sbjct  554   -GTYRAQVQRPTGISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHV  612

Query  229   HMVKSPIVVSS  197
             H V SPIVV +
Sbjct  613   HHVSSPIVVKA  623



>gb|KDP45154.1| hypothetical protein JCGZ_15019 [Jatropha curcas]
Length=771

 Score =   285 bits (730),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 164/370 (44%), Positives = 233/370 (63%), Gaps = 15/370 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNIG---SEVPVGSFLI  1112
              C    L P+K KGK++ CL GS  R  + E+A   G  A++L N     +E+     ++
Sbjct  402   LCKAGALDPKKAKGKILVCLRGSNARVEKGEQAALAGAVAMVLANDKDSENEILADPHVL  461

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P +++ Y +   AI  YI   K+ V  +   KT  G KP+P MA F+S GP+++ P ILK
Sbjct  462   PASHVNYINGV-AIFNYINNTKSSVGYITRPKTQVGTKPAPIMAAFSSKGPNTIAPEILK  520

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA+++A  P +   D R V++N +SGTSMSCPHVS + ALLK +HP+WS
Sbjct  521   PDITAPGVSVIAAYTKAEGPTNEDFDMRRVQFNSMSGTSMSCPHVSGIAALLKTLHPNWS  580

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSA+MTTATT +   E I +A    A PF YGAGH +P++A DPGL+YD +  DYL
Sbjct  581   PAAIKSAVMTTATTLDNSKEEILNASHSKATPFSYGAGHIRPNEAMDPGLIYDLSVNDYL  640

Query  571   LFICTVTGTSL------DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+CT+  +         TSFKCPKK   S +N NYPS+ I    GS+ V R V NVG +
Sbjct  641   NFLCTLGYSEAQILSFSQTSFKCPKK-PVSLANFNYPSITIPKFSGSITVTRKVKNVGVS  699

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSD-G  233
              + Y   +K P+GFS+ + P VLKF ++GE++SF +++K+     + ++ FG   WSD  
Sbjct  700   PSIYQAHIKKPSGFSISVEPKVLKFKKIGEEKSFRVTLKSKKSYAIKDYVFGELVWSDSN  759

Query  232   IHMVKSPIVV  203
              + V+SPIVV
Sbjct  760   KYYVRSPIVV  769



>gb|KDO42093.1| hypothetical protein CISIN_1g038881mg [Citrus sinensis]
Length=794

 Score =   286 bits (731),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 233/380 (61%), Gaps = 18/380 (5%)
 Frame = -3

Query  1291  STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVP  1130
             ST     C   TL P+KVKGK++ CL G   R  + ++A   G   ++L N    G+E+ 
Sbjct  419   STEVALLCEAGTLDPKKVKGKILVCLRGDNARIDKGQQALLAGAVGMVLANAQENGNELL  478

Query  1129  VGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSV  950
                 L+P ++I +    D + + + + K PV  L    T  G KP+P MA F+S GPSSV
Sbjct  479   ADPHLLPASHINFTDGAD-LFRDVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSV  537

Query  949   EPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKA  770
              P ILKPDITAPG+ I+AA++EA+ P +   D R + +N +SGTSMSCPHVS +V LLK 
Sbjct  538   APEILKPDITAPGVTIIAAYTEAAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKT  597

Query  769   IHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDS  590
             +HP WS AAIKSAIMTTA+ ++     I +A    A PF YGAGH QP+ A DPGLVYD 
Sbjct  598   LHPEWSPAAIKSAIMTTASIQDNNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDL  657

Query  589   TYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTV  428
             T  DYL F+C +    T  +L  D +++CP  +  S +N NYPS+ +  L GS++V RTV
Sbjct  658   TENDYLNFLCALGYNKTQIALFSDKTYRCP--EYVSTANFNYPSITVPKLSGSIIVSRTV  715

Query  427   TNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVK-KVGEFEFGW  251
              NVGS   TY   V+ P G SV + P  LKF+ VGE+++F +++K   V+    ++ FG 
Sbjct  716   RNVGSP-GTYIARVRNPKGISVSVEPRSLKFLRVGEEKNFKVTIKVRKVRAATKDYVFGD  774

Query  250   YKWSDG-IHMVKSPIVVSSA  194
               W+D   H V+SPIVV+ A
Sbjct  775   LVWADDKQHQVRSPIVVNPA  794



>ref|XP_010942943.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=772

 Score =   285 bits (729),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 165/370 (45%), Positives = 235/370 (64%), Gaps = 15/370 (4%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGNI---GSEVPVGSFLIP  1109
             C+   L P KV+GK+V C+ G+   V +   V +AGG  +IL N    G+EV   + ++P
Sbjct  406   CISGALDPTKVRGKIVICIRGTNDRVEKGEAVRQAGGIGMILANDESSGNEVIADAHVLP  465

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              T+I Y S+  ++L Y+K+ K+P+  +   KT+  A P+P MA F+S GP+++ P ILKP
Sbjct  466   ATHISY-SDGVSLLSYVKSAKSPLGYITSPKTMLDAFPAPFMAAFSSRGPNTITPEILKP  524

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             DITAPG++I+AA++ A  P     D R V +N  SGTSMSCPHVS V  LLKA+HP WS 
Sbjct  525   DITAPGVSIIAAYTGALGPTSLDFDSRRVLFNTDSGTSMSCPHVSGVAGLLKALHPDWSP  584

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             +AIKSAI+T+A T++   E + ++  + A PF YG+GH +P++A DPGLVYD T  DYL 
Sbjct  585   SAIKSAIITSARTQDNTLEPMSNSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLN  644

Query  568   FICTVTGTSLDTS------FKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTN  407
             F+C++   S   +      + CP K      +LNYPS+AI+ L G++ + RTV NVG T 
Sbjct  645   FLCSLGYNSTQIAGFNREPYSCPSK-PLKIEDLNYPSIAISNLTGAVSLIRTVKNVG-TP  702

Query  406   ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIH  227
              TY V V  PAG SV + P  LKF +VGE++ F +++KA      G++ FG   WSDG H
Sbjct  703   GTYKVRVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKRRDVAGDYAFGKLVWSDGKH  762

Query  226   MVKSPIVVSS  197
              V++PI V +
Sbjct  763   YVRTPIAVKA  772



>gb|KCW89054.1| hypothetical protein EUGRSUZ_A01380 [Eucalyptus grandis]
Length=764

 Score =   284 bits (727),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 171/392 (44%), Positives = 233/392 (59%), Gaps = 18/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLV----GSVYRSTEVERAGGA  1166
             + L+ A D  L   S +   FC   TL P KVKG ++ CL+     +VY   +   AG  
Sbjct  376   YKLISAADARLSHVSAHEALFCKDGTLDPRKVKGNILVCLLEGEYATVYEGAQAFLAGAV  435

Query  1165  AVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
              ++L N    G+E+     L+P +++ Y  +  AI  YIK+ K P A +    T  G KP
Sbjct  436   GMVLANSILSGNEILADPHLLPASHVNY-DDGAAIFSYIKSTKFPTARITRVVTNLGVKP  494

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             SP MA F+S GP+++ P ILKPDITAPG++++AA+SEA+ P +   D R V +N  SGTS
Sbjct  495   SPLMAAFSSRGPNTITPEILKPDITAPGVSVIAAYSEAAGPTNEEIDKRRVPFNAESGTS  554

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHVS V  LLK +HP WS AAI+SAIMT+AT ++   E+I +A    A PF YGAGH
Sbjct  555   MSCPHVSGVAGLLKTLHPEWSPAAIRSAIMTSATIQDNAMESIINASYYKATPFSYGAGH  614

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsL  473
              QP++A DPGLVYD    DYL  +C++    T  SL  D ++ C K+      + NYPS+
Sbjct  615   IQPNRAMDPGLVYDLGIKDYLNLLCSLGYNATQISLFSDGAYNCSKR--IGLLDFNYPSI  672

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              +  L GS++V RTV NVG    TY   +  P G SV + P  LKF ++ EK+SF + +K
Sbjct  673   TVPKLSGSIMVTRTVKNVG-LPGTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLK  731

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             A      G++ FG   WSD  H V+SPIVV +
Sbjct  732   AKGASVTGDYSFGELIWSDTEHYVRSPIVVKA  763



>ref|XP_006602865.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=805

 Score =   285 bits (729),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 242/408 (59%), Gaps = 36/408 (9%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFC----LVGSVYRSTEVERAG  1172
             +TF L+ A D +L  +T     FC P TL PEKVKGK+V C     + SV    E    G
Sbjct  401   QTFSLILATDAKLANATCGDAAFCKPGTLDPEKVKGKIVRCSRDGKITSVAEGQEALSNG  460

Query  1171  GAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKT---NKNPVA-----------  1034
               A++LGN       G  L+   ++   + TD+    I T   ++NP             
Sbjct  461   AVAMLLGNQNQN---GRTLLAEPHVL-STVTDSEGIQITTPPRSQNPTGDEDDIPIETGA  516

Query  1033  --TLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTP  860
                + P +T+FG KP+P MA F+S GP+ ++P+ILKPD+TAPG+NILAA+SE +S  +  
Sbjct  517   TIRMSPARTLFGIKPAPVMASFSSRGPNKIQPSILKPDVTAPGVNILAAYSELASASNLL  576

Query  859   QDHRS-VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIE  683
              D+R   K+N++ GTS+SCPHV+ +  L+K +HP+WS AAIKSAIMTTATT +     I+
Sbjct  577   VDNRRGFKFNVLQGTSVSCPHVAGIAGLIKTLHPNWSPAAIKSAIMTTATTLDNTNRPIQ  636

Query  682   DAYGE-VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICT-------VTGTSLDTSF  527
             DA+ + VA  F YG+GH QP  A DPGLVYD    DYL F+C        ++  + + +F
Sbjct  637   DAFDDKVADAFAYGSGHVQPELAIDPGLVYDLCLDDYLNFLCASGYDQQLISALNFNVTF  696

Query  526   KCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPT  347
              C   DS +  N    +L   GLK  + + RTVTNVG   ATY+  V +PAG+++ + P 
Sbjct  697   ICKGCDSVTDLNYPSITLPNLGLK-PLTITRTVTNVGPP-ATYTANVNSPAGYTIVVVPR  754

Query  346   VLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              L F ++GEK+ F + V+A SV   G++EFG  +W+DG H+V+SPI V
Sbjct  755   SLTFTKIGEKKKFQVIVQASSVTTRGKYEFGDLRWTDGKHIVRSPITV  802



>ref|NP_199377.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AED95279.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=754

 Score =   284 bits (726),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 167/404 (41%), Positives = 232/404 (57%), Gaps = 21/404 (5%)
 Frame = -3

Query  1363  ESISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG-----SV  1202
             +S++ +K     PLVYA DV +PG S N    CLP+ LSP+ V+GKVV CL G     ++
Sbjct  354   DSLTTLKMDNYAPLVYAPDVVVPGVSRNDAMLCLPNALSPDHVRGKVVLCLRGYGSGSTI  413

Query  1201  YRSTEVERAGGAAVILGN--IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATL  1028
              +  EV+RAGG  +IL N        V S  +P T + + S  D IL YI     PVA +
Sbjct  414   GKGLEVKRAGGVGMILANSRDNDAFDVESHFVP-TALVFSSTVDRILDYIYNTYEPVAFI  472

Query  1027  IPGKTV-FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
              P +TV +  +P  ++ P+    P+    + L PDI APGLNILAAWS A S      D 
Sbjct  473   KPAETVLYRNQPEDSVYPYK---PAPFMTSFL-PDIIAPGLNILAAWSGADSASKDSIDR  528

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R + YN+ SGTSMSCPHV+  +ALLK++HP WS AAI+SA+MTTA+  N   E I+D  G
Sbjct  529   RVLDYNLDSGTSMSCPHVAGAIALLKSMHPTWSSAAIRSALMTTASMTNEDNEPIQDYDG  588

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTSFKCPKK--Dsssp  497
               A PF  G+ HF+P+KAA PGLVYD++Y  YLL+ C+V  T+LD +FKCP +     + 
Sbjct  589   SPANPFALGSRHFRPTKAASPGLVYDASYQSYLLYCCSVGLTNLDPTFKCPSRIPPGYNL  648

Query  496   snlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
             +  +     ++G          V   G++ + Y    + P G  VK  P VL F ++G+K
Sbjct  649   NYPSISIPYLSGTVTVTRTVTCVGRTGNSTSVYVFNAQPPNGVLVKAEPNVLVFDKIGQK  708

Query  316   QSFSISVKAGSVKKVGE-----FEFGWYKWSDGIHMVKSPIVVS  200
             + F+I       +  GE     + FGW+ W+DG H+V+S I VS
Sbjct  709   KRFNIIFTTQRYEFTGEARRDRYRFGWFSWTDGHHVVRSSIAVS  752



>dbj|BAK01624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=792

 Score =   285 bits (728),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 236/402 (59%), Gaps = 15/402 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             S +++K  + +P++ + +   PG + +    CL  +L PEKVKGK+V CL G+   V + 
Sbjct  392   SETSLKTKDPYPMIDSAEAAAPGRAVDDAKICLQGSLDPEKVKGKIVVCLRGTSARVAKG  451

Query  1192  TEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
               V +AGGAA++L N    G+EV   + L+P T+I +  +   +  Y+K+ K+PV  +  
Sbjct  452   LTVLQAGGAAMVLANDAASGNEVIADAHLLPATHIRH-HDGLTLYSYLKSTKSPVGYVEK  510

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              +T    KP+P MA F+S GP+ V P ILKPDITAPG+ ++AA++ A +P +   D R V
Sbjct  511   PETSLETKPAPYMAAFSSQGPNPVNPEILKPDITAPGVGVIAAFTRAMAPTELAFDERRV  570

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
              +  +SGTSMSCPHVS +V LLKA+HP WS +AIKSA+MTTAT  + KGE+I +A    A
Sbjct  571   AFTTMSGTSMSCPHVSGLVGLLKALHPDWSPSAIKSAMMTTATDVDNKGESILNASLTPA  630

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDsss  500
             GPF YGAGH  PS+A +PGLVYD     YL F+C      TV        +KCP+K    
Sbjct  631   GPFAYGAGHVWPSRAMNPGLVYDLGPDHYLDFLCALKYNATVLSMFNGEPYKCPEKAPKI  690

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
                       +        VKRTV NVG     Y   V+ PAG  V +SP V++F + GE
Sbjct  691   QDLNYPSITVVNLTASGATVKRTVKNVGFP-GKYKAVVRQPAGVHVAVSPEVMEFGKKGE  749

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +++F +  +    K    + FG   WS+G+  VKSPIVV +A
Sbjct  750   EKTFEVKFEIKDAKLAKNYAFGTLMWSNGVQFVKSPIVVKTA  791



>ref|XP_002269259.3| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=749

 Score =   284 bits (726),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 183/396 (46%), Positives = 239/396 (60%), Gaps = 28/396 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVY+ D   P  S      C   +L PEKVKGK+V+CL+G    V +S  V +AGG  
Sbjct  359   YPLVYSVDARAPNASAREAQLCFVGSLDPEKVKGKIVYCLIGLNEIVQKSWVVAQAGGIG  418

Query  1162  VILGNIGSEVPVGSFLIPGTNIF---YPSETD--AILKYIKTNKNPVATLIPGKTVFGAK  998
             +IL N  S     S LIP  +     Y S  D  AIL YI   K PVA  I G T  G  
Sbjct  419   MILANRLST----STLIPQAHFVPTSYVSAADGLAILLYIHITKYPVA-YIRGATEVGTV  473

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
              +P MA F+S GP+++ P IL PDITAPG+NILAA+ EA  P     D R V +NI+SGT
Sbjct  474   AAPIMASFSSQGPNTITPGILNPDITAPGVNILAAYIEAKGPTFLQSDDRRVLFNIVSGT  533

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCP VS  V LLK IHPHWS +AI+SAIMTTA T N   + + +   E A PF+YGAG
Sbjct  534   SMSCPQVSGTVGLLKKIHPHWSPSAIRSAIMTTARTRNNVRQPMANGTLEEANPFNYGAG  593

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTV--TGTSL----DTSFKCPKKDssspsnlnyps  476
             H  P++A DPGLVYD T  DYL F+C++    T L    D  ++ P  +  S  +LNYPS
Sbjct  594   HLWPNRAMDPGLVYDLTTIDYLNFLCSIGYNATQLSRFVDEPYESP-PNPMSVLDLNYPS  652

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + +    G + V RT+ NVG T ATY+V  + P+   VK+ P  LKF ++ E+++F +++
Sbjct  653   ITVPSFSGKVTVTRTLKNVG-TPATYAVRTEVPSELLVKVEPERLKFEKINEEKTFKVTL  711

Query  295   KAGSVKKVGE---FEFGWYKWSDGIHMVKSPIVVSS  197
             +A   K+ GE   + FG   WSDG H V+SPIVV++
Sbjct  712   EA---KRDGEGSGYIFGRLIWSDGEHYVRSPIVVNA  744



>ref|XP_006857645.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
 gb|ERN19112.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
Length=774

 Score =   284 bits (727),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 246/403 (61%), Gaps = 21/403 (5%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELPGSTNFPGF----CLPDTLSPEKVKGKVVFCLVGS---V  1202
             SI  +   + +PL+ A D+  P S NF       CL  +L P K KGK+V CL G    V
Sbjct  375   SIDTLPHEKFYPLISAADILNPQS-NFSLLNVTNCLLGSLDPTKAKGKIVACLRGDNARV  433

Query  1201  YRSTEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +   V+ AGG  +IL N    G+EV   + ++P  ++   S+   +  YIK+ KNP+A 
Sbjct  434   EKGEAVKLAGGVGMILCNDPNSGNEVIADAHVLPAAHLTL-SDGAQVFSYIKSTKNPMAY  492

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +    T  G+ P+P MA F+S GP+++ P ILKPDIT PG++ILAA++EA+SP D   D 
Sbjct  493   ITRPNTNLGSTPAPVMAAFSSQGPNTITPQILKPDITGPGVSILAAYTEATSPTDMEYDK  552

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V +N++SGTSMSCPH+S VVAL+KA HP+WS AAIKSAIMTTA   +    A++DA  
Sbjct  553   RRVSFNVVSGTSMSCPHLSGVVALIKARHPNWSEAAIKSAIMTTAHRRDNVESAVKDASL  612

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTS------LDTSFKCPKKD  509
             E A PF+YGAGH +P+ AADPGLVYD T TDYL F+C++           D ++ CP   
Sbjct  613   EKATPFNYGAGHVRPNAAADPGLVYDLTPTDYLNFLCSLDYNQSSISAITDQNYTCPTP-  671

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
                  + NYPS +I  L  ++ V R V  VG   ATY+V V++P G S+++S   L F +
Sbjct  672   KPKLLDFNYPSFSITNLTSTVTVTRVVKLVGPP-ATYTVRVQSPTGVSIEVSTKSLSFEK  730

Query  328   VGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
              GE++S+++     S K  G + FG   WSDG H V+S IV++
Sbjct  731   EGEEKSYTVKFTLKS-KNFGNYSFGRLIWSDGTHYVRSAIVIN  772



>emb|CBI38462.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   284 bits (726),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 183/396 (46%), Positives = 239/396 (60%), Gaps = 28/396 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVY+ D   P  S      C   +L PEKVKGK+V+CL+G    V +S  V +AGG  
Sbjct  382   YPLVYSVDARAPNASAREAQLCFVGSLDPEKVKGKIVYCLIGLNEIVQKSWVVAQAGGIG  441

Query  1162  VILGNIGSEVPVGSFLIPGTNIF---YPSETD--AILKYIKTNKNPVATLIPGKTVFGAK  998
             +IL N  S     S LIP  +     Y S  D  AIL YI   K PVA  I G T  G  
Sbjct  442   MILANRLST----STLIPQAHFVPTSYVSAADGLAILLYIHITKYPVA-YIRGATEVGTV  496

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
              +P MA F+S GP+++ P IL PDITAPG+NILAA+ EA  P     D R V +NI+SGT
Sbjct  497   AAPIMASFSSQGPNTITPGILNPDITAPGVNILAAYIEAKGPTFLQSDDRRVLFNIVSGT  556

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCP VS  V LLK IHPHWS +AI+SAIMTTA T N   + + +   E A PF+YGAG
Sbjct  557   SMSCPQVSGTVGLLKKIHPHWSPSAIRSAIMTTARTRNNVRQPMANGTLEEANPFNYGAG  616

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTV--TGTSL----DTSFKCPKKDssspsnlnyps  476
             H  P++A DPGLVYD T  DYL F+C++    T L    D  ++ P  +  S  +LNYPS
Sbjct  617   HLWPNRAMDPGLVYDLTTIDYLNFLCSIGYNATQLSRFVDEPYESP-PNPMSVLDLNYPS  675

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + +    G + V RT+ NVG T ATY+V  + P+   VK+ P  LKF ++ E+++F +++
Sbjct  676   ITVPSFSGKVTVTRTLKNVG-TPATYAVRTEVPSELLVKVEPERLKFEKINEEKTFKVTL  734

Query  295   KAGSVKKVGE---FEFGWYKWSDGIHMVKSPIVVSS  197
             +A   K+ GE   + FG   WSDG H V+SPIVV++
Sbjct  735   EA---KRDGEGSGYIFGRLIWSDGEHYVRSPIVVNA  767



>ref|XP_002306266.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
 gb|EEE93262.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
Length=759

 Score =   284 bits (726),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 175/391 (45%), Positives = 243/391 (62%), Gaps = 15/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVY---RSTEVERAGGAA  1163
             +PL+ + DV+    S++    CL  +L P KVKGK+V+C    V+   +S  V ++GG  
Sbjct  370   YPLINSVDVKAANVSSHLAKHCLVGSLDPVKVKGKIVYCTRDEVFDGEKSLVVAQSGGVG  429

Query  1162  VILGN--IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             +IL +  + S V   +  +P T++    +  +IL YI + K PVA  I G T  G   +P
Sbjct  430   MILADQFMFSVVDPIAHFVP-TSVVSAVDGLSILSYIYSTKTPVA-YISGATEVGTVAAP  487

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              MA F+S GP+ + P ILKPDITAPG+NILAA++EAS PF    D R V +NI+SGTS+S
Sbjct  488   TMANFSSPGPNPITPEILKPDITAPGVNILAAYTEASGPFHIAGDQRQVLFNIMSGTSIS  547

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQ  629
             CPHVS +  LLKAIHP WS AAIKSAIMTTATT +   E I +A    A P +YGAGH  
Sbjct  548   CPHVSGIAGLLKAIHPDWSPAAIKSAIMTTATTISNAREPIANASLIEANPLNYGAGHIW  607

Query  628   PSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsnlnypsLAI  467
             PS+A +PGLVYD T  DY+ F+C++   S   S      + C  +++SS  + NYPS+ +
Sbjct  608   PSRAMEPGLVYDLTTRDYVDFLCSIGYNSTQLSLFLGEPYICQSQNNSSVVDFNYPSITV  667

Query  466   AGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAG  287
               L G + + RT+ NVG T ++Y V +KAP G SVK+ P  L+F +  E++ F ++V+A 
Sbjct  668   PNLSGKITLSRTLKNVG-TPSSYRVHIKAPRGISVKVEPRSLRFDKKHEEKMFEMTVEAK  726

Query  286   SVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
                K  ++ FG   WSDG H V+SPIV+  A
Sbjct  727   KGFKNDDYVFGGITWSDGKHHVRSPIVIKKA  757



>emb|CDP06171.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   283 bits (725),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 168/373 (45%), Positives = 224/373 (60%), Gaps = 16/373 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
             FC+   L P K KGK+V CL G    V +      AG   ++L N    G+E+   + ++
Sbjct  383   FCMAGCLDPIKAKGKIVVCLTGENGIVEKGINAASAGAVGMVLANDVSDGNEISSDAHVL  442

Query  1111  PGTNIFYPSETDAILKYIK-TNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNIL  935
             P   I Y ++  A+  YI  T +NP A + P  T+ G KP+P MAPF+S GP++V P IL
Sbjct  443   PAVQIRY-TDGAAVFAYINSTVRNPTAYISPPSTLLGIKPAPVMAPFSSRGPNTVTPEIL  501

Query  934   KPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHW  755
             KPDITAPG++++AA+SEA  P     D R   Y + SGTSMSCPHVS +  LLK +HP W
Sbjct  502   KPDITAPGVDVIAAYSEAQGPTGESFDKRRTPYFVDSGTSMSCPHVSGIAGLLKTLHPDW  561

Query  754   SGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDY  575
             S AAI+SAIMT+  T +   E I D     A PF YGAGH  PS+A DPGL+YD T  DY
Sbjct  562   SPAAIRSAIMTSGKTRDNAVERITDDGHIKATPFAYGAGHVHPSQAMDPGLIYDLTNQDY  621

Query  574   LLFICTV----TGTSLDT--SFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGS  413
             L F+C++    T   L T  +F CPK    S  NLNYPS+A+  L GS+ V RTV NVGS
Sbjct  622   LTFLCSLGYNETTILLFTHETFTCPKP--ISLVNLNYPSIAVPKLNGSITVTRTVKNVGS  679

Query  412   TNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDG  233
             + ATY+  V  P G SV + P  L F  +G+++SF++++ A       ++ FG   WSDG
Sbjct  680   SPATYTALVVNPPGLSVDVQPKTLAFATIGDQKSFNVTITATKAGANRDYVFGMLTWSDG  739

Query  232   IHMVKSPIVVSSA  194
              H V+S I V ++
Sbjct  740   KHYVRSQIAVKTS  752



>ref|XP_010048355.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=781

 Score =   284 bits (726),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 171/392 (44%), Positives = 233/392 (59%), Gaps = 18/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLV----GSVYRSTEVERAGGA  1166
             + L+ A D  L   S +   FC   TL P KVKG ++ CL+     +VY   +   AG  
Sbjct  393   YKLISAADARLSHVSAHEALFCKDGTLDPRKVKGNILVCLLEGEYATVYEGAQAFLAGAV  452

Query  1165  AVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
              ++L N    G+E+     L+P +++ Y  +  AI  YIK+ K P A +    T  G KP
Sbjct  453   GMVLANSILSGNEILADPHLLPASHVNY-DDGAAIFSYIKSTKFPTARITRVVTNLGVKP  511

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             SP MA F+S GP+++ P ILKPDITAPG++++AA+SEA+ P +   D R V +N  SGTS
Sbjct  512   SPLMAAFSSRGPNTITPEILKPDITAPGVSVIAAYSEAAGPTNEEIDKRRVPFNAESGTS  571

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGH  635
             MSCPHVS V  LLK +HP WS AAI+SAIMT+AT ++   E+I +A    A PF YGAGH
Sbjct  572   MSCPHVSGVAGLLKTLHPEWSPAAIRSAIMTSATIQDNAMESIINASYYKATPFSYGAGH  631

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsL  473
              QP++A DPGLVYD    DYL  +C++    T  SL  D ++ C K+      + NYPS+
Sbjct  632   IQPNRAMDPGLVYDLGIKDYLNLLCSLGYNATQISLFSDGAYNCSKR--IGLLDFNYPSI  689

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              +  L GS++V RTV NVG    TY   +  P G SV + P  LKF ++ EK+SF + +K
Sbjct  690   TVPKLSGSIMVTRTVKNVG-LPGTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLK  748

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             A      G++ FG   WSD  H V+SPIVV +
Sbjct  749   AKGASVTGDYSFGELIWSDTEHYVRSPIVVKA  780



>ref|XP_010483626.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=422

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/372 (44%), Positives = 223/372 (60%), Gaps = 18/372 (5%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              C   +L PEKVKGK+V CL G    V +  +   AG A +IL N    G+E+   + ++
Sbjct  52    LCKKGSLDPEKVKGKIVVCLRGDNARVEKGQQAAAAGAAGMILCNDKASGNEIISDAHVL  111

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P + I Y  + +A+ KY+ + K+P   +    +    KP+P MA F+S GP+SV P ILK
Sbjct  112   PASQIDY-KDGEAVFKYLNSTKDPKGYIKAPTSALNIKPAPFMASFSSRGPNSVTPGILK  170

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA++EA+SP D   DHR   YN  SGTSMSCPH+S +V LLK +HP WS
Sbjct  171   PDITAPGVNIIAAFTEATSPTDLDSDHRRTPYNTESGTSMSCPHISGIVGLLKTLHPQWS  230

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SAIMTT+ T + + + + D   + A PF YG+GH QP+KAA PGLVYD T  DYL
Sbjct  231   PAAIRSAIMTTSRTRDNRRKPMVDESFKKANPFSYGSGHVQPNKAAHPGLVYDLTTGDYL  290

Query  571   LFICTVTGTSL-------DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGS  413
              F+C V   +        D  + C  +  ++  + NYPS+ I  L  S+ V R + NVG 
Sbjct  291   DFLCAVGYNNTVVQLFAEDKQYMC--RQGANLLDFNYPSITILNLTDSITVTRKLKNVGP  348

Query  412   TNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGE-FEFGWYKWSD  236
               ATY+   + P G SV + P  L F + GE + F ++++  SVK  G  + FG   W+D
Sbjct  349   P-ATYNAHFREPLGVSVNVEPKQLNFNKTGEVKMFQMTLRPKSVKPSGSGYVFGELTWTD  407

Query  235   GIHMVKSPIVVS  200
               H V+SPIVV 
Sbjct  408   SHHYVRSPIVVQ  419



>ref|XP_002320540.2| subtilisin-like protease family protein [Populus trichocarpa]
 gb|EEE98855.2| subtilisin-like protease family protein [Populus trichocarpa]
Length=769

 Score =   283 bits (725),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 176/402 (44%), Positives = 244/402 (61%), Gaps = 19/402 (5%)
 Frame = -3

Query  1363  ESISA--IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SV  1202
             ES+SA  + K + FPL+ A D      S      C   +L PEK KGK++ CL G    V
Sbjct  369   ESLSAKALPKNKFFPLMSAADARATNASIENALLCKDGSLDPEKAKGKILVCLRGINARV  428

Query  1201  YRSTEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              +  +   AG   ++L N    G+E+     ++P ++I Y S   AI KYI + + PVA 
Sbjct  429   DKGQQAALAGAVGMVLANNKDAGNEILADPHVLPVSHINYTSGV-AIFKYINSTEYPVAY  487

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +    T  G KP+P +A F+S GP++V P ILKPDITAPG++++AA+++A  P +   D 
Sbjct  488   ITHPVTRIGTKPAPVVAAFSSKGPNTVTPEILKPDITAPGVSVIAAYTKAQGPTNQDFDT  547

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V +N +SGTSMSCPHVS +V LLK +HP WS A+IKSAIMTTA T++   E I +A  
Sbjct  548   RRVLFNSVSGTSMSCPHVSGIVGLLKTLHPTWSPASIKSAIMTTAMTQDNTMEPILNANH  607

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKD  509
               A PF YGAGH +P+KA DPGLVYD T  DYL  +C      T   T  D  ++CP K 
Sbjct  608   TKASPFSYGAGHIRPNKAMDPGLVYDLTVNDYLNLLCALGYNETQISTFSDAPYECPSK-  666

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               S +N NYPS+ +    GS+ + RTV NVGS  +TY + ++ P G SV + P  L+F +
Sbjct  667   PISLANFNYPSITVPKFNGSITLSRTVKNVGSP-STYKLRIRKPTGVSVSVEPKKLEFKK  725

Query  328   VGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             VGE+++F++++K G  K   ++ FG   WSD  H V+SPIVV
Sbjct  726   VGEEKAFTVTLK-GKGKAAKDYVFGELIWSDNKHHVRSPIVV  766



>gb|KHN40540.1| Subtilisin-like protease [Glycine soja]
Length=796

 Score =   284 bits (727),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 170/408 (42%), Positives = 242/408 (59%), Gaps = 36/408 (9%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFC----LVGSVYRSTEVERAG  1172
             +TF L+ A D +L  +T     FC P TL PEKVKGK+V C     + SV    E    G
Sbjct  392   QTFSLILATDAKLANATCGDAAFCKPGTLDPEKVKGKIVRCSRDGKITSVAEGQEALSNG  451

Query  1171  GAAVILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKT---NKNPVA-----------  1034
               A++LGN       G  L+   ++   + TD+    I T   ++NP             
Sbjct  452   AVAMLLGNQNQN---GRTLLAEPHVL-STVTDSEGIQITTPPRSQNPTGDEDDIPIETGA  507

Query  1033  --TLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTP  860
                + P +T+FG KP+P MA F+S GP+ ++P+ILKPD+TAPG+NILAA+SE +S  +  
Sbjct  508   TIRMSPARTLFGIKPAPVMASFSSRGPNKIQPSILKPDVTAPGVNILAAYSELASASNLL  567

Query  859   QDHRS-VKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIE  683
              D+R   K+N++ GTS+SCPHV+ +  L+K +HP+WS AAIKSAIMTTATT +     I+
Sbjct  568   VDNRRGFKFNVLQGTSVSCPHVAGIAGLIKTLHPNWSPAAIKSAIMTTATTLDNTNRPIQ  627

Query  682   DAYGE-VAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICT-------VTGTSLDTSF  527
             DA+ + +A  F YG+GH QP  A DPGLVYD    DYL F+C        ++  + + +F
Sbjct  628   DAFDDKLADAFAYGSGHVQPELAIDPGLVYDLCLDDYLNFLCASGYDQQLISALNFNVTF  687

Query  526   KCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPT  347
              C   DS +  N    +L   GLK  + + RTVTNVG   ATY+  V +PAG+++ + P 
Sbjct  688   ICKGCDSVTDLNYPSITLPNLGLK-PLTITRTVTNVGPP-ATYTANVNSPAGYTIVVVPR  745

Query  346   VLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              L F ++GEK+ F + V+A SV   G++EFG  +W+DG H+V+SPI V
Sbjct  746   SLTFTKIGEKKKFQVIVQASSVTTRGKYEFGDLRWTDGKHIVRSPITV  793



>gb|EYU34388.1| hypothetical protein MIMGU_mgv1a001745mg [Erythranthe guttata]
Length=765

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 248/406 (61%), Gaps = 26/406 (6%)
 Frame = -3

Query  1363  ESISA--IKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRS  1193
             ES+SA  + K ++F ++ A D +    S +    C   TL  +KVKGK++ CL G   R 
Sbjct  364   ESLSAKSLPKKKSFQIISATDAKAANASADQALLCKAGTLDAKKVKGKILVCLRGDNARV  423

Query  1192  TEVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              + E+A   G   ++L N    G+E+     ++P ++I Y ++  A+  YI + ++P+A 
Sbjct  424   DKGEQAALCGAVGMVLANNQISGNEILADPHVLPASHINY-TDGLALFSYINSTRSPIAY  482

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +  G T  G KP+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D 
Sbjct  483   ITKGTTELGTKPAPFMAAFSSNGPNTLNPEILKPDITAPGVSVIAAYTEAQGPTNQDFDT  542

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V +N +SGTSMSCPHVS VV LLK +HPHWS AAIKSAI+TTA T +   + + +A  
Sbjct  543   RRVLFNSVSGTSMSCPHVSGVVGLLKTLHPHWSPAAIKSAIITTAKTRDNTMKPLTNASY  602

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV--TGTSLD------TSFKCPK  515
               A PF+YG GH QP++A DPGLVYD +  DYL F+C +    T +        ++KC  
Sbjct  603   SKATPFNYGGGHIQPNRAMDPGLVYDLSANDYLDFLCALGYNATQIQQFSNESQTYKC--  660

Query  514   KDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKF  335
             +D  S  + NYPS+ +  LKG++ V R V NVG T  TY   V++P G SV++ P  L+F
Sbjct  661   RDPISLIDFNYPSITVPSLKGTVTVSRKVKNVG-TPGTYKARVRSPRGISVRVEPNSLRF  719

Query  334   MEVGEKQSFSISVKAGSVKKVG--EFEFGWYKWSDGIHMVKSPIVV  203
                GE++ + +++ A   KK G  ++ FG   WSDG H V+S IVV
Sbjct  720   EREGEEKGYRVTLMA---KKSGVRDYVFGQLTWSDGRHYVRSSIVV  762



>ref|XP_009611073.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=772

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 166/401 (41%), Positives = 234/401 (58%), Gaps = 17/401 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             S+  + K   FP++ A   + P  ST+    C    L P+KVKG ++ CL G    V + 
Sbjct  375   SVETLPKGNFFPIINAASAKAPHASTDDAQLCKAGALDPKKVKGTILVCLRGDNARVDKG  434

Query  1192  TEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              +   AG   +IL N    G+E+     ++P T I Y ++   +  Y+ + + P A++  
Sbjct  435   QQAALAGAVGMILANDYASGNEIIADPHVLPATQISY-TDGLELFAYLNSTRAPTASITH  493

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
               T  G KP+P MA F+S+GP++V P ILKPDITAPG++I+AA++ A  P +   D R V
Sbjct  494   PTTQLGTKPAPVMAAFSSIGPNTVTPEILKPDITAPGVSIIAAYTGAEGPTNQDFDKRRV  553

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             K+N +SGTSMSCPH+S VV LLK +HP WS +AIKSAIMTTA T +   E + +A     
Sbjct  554   KFNSVSGTSMSCPHISGVVGLLKTLHPTWSPSAIKSAIMTTARTRDNAIEPMLNASHIKT  613

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDsss  500
              PF YGAGH  P++A DPGLVYD T  DYL F+C      T   T     FKCP  +  +
Sbjct  614   SPFAYGAGHVWPNRAMDPGLVYDLTMDDYLSFLCGQGYNETQIKTFTQGPFKCP--EPVN  671

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               ++N PS+ +  L G++ + RT+ NVGS  ATY   ++ P G S  + P  L+F  +GE
Sbjct  672   FIDMNLPSITVPNLNGTVTITRTLKNVGSP-ATYKARIRRPIGISAAVEPNSLEFKNIGE  730

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             ++SF I++K    K   ++ FG   WSD  H V+SPIVV S
Sbjct  731   EKSFKITLKVKGSKGPKDYVFGQLIWSDSKHYVRSPIVVKS  771



>gb|KDO51018.1| hypothetical protein CISIN_1g015812mg [Citrus sinensis]
Length=400

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 170/393 (43%), Positives = 238/393 (61%), Gaps = 18/393 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCL---VGSVYRSTEVERAGGAA  1163
             FP + A D +L   S      C   TL P+KVKGK++ CL     SV +  +   AG A 
Sbjct  10    FPFISAEDAKLANASVENALICKKGTLDPKKVKGKILVCLDVNTRSVDKGLQAALAGAAG  69

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++L N+   G++      ++P ++I + +++ ++  YI + K+PV  +    T FG KP+
Sbjct  70    IVLVNLPEYGNDRMTDPHVLPASDINF-NDSVSLFSYITSIKHPVGYITRPTTEFGTKPA  128

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ + P ILKPDITAPG NI+AA++EA SP     D R   +N +SGTSM
Sbjct  129   PFMAAFSSKGPNIITPEILKPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSM  188

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPH+S + +LLK +HP WS AAI+SAIMTTA+T +   + I +A    A PF YGAGH 
Sbjct  189   SCPHISGIASLLKILHPDWSPAAIQSAIMTTASTHDNNKQQILNASFAEATPFSYGAGHV  248

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGT-------SLDTSFKCPKKDssspsnlnypsL  473
             QP+ A DPGLVYD T  DYL F+CT+          S + ++ CP   + S  + NYPS+
Sbjct  249   QPNLAMDPGLVYDLTANDYLNFLCTLGYNKKEIFWFSKNYTYTCPNH-TISLVDFNYPSI  307

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
             ++  L GS+ V R V NVGS   TY   +K+P G SV I+P  LKF+ VGE++SF + +K
Sbjct  308   SVPKLSGSITVTRKVKNVGSP-GTYQALLKSPKGVSVTIAPKSLKFINVGEEKSFKVIIK  366

Query  292   AGSVKKVGEFEFGWYKWSDGI-HMVKSPIVVSS  197
             A +     ++ FG   WSD   H V+SPIVV +
Sbjct  367   AQNASVTKDYAFGELIWSDDKHHQVRSPIVVKA  399



>gb|KCW88587.1| hypothetical protein EUGRSUZ_A00964 [Eucalyptus grandis]
Length=421

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 165/391 (42%), Positives = 228/391 (58%), Gaps = 17/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERAGGAA---  1163
             + L+ A D  L   S N    C   TL P KVKGK++ CL G   R  + E+A  A+   
Sbjct  33    YKLISAADARLSHVSANEALLCKNGTLDPRKVKGKILVCLRGDNARVDKGEQALLASAVG  92

Query  1162  -VILGNI--GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
              V+  N+  GSE+      +P +++ Y ++  AI  YI + K P A +    T  G KPS
Sbjct  93    MVLANNLVSGSEILSDPHFLPASHVNY-TDGAAIFSYINSTKFPTAQITRVVTNLGVKPS  151

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+++ P ILKPD+TAPG++++AA++EA+ P D   D R V YN +SGTSM
Sbjct  152   PFMAAFSSKGPNTIIPEILKPDVTAPGVSVIAAYTEAAGPTDQAYDKRRVPYNAMSGTSM  211

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS V  LLK +HP WS AAI+SAIMT+AT  +   E+I +     A PF YGAGH 
Sbjct  212   SCPHVSGVAGLLKTLHPEWSPAAIRSAIMTSATILDNAMESIMNNSFYKATPFSYGAGHI  271

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnypsLA  470
             QP++A DPGLVYD    DYL F+C++   ++      D ++ C K+      + NYPS+ 
Sbjct  272   QPNRAMDPGLVYDLGIIDYLNFLCSLGYNAMQISNVTDGAYDCSKR--IGLLDFNYPSIT  329

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L  S+ V RTV NVG    TY   +  P G  V + P  LKF ++GE++SF + +K 
Sbjct  330   VPKLSRSITVTRTVKNVGFP-GTYRASILEPNGVLVLVKPAYLKFKKIGEEKSFKVMLKV  388

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
                    ++ FG   WSD  H V+SPIVV +
Sbjct  389   KGAGATEDYSFGELIWSDTEHHVRSPIVVKA  419



>ref|XP_011039899.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=894

 Score =   285 bits (729),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 175/393 (45%), Positives = 241/393 (61%), Gaps = 18/393 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +PL+ A +  LP  S+     C   TL P+KV GK++ CL G    V +  E E AG   
Sbjct  506   YPLINAAEAGLPTASSADAQLCQNGTLDPKKVAGKIIVCLRGINSRVVKGHEAELAGAVG  565

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    GSE+     ++P  ++ + ++  A++ YIK+ KNP A++ P  T  G  P+
Sbjct  566   MILANNEESGSELLSDPHVLPAAHLTF-TDGQAVMDYIKSTKNPTASISPVHTDLGVVPN  624

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GPS +EP ILKPD+TAPG++++AA++EA  P + P D R   Y  +SGTSM
Sbjct  625   PVMAAFSSRGPSVIEPAILKPDVTAPGVDVIAAFTEAIGPSELPFDKRRTPYITMSGTSM  684

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LL+AIHP WS AAIKSAIMTTA T++   + I DA G+ A PF YGAGH 
Sbjct  685   SCPHVSGIVGLLRAIHPDWSPAAIKSAIMTTAKTKSNSKKRILDADGQPATPFAYGAGHV  744

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTS---LDTS---FKCPKKDssspsnlnypsLA  470
              P+ AADPGLVYD+   DYL F+C     S   L+ S   +KCP+K  +S +  NYPS+ 
Sbjct  745   NPNLAADPGLVYDTNVIDYLNFLCAHGYNSTFILEFSGVPYKCPEK--ASLAEFNYPSIT  802

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G + V R V NVG+   TY+V+ KAP   SV + P+ L+F + GE++ F ++ K 
Sbjct  803   VPDLNGPVTVTRRVKNVGAP-GTYTVKAKAPPQVSVVVEPSSLEFKKAGEEKIFKVTFKP  861

Query  289   GSVKKVGEFEFGWYKWSDGI-HMVKSPIVVSSA  194
                    ++ FG   WSD   H V+SP+VV  A
Sbjct  862   VVNGTPKDYTFGHLTWSDSNGHRVRSPLVVKHA  894



>ref|XP_011013813.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=768

 Score =   283 bits (723),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 171/389 (44%), Positives = 236/389 (61%), Gaps = 18/389 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCL---VGSVYRSTEVERAGGAA  1163
             +P+V + D +    S      C P++L P KV+GK+V+CL   +  V +S  V +AGG  
Sbjct  378   YPIVNSVDAKAANASAQLAQLCYPESLDPTKVRGKIVYCLGDMIPDVEQSLVVAQAGGVG  437

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL +     S  P G F +P T++    +  ++L YI + K+PVA  I G T  G   +
Sbjct  438   MILAHQFADSSSSPRG-FFVP-TSLVSAIDGLSVLSYIHSTKSPVA-YISGSTEIGKVVA  494

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MAPF+S GP+ + P ILKPDITAPG++ILAA+++A        D R + +NIISGTSM
Sbjct  495   PVMAPFSSTGPNEITPEILKPDITAPGVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSM  554

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +  LLK +HP WS AAIKSAIMTTA T +   + I  A    A PF+YG+GH 
Sbjct  555   SCPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTSSNARQPIPKASAAEATPFNYGSGHL  614

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsnlnypsLA  470
             +P++A DPGLVYD T TDYL F+C++   +   S      + CP K+  S  N NYPS+ 
Sbjct  615   RPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSIFNEEPYDCPPKN-ISLLNFNYPSIT  673

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G++ + R + NVG T   Y+V VK P G  VK+ P  LKF ++ E+++F + +KA
Sbjct  674   VPNLSGNVTLTRILKNVG-TPGLYTVRVKMPDGILVKVEPESLKFSKLNEERTFKVMLKA  732

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                     + FG   WSDG+H VKSPIVV
Sbjct  733   TDDWYSSSYVFGGLTWSDGVHRVKSPIVV  761



>ref|XP_009759676.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=623

 Score =   279 bits (714),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 165/401 (41%), Positives = 235/401 (59%), Gaps = 17/401 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             S+  + K + FP++ A   + P  ST+    C    L P+KVKG ++ CL G    V + 
Sbjct  226   SVETLPKGKLFPIINAASAKAPHASTDDAQLCKAGALDPKKVKGTILVCLRGDNARVDKG  285

Query  1192  TEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              +   AG   ++L N    G+E+     ++P T I Y ++   +  Y+ + + P A++  
Sbjct  286   QQAALAGAVGMVLANDYASGNEIIADPHVLPATQISY-TDGLELFAYVNSTRTPTASITH  344

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              KT  G KP+P MA F+S+GP++V P  LKPDITAPG++++AA++ A  P +   D R V
Sbjct  345   PKTQLGTKPAPVMAAFSSIGPNTVTPEFLKPDITAPGVSVIAAYTGAEGPTNQDFDKRRV  404

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             K+N +SGTSMSCPHVS +V LLK ++P WS +AIKSAIMTTA T +   E + +A     
Sbjct  405   KFNSVSGTSMSCPHVSGIVGLLKTLYPTWSPSAIKSAIMTTARTRDNAIEPMLNASYIKT  464

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDsss  500
              PF YGAGH +P++A DPGLVYD T  DYL F+C      T   T     FKCP  +  +
Sbjct  465   SPFAYGAGHVRPNRAMDPGLVYDLTIDDYLSFLCAQGYNETQIKTFTQGPFKCP--EPIN  522

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               N+N PS+ +  L GS+ V RT+ NVGS   TY   ++ P G S  + P  L+F  +GE
Sbjct  523   FINMNLPSITVPNLNGSVTVTRTLKNVGSP-GTYKACIRRPIGISAVVEPNSLEFKNIGE  581

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             K+SF +++K    K   ++ FG   WS G H V+SPIVV S
Sbjct  582   KKSFKLTLKVKGSKGPKDYVFGQLIWSYGKHYVRSPIVVKS  622



>ref|XP_004167057.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=673

 Score =   280 bits (717),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 245/404 (61%), Gaps = 22/404 (5%)
 Frame = -3

Query  1363  ESIS--AIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRS  1193
             ES+S  A+   + +PL+ A DV L   S +    C   TL+P K KGK++ CL G   R 
Sbjct  272   ESLSQDALPSKKLYPLMNAADVRLANASVHEAQLCKAGTLNPMKAKGKILVCLRGDNARV  331

Query  1192  TEVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              + E+A   G A +IL N    G+E+     ++P ++I + ++  A+  YI + K P A 
Sbjct  332   DKGEQALLAGAAGMILANNELSGNEILADPHVLPASHINF-TDGSAVFAYINSTKYPEAY  390

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             + P  T  G +P+P MA F+S+GP++V P ILKPDITAPGL+++AA++EA  P +   D+
Sbjct  391   ITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAAYTEAEGPTNQEFDN  450

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R + +N +SGTSMSCPHVS +  LLK ++PHWS AAIKSAIMTTA+  +   E + +A  
Sbjct  451   RRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAAIKSAIMTTASILDNNFEPLLNASY  510

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKD  509
              VA PF+YGAGH  P+ AADPGLVYD    +YL F+C +       S      F C   D
Sbjct  511   SVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFLCALGYNKAQISQFSNGPFNC--SD  568

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               SP+NLNYPS+ +  L  S+ + R + NVGS   TY  E++ PAG SV + P  L F  
Sbjct  569   PISPTNLNYPSITVPKLSRSITITRRLKNVGSP-GTYKAEIRKPAGISVWVKPKKLSFTR  627

Query  328   VGEKQSFSISVKAGSVKKVGE--FEFGWYKWSDGIHMVKSPIVV  203
             +GE+ SF + +K    +KV +  + +G   WSDG H V+SPIVV
Sbjct  628   LGEELSFKVLMKVKE-RKVAKKNYVYGDLIWSDGKHHVRSPIVV  670



>ref|XP_009374900.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Pyrus x bretschneideri]
Length=775

 Score =   283 bits (723),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 236/377 (63%), Gaps = 22/377 (6%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              CL  +L P+KVKGK++ CL G    V +  +   AG   +IL N    G+E+     ++
Sbjct  401   LCLGGSLDPKKVKGKILACLRGLSARVDKGQQASLAGAVGMILCNDEASGNELIADPHVL  460

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P + I Y ++  A+  YI +  +P+  + P       KP+P MA F+S GP+++ P ILK
Sbjct  461   PASQINY-TDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEILK  519

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PD+TAPG+NI+AA+++A+SP D   D R V +N  SGTSMSCPHVS VV LLK ++PHWS
Sbjct  520   PDVTAPGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHWS  579

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              +AI+SAIMTTA T +     + +A    A PF YG+GH +P++A DPGL+YD T  DYL
Sbjct  580   PSAIRSAIMTTARTRDNTVNPMMNASFVEATPFSYGSGHIRPNRAMDPGLIYDLTANDYL  639

Query  571   LFIC-------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGS  413
              F+C       T+   S   ++KCP  +S+S  + NYPS+++  L GS+ V R + NVG+
Sbjct  640   DFLCAIGYNKTTIQLFSEGPNYKCP--ESASLLDFNYPSISVPRLSGSVTVTRRLKNVGA  697

Query  412   TNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA----GSVKKVGEFEFGWYK  245
                TY+V +K   G SV + P VL+F  VGE++SF +++KA    G V K G++ FG   
Sbjct  698   P-GTYAVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAK-GDYVFGGLT  755

Query  244   WSDGIHMVKSPIVVSSA  194
             WSDG H V+SP VV+SA
Sbjct  756   WSDGKHYVRSPFVVASA  772



>ref|XP_010647022.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=758

 Score =   282 bits (721),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 175/389 (45%), Positives = 240/389 (62%), Gaps = 21/389 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +PLVY+ D      S +    C   +L P+KVKGK+V+CLVG   +V +S  V +AGG  
Sbjct  377   YPLVYSVDARAANASASDAQVCSVGSLDPKKVKGKIVYCLVGVNENVEKSWVVAQAGGIG  436

Query  1162  VILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAM  983
             +IL +  S     SF+I         +      ++ T + PVA  I G T  G   +P +
Sbjct  437   MILSDRLSTDT--SFMI----XLVLRKVFFFFFHVSTFRYPVA-YISGATEVGTVAAPII  489

Query  982   APFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCP  803
               F+S GP+ + P ILKPD+TAPG+ I+AA+S+A+ P D   D R V ++IISGTSMSCP
Sbjct  490   PSFSSQGPNPITPEILKPDLTAPGVQIVAAYSQATGPTDLQSDDRRVPFSIISGTSMSCP  549

Query  802   HVSAVVALLKAIHPHWSGAAIKSAIMTTATTE-NVKGEAIEDAYGEVAGPFHYGAGHFQP  626
             HV+  + LLK IHP WS +A++SAIMTTA T  NV+   + +  GE A PF YGAGH  P
Sbjct  550   HVAGTIGLLKKIHPDWSPSALRSAIMTTARTRTNVRQPLVNETLGE-ANPFSYGAGHLWP  608

Query  625   SKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnlnypsLAIA  464
             S+A DPGLVYD T TDYL F+C++        T +D  ++CP K   S  NLNYPS+ + 
Sbjct  609   SRAMDPGLVYDLTTTDYLNFLCSIGYNATQLSTFVDKGYECPSK-PMSLLNLNYPSITVP  667

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGS  284
              L G + V RT+ NVG T ATY+V  + P+G SVK+ P  LKF ++ E+++F + ++A  
Sbjct  668   SLSGKVTVTRTLKNVG-TPATYTVRTEVPSGISVKVEPNTLKFEKINEEKTFKVILEAKR  726

Query  283   VKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
               K GE+ FG   WSDG H V+SPIVV++
Sbjct  727   DGKGGEYVFGRLIWSDGEHYVRSPIVVNA  755



>emb|CAN62337.1| hypothetical protein VITISV_004299 [Vitis vinifera]
Length=590

 Score =   278 bits (711),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 228/372 (61%), Gaps = 16/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C   TL   KVKGK++ CL G    V +  +   AG   ++L N    G+EV     ++
Sbjct  223   LCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVL  282

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++  A+  Y+ + K+P+A + P  T  G KP+P MA F+S GP+++ P ILK
Sbjct  283   PASHINF-TDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  341

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R V +N +SGTSMSCPHVS +V LLK +HP WS
Sbjct  342   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  401

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SA+MTTA T +   EAI +A    A PF YGAGH +P++A +PGLVYD    DYL
Sbjct  402   PAAIRSAMMTTARTMDNSMEAILNASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYL  461

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T+     +  + CPK    S +N NYPS+ +  L GS+ V RT+ NVG  
Sbjct  462   NFLCALGYNQTLIKMFSERPYTCPKP--ISLTNFNYPSITVPKLHGSITVTRTLKNVGPP  519

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  LKF ++GE+++FS++++A       ++ FG   WSD  
Sbjct  520   -GTYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAK  578

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  579   HFVRSPIVVKAA  590



>gb|KDP29035.1| hypothetical protein JCGZ_16424 [Jatropha curcas]
Length=1089

 Score =   287 bits (734),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 233/370 (63%), Gaps = 16/370 (4%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGN---IGSEVPVGSFLIP  1109
             CL  +L P KVKGK++ CL G   R  + ++A   G    IL N    G E+     ++P
Sbjct  725   CLAGSLDPAKVKGKILACLRGGSDRMEKGQQAALAGAVGFILSNDKSFGDEISQDLHMLP  784

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              ++I Y  +  A+  YI +  +PVA + P   +  A P+P MA F+S+GP+ + P ILKP
Sbjct  785   ASHINY-RDGLALYSYINSTDDPVAFITPTSEML-AGPAPFMADFSSVGPNIITPEILKP  842

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             D+TAPG+NI+AA+SEA+SP ++  D R   +N+ SGTSMSCPHV+ VVALLK ++P+WS 
Sbjct  843   DVTAPGVNIIAAFSEAASPSESYFDKRRTAFNLNSGTSMSCPHVAGVVALLKTLYPYWSP  902

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             AAI+SAIMTTA T +     + D Y + A PFHYG+GH +P++A +PGLVYD +  DYL 
Sbjct  903   AAIRSAIMTTARTRDNTIHPMRDGYSKKATPFHYGSGHMRPNRAMNPGLVYDLSVNDYLD  962

Query  568   FICTV-TGTSLDTSF----KCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNA  404
             F+C +    +L  +F    KCPK   +S    NYPS+A+  L GS+ V R + NVGS   
Sbjct  963   FLCAIGYNQTLIHAFSVGHKCPKS--ASLLEFNYPSIAVLKLSGSVTVSRKLKNVGSP-G  1019

Query  403   TYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHM  224
              Y+V +K P G SV + P VL F + GE++SF  +  A       E+EFG   W+DG+H 
Sbjct  1020  KYAVRIKEPYGISVSVEPRVLTFDKNGEEKSFKATFTAKWEGAAKEYEFGGLIWTDGLHY  1079

Query  223   VKSPIVVSSA  194
             V+SPIVVS+A
Sbjct  1080  VRSPIVVSAA  1089


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 10/131 (8%)
 Frame = -3

Query  1270  CLPDTLSPEKVKGKVVFCLVGSVYRSTEVER---AGGAAVILGN---IGSEVPVGSFLIP  1109
             CL  +L P KVKGK++ CL G   R  + ++   AG    IL N    G E+     ++P
Sbjct  390   CLAGSLDPAKVKGKILACLRGGSDRMEKGQQAALAGAVGFILSNDKSFGDEISQDLHMLP  449

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              ++I Y  +  A+  YI +  +PVA + P   +  A P+P MA F+S+GP+ + P ILK 
Sbjct  450   ASHINY-RDGLALYSYINSTDDPVAFITPTSEML-AGPAPFMADFSSVGPNIITPEILK-  506

Query  928   DITAPGLNILA  896
              +  P   +LA
Sbjct  507   -VCGPNQKVLA  516



>ref|XP_007049440.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOX93597.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=794

 Score =   283 bits (723),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 233/371 (63%), Gaps = 16/371 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C   T+ PEK  GK + CL G    V +  +   AG   ++L N    G+E+   + ++
Sbjct  427   LCQAGTIDPEKASGKFLVCLRGQNARVDKGQQAALAGAVGMVLANNILAGNEIIADAHVL  486

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I Y ++  A+  YI + K P A + P  T  G KP+P MA F+S GP+++ P ILK
Sbjct  487   PASHINY-TDGLAVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEILK  545

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R V++N +SGTSMSCPHVS +V LLK ++P WS
Sbjct  546   PDITAPGVSVIAAYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDWS  605

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMT+ATT +   E I +A    AGPF YGAGH QP+ A DPGLVYD   TDYL
Sbjct  606   PAAIKSAIMTSATTWDNMKEPILNASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATDYL  665

Query  571   LFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+CT+    T  S+     +KCPK    S +N NYPS+A+  L GS+ V RTV NVGS 
Sbjct  666   NFLCTLGYNETLISMFSQNPYKCPKP--ISLANFNYPSIAVPNLVGSITVTRTVKNVGSP  723

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY  +V+ P G SV++ P  LKF +VGE+++FS+++       V E+ FG   WSD +
Sbjct  724   -GTYRAQVQRPTGISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHV  782

Query  229   HMVKSPIVVSS  197
             H V SPIVV +
Sbjct  783   HHVSSPIVVKA  793



>ref|XP_008794759.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score =   282 bits (722),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 246/396 (62%), Gaps = 18/396 (5%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGG  1169
             E +P++ + +      S +    C   +L PEKV+GK+V CL G    V +   V +AGG
Sbjct  387   ELYPMISSKEARASNASAHDAELCYLGSLDPEKVRGKIVVCLRGITARVEKGEAVLQAGG  446

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             + ++L N    G+E+   + L+P T+I Y ++  ++  Y+K+ K+P+  +    T    K
Sbjct  447   SGMVLVNDQSSGNEISADAHLLPATHITY-NDGFSLFSYLKSTKSPLGYITTPITQLDTK  505

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP+++   ILKPDITAPG+++LAA++ A+ P     D R V +N++ GT
Sbjct  506   PAPLMAAFSSQGPNTINAEILKPDITAPGVSVLAAFTGAAGPTGLAFDTRRVAFNLLYGT  565

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPH+S VV LLK++HP WS +AIKSAIMTTATT++   E + ++    A PF YG+G
Sbjct  566   SMSCPHISGVVGLLKSLHPDWSPSAIKSAIMTTATTQDNMDEPVLNSSYVKATPFSYGSG  625

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnyps  476
             H QP++A DPGLVYD T  DYL F+C +  TS       + SF CP K      +LNYPS
Sbjct  626   HVQPNRAMDPGLVYDLTTNDYLNFLCALGYTSTQIALISNDSFLCPSK-PPKLEDLNYPS  684

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + I  L GS+ V R + NVGS   TY V V+ P G SV ++PT L + ++GE++ F +++
Sbjct  685   ITIPDLSGSITVTRAMKNVGSP-GTYIVRVREPIGISVSVNPTSLTYDKIGEEKKFEVTL  743

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*L  188
             K G      ++ FG   WSDG H V++P+VVS+A L
Sbjct  744   KEGHAPT--DYVFGELIWSDGKHYVQTPLVVSAAGL  777



>ref|XP_008224681.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   282 bits (721),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 229/368 (62%), Gaps = 17/368 (5%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVPVGSFLI  1112
              C+  TL P+KVKGK++ CL G   R+ + E+A   G   +IL N    G+E+     ++
Sbjct  401   LCIGGTLDPQKVKGKILACLRGDTARADKGEQAALAGAVGMILCNDKASGNEIIADPHVL  460

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P + I Y ++  A++ YI +  +P   + P      AKP+P MA F+S GP+++ P ILK
Sbjct  461   PASQINY-TDGIAVVSYINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEILK  519

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA+++A+SP +   D R + +N  SGTSMSCPHVS VV LLK ++P WS
Sbjct  520   PDITAPGVNIIAAYTQATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDWS  579

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              +AI+SAIMTTA T +     +++A    A PF YGAGH +P++A DPGL+YD T  DYL
Sbjct  580   PSAIRSAIMTTARTRDNTANPMKNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVNDYL  639

Query  571   LFICTVTGT-------SLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGS  413
              F+C +          S   ++KCPK   +S  + NYPS+A+  L GS+ V R V NVGS
Sbjct  640   DFLCAIGYNKTMMQLFSESPNYKCPKS--ASLLDFNYPSIAVPELSGSVTVTRRVKNVGS  697

Query  412   TNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDG  233
                TY+V +  P G SV + P +LKF  +GE++SF +++KA  +     + FG   WSDG
Sbjct  698   P-GTYAVRIHKPLGVSVTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKGYVFGGLIWSDG  756

Query  232   IHMVKSPI  209
              H V+SPI
Sbjct  757   KHYVRSPI  764



>ref|XP_002299064.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
 gb|EEE83869.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
Length=810

 Score =   283 bits (723),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 171/393 (44%), Positives = 236/393 (60%), Gaps = 18/393 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +PL+ A +  LP +       C   TL P+KV GK++ CL G    V +  E E AG   
Sbjct  422   YPLINAAEARLPTAPAADAQLCQNGTLDPKKVAGKIIVCLRGINSRVVKGHEAELAGAVG  481

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    GSE+     ++P  ++ + ++  A++ YIK+ KNP A++ P  T  G  P+
Sbjct  482   MILANDEESGSEILSDPHMLPAAHLTF-TDGQAVMNYIKSTKNPTASISPVHTDLGVVPN  540

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GPS +EP ILKPD+TAPG++++AA++EA  P + P D R   Y  +SGTSM
Sbjct  541   PVMAAFSSRGPSLIEPAILKPDVTAPGVDVIAAYTEALGPSELPFDKRRTPYITMSGTSM  600

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LL+AIHP WS AA+KSAIMTTA T +   + I DA G+ A PF YGAGH 
Sbjct  601   SCPHVSGIVGLLRAIHPDWSPAALKSAIMTTAKTISNSKKRILDADGQPATPFAYGAGHV  660

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnypsLA  470
              P++AADPGLVYD+   DYL F+C     S          +KCP+   +S +  NYPS+ 
Sbjct  661   NPNRAADPGLVYDTNEIDYLNFLCAHGYNSTFIIEFSGVPYKCPEN--ASLAEFNYPSIT  718

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L G + V R V NVG+   TY+V+ KAP   SV + P+ L+F + GE++ F ++ K 
Sbjct  719   VPDLNGPVTVTRRVKNVGAP-GTYTVKAKAPPEVSVVVEPSSLEFKKAGEEKIFKVTFKP  777

Query  289   GSVKKVGEFEFGWYKWSDGI-HMVKSPIVVSSA  194
                    ++ FG   WSD   H VKSP+VV  A
Sbjct  778   VVNGMPKDYTFGHLTWSDSNGHHVKSPLVVKHA  810



>ref|XP_007213363.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
 gb|EMJ14562.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
Length=740

 Score =   281 bits (719),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/369 (44%), Positives = 228/369 (62%), Gaps = 17/369 (5%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVPVGSFLI  1112
              C+  TL P+KVKGK++ CL G   R  + E+A   G   +IL N    G+E+     ++
Sbjct  373   LCIGGTLDPQKVKGKILACLRGDTARIDKGEQAALAGAVGMILCNDKASGNEIIADPHVL  432

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P + I Y ++  A++ YI +  +P   + P      AKP+P MA F+S GP+++ P ILK
Sbjct  433   PASQINY-TDGIAVVSYINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEILK  491

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA+++A+SP +   D R + +N  SGTSMSCPHVS VV LLK ++P WS
Sbjct  492   PDITAPGVNIIAAYTQATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDWS  551

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              +AI+SAIMTTA T +     +++A    A PF YGAGH +P++A DPGL+YD T  DYL
Sbjct  552   PSAIRSAIMTTARTRDNTANPMKNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVNDYL  611

Query  571   LFICTVTGT-------SLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGS  413
              F+C +          S   ++KCPK   +S  + NYPS+ +  L GS+ V R V NVGS
Sbjct  612   DFLCAIGYNKTMMQLFSESPNYKCPKS--ASLLDFNYPSIVVPELSGSVTVTRRVKNVGS  669

Query  412   TNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDG  233
                TY+V    P G SV + P +LKF  +GE++SF +++KA  +    ++ FG   WSDG
Sbjct  670   P-GTYAVRAHKPLGVSVTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKDYVFGGLIWSDG  728

Query  232   IHMVKSPIV  206
              H V+SPIV
Sbjct  729   KHYVRSPIV  737



>ref|XP_004294696.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score =   281 bits (720),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 166/372 (45%), Positives = 231/372 (62%), Gaps = 15/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVER---AGGAAVILGNI---GSEVPVGSFLI  1112
              C   TL PEKVKGK++ CL G   R  + E+   AG   +IL N    G+E+     ++
Sbjct  403   LCKAGTLDPEKVKGKILACLRGDNARVDKGEQSLLAGAVGMILANDEVNGNEIISDPHVL  462

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P  +I + ++   +  YI    +P A +    T+ G KP+P MA F+S GP+S+ P+ILK
Sbjct  463   PAAHINF-TDGALVFAYINETTSPRAYIKRPTTMLGTKPAPFMAAFSSKGPNSITPDILK  521

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA+SEA  P +   D R + +N +SGTSMSCPH+S +V LLK ++PHWS
Sbjct  522   PDITAPGVSVIAAYSEAQGPTNQEFDRRRIPFNSVSGTSMSCPHISGIVGLLKTLYPHWS  581

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTA T++   E + +A    A PF YGAGH +P+ A DPGLVYD    DYL
Sbjct  582   PAAIKSAIMTTAKTQDNNREPLLNASNSEATPFSYGAGHVKPNSAMDPGLVYDLDTDDYL  641

Query  571   LFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
               +C +    T ++T    S+KCP   + S +NLNYPS+ +  L GS+VVKRT+ NVG  
Sbjct  642   NVLCALGYNKTQIETFSQESYKCPSP-AISLTNLNYPSITVPKLSGSLVVKRTLKNVGEP  700

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY+  +  P G  V + P  LKF +VGE++SF++ ++A        + FG   WSDG 
Sbjct  701   -GTYTARITNPDGILVSVEPKSLKFKKVGEEKSFNVVLEAKDSNAAKNYVFGKLIWSDGK  759

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  760   HNVRSPIVVKAA  771



>ref|XP_008661010.1| PREDICTED: subtilisin-like protease SBT5.3 [Zea mays]
 gb|AFW87513.1| putative subtilase family protein [Zea mays]
Length=785

 Score =   282 bits (721),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 224/392 (57%), Gaps = 16/392 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYR---STEVERAGGAA  1163
             +PL+       PGS       CL  +L PEK +GK+V CL G++ R      V  AGGAA
Sbjct  393   YPLITGDQAIHPGSKQEDAQLCLVGSLDPEKTRGKIVVCLRGNIPRVDKGAAVRHAGGAA  452

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+ +     +IP  +I Y ++   +  YIK  K P   ++ G+T+ G +P+
Sbjct  453   MILVNDEANGNVLQADPHVIPAVHISY-ADGLRLSAYIKNTKVPSGFVVKGRTILGTRPA  511

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+++ P ILKPDITAPG+N++AAWS A+SP D   D R V +NI+SGTSM
Sbjct  512   PVMAAFSSQGPNTINPEILKPDITAPGVNVIAAWSGATSPTDKSFDKRRVAFNILSGTSM  571

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS V  L+K +HP WS AAIKSAIMT+AT  + + + I ++    A PF YGAGH 
Sbjct  572   SCPHVSGVAGLIKTLHPDWSPAAIKSAIMTSATVLDAEMKPILNSSYAPATPFSYGAGHV  631

Query  631   QPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLA  470
              PS+A DPGLVYD T  DYL F+C +    T++ T    SF CP    S          A
Sbjct  632   FPSRALDPGLVYDMTVVDYLDFLCALGYNATAMRTMNRGSFVCPTTPMSLHDLNYPSITA  691

Query  469   IAGLKG-SMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
                  G + +V+R + NVG    TY+  V  P G  V + P +L F E GE++ F +   
Sbjct  692   HGLPAGTTTMVRRRLKNVG-LPGTYTAAVVEPEGMHVSVIPAMLVFRETGEEKEFDVIFT  750

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
                      + FG   WSDG H V+SP+VV +
Sbjct  751   VSDRAPAASYVFGTIVWSDGSHQVRSPLVVKT  782



>ref|XP_010657502.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=620

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 228/372 (61%), Gaps = 16/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C   TL   KVKGK++ CL G    V +  +   AG   ++L N    G+EV     ++
Sbjct  253   LCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVL  312

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++  A+  Y+ + K+P+A + P  T  G KP+P MA F+S GP+++ P ILK
Sbjct  313   PASHINF-TDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  371

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R V +N +SGTSMSCPHVS +V LLK +HP WS
Sbjct  372   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  431

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SA+MTTA T +   EAI +A    A PF YGAGH +P++A +PGLVYD    DYL
Sbjct  432   PAAIRSAMMTTARTMDNSMEAILNASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYL  491

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T+     +  + CPK    S +N NYPS+ +  L GS+ V RT+ NVG  
Sbjct  492   NFLCALGYNQTLIKMFSERPYTCPKP--ISLTNFNYPSITVPKLHGSITVTRTLKNVGPP  549

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  LKF ++GE+++FS++++A       ++ FG   WSD  
Sbjct  550   -GTYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAK  608

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  609   HFVRSPIVVKAA  620



>ref|XP_010048342.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW89053.1| hypothetical protein EUGRSUZ_A01377 [Eucalyptus grandis]
Length=770

 Score =   281 bits (720),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/371 (44%), Positives = 224/371 (60%), Gaps = 16/371 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
             FC   TL P KVKG ++ CL G   +V+   +   AG   ++L N    G+E+     L+
Sbjct  403   FCKDGTLDPRKVKGNILVCLWGENATVHEGEQAFLAGAVGMVLANSILSGNEILADPHLL  462

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P +++ Y  +  AI  YIK+ K P A +    T  G KPSP MA F+S GP+++ P ILK
Sbjct  463   PASHVNY-GDGAAIFSYIKSTKFPTAQITRVVTNLGVKPSPLMAAFSSKGPNTITPEILK  521

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA+ P D   D R V +N +SGTSMSCPHVS V  LLK +HP WS
Sbjct  522   PDITAPGVSVIAAYTEAAGPTDEEFDKRRVPFNAVSGTSMSCPHVSGVAGLLKTLHPEWS  581

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SAIMT+AT ++   E+I +A    A PF YGAGH QP++A DPGLVYD    DY 
Sbjct  582   PAAIRSAIMTSATIQDNAMESIINASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIEDYP  641

Query  571   LFICTVTGTSL------DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C++   ++      D ++ C K       + NYPS+ +  L GS++V RTV NVG  
Sbjct  642   NFLCSLGYNAMQISMFSDGAYNCSKH--IGLLDFNYPSITVPKLSGSIMVTRTVKNVG-L  698

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   +  P G SV + P  LKF ++ EK+SF + +KA      G++ FG   WSD  
Sbjct  699   PGTYRASILEPNGVSVLVKPAYLKFKKINEKKSFKVVLKAKGASVTGDYSFGELIWSDTE  758

Query  229   HMVKSPIVVSS  197
             H V+SPIVV +
Sbjct  759   HYVRSPIVVKA  769



>ref|XP_007217687.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
 gb|EMJ18886.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
Length=773

 Score =   281 bits (719),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 166/372 (45%), Positives = 230/372 (62%), Gaps = 15/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGNI---GSEVPVGSFLI  1112
              C   TL  +KVKGK++ CL G   R  + E+A   G   +IL N    G+EV     ++
Sbjct  405   LCKAGTLDLKKVKGKILACLRGESARVDKGEQALLAGAVGMILANDELSGNEVISDPHVL  464

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++   +  YI + K+P A +    T  G KP+P MA F+S GP+++ P+ILK
Sbjct  465   PASHINF-TDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAAFSSKGPNTITPDILK  523

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+NI+AA++EA  P +   D R V +N +SGTSMSCPH+S +  LLK ++PHWS
Sbjct  524   PDITAPGVNIIAAYTEAQGPTNQMFDERRVLFNSVSGTSMSCPHISGICGLLKTLYPHWS  583

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTATT++   E + +A    A PF YGAGH  P+ A DPGLVYD +  DYL
Sbjct  584   PAAIKSAIMTTATTQDNSREPVLNASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLNDYL  643

Query  571   LFICTVTGTSL------DTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C+            + ++KCPK  + S +NLNYPS+ +  L GS+VV RTV NVG T
Sbjct  644   NFLCSNGYNKRQIEMVSEETYKCPKP-AISRTNLNYPSITVPKLNGSLVVTRTVKNVG-T  701

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  L+F ++GE++SF + ++    K    + FG   WSDG 
Sbjct  702   PGTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGK  761

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV  A
Sbjct  762   HYVRSPIVVKVA  773



>ref|XP_004243217.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=774

 Score =   281 bits (719),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 164/399 (41%), Positives = 234/399 (59%), Gaps = 17/399 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             S+ A+ K + FP++ A   +   +T +    C    L P+KVKG ++ CL G    V + 
Sbjct  377   SVEALPKGKLFPIITAASAKATHATTYDAQLCKAGALDPKKVKGTILVCLRGENARVDKG  436

Query  1192  TEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              +   AG  A++L N    G+E+     ++P T I Y    D ++ Y+ + + P A +  
Sbjct  437   QQAALAGAVAMVLANDYASGNEIIADPHVLPATQISYTDGLD-VIAYVNSTRAPTAFITH  495

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
               T  G KP+P MA F+S+GP++V P ILKPDITAPG++I+AA++ A  P +   D R V
Sbjct  496   PTTQLGTKPAPVMAAFSSIGPNTVTPQILKPDITAPGVSIIAAFTGAQGPTEQAFDKRRV  555

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             K+N +SGTSMSCPHVS +V LLK +HP WS +AIKSAIMTTA T +   E + +A     
Sbjct  556   KFNSVSGTSMSCPHVSGIVGLLKTLHPTWSPSAIKSAIMTTARTRDNSVEPMLNASYIKT  615

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICT--VTGTSLDT----SFKCPKKDsss  500
              PF YGAGH +P++A DPGLVYD T  DYL F+C      T + T    SFKCP  D  +
Sbjct  616   SPFAYGAGHVRPNRAMDPGLVYDLTIDDYLSFLCAQGYNETQIKTFTLGSFKCP--DPIN  673

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               ++N PS+ +  L  S+ + RT+ NVGS   TY   ++ P G S  + P  L+F  + E
Sbjct  674   FIDMNLPSITVPNLNSSVTITRTLKNVGSP-GTYKARIRHPIGISAVVEPNSLEFKNINE  732

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             ++SF +++K    K   ++ FG   WSD  H V+SPIVV
Sbjct  733   EKSFKLTLKVKGSKAPKDYVFGQLIWSDNKHYVRSPIVV  771



>gb|KHM99088.1| Subtilisin-like protease [Glycine soja]
Length=763

 Score =   281 bits (719),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 227/399 (57%), Gaps = 25/399 (6%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCL----VGSVYRSTEVERAGGA  1166
             +PLV+A +  LP +T    G C P  L P K+KG ++ C+      SV +  E   AG  
Sbjct  366   YPLVHAVNARLPNATIEDAGLCKPGALDPRKIKGNILVCIRRDKTTSVAQGYEAANAGAV  425

Query  1165  AVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKY---------IKTNKNPVATLIP  1022
              V + N    G  +    + IPG N+    + D I ++            ++  VA +  
Sbjct  426   GVFVVNGKQSGGTLLAEPYPIPGANVDVSQDKD-IDEHEWFEKGGSDTNNSRKLVAYMTV  484

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              +T  G KP+P +A F+S GP++V+P ILKPDI APG+NILAA S A+SP + P D R V
Sbjct  485   ARTYLGIKPAPIVAGFSSRGPNAVQPLILKPDIIAPGVNILAANSLAASPSNQPSDRRRV  544

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
              +NI  GTSMSCPHV+ VV LLK +HP WS AAIKSAIMTTATT++     I DA+ ++A
Sbjct  545   PFNIQQGTSMSCPHVAGVVGLLKTLHPDWSPAAIKSAIMTTATTQDNNHLPIRDAFDQIA  604

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDsss  500
              PF YG+GH QP+ A DPGLVYD    DYL FIC              +S+ CPK  +  
Sbjct  605   TPFDYGSGHIQPNLAMDPGLVYDMRTRDYLNFICAHDHNQYFLKYFHRSSYNCPKSYNIE  664

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               N    ++A  G+K  + V RTVTNVG+ N+TY V+     GF V + P+ L F  +GE
Sbjct  665   NLNYPSITVANRGMK-PISVTRTVTNVGTPNSTYVVKANVLEGFKVLVQPSSLAFKTIGE  723

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             K+SF + ++  S    G   FG   W+DG H V SPIV+
Sbjct  724   KKSFRVILEGTSWPSHGFPVFGNLSWTDGNHTVTSPIVI  762



>gb|KGN43389.1| hypothetical protein Csa_7G030520 [Cucumis sativus]
Length=736

 Score =   280 bits (717),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 245/404 (61%), Gaps = 22/404 (5%)
 Frame = -3

Query  1363  ESIS--AIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRS  1193
             ES+S  A+   + +PL+ A DV L   S +    C   TL+P K KGK++ CL G   R 
Sbjct  335   ESLSQDALPSKKLYPLMNAADVRLANASVHEAQLCKAGTLNPMKAKGKILVCLRGDNARV  394

Query  1192  TEVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              + E+A   G A +IL N    G+E+     ++P ++I + ++  A+  YI + K P A 
Sbjct  395   DKGEQALLAGAAGMILANNELSGNEILADPHVLPASHINF-TDGSAVFAYINSTKYPEAY  453

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             + P  T  G +P+P MA F+S+GP++V P ILKPDITAPGL+++AA++EA  P +   D+
Sbjct  454   ITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAAYTEAEGPTNQEFDN  513

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R + +N +SGTSMSCPHVS +  LLK ++PHWS AAIKSAIMTTA+  +   E + +A  
Sbjct  514   RRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAAIKSAIMTTASILDNNFEPLLNASY  573

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKD  509
              VA PF+YGAGH  P+ AADPGLVYD    +YL F+C +       S      F C   D
Sbjct  574   SVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFLCALGYNKAQISQFSNGPFNC--SD  631

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               SP+NLNYPS+ +  L  S+ + R + NVGS   TY  E++ PAG SV + P  L F  
Sbjct  632   PISPTNLNYPSITVPKLSRSITITRRLKNVGSP-GTYKAEIRKPAGISVWVKPKKLSFTR  690

Query  328   VGEKQSFSISVKAGSVKKVGE--FEFGWYKWSDGIHMVKSPIVV  203
             +GE+ SF + +K    +KV +  + +G   WSDG H V+SPIVV
Sbjct  691   LGEELSFKVLMKVKE-RKVAKKNYVYGDLIWSDGKHHVRSPIVV  733



>ref|XP_009361505.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=777

 Score =   281 bits (719),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 163/372 (44%), Positives = 233/372 (63%), Gaps = 15/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGN---IGSEVPVGSFLI  1112
              C P+TL P+KVKGK++ CL G   R  + E+A   G   +IL N    G+E+     ++
Sbjct  409   LCKPNTLDPKKVKGKILACLRGDNARVDKGEQAFLAGAVGMILANNELTGNEIIADPHVL  468

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++ + +  YI + K+P A +    T  G KPSP MA F+S GP+++ P ILK
Sbjct  469   PASHINF-TDGNLVFAYIYSTKSPRAYIKRAITELGTKPSPFMAAFSSKGPNAITPGILK  527

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R + +N +SGTSMSCPH+S +  LLK ++PHWS
Sbjct  528   PDITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHWS  587

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTA T++   E + +A    A PF YGAGH  P+ A DPGLVYD +  DYL
Sbjct  588   PAAIKSAIMTTAVTQDNSMEPLLNASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLNDYL  647

Query  571   LFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C +    T ++      +KC  K + S +NLNYPS+ +  + GS+ V RTV NVGS 
Sbjct  648   NFLCAIGYNETQIEMFSEEMYKC-SKPAISLTNLNYPSITVPKISGSLEVTRTVKNVGSP  706

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  LKF ++GE++SF + ++    K+   + FG   WSDG 
Sbjct  707   -GTYKARIQNPDGISVSVEPKELKFKKIGEEKSFKVLLQVREAKQDKNYVFGKLIWSDGK  765

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  766   HYVRSPIVVKAA  777



>ref|XP_007207992.1| hypothetical protein PRUPE_ppa015005mg, partial [Prunus persica]
 gb|EMJ09191.1| hypothetical protein PRUPE_ppa015005mg, partial [Prunus persica]
Length=746

 Score =   280 bits (717),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 174/390 (45%), Positives = 239/390 (61%), Gaps = 19/390 (5%)
 Frame = -3

Query  1330  FPLVYAGDVE-LPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAA  1163
             +PL+ A D +    S++    C   +L  +KV+GK++ C+ G   R+ + ++A   G   
Sbjct  359   YPLISAVDAKGANASSSDAQLCKAGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVG  418

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+     L+P +++ Y S+  A+  YIK+ K PVA L   KT  GAKP+
Sbjct  419   MILVNDKLSGNEIIADPHLLPTSHVNY-SDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPA  477

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+++E +ILKPDITAPG++I+AA++ A  P D   D R V +N  SGTSM
Sbjct  478   PFMASFSSRGPNTIEQSILKPDITAPGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSM  537

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LLK +HP WS AAIKSAIMTTA   + K EA++D+    A PF YGAGH 
Sbjct  538   SCPHVSGIVGLLKTLHPSWSPAAIKSAIMTTARKRDNKKEAMQDSSKARATPFAYGAGHV  597

Query  631   QPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             QP++A DPGLVYD T  DYL F+C      T+     +    CPK  + S ++ NYPS+ 
Sbjct  598   QPNRAMDPGLVYDLTTDDYLNFLCFRGYNATLLKVFSNEPHTCPK--AYSLADFNYPSIT  655

Query  469   IAGLKGSMV-VKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
             +  L    V V R V NVGS   TY V +K PAG SV + P  L+F  +GE++ F + +K
Sbjct  656   VPDLHDKPVTVTRRVKNVGSP-GTYVVHIKEPAGVSVSVKPGSLQFKTIGEEKKFKVVLK  714

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                V+   ++ FG   WSDG H V+SPIVV
Sbjct  715   P-KVQGAQDYVFGELNWSDGKHNVRSPIVV  743



>ref|XP_003545192.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=787

 Score =   281 bits (719),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 227/399 (57%), Gaps = 25/399 (6%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCL----VGSVYRSTEVERAGGA  1166
             +PLV+A +  LP +T    G C P  L P K+KG ++ C+      SV +  E   AG  
Sbjct  390   YPLVHAVNARLPNATIEDAGLCKPGALDPRKIKGNILVCIRRDKTTSVAQGYEAANAGAV  449

Query  1165  AVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKY---------IKTNKNPVATLIP  1022
              V + N    G  +    + IPG N+    + D I ++            ++  VA +  
Sbjct  450   GVFVVNGKQSGGTLLAEPYPIPGANVDVSQDKD-IDEHEWFEKGGSDTNNSRKLVAYMTV  508

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              +T  G KP+P +A F+S GP++V+P ILKPDI APG+NILAA S A+SP + P D R V
Sbjct  509   ARTYLGIKPAPIVAGFSSRGPNAVQPLILKPDIIAPGVNILAANSLAASPSNQPSDRRRV  568

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
              +NI  GTSMSCPHV+ VV LLK +HP WS AAIKSAIMTTATT++     I DA+ ++A
Sbjct  569   PFNIQQGTSMSCPHVAGVVGLLKTLHPDWSPAAIKSAIMTTATTQDNNHLPIRDAFDQIA  628

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDsss  500
              PF YG+GH QP+ A DPGLVYD    DYL FIC              +S+ CPK  +  
Sbjct  629   TPFDYGSGHIQPNLAMDPGLVYDMRTRDYLNFICAHDHNQYFLKYFHRSSYNCPKSYNIE  688

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               N    ++A  G+K  + V RTVTNVG+ N+TY V+     GF V + P+ L F  +GE
Sbjct  689   NLNYPSITVANRGMK-PISVTRTVTNVGTPNSTYVVKANVLEGFKVLVQPSSLAFKTIGE  747

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             K+SF + ++  S    G   FG   W+DG H V SPIV+
Sbjct  748   KKSFRVILEGTSWPSHGFPVFGNLSWTDGNHTVTSPIVI  786



>ref|XP_007141639.1| hypothetical protein PHAVU_008G213000g [Phaseolus vulgaris]
 gb|ESW13633.1| hypothetical protein PHAVU_008G213000g [Phaseolus vulgaris]
Length=783

 Score =   281 bits (718),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 168/395 (43%), Positives = 228/395 (58%), Gaps = 20/395 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCL----VGSVYRSTEVERAGGA  1166
             + LV+A +  LP +T N    C P TL   K+KG ++ C+      SV +  E   AG  
Sbjct  389   YRLVHAANAGLPNATVNDARLCKPGTLDITKIKGNILICIRRDKTTSVAQGYEAANAGAV  448

Query  1165  AVILGN---IGSEVPVGSFLIPGTNI--FYPSETDAILK--YIKTNKNPVATLIP-GKTV  1010
              V + N    G+ +    + IPG N+  +   E++   K  + K N   +A  +   +T 
Sbjct  449   GVFVVNNDKSGNTLLAEPYTIPGANLNGYENEESEWFEKGGFDKNNSRKLAAYMTVARTY  508

Query  1009  FGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNI  830
              G KP+P MA F+S GP++V+P ILKPDITAPG+NILAA+S A+SP + P D R V +N+
Sbjct  509   LGIKPAPIMAGFSSRGPNAVQPLILKPDITAPGVNILAAYSLATSPSNLPSDRRRVPFNV  568

Query  829   ISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFH  650
               GTSMSCPHV+ +V LLK +HPHWS AAIKSAIMTTATT +   + I DA+ ++A PF 
Sbjct  569   QQGTSMSCPHVAGIVGLLKTLHPHWSPAAIKSAIMTTATTLDNSNQPIRDAFDQMATPFD  628

Query  649   YGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTS------LDTSFKCPKKDssspsnl  488
             YG+GH QP+ A DPGLVYD    DYL FIC               S+ CP+  +    N 
Sbjct  629   YGSGHIQPNLAMDPGLVYDMRTRDYLNFICAHEHNQNFLRYFRRISYNCPESYNIENLNY  688

Query  487   nypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSF  308
                ++A  G+   + V RTVTNVG+  +TY V+     GF V + P+ L F  +GEK+ F
Sbjct  689   PSITVANRGMN-PINVTRTVTNVGTPTSTYVVKANITEGFKVLVQPSSLTFKTIGEKKRF  747

Query  307   SISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
              + ++A S    G   FG   W+DG H V SPIVV
Sbjct  748   RVILQAISWPTHGFPVFGNLSWTDGNHTVTSPIVV  782



>ref|XP_004144624.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=758

 Score =   280 bits (717),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 245/404 (61%), Gaps = 22/404 (5%)
 Frame = -3

Query  1363  ESIS--AIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRS  1193
             ES+S  A+   + +PL+ A DV L   S +    C   TL+P K KGK++ CL G   R 
Sbjct  357   ESLSQDALPSKKLYPLMNAADVRLANASVHEAQLCKAGTLNPMKAKGKILVCLRGDNARV  416

Query  1192  TEVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              + E+A   G A +IL N    G+E+     ++P ++I + ++  A+  YI + K P A 
Sbjct  417   DKGEQALLAGAAGMILANNELSGNEILADPHVLPASHINF-TDGSAVFAYINSTKYPEAY  475

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             + P  T  G +P+P MA F+S+GP++V P ILKPDITAPGL+++AA++EA  P +   D+
Sbjct  476   ITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAAYTEAEGPTNQEFDN  535

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R + +N +SGTSMSCPHVS +  LLK ++PHWS AAIKSAIMTTA+  +   E + +A  
Sbjct  536   RRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAAIKSAIMTTASILDNNFEPLLNASY  595

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKD  509
              VA PF+YGAGH  P+ AADPGLVYD    +YL F+C +       S      F C   D
Sbjct  596   SVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFLCALGYNKAQISQFSNGPFNC--SD  653

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               SP+NLNYPS+ +  L  S+ + R + NVGS   TY  E++ PAG SV + P  L F  
Sbjct  654   PISPTNLNYPSITVPKLSRSITITRRLKNVGSP-GTYKAEIRKPAGISVWVKPKKLSFTR  712

Query  328   VGEKQSFSISVKAGSVKKVGE--FEFGWYKWSDGIHMVKSPIVV  203
             +GE+ SF + +K    +KV +  + +G   WSDG H V+SPIVV
Sbjct  713   LGEELSFKVLMKVKE-RKVAKKNYVYGDLIWSDGKHHVRSPIVV  755



>ref|XP_010942535.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X4 [Elaeis 
guineensis]
Length=775

 Score =   281 bits (718),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 165/396 (42%), Positives = 246/396 (62%), Gaps = 16/396 (4%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVER---AGG  1169
             + +P++ + + + P +T      C   +L PEKV+GK+V CL G + R  + E    AGG
Sbjct  381   QLYPMINSKEAKAPNATEHDAELCYLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGG  440

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             + ++L N    G+E+   + L+P T+I Y ++  ++  Y+   ++P+  +    T+   K
Sbjct  441   SGMVLVNDQSSGNEIIADAHLLPATHITY-NDGLSLYLYLSYTRSPLGYITTPITLLDTK  499

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP++V   ILKPDITAPG+++LAA+SEA  P   P D R V +N  SGT
Sbjct  500   PAPFMAAFSSQGPNTVNAEILKPDITAPGVSVLAAYSEAVGPTGLPFDTRRVAFNSDSGT  559

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPH+S VV LLK++HP W+ +AIKSAIMTTA T++   E + ++    A PF YG+G
Sbjct  560   SMSCPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPVLNSSYVKATPFSYGSG  619

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnyps  476
             H +P++A DPGLVYD T  DYL F+C++   S       + SF CP K      +LNYPS
Sbjct  620   HVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSK-PPRLEDLNYPS  678

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + I  L GS+ V RT+ NVGS   TY + ++ P G SV ++PT L + ++GE++ F +++
Sbjct  679   ITIPYLFGSITVTRTLKNVGSP-GTYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTL  737

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*L  188
             K        ++ FG   WSDG H V++P+VVS+A L
Sbjct  738   KVKKGHASMDYVFGGLIWSDGKHYVRTPLVVSAAGL  773



>gb|KGN55997.1| hypothetical protein Csa_3G045110 [Cucumis sativus]
Length=632

 Score =   277 bits (708),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 167/391 (43%), Positives = 236/391 (60%), Gaps = 18/391 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VERAGGAA  1163
             +PL+ A D +    S++    CL  +L PEKVKGK++ CL G   R+ +     +AG   
Sbjct  244   YPLIDAVDAKANKVSSDIAQLCLVGSLDPEKVKGKIIICLRGENARADKGYAAVKAGAVG  303

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G E+   + L+P +++ Y ++  +I +YI + K P+A +   +T  G KP+
Sbjct  304   MILANAEENGDEIIADAHLLPVSHVSY-TDGQSIYQYINSTKTPMAYMTHVRTELGIKPA  362

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP++VE  ILKPDITAPG+NILAA+SE +SP  +  D R + +NI+SGTSM
Sbjct  363   PVMASFSSRGPNTVEETILKPDITAPGVNILAAYSEDASPSGSFFDKRRIPFNIVSGTSM  422

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPH+S +V LLK ++P+WS AAIKSAIMTTA +       I++     A  F YGAGH 
Sbjct  423   SCPHISGIVGLLKTLYPNWSPAAIKSAIMTTAESRANDMHPIQNGGNLKANSFAYGAGHV  482

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKCPKKDssspsnlnypsLA  470
             QP++A +PGLVYD T  DY+ F+C               SF C K  S   ++ NYPS++
Sbjct  483   QPNRAMNPGLVYDLTTKDYMNFLCAQGYNKSQISKFSAMSFVCSK--SFKLTDFNYPSIS  540

Query  469   IAGLK-GSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
             I  +K G + +KR V NVG   +TY   VK P G SV + P  LKF  + E++SF + + 
Sbjct  541   IPDMKSGVVTIKRRVKNVGKP-STYVARVKVPHGVSVSVEPRTLKFTRIDEEKSFKVVIG  599

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
             + +  K   + FG   W DG H V+SPIVV+
Sbjct  600   SVANNKHKGYVFGSLIWEDGKHHVRSPIVVN  630



>ref|XP_010942534.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Elaeis 
guineensis]
Length=782

 Score =   280 bits (717),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 165/396 (42%), Positives = 246/396 (62%), Gaps = 16/396 (4%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVER---AGG  1169
             + +P++ + + + P +T      C   +L PEKV+GK+V CL G + R  + E    AGG
Sbjct  388   QLYPMINSKEAKAPNATEHDAELCYLGSLDPEKVRGKIVVCLRGIIARVEKGEAVLLAGG  447

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             + ++L N    G+E+   + L+P T+I Y ++  ++  Y+   ++P+  +    T+   K
Sbjct  448   SGMVLVNDQSSGNEIIADAHLLPATHITY-NDGLSLYLYLSYTRSPLGYITTPITLLDTK  506

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP++V   ILKPDITAPG+++LAA+SEA  P   P D R V +N  SGT
Sbjct  507   PAPFMAAFSSQGPNTVNAEILKPDITAPGVSVLAAYSEAVGPTGLPFDTRRVAFNSDSGT  566

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPH+S VV LLK++HP W+ +AIKSAIMTTA T++   E + ++    A PF YG+G
Sbjct  567   SMSCPHISGVVGLLKSLHPDWNPSAIKSAIMTTARTQDNMDEPVLNSSYVKATPFSYGSG  626

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnyps  476
             H +P++A DPGLVYD T  DYL F+C++   S       + SF CP K      +LNYPS
Sbjct  627   HVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQIAKFSNDSFLCPSK-PPRLEDLNYPS  685

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + I  L GS+ V RT+ NVGS   TY + ++ P G SV ++PT L + ++GE++ F +++
Sbjct  686   ITIPYLFGSITVTRTLKNVGSP-GTYIIRIREPRGISVSVNPTSLTYDKIGEEKKFEVTL  744

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*L  188
             K        ++ FG   WSDG H V++P+VVS+A L
Sbjct  745   KVKKGHASMDYVFGGLIWSDGKHYVRTPLVVSAAGL  780



>emb|CBI38458.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   280 bits (715),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 237/389 (61%), Gaps = 29/389 (7%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +PLVY+ D      S +    C   +L P+KVKGK+V+CLVG   +V +S  V +AGG  
Sbjct  374   YPLVYSVDARAANASASDAQVCSVGSLDPKKVKGKIVYCLVGVNENVEKSWVVAQAGGIG  433

Query  1162  VILGNIGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAM  983
             +IL +  S                 S+      ++ T + PVA  I G T  G   +P +
Sbjct  434   MILSDRLSTDT--------------SKVFFFFFHVSTFRYPVA-YISGATEVGTVAAPII  478

Query  982   APFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCP  803
               F+S GP+ + P ILKPD+TAPG+ I+AA+S+A+ P D   D R V ++IISGTSMSCP
Sbjct  479   PSFSSQGPNPITPEILKPDLTAPGVQIVAAYSQATGPTDLQSDDRRVPFSIISGTSMSCP  538

Query  802   HVSAVVALLKAIHPHWSGAAIKSAIMTTATTE-NVKGEAIEDAYGEVAGPFHYGAGHFQP  626
             HV+  + LLK IHP WS +A++SAIMTTA T  NV+   + +  GE A PF YGAGH  P
Sbjct  539   HVAGTIGLLKKIHPDWSPSALRSAIMTTARTRTNVRQPLVNETLGE-ANPFSYGAGHLWP  597

Query  625   SKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKDssspsnlnypsLAIA  464
             S+A DPGLVYD T TDYL F+C++        T +D  ++CP K   S  NLNYPS+ + 
Sbjct  598   SRAMDPGLVYDLTTTDYLNFLCSIGYNATQLSTFVDKGYECPSK-PMSLLNLNYPSITVP  656

Query  463   GLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGS  284
              L G + V RT+ NVG T ATY+V  + P+G SVK+ P  LKF ++ E+++F + ++A  
Sbjct  657   SLSGKVTVTRTLKNVG-TPATYTVRTEVPSGISVKVEPNTLKFEKINEEKTFKVILEAKR  715

Query  283   VKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
               K GE+ FG   WSDG H V+SPIVV++
Sbjct  716   DGKGGEYVFGRLIWSDGEHYVRSPIVVNA  744



>ref|XP_008342263.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=777

 Score =   280 bits (716),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 231/372 (62%), Gaps = 15/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGN---IGSEVPVGSFLI  1112
              C P+TL P+KVKGK++ CL G   R  + E+A   G   +IL N    G+E+     ++
Sbjct  409   LCKPNTLDPKKVKGKILACLRGDNARVDKGEQALLAGAVGMILANNELTGNEIIADPHVL  468

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++ + +  YI + K+P A +    T  G KPSP MA F+S GP+++ P ILK
Sbjct  469   PASHINF-TDGNLVFTYINSTKSPRAYIKRAITELGTKPSPFMAAFSSRGPNTITPGILK  527

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R + +N +SGTSMSCPH+S +  LLK ++PHWS
Sbjct  528   PDITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHWS  587

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTA T +   E + +A    A PF YGAGH  P+ A DPGLVYD +  DYL
Sbjct  588   PAAIKSAIMTTAVTRDNSMEPLLNASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLNDYL  647

Query  571   LFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C +    T ++      + C  K + S ++LNYPS+ +  + GS+ V RTV NVGS 
Sbjct  648   NFLCAIGYNETQIEMFSEEMYMC-SKPAISLTSLNYPSITVPKISGSLEVTRTVKNVGSP  706

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  LKF ++GE++SF + ++    K+   + FG   WSDG 
Sbjct  707   -GTYKARIQNPBGISVSVEPKELKFKKIGEEKSFKVLLQVXEAKQDKNYVFGKLIWSDGK  765

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  766   HYVRSPIVVKAA  777



>ref|XP_008218932.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   280 bits (716),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 174/390 (45%), Positives = 239/390 (61%), Gaps = 19/390 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAA  1163
             +PL+ A D +    S++    C   +L  +KV+GK++ C+ G   R+ + ++A   G   
Sbjct  387   YPLISAVDGKAANASSSDAQLCKAGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVG  446

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+     L+P +++ Y S+  A+  YIK+ K PVA L   KT  GAKP+
Sbjct  447   MILVNDKLSGNEIIADPHLLPTSHVNY-SDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPA  505

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+++E +ILKPDITAPG++I+AA++ A  P D   D R V +N  SGTSM
Sbjct  506   PFMASFSSRGPNTIEQSILKPDITAPGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSM  565

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LLK +HP WS AAIKSAIMTTA   +   EA++D+    A PF YGAGH 
Sbjct  566   SCPHVSGIVGLLKTLHPSWSPAAIKSAIMTTARKRDNNKEAMQDSSKARATPFAYGAGHV  625

Query  631   QPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             QP++A DPGLVYD T  DYL F+C      T+     +    CPK  + S ++ NYPS+ 
Sbjct  626   QPNRAMDPGLVYDLTTDDYLNFLCARGYNATLLKVFSNEPHTCPK--AYSLADFNYPSVT  683

Query  469   IAGLKGSMV-VKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
             +  L    V V R V NVGS   TY V +K PAG SV + P+ L+F  VGE++ F + +K
Sbjct  684   VPDLHDKPVAVTRRVKNVGSP-GTYVVHIKEPAGVSVSVKPSSLQFKTVGEEKKFKVVLK  742

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                V+   ++ FG   WSDG H V+SPIVV
Sbjct  743   P-KVQGTQDYVFGELNWSDGKHNVRSPIVV  771



>ref|XP_008794749.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=776

 Score =   280 bits (716),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 242/396 (61%), Gaps = 16/396 (4%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGG  1169
             E +P++ + +      S +    C   +L PEKV+GK+V CL G    V +   V +AGG
Sbjct  382   ELYPMISSKEARASNASAHDAELCYLGSLDPEKVRGKIVVCLRGITARVEKGEAVLQAGG  441

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
             + ++L N    G+E+   + L+P T+I Y ++  ++  Y+K+ K+P+  +    T    K
Sbjct  442   SGMVLVNDQSSGNEIIADAHLLPATHITY-NDGFSLFSYLKSTKSPLGYITTPITQLDTK  500

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP++V   ILKPDITAPG+++LAA++ A+ P     D R V +N  SGT
Sbjct  501   PAPFMAAFSSQGPNTVNAEILKPDITAPGVSVLAAYTGAAGPTGLAFDTRRVAFNSDSGT  560

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPH+S VV LLK++HP WS +AIKSAIMTTA T++   E + ++    A PF YG+G
Sbjct  561   SMSCPHISGVVGLLKSLHPDWSPSAIKSAIMTTARTQDSMDEPVLNSSYVKATPFSYGSG  620

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL------DTSFKCPKKDssspsnlnyps  476
             H QP++A DPGLVYD T  DYL F+C +   S       + SF CP K      +LNYPS
Sbjct  621   HVQPNRAMDPGLVYDLTTNDYLNFLCALGYNSTQIAIFSNDSFSCPSK-PPKLEDLNYPS  679

Query  475   LAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
             + I  L GS+ V R + NVGS   TY V V+ P G SV ++PT L + ++GE++ F +++
Sbjct  680   ITIPDLSGSITVTRAMKNVGSP-GTYIVRVREPRGISVSVNPTSLTYDKIGEEKKFEVTL  738

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*L  188
             K        ++ FG   WSDG H V++PIVVS+A L
Sbjct  739   KVKKGHASTDYVFGGLIWSDGKHYVRTPIVVSAAGL  774



>gb|ACP18876.1| subtilisin-like serine protease [Carica papaya]
Length=771

 Score =   280 bits (715),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 240/393 (61%), Gaps = 17/393 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             FPL+ A + +   ++N     C    L P+KVKGK++ CL G    V +  +   AG   
Sbjct  382   FPLISALNAKATNASNEEAILCEAGALDPKKVKGKILVCLRGLNARVDKGQQAALAGAVG  441

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+   + ++P ++I + ++  ++ +YI    +PVA +   KT    KP+
Sbjct  442   MILANSELNGNEIIADAHVLPASHISF-TDGLSVFEYINLTNSPVAYMTRPKTKLPTKPA  500

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ V P ILKPDITAPG+N++AA++ A  P +   D R V++N +SGTSM
Sbjct  501   PVMAAFSSKGPNIVTPEILKPDITAPGVNVIAAYTRAQGPTNQNFDRRRVQFNSVSGTSM  560

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LLK ++P WS AAI+SAIMT+ATT +   E+I +A    A PF YGAGH 
Sbjct  561   SCPHVSGIVGLLKTLYPSWSPAAIRSAIMTSATTMDNINESILNASNVKATPFSYGAGHV  620

Query  631   QPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLA  470
             QP++A +PGLVYD    DYL F+C      T+     +  F CP+ +  S ++ NYPS+ 
Sbjct  621   QPNQAMNPGLVYDLNTKDYLKFLCALGYSKTLISIFSNDKFNCPRTN-ISLADFNYPSIT  679

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  LKG + + R V NVGS   TY V V+ P G SV + P +LKF + GE++SF++++K 
Sbjct  680   VPELKGLITLSRKVKNVGSP-TTYRVTVQKPKGISVTVKPKILKFKKAGEEKSFTVTLKM  738

Query  289   GSVKKVGEFEFGWYKWSD-GIHMVKSPIVVSSA  194
              +     E+ FG   WSD   H V+SPIVV +A
Sbjct  739   KAKNPTKEYVFGELVWSDEDEHYVRSPIVVKAA  771



>emb|CDY63300.1| BnaCnng41800D [Brassica napus]
Length=716

 Score =   278 bits (712),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 172/394 (44%), Positives = 237/394 (60%), Gaps = 20/394 (5%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG--SVYRSTEVERAGGAA  1163
             +  P +YAG+     +  +  FC+  TL PEKVKGK+V C  G     +   V+ AGG  
Sbjct  326   KMLPFIYAGNAS--NNATYGNFCISGTLIPEKVKGKIVMCDTGGNQARKGEVVKAAGGLG  383

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N+   G EV   +  +P T +   +  D I +Y+ T+ NP A+++   TV   KPS
Sbjct  384   MILANLAEEGEEVQAEAHFLPATAVGEKA-GDIIRRYVLTDPNPTASVVIQGTVVHVKPS  442

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P +A F+S GP+ + PNILKPD+ APG+NILAAW+ A  P     D R V++NIISGTSM
Sbjct  443   PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGALGPTGLASDTRRVEFNIISGTSM  502

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGH  635
             SCPHVS + ALLK++HP WS AAI+SA+MTTA      G+ I D A G+ + PF +GAGH
Sbjct  503   SCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYNTYKDGKRIRDIATGKPSTPFEHGAGH  562

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTVT-GTSL-----DTSFKCPKKDssspsnlnypsL  473
               P+ A +PGL+YD T  DYL F+C +   +SL       ++ C    + S ++LNYPS 
Sbjct  563   VSPTIAVNPGLIYDLTTVDYLDFLCALKYNSSLIRIISRGNYTCNPSKNYSVADLNYPSF  622

Query  472   AIAGLKGSMVVK--RTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSI  302
             A+  + GS   K  RTVTNVG    +YSV+V +      + + P VL F EV EK+S+S+
Sbjct  623   AV-NVDGSDTYKYTRTVTNVGGA-GSYSVKVTSETTAVKISVQPAVLNFKEVNEKKSYSV  680

Query  301   SVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
             +    S K  G   FG  +WSDG H+V SP+ +S
Sbjct  681   TFTVDSSKPSGSNSFGSIEWSDGKHVVASPVAIS  714



>gb|KCW75459.1| hypothetical protein EUGRSUZ_E04225 [Eucalyptus grandis]
Length=751

 Score =   279 bits (713),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 169/390 (43%), Positives = 230/390 (59%), Gaps = 18/390 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVER---AGGAA  1163
             +PL+     +    S N    C P TL P+K KGK++ CL G   R  +  +   AG   
Sbjct  363   YPLITGAQAKAANASVNDSMLCKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVG  422

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+     L+P + + Y  +   +  YI +  NPV  +         KP+
Sbjct  423   MILCNDVLSGNEIIADPHLLPASQLTY-KDGLQVFAYINSTANPVGFITAPTAKLNTKPA  481

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ V P ILKPD+TAPG+NI+AA+SEA SP D   D+R V +N  SGTSM
Sbjct  482   PFMAAFSSRGPNLVTPEILKPDVTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSM  541

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV-AGPFHYGAGH  635
             SCPHV+ VV LL+A+HP WS +AI+SAIMTTA T +   EA+ D    + A PF +G+GH
Sbjct  542   SCPHVAGVVGLLRALHPDWSVSAIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGH  601

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSF-----KCPKKDssspsnlnypsL  473
              +P++A DPGLVYD +  +Y  F+C +    +L  SF     +CPK    S  + NYPS+
Sbjct  602   MRPNRAMDPGLVYDLSTDNYFDFLCALGYNRTLMRSFSKDPYECPKS--FSLLDFNYPSI  659

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              +  L GS  V R V NVGS   TY+ +V  P G SV + P  L F  VGE++SF +++K
Sbjct  660   MVPNLHGSATVTRRVKNVGSP-GTYAAQVIEPPGISVSVEPRTLTFDRVGEEKSFKVTLK  718

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             A S +   E+ FG  +WSDG H V+SPIVV
Sbjct  719   AKSARHATEYVFGGLRWSDGRHYVRSPIVV  748



>ref|XP_002437266.1| hypothetical protein SORBIDRAFT_10g023870 [Sorghum bicolor]
 gb|EER88633.1| hypothetical protein SORBIDRAFT_10g023870 [Sorghum bicolor]
Length=800

 Score =   280 bits (715),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 161/393 (41%), Positives = 228/393 (58%), Gaps = 17/393 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             +P++   +   PGS       CL  +L PEKV+GK+V CL G    V +   V  AGGAA
Sbjct  408   YPIIAGEEATAPGSKPKDAELCLMGSLDPEKVRGKIVVCLRGIAMRVLKGEAVRHAGGAA  467

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G ++     ++P  +I Y +   A+  YIK+ K     ++ G+T+ G +P 
Sbjct  468   MILVNDEASGDDIYPDPHVLPAVHISYANGL-ALWAYIKSTKVATGFVVKGRTILGMRPV  526

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP++V P ILKPDITAPG+N++AAWS A+SP +   D R V +N++SGTSM
Sbjct  527   PVMAAFSSQGPNTVNPEILKPDITAPGVNVIAAWSGATSPTERSFDKRRVAFNMLSGTSM  586

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +  L+K +HP WS +AIKSAIMT+AT  +V+ + I+++    A PF YGAGH 
Sbjct  587   SCPHVSGIAGLIKTLHPDWSPSAIKSAIMTSATELDVERKPIQNSSHAPATPFSYGAGHV  646

Query  631   QPSKAADPGLVYDSTYTDYLLFICTV--TGTSLDT----SFKCPKKDssspsnlnypsLA  470
              PS+A DPGLVYD T  DYL F+C +    T+++     SF CP    S          A
Sbjct  647   FPSRALDPGLVYDMTIVDYLDFLCALGYNATAMEDFNKGSFVCPSTHMSLHDLNYPSITA  706

Query  469   IAGLK--GSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISV  296
               GL+   + +V+R + NVG         V+ P G  V ++P +L F E GE++ F ++ 
Sbjct  707   -HGLRPGTTTMVRRRLKNVGPPGTYRVAVVREPEGVHVSVTPAMLVFREAGEEKEFDVNF  765

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
                       + FG   WSDG H V+SP+VV +
Sbjct  766   TVRDPAPPAGYAFGAIVWSDGSHQVRSPLVVKT  798



>ref|XP_009759675.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Nicotiana 
sylvestris]
Length=772

 Score =   279 bits (713),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/401 (41%), Positives = 235/401 (59%), Gaps = 17/401 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRS  1193
             S+  + K + FP++ A   + P  ST+    C    L P+KVKG ++ CL G    V + 
Sbjct  375   SVETLPKGKLFPIINAASAKAPHASTDDAQLCKAGALDPKKVKGTILVCLRGDNARVDKG  434

Query  1192  TEVERAGGAAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
              +   AG   ++L N    G+E+     ++P T I Y ++   +  Y+ + + P A++  
Sbjct  435   QQAALAGAVGMVLANDYASGNEIIADPHVLPATQISY-TDGLELFAYVNSTRTPTASITH  493

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
              KT  G KP+P MA F+S+GP++V P  LKPDITAPG++++AA++ A  P +   D R V
Sbjct  494   PKTQLGTKPAPVMAAFSSIGPNTVTPEFLKPDITAPGVSVIAAYTGAEGPTNQDFDKRRV  553

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             K+N +SGTSMSCPHVS +V LLK ++P WS +AIKSAIMTTA T +   E + +A     
Sbjct  554   KFNSVSGTSMSCPHVSGIVGLLKTLYPTWSPSAIKSAIMTTARTRDNAIEPMLNASYIKT  613

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDsss  500
              PF YGAGH +P++A DPGLVYD T  DYL F+C      T   T     FKCP  +  +
Sbjct  614   SPFAYGAGHVRPNRAMDPGLVYDLTIDDYLSFLCAQGYNETQIKTFTQGPFKCP--EPIN  671

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
               N+N PS+ +  L GS+ V RT+ NVGS   TY   ++ P G S  + P  L+F  +GE
Sbjct  672   FINMNLPSITVPNLNGSVTVTRTLKNVGSP-GTYKACIRRPIGISAVVEPNSLEFKNIGE  730

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             K+SF +++K    K   ++ FG   WS G H V+SPIVV S
Sbjct  731   KKSFKLTLKVKGSKGPKDYVFGQLIWSYGKHYVRSPIVVKS  771



>ref|XP_009396709.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=770

 Score =   279 bits (713),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 230/371 (62%), Gaps = 15/371 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VERAGGAAVILGNIGS---EVPVGSFLI  1112
              CLP +L P KVKGK+V CL GS  R  +   V  AGG  ++L N GS   E+     ++
Sbjct  401   LCLPGSLDPAKVKGKIVVCLRGSSAREAKGETVREAGGVGMVLANSGSFGNEIIADVHVL  460

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P T+I + S+  A+  Y+ + K+P+  +    T  GA+P+PAMA F+S GP+++ P ILK
Sbjct  461   PATHITF-SDGLALYSYLNSTKSPLGYIAVHMTKLGAEPAPAMASFSSRGPNTITPGILK  519

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG+++LAA +   SP +   D R V + + SGTSMSCPH+S VV LLKA+HP WS
Sbjct  520   PDITAPGVDVLAASTGDVSPTELDFDRRRVAFMLKSGTSMSCPHISGVVGLLKALHPGWS  579

Query  751   GAAIKSAIMTTATT-ENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDY  575
              AAIKSAIMTTA   +N K   +++A    A PF+YG+GH +P++A DPGLVYD T TDY
Sbjct  580   PAAIKSAIMTTARVWDNEKLPLLDEATFLDASPFNYGSGHVRPNRAMDPGLVYDLTTTDY  639

Query  574   LLFICTVTGTSLD----TSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTN  407
             L F+C +   S       S+ CP K      +LNYPS+ I  L  S  V R V NVGS  
Sbjct  640   LNFLCGLGYNSTQLAEFRSYSCPSK-PPHIKDLNYPSITIPDLSSSTKVTRVVKNVGSP-  697

Query  406   ATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA-GSVKKVGEFEFGWYKWSDGI  230
              TY+V V  P G SV +SPT L F EVGE++ F +++K     +   E+ FG   W+D  
Sbjct  698   GTYAVRVIEPRGISVTVSPTNLTFDEVGEEKKFEVTLKKIKEGESSAEYVFGRLIWTDRK  757

Query  229   HMVKSPIVVSS  197
             H V++P+VV S
Sbjct  758   HYVRTPLVVKS  768



>ref|XP_010059708.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=781

 Score =   279 bits (713),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 169/390 (43%), Positives = 230/390 (59%), Gaps = 18/390 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVER---AGGAA  1163
             +PL+     +    S N    C P TL P+K KGK++ CL G   R  +  +   AG   
Sbjct  393   YPLITGAQAKAANASVNDSMLCKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVG  452

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G+E+     L+P + + Y  +   +  YI +  NPV  +         KP+
Sbjct  453   MILCNDVLSGNEIIADPHLLPASQLTY-KDGLQVFAYINSTANPVGFITAPTAKLNTKPA  511

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+ V P ILKPD+TAPG+NI+AA+SEA SP D   D+R V +N  SGTSM
Sbjct  512   PFMAAFSSRGPNLVTPEILKPDVTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSM  571

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV-AGPFHYGAGH  635
             SCPHV+ VV LL+A+HP WS +AI+SAIMTTA T +   EA+ D    + A PF +G+GH
Sbjct  572   SCPHVAGVVGLLRALHPDWSVSAIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGH  631

Query  634   FQPSKAADPGLVYDSTYTDYLLFICTV-TGTSLDTSF-----KCPKKDssspsnlnypsL  473
              +P++A DPGLVYD +  +Y  F+C +    +L  SF     +CPK    S  + NYPS+
Sbjct  632   MRPNRAMDPGLVYDLSTDNYFDFLCALGYNRTLMRSFSKDPYECPKS--FSLLDFNYPSI  689

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              +  L GS  V R V NVGS   TY+ +V  P G SV + P  L F  VGE++SF +++K
Sbjct  690   MVPNLHGSATVTRRVKNVGSP-GTYAAQVIEPPGISVSVEPRTLTFDRVGEEKSFKVTLK  748

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             A S +   E+ FG  +WSDG H V+SPIVV
Sbjct  749   AKSARHATEYVFGGLRWSDGRHYVRSPIVV  778



>ref|XP_006400913.1| hypothetical protein EUTSA_v10015943mg [Eutrema salsugineum]
 gb|ESQ42366.1| hypothetical protein EUTSA_v10015943mg [Eutrema salsugineum]
Length=761

 Score =   278 bits (712),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/392 (41%), Positives = 234/392 (60%), Gaps = 19/392 (5%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGG  1169
             + + L+ AGD +    ST     C  D+L PEKVKGK+V CL G    V +  +   AG 
Sbjct  373   KMYDLINAGDAKAANASTKEALLCKKDSLDPEKVKGKIVVCLRGDNARVDKGQQAATAGA  432

Query  1168  AAVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAK  998
               +IL N    G+E+   + ++P + I Y  + +A+  Y+ + K P   + P  +    K
Sbjct  433   VGMILCNDKASGNEILSDAHVLPASQIDY-EDGEAVFSYLNSTKEPKGYISPPASKLNTK  491

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
             P+P MA F+S GP++V P ILKPDITAPG+N++AA++EA+SP D   D+R   YN  SGT
Sbjct  492   PAPFMASFSSRGPNTVTPGILKPDITAPGVNVIAAFTEATSPTDLDSDNRRTPYNTESGT  551

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAG  638
             SMSCPH+S +V LLK +HP WS AAI+SAIMT++ T + + + + D     + PF YG+G
Sbjct  552   SMSCPHISGIVGLLKTLHPQWSPAAIRSAIMTSSRTRDNRRKPMVDQSFNKSTPFSYGSG  611

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSL-------DTSFKCPKKDssspsnlnyp  479
             H QP+KA+ PGLVYD T  DYL F+C +   +        D  + C  +  ++  + NYP
Sbjct  612   HVQPNKASHPGLVYDLTTGDYLDFLCAIGYNNTIVQLFAEDRHYIC--RQGANLLDFNYP  669

Query  478   sLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSIS  299
             S+ +  L  S+ V R + NVG   +TY+   + P G SV + P  LKF E+GE + F ++
Sbjct  670   SITVPNLTDSVTVTRKLKNVGPP-STYNAHFREPLGVSVSVEPKQLKFNEIGEVKMFQMT  728

Query  298   VKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             ++  S K +G + FG  KW+D  H V+SPIVV
Sbjct  729   LRPKSSKSLG-YVFGELKWTDSKHYVRSPIVV  759



>ref|XP_002453487.1| hypothetical protein SORBIDRAFT_04g006740 [Sorghum bicolor]
 gb|EES06463.1| hypothetical protein SORBIDRAFT_04g006740 [Sorghum bicolor]
Length=590

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/404 (40%), Positives = 226/404 (56%), Gaps = 17/404 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELP-GSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRS  1193
             SI+ + +  ++PL+ +        ST     C+   L P KVKGK+V CL G    V + 
Sbjct  189   SITTLPEKTSYPLIDSVKAAAANASTKDAQLCMIGALDPAKVKGKIVVCLRGINPRVAKG  248

Query  1192  TEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
               V++AGG  ++L N    G+E+   + ++P T I Y S+   +  Y+ + KNP   +  
Sbjct  249   EAVKQAGGVGMVLANDVTTGNEIIADAHVLPATQIKY-SDGLHLYSYLNSTKNPAGFITK  307

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
               TV G KP+P MA F+S GP+++ P ILKPDITAPG++++AAW+ A+SP D   D R V
Sbjct  308   PATVLGTKPAPFMAAFSSQGPNTITPEILKPDITAPGVSVIAAWTRANSPTDLAFDPRRV  367

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
              +N  SGTSMSCPHVS VV LL+ +HP WS AAIKSAIMTTA   + KGE I ++    +
Sbjct  368   AFNSQSGTSMSCPHVSGVVGLLRTVHPQWSPAAIKSAIMTTAIEMDNKGELILNSSSRSS  427

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDsss  500
              PF YGAGH  P++A +PGLVYD    DYL F+C      TV        + CP  ++  
Sbjct  428   SPFGYGAGHIYPTRALNPGLVYDLGDKDYLDFLCALKYNATVMAMFNGAPYTCPTGEAPH  487

Query  499   psnlny--psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEV  326
               +         +         +R V NV    +TY   V  PAG SV ++P+VLKF   
Sbjct  488   RISDLNYPSITVVNVTSAGATARRRVKNVAKP-STYRAFVVEPAGVSVVVNPSVLKFSAK  546

Query  325   GEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             GE++ F +  K         + FG   W++G+H V+SP+VV +A
Sbjct  547   GEEKGFEVQFKVKDAALAKGYSFGALAWTNGVHFVRSPLVVKAA  590



>gb|KDP32632.1| hypothetical protein JCGZ_13182 [Jatropha curcas]
Length=769

 Score =   278 bits (712),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 227/371 (61%), Gaps = 17/371 (5%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAAVILGN---IGSEVPVGSFLI  1112
              CLP+ L P+KVKGK++ CL G + R  + ++A   G   ++L N    G+E+     ++
Sbjct  400   LCLPEALDPKKVKGKILVCLRGEIGRVNKGQQALLAGAVGMVLINDEKSGNEILADPHVL  459

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P  ++ + S+ +A+L YI + K P+A +   +T F  KP+P MA F+S GPS V+P+ILK
Sbjct  460   PAAHVNF-SDGEAVLAYINSTKVPMAYMTRSRTQFDTKPAPVMAAFSSRGPSYVDPSILK  518

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+AA+S A SP +   D R + +N  SGTSMSCPHVS +V LLK +HP WS
Sbjct  519   PDITAPGVSIIAAFSLAVSPTEEDFDKRRIAFNTESGTSMSCPHVSGIVGLLKTLHPDWS  578

Query  751   GAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDY  575
              AAI+SA+MTTA T     E I D +  + A PF YGAGH  P+KA DPGL+YD T  DY
Sbjct  579   PAAIRSALMTTARTRGNNMEPIIDSSTNKEATPFDYGAGHVNPNKAMDPGLIYDLTENDY  638

Query  574   LLFIC----TVTGTSLDTS--FKCPKK-DssspsnlnypsLAIAGLKGSMVVKRTVTNVG  416
             L F+C      T   L +S  + CPK    +  +  +    ++  L G   V R V NVG
Sbjct  639   LNFLCAKGYNKTQIRLFSSKPYSCPKSFKIADFNYPSITIPSLISLGGP--VTRRVKNVG  696

Query  415   STNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSD  236
             S  + Y   VKAP G SV + P  L+F + GE++ F +++K+    +V ++ FG   WSD
Sbjct  697   SGPSKYCANVKAPHGVSVLVEPKCLEFEKTGEEKIFKVALKSLVKNEVKDYVFGKLIWSD  756

Query  235   GIHMVKSPIVV  203
             G H V+SPIVV
Sbjct  757   GKHYVRSPIVV  767



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   278 bits (711),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 167/392 (43%), Positives = 226/392 (58%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  358   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGM  414

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  D I  Y+ T+ NP A++    TV G KPSP
Sbjct  415   ILANTAANGEELVADAHLLPATTVGEKAG-DIIRHYVTTDPNPTASISILGTVVGVKPSP  473

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P     D R V++NIISGTSMS
Sbjct  474   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMS  533

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLK++HP WS AAI+SA+MTTA      G+ + D A G+ + PF +GAGH 
Sbjct  534   CPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHV  593

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTS------LDTSFKC-PKKDssspsnlnypsL  473
              P+ A +PGL+YD T  DYL F+C +  TS         ++ C P K  S          
Sbjct  594   SPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFA  653

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    TYSV+V +   G  + + P VL F E  EK+S++++ 
Sbjct  654   VNVDGAGAYKYTRTVTSVGGA-GTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTF  712

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ +S
Sbjct  713   TVDSSKPSGSNSFGSIEWSDGKHVVGSPVAIS  744



>ref|XP_011082896.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=769

 Score =   278 bits (712),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 174/406 (43%), Positives = 245/406 (60%), Gaps = 26/406 (6%)
 Frame = -3

Query  1363  ESISA--IKKMETFPLVYAGDVELPGSTNFPG-FCLPDTLSPEKVKGKVVFCLVGSVYRS  1193
             ES+SA  + K ++FP++ A   +   ++      C   TL P KVKGK++ CL G   R 
Sbjct  368   ESLSAKSLLKKKSFPIISARYAKAANASADEAALCKAGTLDPTKVKGKILVCLRGDNARV  427

Query  1192  TEVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              + E+A   G   ++L N    G+E+     ++P + I Y ++  A+  YIK+ ++PVA 
Sbjct  428   DKGEQAALAGAVGMVLANNQISGNEILADPHVLPASQINY-TDGLALFSYIKSTRSPVAY  486

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             +    T    KP+P MA F+S GP+++ P ILKPDITAPG++I+AA+++A +P +   D 
Sbjct  487   ITKATTQLHTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSIIAAYTKAQAPTNQDFDK  546

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V +N +SGTSMSCPHVS VV LLK +HP+WS AAIKSAIMTTA T +   + + DA  
Sbjct  547   RRVLFNSVSGTSMSCPHVSGVVGLLKTLHPNWSPAAIKSAIMTTARTRDNTLKPLTDASY  606

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV----TGTSL--DTSFKCPKKD  509
               A P +YG GH QP++A DPGLVYD    DYL F+C +    T   L  +  + CP+  
Sbjct  607   LKATPLNYGGGHVQPNRAMDPGLVYDLGANDYLNFLCALGYNQTQIQLFSEEPYACPQP-  665

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
                  +LNYPS+ + GL GS+ V R V NVGS   TY   V++P G SV + P  LKF  
Sbjct  666   -IRLIDLNYPSITVPGLTGSVTVTRKVKNVGSP-GTYRARVRSPHGISVHVEPDSLKFER  723

Query  328   VGEKQSFSISVKAGSVKKVG----EFEFGWYKWSDGIHMVKSPIVV  203
              GE++ F ++++   VKK G    ++ FG   WSDG H V+SPIVV
Sbjct  724   AGEEKRFRVTLQ---VKKPGGAVKDYVFGQLIWSDGRHYVRSPIVV  766



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   278 bits (711),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 226/392 (58%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  365   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGM  421

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  D I  Y+ T+ NP A++    TV G KPSP
Sbjct  422   ILANTAANGEELVADAHLLPATTVGEKAG-DIIRHYVTTDPNPTASISILGTVVGVKPSP  480

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P     D R V++NIISGTSMS
Sbjct  481   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTTAAGPTGLASDSRRVEFNIISGTSMS  540

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLK++HP WS AAI+SA+MTTA      G+ + D A G+ + PF +GAGH 
Sbjct  541   CPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHV  600

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKC-PKKDssspsnlnypsL  473
              P+ A +PGL+YD +  DYL F+C +  TS         ++ C P K  S          
Sbjct  601   SPTTATNPGLIYDLSTEDYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFA  660

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPA-GFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    TYSV+V +   G  + + P VL F E  EK+S++++ 
Sbjct  661   VNVDGAGAYKYTRTVTSVGGA-GTYSVKVTSETRGAKISVEPAVLNFKEANEKKSYTVTF  719

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ +S
Sbjct  720   TVDSSKASGSNSFGSIEWSDGKHVVGSPVAIS  751



>ref|XP_009794911.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=374

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 222/372 (60%), Gaps = 16/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
             FC+  TL P+K KG ++ C  G      + T+    G   +++ N    G+E+    ++ 
Sbjct  7     FCIGGTLDPKKTKGAILVCHRGGSPGFDKCTQATLVGAVGIVILNSAFFGNEMYAEPYIC  66

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P T I Y S+   +L Y+ + + P A +    T  G KP+P +A F+S+GP+ V P ILK
Sbjct  67    PATLISY-SDALEVLAYLNSTRKPTAYITRPTTELGTKPAPIVAAFSSIGPNRVTPEILK  125

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDI APG++I+AA++    P     D R VK+N ++GTSMSCPHV+ VV LLKA+HP WS
Sbjct  126   PDIIAPGVSIIAAYTGVQPPTQMGFDDRRVKFNTMTGTSMSCPHVAGVVGLLKALHPTWS  185

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMT+A T +   + + ++      PF YGAG+  P++A DPGLVYD T  DY+
Sbjct  186   AAAIKSAIMTSARTRDNTFKPMTNSTNLKVTPFAYGAGNIWPNRAMDPGLVYDLTIDDYM  245

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T         FKCP  +  S  NLN PS+ +  L GS+VV RT+ NVGS 
Sbjct  246   SFLCAQGYNETQINIFSQGYFKCP--EPISFINLNLPSITVPKLNGSVVVTRTLKNVGSP  303

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   +++PAG SV I P  L+F ++GE++SF +++K    K   ++ FG   WSDG 
Sbjct  304   -GTYKARIRSPAGISVVIEPNTLEFNKIGEEKSFKLTLKVRGNKAPKDYVFGQLIWSDGK  362

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV ++
Sbjct  363   HNVRSPIVVKAS  374



>ref|XP_010689355.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   278 bits (711),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 167/396 (42%), Positives = 236/396 (60%), Gaps = 17/396 (4%)
 Frame = -3

Query  1351  AIKKMETFPLVYAGDVE-LPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEV  1184
             +++  + +PLV A  V+ L  S      C   T+ P K +GK+V C+ G    V +  +V
Sbjct  373   SLQAGKYYPLVSAAQVKALNASVEEAKLCKSRTIDPRKARGKIVVCIRGDNARVDKGQQV  432

Query  1183  ERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKT  1013
               AGG  +IL N     +E+     ++P ++I Y S    +  YI + K P A++    T
Sbjct  433   ALAGGVGMILANDHDTANEILADPHVLPASHINY-SNGILVSTYINSTKFPKASITRTST  491

Query  1012  VFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYN  833
               G  P+P MA F+S GP+++ P ILKPDITAPG++++AA++EA  P +   D R V++N
Sbjct  492   RLGINPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIAAYTEAQGPTNQVFDKRRVQFN  551

Query  832   IISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPF  653
              ISGTSMSCPH+S +V LLK ++PHWS AAIKSAIMTTA+  +   E I +A    A PF
Sbjct  552   SISGTSMSCPHISGIVGLLKTLYPHWSPAAIKSAIMTTASVIDNVHEPITNASNIQANPF  611

Query  652   HYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDssspsn  491
             HYGAGH QP++A DPGLVYD T TDYL F+C +       +      + CPK    S  +
Sbjct  612   HYGAGHVQPNRAVDPGLVYDMTTTDYLNFLCALGYNEKSIALFHAGHYLCPKN--FSILD  669

Query  490   lnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQS  311
             LNYPS+ +  LK ++ V RTV NVGS    Y   V+ P G S+ +SP +L+F  + +++S
Sbjct  670   LNYPSITVPRLKNTITVTRTVKNVGSP-GKYKAHVQNPRGISIFVSPPILEFTTLCQEKS  728

Query  310   FSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             F ++++    K    + FG   WSDG H V SPIVV
Sbjct  729   FHLTLEVVKGKISKNYAFGRIIWSDGYHNVSSPIVV  764



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   278 bits (711),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 224/392 (57%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  371   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVMCDRGVNARVQKGDVVKEAGGVGM  427

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  D I  Y+ T+ +P AT+    TV G KPSP
Sbjct  428   ILANTAANGEELVADAHLLPATTVGEKAG-DLIRHYVTTDPHPTATISILGTVVGVKPSP  486

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P     D R V++NIISGTSMS
Sbjct  487   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTRAAGPTGLASDSRRVEFNIISGTSMS  546

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLKA+HP WS AAI+SA+MTTA      G+ + D A G+ + PF +GAGH 
Sbjct  547   CPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHV  606

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKC-PKKDssspsnlnypsL  473
              P+ A +PGL+YD T  DYL F+C +  TS         ++ C P K  S          
Sbjct  607   SPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFA  666

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    TYSV++ +      + + P VL F    EKQS++++ 
Sbjct  667   VNVEEAGAYKYTRTVTSVGGA-GTYSVKLTSETTAVKISVEPAVLNFKAANEKQSYTVTF  725

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ +S
Sbjct  726   TVDSSKASGSNSFGTIEWSDGKHVVGSPVAIS  757



>ref|XP_006377976.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
 gb|ERP55773.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
Length=775

 Score =   278 bits (711),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 230/369 (62%), Gaps = 16/369 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C P TL  +KVKGK++ CL G    V +      AG   +IL N    G+ +   + ++
Sbjct  405   LCKPGTLDSKKVKGKILVCLRGVNPRVEKGHVALLAGAVGMILANDEESGNGILADAHVL  464

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P  +I   ++  A+  Y+ + K+P A +   +T  G KP+P MA F+S GP+ +E +ILK
Sbjct  465   PAAHII-STDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILK  523

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++ A+ P DT  D R + +N  SGTSMSCPHVS +V LLK++HP WS
Sbjct  524   PDITAPGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWS  583

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SAIMTTATT +  G+ I D+    A PF YGAGH QP++AADPGLVYD T  D+L
Sbjct  584   PAAIRSAIMTTATTRDNNGDPILDSSNTRATPFAYGAGHVQPNRAADPGLVYDLTVNDFL  643

Query  571   LFICTVTGTSLDTS------FKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              ++C+   T+ D        + CPK  S S ++ NYPS++   L  ++ V R V NVGS 
Sbjct  644   NYLCSRGYTAKDLKLFTDKPYTCPK--SFSLTDFNYPSISAINLNDTITVTRRVKNVGSP  701

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
                Y + V+ P G  V ++PT L+F ++GE+++F ++ K     K+ ++ FG   WSDG 
Sbjct  702   -GKYYIHVREPTGVLVSVAPTTLEFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGK  760

Query  229   HMVKSPIVV  203
             H V+SP+VV
Sbjct  761   HFVRSPLVV  769



>ref|XP_006648425.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=748

 Score =   277 bits (709),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 225/378 (60%), Gaps = 16/378 (4%)
 Frame = -3

Query  1291  STNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGN---IGSEVP  1130
             + N    C+  +L P KVKGK+V CL G    V +   V  AGGA ++L N    G+E+ 
Sbjct  372   TQNESRLCMLGSLDPAKVKGKIVVCLRGVNPRVEKGEAVREAGGAGMVLANDATTGNEII  431

Query  1129  VGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSV  950
               + ++P T++ + S+   I  Y+K  KNP  T+   +T  GAKP+P MA F+S GP++V
Sbjct  432   ADAHVLPATHVKF-SDGQRIFSYLKKTKNPSGTITRPETRLGAKPAPFMASFSSKGPNTV  490

Query  949   EPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKA  770
              P ILKPDITAPG++++AAW+ A+SP D   D R V +N  SGTSMSCPHV+ +V LL+ 
Sbjct  491   TPGILKPDITAPGVSVVAAWTRANSPTDLAFDKRRVAFNSESGTSMSCPHVAGIVGLLRT  550

Query  769   IHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDS  590
             + P WS AAI+SA+MTTAT  +     I ++    A PF+Y AGH  PS+A +PGLVYD 
Sbjct  551   LRPDWSPAAIRSALMTTATDVDNDRHPILNSSSVAASPFNYDAGHVSPSRAMNPGLVYDL  610

Query  589   TYTDYLLFIC------TVTGTSLDTS-FKCPKKDssspsnlnypsLAIAGLKGSMVVKRT  431
                DYL F+C      TV  T  D   +KCP        +LNYPS+ +  L  S  VKRT
Sbjct  611   AAADYLNFLCSLRYNATVMATFNDGKPYKCPAS-PPKAQDLNYPSITVVNLTSSATVKRT  669

Query  430   VTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGW  251
             V NVG T  TY   V +PAG  V +SP  L F   GE+++F +S +  +     ++ FG 
Sbjct  670   VKNVG-TPGTYKAYVNSPAGVRVAVSPDTLAFATKGEEKTFRVSFQVTNAALAMDYAFGA  728

Query  250   YKWSDGIHMVKSPIVVSS  197
               W++G   V+SP+VV +
Sbjct  729   LVWTNGKQFVRSPLVVKT  746



>emb|CBI38463.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   279 bits (714),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 177/398 (44%), Positives = 243/398 (61%), Gaps = 24/398 (6%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAA  1163
             +PLVY+ D   P  S      C   +L PEKVKGK+V+CLVG    V +S  V +AGG  
Sbjct  450   YPLVYSVDARAPNASARDAQLCFVGSLDPEKVKGKIVYCLVGLNAIVEKSWVVAQAGGIG  509

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETD--AILKYIKTNKNPVATLIPGKTVFGAK  998
             +I+ N    G+ +    F +P +++   S  D  +IL YI T K PV   I G T  G  
Sbjct  510   MIIANRLSTGAIIHRAHF-VPTSHV---SAADGLSILLYIHTTKYPV-DYIRGATEVGTV  564

Query  997   PSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGT  818
              +P MA  ++ GP+ + P ILKPDITA G+NILAA++EA  P D   D R + ++I+SGT
Sbjct  565   VAPIMASTSAQGPNPIAPEILKPDITARGVNILAAYTEAKGPTDLQSDDRRLPFHIVSGT  624

Query  817   SMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTE-NVKGEAIEDAYGEVAGPFHYGA  641
             SMSCPHVS +V LLK IHP WS +AI+SAIMTT  T  NV+     D   EV  PF+YGA
Sbjct  625   SMSCPHVSRIVGLLKKIHPEWSPSAIRSAIMTTGQTRSNVRQPLANDTLAEV-NPFNYGA  683

Query  640   GHFQPSKAADPGLVYDSTYTDYLLFICTVTGTS------LDTSFKCPKKDssspsnlnyp  479
             GH  P++A DPGLVYD T  DYL F+C++   +      +D  ++CP K   S  +LNYP
Sbjct  684   GHLWPNRAMDPGLVYDLTTIDYLNFLCSIGYNATQPLKFVDKPYECPPK-PLSSWDLNYP  742

Query  478   sLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSIS  299
             S+ +  L G + V  T+ NVGS  ATY+V  + P+G SVK+ P  LKF ++ E+++F ++
Sbjct  743   SITVPSLSGKVTVTWTLKNVGSP-ATYTVRTEVPSGISVKVEPNRLKFEKINEEKTFKVT  801

Query  298   VKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA*LS  185
             ++A    + G + FG   W+DG H V+SPIVV++  L 
Sbjct  802   LEAKRDGEDGGYVFGRLIWTDGEHYVRSPIVVNATTLQ  839



>ref|XP_010647023.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=354

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/364 (43%), Positives = 217/364 (60%), Gaps = 47/364 (13%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN--IGSEVPVGSFLIP  1109
              C   +L P+KVKGK+V+CLVG    V +S  V +AGG  +IL N    + +   +  +P
Sbjct  5     LCSVGSLDPKKVKGKIVYCLVGLNAIVEKSWVVAQAGGVGMILANHLTTTALIAQAHFVP  64

Query  1108  GTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKP  929
              +++   ++  AIL YI+T K PVA  I G T  G  P+P MA F+S GP+ + P ILKP
Sbjct  65    TSHV-SAADGLAILLYIQTTKYPVA-YISGATEVGTVPAPIMATFSSQGPNLITPEILKP  122

Query  928   DITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSG  749
             DITAPG+ ILAA++EA+ P     D R V +NI SGTSMSCP V+  V LLK IHPHWS 
Sbjct  123   DITAPGVRILAAYTEANGPTGLQSDDRRVPFNIGSGTSMSCPRVAGTVGLLKKIHPHWSP  182

Query  748   AAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLL  569
             +AI+SAI+TT                  A PF+YGAG+  P++A DPGLVYD T TDYL 
Sbjct  183   SAIRSAIVTTE-----------------ANPFNYGAGYLSPNRAMDPGLVYDLTTTDYLN  225

Query  568   FICTVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVE  389
             F+C++                       Y +  ++ L G + V RT+ NVG T ATY+V+
Sbjct  226   FLCSI----------------------GYNATQLSSLSGKVTVTRTLKNVG-TPATYTVQ  262

Query  388   VKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPI  209
              + P+G S+K+ P  LKF ++ E+++F + ++A    + GE+ FG   WSDG H V+S I
Sbjct  263   TEVPSGISLKVEPNTLKFQKINEEKTFKVPLEAKRDGEGGEYVFGRLIWSDGEHYVRSSI  322

Query  208   VVSS  197
             VV++
Sbjct  323   VVNA  326



>ref|XP_008462020.1| PREDICTED: subtilisin-like protease isoform X2 [Cucumis melo]
Length=655

 Score =   275 bits (704),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 241/404 (60%), Gaps = 22/404 (5%)
 Frame = -3

Query  1363  ESIS--AIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRS  1193
             ES+S  A+   + +PL+ A DV L   S +    C   TL P K KGK++ CL G   R 
Sbjct  254   ESLSQEALPSKKLYPLMNAADVRLANASAHEAQLCKAGTLDPMKAKGKILVCLRGDNARV  313

Query  1192  TEVERA---GGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVAT  1031
              + E+A   G A +IL N    G+E+     ++P  +I Y ++  A+  YI + K P A 
Sbjct  314   DKGEQALLAGAAGMILANNELSGNEILADPHVLPALHINY-TDGSAVFAYINSTKFPEAY  372

Query  1030  LIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDH  851
             + P  T  G +P+P MA F+S+GP++V P ILKPDITAPGL+++AA++EA  P +   D+
Sbjct  373   ITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAAYTEAEGPTNQEFDN  432

Query  850   RSVKYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG  671
             R V +N +SGTSMSCPHVS +  LL+ ++PHWS AAIKSAIMTTA+T +   E + +A  
Sbjct  433   RRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSPAAIKSAIMTTASTLDNNFEPLLNASY  492

Query  670   EVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV------TGTSLDTSFKCPKKD  509
              VA PF+YGAGH  P+ A DPGLVYD    +YL F+C +           D  F C   +
Sbjct  493   FVATPFNYGAGHVHPNGATDPGLVYDIDVNEYLSFLCALGYDKAQISQFSDGPFNC--SE  550

Query  508   ssspsnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFME  329
               S +NLNYPS+ +  L  S+ + R + NVGS   TY  +++ PAG SV + P  L F +
Sbjct  551   PISLTNLNYPSITVPKLSRSITITRRLKNVGSP-GTYEAKIRKPAGISVWVKPKKLNFTK  609

Query  328   VGEKQSFSI--SVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             +GE+ SF +   VK   V K   + +G   WSDG H V+SPIVV
Sbjct  610   LGEELSFKVFMKVKGHKVAK-KNYVYGDLIWSDGKHHVRSPIVV  652



>ref|XP_010108994.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20634.1| Subtilisin-like protease [Morus notabilis]
Length=833

 Score =   279 bits (713),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 163/390 (42%), Positives = 229/390 (59%), Gaps = 16/390 (4%)
 Frame = -3

Query  1330  FPLVYAGDVEL-PGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAA  1163
             +PL+   D +    ST+    C    L P+KVKG ++ C+ G   RS   E+A   G   
Sbjct  443   YPLISGADAKAAKASTSDAQQCKRGALDPKKVKGNILVCVWGKFARSEMGEQAFHSGAVG  502

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N     ++V     L+P ++I + ++ + I +Y+ + K P+A +   KT  G KP+
Sbjct  503   MILANDIRRWNDVIADPHLLPASHINF-TDGEFIFEYLNSTKTPMAYMTRVKTQLGVKPA  561

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P +A F+S GP+ +EP ILKPD+TAPG++I+AA+SE +   +   D R V +NI SGTSM
Sbjct  562   PLVAFFSSRGPNLIEPTILKPDLTAPGVSIIAAYSEGTGALEVTTDERRVPFNIKSGTSM  621

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYG-EVAGPFHYGAGH  635
             SCPH+S V+ LLK +HP+WS AA++SAIMTTA T +   E + DA   + A PF YGAGH
Sbjct  622   SCPHISGVIGLLKTLHPYWSPAALRSAIMTTARTRDSNREQMLDAATMQRATPFAYGAGH  681

Query  634   FQPSKAADPGLVYDSTYTDYLLFIC------TVTGTSLDTSFKCPKKDssspsnlnypsL  473
              QP++A DPGLVYD T  DYL  +C      T      +  +KC K  +    N    ++
Sbjct  682   VQPNRAMDPGLVYDLTIDDYLNLLCAHGYNETTIKLFSNKPYKCSKSFTLVNFNYPSIAV  741

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
                G +   +V R V NVG    TY+  VKAPAG SV + P  LKF  +GE+++F I +K
Sbjct  742   PNLGSEQVNIVTRKVKNVG-IPGTYTAYVKAPAGVSVSVKPKTLKFKRIGEEKTFKIIMK  800

Query  292   AGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
                  K  ++ FGW KWSDG H V+S IVV
Sbjct  801   PKIAGKPRDYVFGWLKWSDGKHCVRSHIVV  830



>ref|XP_002266728.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
 emb|CBI28486.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   278 bits (710),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 228/372 (61%), Gaps = 16/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVGS---VYRSTEVERAGGAAVILGN---IGSEVPVGSFLI  1112
              C   TL   KVKGK++ CL G    V +  +   AG   ++L N    G+EV     ++
Sbjct  402   LCKAGTLDHSKVKGKILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVL  461

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++  A+  Y+ + K+P+A + P  T  G KP+P MA F+S GP+++ P ILK
Sbjct  462   PASHINF-TDGVAVFTYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILK  520

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++EA  P +   D R V +N +SGTSMSCPHVS +V LLK +HP WS
Sbjct  521   PDITAPGVSVIAAYTEAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWS  580

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SA+MTTA T +   EAI +A    A PF YGAGH +P++A +PGLVYD    DYL
Sbjct  581   PAAIRSAMMTTARTMDNSMEAILNASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYL  640

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T+     +  + CPK    S +N NYPS+ +  L GS+ V RT+ NVG  
Sbjct  641   NFLCALGYNQTLIKMFSERPYTCPKP--ISLTNFNYPSITVPKLHGSITVTRTLKNVGPP  698

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  LKF ++GE+++FS++++A       ++ FG   WSD  
Sbjct  699   -GTYKARIRKPTGISVSVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAK  757

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  758   HFVRSPIVVKAA  769



>ref|XP_003571633.1| PREDICTED: subtilisin-like protease SBT5.3 [Brachypodium distachyon]
Length=775

 Score =   278 bits (710),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 169/400 (42%), Positives = 234/400 (59%), Gaps = 17/400 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVG----SVYRST  1190
             S +   + FP+V A    LP  S      C    L P KVKGK+V C+ G     V +  
Sbjct  377   SDLHSNKLFPMVNASGAALPNCSAELASNCAMGCLDPPKVKGKIVVCVRGGDIPRVMKGM  436

Query  1189  EVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPG  1019
              V  AGGA +IL N    G +V     ++P T I Y SE  ++ KY+ ++  PVA + P 
Sbjct  437   AVLSAGGAGMILANGKMDGDDVEADPHVLPATMITY-SEAVSLYKYMASSAYPVANISPS  495

Query  1018  KTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVK  839
             KT  G K SP+MA F+S GPS   P +LKPDI APG++ILAA++E  SP +   D R  +
Sbjct  496   KTELGVKNSPSMAAFSSRGPSGTLPFVLKPDIAAPGVDILAAFTEYVSPTEVAADKRRSE  555

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             Y I+SGTSM+CPHVS V+ LLKA  P WS AA++SAIMTTA T++  G  + D+ G+ A 
Sbjct  556   YAILSGTSMACPHVSGVIGLLKAARPEWSPAAMRSAIMTTARTQDNTGAPMRDSNGKEAT  615

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDsssp  497
              F YGAG+  P++A DPGLVYD T  +Y  F+C +  T+ D S      F CP K     
Sbjct  616   AFAYGAGNVHPNRAVDPGLVYDITPDEYFTFLCALGFTTKDLSRLSGGKFSCPAK-PPPM  674

Query  496   snlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
              +LNYPS+ +  L+ +M + R + NVG    TY    +AP G ++ + P VL F + GE+
Sbjct  675   EDLNYPSIVVPALRHNMTLTRRLKNVGRP-GTYRASWRAPFGINMTVDPKVLVFEKAGEE  733

Query  316   QSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             + F +++ +   K    + FG   WSDGIH V+SP+VV++
Sbjct  734   KEFKVNIASQKDKLGRGYVFGKLVWSDGIHYVRSPVVVNA  773



>ref|XP_010045213.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW88581.1| hypothetical protein EUGRSUZ_A00959 [Eucalyptus grandis]
Length=769

 Score =   277 bits (709),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 168/391 (43%), Positives = 229/391 (59%), Gaps = 17/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPG-STNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTEVERA---GGAA  1163
             + L+ A D  L   S +    C   TL P KVK K++ CL G   R  + E+A   G   
Sbjct  381   YKLISAADARLSHVSADEALLCQNGTLDPRKVKEKILVCLRGENARVDKGEQAFLAGAVG  440

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++L N    G+E+      +P +++ Y ++  AI  YI + K P A +    T  G KPS
Sbjct  441   MVLANNILSGNEIVADPHFLPASHVNY-TDGAAIFSYINSTKFPTAQITRVVTNLGVKPS  499

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP+++ P ILKPDITAPGL+++AA++EA  P +   D R V +N +SGTSM
Sbjct  500   PFMAAFSSKGPNTITPEILKPDITAPGLSVIAAYTEAVGPTNEDIDQRRVPFNAVSGTSM  559

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS V  LLK +HP WS A I+SAIMT+AT  +   E+I +A    A PF YGAGH 
Sbjct  560   SCPHVSGVAGLLKTLHPEWSPAVIRSAIMTSATIRDNAMESIINASYYKATPFSYGAGHI  619

Query  631   QPSKAADPGLVYDSTYTDYLLFICTV----TGTSL--DTSFKCPKKDssspsnlnypsLA  470
             QP++A DPGLVYD    DYL F+C++    T  S+  D ++ C K+      + NYPS+ 
Sbjct  620   QPNRAMDPGLVYDLGIKDYLNFLCSLGYNATQISMFSDGAYNCSKR--IGLLDFNYPSIT  677

Query  469   IAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKA  290
             +  L GS+ V RTV NVG    TY   V  P G SV + P  LKF ++ E++SF + +KA
Sbjct  678   VPKLPGSITVTRTVKNVG-LPGTYKASVLEPNGVSVHVKPAHLKFKKINEEKSFKVVLKA  736

Query  289   GSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
                   G++ FG   WSD  H V+SPIVV +
Sbjct  737   KGANATGDYSFGELIWSDTEHHVRSPIVVKA  767



>ref|XP_010092373.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51049.1| Subtilisin-like protease [Morus notabilis]
Length=745

 Score =   277 bits (708),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 227/369 (62%), Gaps = 16/369 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCL---VGSVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
             +C P  L P+KVKGK++ CL   + S+    +   AG   +IL N    G+ V     ++
Sbjct  378   YCKPGALDPKKVKGKILVCLWKEMTSIEMGEQAALAGAVGMILANDIESGNRVNADLHVL  437

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I Y ++   +L Y+ ++KNP+A +   KT  G +P+P MA F+S GP+++EP ILK
Sbjct  438   PVSHITY-NDGKLVLDYLNSSKNPMAYMTGVKTEVGVRPAPLMASFSSRGPNTIEPAILK  496

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+AA+S+A+ P     D R V +   SGTS SCPHVS +  LLK +HP WS
Sbjct  497   PDITAPGVDIIAAYSKAAPPTYLTSDTRRVSFIAQSGTSTSCPHVSGIAGLLKTLHPDWS  556

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTA   +   E + ++  +   PF YGAGH +P++A DPGLVYD T  DYL
Sbjct  557   PAAIKSAIMTTARARDNNMEPMLNSSMKRETPFAYGAGHIRPNRAMDPGLVYDLTIDDYL  616

Query  571   LFIC------TVTGTSLDTSFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C      T+     D   KC K  S + +N NYPS+A+  L  S++V R + NVG T
Sbjct  617   DFLCAHGYNQTLVRKFSDKPHKCSK--SFTMANFNYPSIAVPNLSKSVIVTRKLKNVG-T  673

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   VKAP G S+ + P  LKF  +GE++ F I VK  +V K  ++ FG  KWSDG 
Sbjct  674   PGTYKAYVKAPIGVSIYVKPKSLKFDRIGEEKRFKIVVKPKAVGKSKDYVFGHLKWSDGK  733

Query  229   HMVKSPIVV  203
             H V+SPIVV
Sbjct  734   HFVRSPIVV  742



>gb|EAZ22112.1| hypothetical protein OsJ_05774 [Oryza sativa Japonica Group]
Length=527

 Score =   271 bits (694),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 229/395 (58%), Gaps = 20/395 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAA  1163
             FP++ +     P  T N    C   +L PEKVKGK+V CL G    V +   V  AGGA 
Sbjct  130   FPMIDSSLAASPNRTQNESQLCFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAG  189

Query  1162  VILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             ++L N    G+E+   + ++P T+I + S+   +  Y+K  K+P  T+   +T  G KP+
Sbjct  190   MVLANDVTTGNEIIADAHVLPATHIKF-SDGQILFSYLKNTKSPAGTITRPETRLGTKPA  248

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP++V P ILKPDITAPG++++AAW+ AS+P D   D R V +N  SGTSM
Sbjct  249   PFMAAFSSQGPNTVTPGILKPDITAPGVSVVAAWTRASAPTDLAFDKRRVAFNSESGTSM  308

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHV+ VV LL+ + P WS AAI+SA+MTTA   + +  AI ++    A PF +GAGH 
Sbjct  309   SCPHVAGVVGLLRTLRPDWSPAAIRSALMTTAVEVDNERHAILNSSFAAANPFGFGAGHV  368

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVT----------GTSLDTSFKCPKKDssspsnlny  482
              P++A +PGLVYD    DYL F+C+++          G      F+CP        +LNY
Sbjct  369   SPARAMNPGLVYDLGAVDYLNFLCSLSYNATVMAMFAGGGGAAPFRCPAS-PPKVQDLNY  427

Query  481   psLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSI  302
             PS+ +  L  S  V+RTV NVG     Y   V +PAG  V +SP  L F+  GEK++F +
Sbjct  428   PSITVVNLTSSATVRRTVKNVGKP-GVYKAYVTSPAGVRVTVSPDTLPFLLKGEKKTFQV  486

Query  301   SVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
               +  +     ++ FG   W++G   V+SP+VV +
Sbjct  487   RFEVTNASLAMDYSFGALVWTNGKQFVRSPLVVKT  521



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   277 bits (709),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 167/392 (43%), Positives = 226/392 (58%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  369   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGM  425

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  D I  Y+ T+ NP A++    TV G KPSP
Sbjct  426   ILANTAANGEELVADAHLLPATTVGEKAG-DIIRHYVTTDPNPTASISILGTVVGVKPSP  484

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P     D R V++NIISGTSMS
Sbjct  485   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMS  544

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLK++HP WS AAI+SA+MTTA      G+ + D A G+ + PF +GAGH 
Sbjct  545   CPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHV  604

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTS------LDTSFKC-PKKDssspsnlnypsL  473
              P+ A +PGL+YD T  DYL F+C +  TS         ++ C P K  S          
Sbjct  605   SPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFA  664

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    TYSV+V +   G  + + P VL F E  EK+S++++ 
Sbjct  665   VNVDGVGAYKYTRTVTSVGGA-GTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTF  723

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ +S
Sbjct  724   TVDSSKPSGSNSFGSIEWSDGKHVVGSPVAIS  755



>gb|KGN55998.1| hypothetical protein Csa_3G045120 [Cucumis sativus]
Length=760

 Score =   277 bits (709),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 231/391 (59%), Gaps = 17/391 (4%)
 Frame = -3

Query  1330  FPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VERAGGAA  1163
             +PL+ + D +    T N    C   +L P+KV GK++ CL G   R  +     +AG   
Sbjct  368   YPLISSLDAKAKNVTDNDALLCEEGSLDPKKVNGKIIICLRGDNARVAKGYVAAKAGAVG  427

Query  1162  VILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPS  992
             +IL N    G E+   + L+P ++I Y S+   + +YI + K P+A +   +T  G KP+
Sbjct  428   MILANAEENGDEILADAHLLPASHITY-SDGQLVYQYINSTKIPMAYMTHVRTEEGIKPA  486

Query  991   PAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSM  812
             P MA F+S GP++V+P+ILKPDITAPG NILAA+S  +SP  T  D R V +N+ SGTSM
Sbjct  487   PVMASFSSRGPNTVDPSILKPDITAPGENILAAYSRDASPTGTDFDKRRVPFNVESGTSM  546

Query  811   SCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHF  632
             SCPHVS +V LLK ++P WS AAI+SAIMTTA T+      I     E A  F YGAGH 
Sbjct  547   SCPHVSGIVGLLKTLYPKWSPAAIRSAIMTTAGTKANDLTPILSTNQEKANAFAYGAGHV  606

Query  631   QPSKAADPGLVYDSTYTDYLLFIC-------TVTGTSLDTSFKCPKKDssspsnlnypsL  473
              P++AADPGLVYD +  DYL ++C        +   S DTSF C K    +  N    S+
Sbjct  607   SPNRAADPGLVYDLSTKDYLNYLCAQGYNTAQIKQFSNDTSFVCSKSFKLTDLNYPSISI  666

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVK  293
              I     ++ +KR + NVGS   TY V+VK P G SV + PT LKF  + E++SF + +K
Sbjct  667   PILEYDVAVKIKRKLKNVGSP-GTYVVQVKEPLGVSVSVEPTSLKFTGIDEEKSFRVVLK  725

Query  292   AGSVKKVG-EFEFGWYKWSDGIHMVKSPIVV  203
             +      G ++ FG  +WSDG H V+SPIVV
Sbjct  726   SYEPNGSGPKYLFGKLEWSDGKHRVRSPIVV  756



>ref|XP_006601388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=561

 Score =   272 bits (695),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 166/380 (44%), Positives = 228/380 (60%), Gaps = 26/380 (7%)
 Frame = -3

Query  1288  TNFP---GFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSE  1136
             T FP     C+  T+ PEK +GK++ CL G    V +S    +AG A +IL N    G+E
Sbjct  185   TGFPCNSTLCMRGTIDPEKARGKILVCLRGVTARVEKSLVALKAGAAGMILCNDELSGNE  244

Query  1135  VPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPS  956
             +     L+P + I Y  +  A+  Y+ + KNP+  + P KT    KP+P+MA F+S GP+
Sbjct  245   LIADPHLLPASQINY-EDGLAVYAYMNSTKNPLGYIDPPKTKLQIKPAPSMAAFSSRGPN  303

Query  955   SVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALL  776
              V P ILKPD+TAPG+NI+AA+SE  SP D   D R V +  +SGTSMSCPHV+ VV LL
Sbjct  304   IVTPEILKPDVTAPGVNIIAAYSEGVSPTDMNFDKRRVPFITMSGTSMSCPHVAGVVGLL  363

Query  775   KAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEV-AGPFHYGAGHFQPSKAADPGLV  599
             K +HP WS   IKSA++TTA T +  G+ + D      A PF YG+GH +P++A DPGLV
Sbjct  364   KTLHPDWSPTVIKSALLTTARTRDNTGKPMLDGGNNANATPFAYGSGHIRPNRAMDPGLV  423

Query  598   YDSTYTDYLLFICTVTGTSLDT-------SFKCPKKDssspsnlnypsLAIAGLKGSMVV  440
             YD T  DYL F+C V+G +           ++CP  D  +  + NYP++ I  L GS+ +
Sbjct  424   YDLTNNDYLNFLC-VSGYNQSQIEMFSGAHYRCP--DIINILDFNYPTITIPKLYGSVSL  480

Query  439   KRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVG-EF  263
              R V NVGS   TY+  +K P G S+ + P VLKF  +GE++SF ++V+   V + G   
Sbjct  481   TRRVKNVGSP-GTYTARLKVPVGLSISVEPNVLKFDNIGEEKSFKLTVE---VTRPGVAT  536

Query  262   EFGWYKWSDGIHMVKSPIVV  203
              FG   WSDG H V+S IVV
Sbjct  537   TFGGITWSDGKHQVRSQIVV  556



>ref|XP_009112378.1| PREDICTED: subtilisin-like protease, partial [Brassica rapa]
Length=619

 Score =   273 bits (699),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 172/393 (44%), Positives = 233/393 (59%), Gaps = 21/393 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P VYAG+     +  +  FC P TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  230   LPFVYAGNAS--NNATYGNFCFPGTLIPEKVKGKIVMCEKGVNVRVEKGEVVKAAGGLGM  287

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E    +FL+P T +   + +D I  Y  T+ NP A+++   TV   +PSP
Sbjct  288   ILANTAYEGEERTANAFLLPATTVGEKA-SDIIRHYAFTDPNPTASIVFQGTVVNVQPSP  346

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+ + PNILKPD+ APG+NILAAW+ A  P     D R V++NIISGTSMS
Sbjct  347   VLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGAVGPSGLASDTRRVEFNIISGTSMS  406

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLK+++P WS AAI+SA+MTTA      G  I D A G  + PF +GAGH 
Sbjct  407   CPHVSGLAALLKSVYPEWSPAAIRSALMTTAYNTYKDGNPIIDIATGIPSTPFEHGAGHV  466

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVT-GTSL-----DTSFKCPKKDssspsnlnypsLA  470
              P+ A +PGL+YD T  DYL F+C +   +SL       ++ C    + S ++LNYPS A
Sbjct  467   SPTTAVNPGLIYDLTTADYLGFLCALKYNSSLIRIISRGNYTCDPSKTYSVADLNYPSFA  526

Query  469   IAGLKGSMVVK--RTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSIS  299
             +  + GS   K  RTVTNVG    +YSV+V +      + + P +L F EV EK+S+ ++
Sbjct  527   V-NVDGSSTYKYTRTVTNVGGA-GSYSVKVTSETTAVKISVEPAILNFKEVNEKKSYEVT  584

Query  298   VKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                 S K  G   FG  +WSDG H+V SP+ +S
Sbjct  585   FTVDSSKPSGSNSFGSIEWSDGKHVVASPVAIS  617



>ref|XP_008229767.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=773

 Score =   276 bits (707),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 163/372 (44%), Positives = 233/372 (63%), Gaps = 15/372 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              C   TL  +KVKGK++ CL G   +V +  +   AG   +IL N    G+E+     ++
Sbjct  405   LCKAGTLDLKKVKGKILACLQGDSATVDKGEQALLAGAVGMILANDELSGNEIISDPHVL  464

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P ++I + ++   +  YI + K+P A +    T  G KP+P MA F+S GP+++ P+ILK
Sbjct  465   PASHINF-TDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPVMAAFSSKGPNTITPDILK  523

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++I+AA++EA  P +   D R V +N +SGTSMSCPH+S +  LLK ++PHWS
Sbjct  524   PDITAPGVSIIAAYTEAQGPTNQMFDKRRVLFNSVSGTSMSCPHISGICGLLKTLYPHWS  583

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAIKSAIMTTATT++   E + +A    A PF YGAGH  P+ A DPGLVYD +  DYL
Sbjct  584   PAAIKSAIMTTATTQDNSREPLLNASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLNDYL  643

Query  571   LFICT--VTGTSLDT----SFKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              F+C+     T ++     +++CPK  + S +NLNYPS+ +  L GS+VV RTV NVG T
Sbjct  644   NFLCSNGYNKTQIEMVSEEAYECPKP-AVSLTNLNYPSITVPKLNGSLVVTRTVKNVG-T  701

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
               TY   ++ P G SV + P  L+F ++GE++SF + ++    K    + FG   WSDG 
Sbjct  702   PGTYKARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVIDAKAAKNYVFGKLIWSDGK  761

Query  229   HMVKSPIVVSSA  194
             H V+SPIVV +A
Sbjct  762   HYVRSPIVVKAA  773



>ref|XP_006660048.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=747

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 233/400 (58%), Gaps = 17/400 (4%)
 Frame = -3

Query  1354  SAIKKMETFPLVYAGDVELPGSTN-FPGFCLPDTLSPEKVKGKVVFCLVG----SVYRST  1190
             S +   E +P++ A D  L G        C   TL P KVK K+V C+ G     V +  
Sbjct  349   STLHSSELYPMIKASDAALAGCDPVIASTCPLGTLDPAKVKDKIVVCVRGGDIPRVTKGM  408

Query  1189  EVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPG  1019
              V  AGG+ +IL N    G ++     ++P T I Y  E  ++ +Y+ ++KNPVA + P 
Sbjct  409   TVLNAGGSGMILANGEMDGDDIVADPHVLPATMITY-KEAVSLYEYMGSSKNPVANISPS  467

Query  1018  KTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVK  839
             KT  G K SP++A F+S GPS   P +LKPDI APG++ILAA++E  SP + P D R  +
Sbjct  468   KTEVGVKNSPSVAAFSSRGPSGTLPYVLKPDIAAPGVDILAAFTEYVSPTEVPDDQRRSE  527

Query  838   YNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVAG  659
             Y I+SGTSM+CPHVS V+ LLKA  P WS AA++SAIMTTA T++  G  + D  G  A 
Sbjct  528   YAIMSGTSMACPHVSGVIGLLKAARPGWSPAAMRSAIMTTARTQDNTGAPMRDHDGTEAT  587

Query  658   PFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLDTS------FKCPKKDsssp  497
              F +GAG+  P++A DPGLVYD +  DY  F+C +  ++ D +      F CP K     
Sbjct  588   AFAFGAGNVHPNRAVDPGLVYDLSNDDYFTFLCAMGFSTEDLAKLSAGKFACPAK-VPPV  646

Query  496   snlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEK  317
              +LNYPS+ +  L+ S  V R + NVG   ATY    +AP G ++ + P  L+F   GE+
Sbjct  647   QDLNYPSIVVPALRHSATVTRRLKNVGRP-ATYRATWRAPTGINMTVEPAALEFKNAGEQ  705

Query  316   QSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSS  197
             + F +++K+   K    + FG   WSDG H V+SP+VV++
Sbjct  706   KEFKVTLKSDKDKIGKGYVFGRLDWSDGTHHVRSPVVVNA  745



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 224/392 (57%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  370   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGM  426

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  D I  Y+ T+ +P AT+    TV G KPSP
Sbjct  427   ILANTAANGEELVADAHLLPATTVGEKAG-DLIRHYVTTDPHPTATISILGTVVGVKPSP  485

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P     D R V++NIISGTSMS
Sbjct  486   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMS  545

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLKA+HP WS AAI+SA+MTTA      G+ + D A G+ + PF +GAGH 
Sbjct  546   CPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHV  605

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKC-PKKDssspsnlnypsL  473
              P+ A +PGL+YD T  DYL F+C +  TS         ++ C P K  S          
Sbjct  606   SPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFA  665

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    TYSV++ +      + + P VL F    EKQS++++ 
Sbjct  666   VNVEEAGAYKYTRTVTSVGGA-GTYSVKLTSETTAVKISVEPAVLNFKAANEKQSYTVTF  724

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ +S
Sbjct  725   TVDSSKASGSNSFGTIEWSDGKHVVGSPVAIS  756



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 165/392 (42%), Positives = 228/392 (58%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  372   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGM  428

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + ++P T +   +  D I +Y+ T+ NP A+++   TV   +PSP
Sbjct  429   ILANTAANGEELVADAHMLPATTVGEKAG-DIIRRYVLTDPNPTASVLIQGTVVNVQPSP  487

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P   P D R V++NIISGTSMS
Sbjct  488   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRVEFNIISGTSMS  547

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLK+ HP WS AAI+SA+MTTA      G+ I D A G+ + PF +GAG+ 
Sbjct  548   CPHVSGLAALLKSAHPEWSPAAIRSALMTTAYRSYKDGKPILDIATGKPSTPFDHGAGYV  607

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKC-PKKDssspsnlnypsL  473
              P+ A +PGLVYD T  DYL F+C +  TS         +F C P K  S          
Sbjct  608   SPTIATNPGLVYDLTTVDYLGFLCALNYTSSQIRSVSRRNFTCDPTKTYSIADLNYPSFA  667

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPA-GFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    +Y VEV + +    + ++P VL F EV EK+S++++ 
Sbjct  668   VNVDGSGAYKYTRTVTSVGGA-GSYKVEVTSESTAVKISVAPAVLNFKEVNEKKSYTVTF  726

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ ++
Sbjct  727   TVDSSKASGSNSFGSIEWSDGKHVVASPVAIT  758



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   276 bits (705),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 224/392 (57%), Gaps = 20/392 (5%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     + N    C+  TL PEKVKGK+V C  G    V +   V+ AGG  +
Sbjct  371   LPFIYAGNASNATNGNL---CMTGTLIPEKVKGKIVLCDRGVNARVQKGDVVKAAGGVGM  427

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  D I  Y+ T+ +P AT+    TV G KPSP
Sbjct  428   ILANTAANGEELVADAHLLPATTVGEKAG-DLIRHYVTTDPHPTATVSILGTVVGVKPSP  486

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GP+S+ PNILKPD+ APG+NILAAW+ A+ P     D R V++NIISGTSMS
Sbjct  487   VVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMS  546

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS + ALLKA+HP WS AAI+SA+MTTA      G+ + D A G+ + PF +GAGH 
Sbjct  547   CPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHV  606

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKC-PKKDssspsnlnypsL  473
              P+ A +PGL+YD T  DYL F+C +  TS         ++ C P K  S          
Sbjct  607   SPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFA  666

Query  472   AIAGLKGSMVVKRTVTNVGSTNATYSVEVKAP-AGFSVKISPTVLKFMEVGEKQSFSISV  296
                   G+    RTVT+VG    TYSV++ +      + + P VL F    EKQS++++ 
Sbjct  667   VNVEEAGAYKYTRTVTSVGGA-GTYSVKLTSETTAVKISVEPAVLNFKAANEKQSYTVTF  725

Query  295   KAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                S K  G   FG  +WSDG H+V SP+ +S
Sbjct  726   TVDSSKASGSNSFGTIEWSDGKHVVGSPVAIS  757



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   276 bits (705),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 166/396 (42%), Positives = 229/396 (58%), Gaps = 20/396 (5%)
 Frame = -3

Query  1336  ETFPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVGSVYRSTE---VERAGGA  1166
             E  P VYAG+     + NF   C+  TL PEKVKGK+V C  G  +R  +   V+  GG 
Sbjct  367   ELLPFVYAGNASNATNGNF---CVSGTLIPEKVKGKIVMCDRGVNFRVEKGEVVKAVGGL  423

Query  1165  AVILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKP  995
              +IL N    G E+   + L+P T +   +  + I  Y+ T+ NP A+++   TV   +P
Sbjct  424   GMILANTAENGEELVADAHLLPATAVGEKA-GEIIRHYVITHPNPTASILTQGTVVNVQP  482

Query  994   SPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTS  815
             SP +A F+  GP+   PNILKPD+ APG+NILAAW+ A  P +   D R V++NIISGTS
Sbjct  483   SPVVAAFSLRGPNPTTPNILKPDLIAPGVNILAAWTGAKGPTELASDTRRVEFNIISGTS  542

Query  814   MSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAG  638
             MSCPHVS + ALLK++HP WS AAI+SA+MTTA +    G+ + D A G+ + PF +GAG
Sbjct  543   MSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYSTYKDGKPLIDIATGKPSTPFDHGAG  602

Query  637   HFQPSKAADPGLVYDSTYTDYLLFICTVTGTSLD------TSFKC-PKKDssspsnlnyp  479
             H  P+ A +PGL+YD    DYL F+C +  TS         ++ C P K  S  +     
Sbjct  603   HVSPTMAVNPGLIYDILTVDYLDFLCALNYTSSQIMKVSRRNYTCDPSKTYSVGNLNYPS  662

Query  478   sLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGF-SVKISPTVLKFMEVGEKQSFSI  302
                     G+    RTVTNVG    +YSV+V +     ++ + P VL F EV EK+S+S+
Sbjct  663   FALNVQGSGAYTYTRTVTNVGEA-GSYSVKVTSETTIVNISVVPAVLNFKEVNEKKSYSV  721

Query  301   SVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVSSA  194
             +    S K  G   FG  +WSDGIH+V SP+ +S A
Sbjct  722   TFNVDSSKASGSNSFGSIQWSDGIHVVGSPVAISWA  757



>ref|XP_011000330.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=775

 Score =   276 bits (706),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 228/369 (62%), Gaps = 16/369 (4%)
 Frame = -3

Query  1273  FCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAVILGNI---GSEVPVGSFLI  1112
              C P TL  +KVKGK++ CL G    V +      AG   +IL N    G+ +   + ++
Sbjct  405   LCKPGTLDSKKVKGKILVCLRGINPRVEKGHVALLAGAVGMILANDEESGNGILADAHVL  464

Query  1111  PGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSPAMAPFTSLGPSSVEPNILK  932
             P  +I    +  A+  Y+ + K+P A +   +T  G KP+P MA F+S GP+ +E +ILK
Sbjct  465   PAAHII-SKDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILK  523

Query  931   PDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPHWS  752
             PDITAPG++++AA++ A+ P DT  D R + +N  SGTSMSCPHVS +V LLK++HP WS
Sbjct  524   PDITAPGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWS  583

Query  751   GAAIKSAIMTTATTENVKGEAIEDAYGEVAGPFHYGAGHFQPSKAADPGLVYDSTYTDYL  572
              AAI+SAIMTTATT +  G+ I D+    A PF YGAGH QP++A+DPGLVYD T  D+L
Sbjct  584   PAAIRSAIMTTATTRDNNGDPILDSSNTRATPFAYGAGHVQPNRASDPGLVYDLTVNDFL  643

Query  571   LFICTVTGTSLDTS------FKCPKKDssspsnlnypsLAIAGLKGSMVVKRTVTNVGST  410
              ++C+   T+ D        + CPK  S S ++ NYPS++   L  ++ V R V NVGS 
Sbjct  644   NYLCSRGYTAKDLKLFTDKPYTCPK--SFSLTDFNYPSISAINLNDTITVSRRVKNVGSP  701

Query  409   NATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSISVKAGSVKKVGEFEFGWYKWSDGI  230
                Y + V+ P G  V ++PT L F ++GE+++F ++ K     K+ ++ FG   WSDG 
Sbjct  702   -GKYYIHVREPTGVLVSVTPTTLDFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGK  760

Query  229   HMVKSPIVV  203
             H V+SP+VV
Sbjct  761   HFVRSPLVV  769



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   276 bits (705),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 173/393 (44%), Positives = 229/393 (58%), Gaps = 22/393 (6%)
 Frame = -3

Query  1330  FPLVYAGDVELPGSTNFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRSTEVERAGGAAV  1160
              P +YAG+     +T     C+  TL P+KV GK+V C  G    V + + V  AGGA +
Sbjct  369   LPFIYAGNAT---NTTNGNLCMTGTLLPDKVAGKIVLCDRGINARVQKGSVVRDAGGAGM  425

Query  1159  ILGNI---GSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIPGKTVFGAKPSP  989
             IL N    G E+   + L+P T +   +  DAI  Y+ ++ NP AT+    T  G KPSP
Sbjct  426   ILANTAANGEELVADAHLLPATAVGEIAG-DAIKSYLFSDPNPTATIAFRGTKVGVKPSP  484

Query  988   AMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSVKYNIISGTSMS  809
              +A F+S GPS++ P+ILKPD+ APG+NILAAW+ +  P     D R  ++NIISGTSMS
Sbjct  485   VVAAFSSRGPSAITPDILKPDLIAPGVNILAAWTGSVGPTGQAADPRRTEFNIISGTSMS  544

Query  808   CPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIED-AYGEVAGPFHYGAGHF  632
             CPHVS ++ALLK  HP WS  AIKSA+MTTA         I D A G  A PF +GAGH 
Sbjct  545   CPHVSGLLALLKGAHPDWSPGAIKSALMTTAYAAYPGDGGILDVATGRAATPFDFGAGHV  604

Query  631   QPSKAADPGLVYDSTYTDYLLFICTVTGTSLD-------TSFKCPKKDssspsnlnypsL  473
              P KA DPGLVYD T  DYL F+C +  T L        T++ C ++ +   S+LNYPS 
Sbjct  605   DPPKALDPGLVYDLTTEDYLDFLCALNYTPLQIARLSRLTNYTCDRQKAYEVSDLNYPSF  664

Query  472   AIAGLKGSMVVK--RTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGEKQSFSIS  299
             A+A    S  VK  RT+TNVG+   TY   V AP G  V + PT L F  +GEK++++++
Sbjct  665   AVAFATASTTVKHTRTLTNVGAP-GTYKATVSAPEGVKVVVEPTALTFSALGEKKNYTVT  723

Query  298   VKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVVS  200
                 S +  G   FG  +WSD  H+V SP+  S
Sbjct  724   FSTAS-QPSGSTAFGRLEWSDAQHVVASPLAFS  755



>ref|XP_006350127.1| PREDICTED: subtilisin-like protease-like, partial [Solanum tuberosum]
Length=760

 Score =   275 bits (704),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 238/399 (60%), Gaps = 17/399 (4%)
 Frame = -3

Query  1360  SISAIKKMETFPLVYAGDVELPGST-NFPGFCLPDTLSPEKVKGKVVFCLVG---SVYRS  1193
             S  A+ + ++FP++     ++  +T     FC+  TL P+K KG ++ C  G   +  + 
Sbjct  359   SSKALPEGKSFPIITGASAKVANATAEEANFCIEGTLDPKKAKGTILVCHRGGSPAFNKC  418

Query  1192  TEVERAGGAAVILGN---IGSEVPVGSFLIPGTNIFYPSETDAILKYIKTNKNPVATLIP  1022
             T+    G   +++ N    G+E+    +L P T+I Y S+   +  Y+ + +   A +  
Sbjct  419   TQATSVGAVGIVILNSAFFGNEMYAEPYLCPATHISY-SDGLQVSSYVNSTRKATAYITR  477

Query  1021  GKTVFGAKPSPAMAPFTSLGPSSVEPNILKPDITAPGLNILAAWSEASSPFDTPQDHRSV  842
               T  G KP+P MA F+S+GP+ V P ILKPDITAPG++ILAA++    P +T  D+R V
Sbjct  478   PTTELGTKPAPVMAAFSSIGPNRVTPEILKPDITAPGVSILAAYTGVQGPTETDLDNRRV  537

Query  841   KYNIISGTSMSCPHVSAVVALLKAIHPHWSGAAIKSAIMTTATTENVKGEAIEDAYGEVA  662
             K+N ++GTSMSCPHV+ VV LLK +HP WS AAIKSAIMT+A T +     + ++    A
Sbjct  538   KFNTMTGTSMSCPHVAGVVGLLKTLHPTWSPAAIKSAIMTSARTRDNTINPMTNSTHLKA  597

Query  661   GPFHYGAGHFQPSKAADPGLVYDSTYTDYLLFICTV----TGTSLDTS--FKCPKKDsss  500
              PF YG+GH  P++A DPGLVYD T  DY+ F+C      T  S  T   FKCP  D  S
Sbjct  598   SPFAYGSGHIWPNRAMDPGLVYDLTINDYMNFLCAQGYKETQISFFTQGHFKCP--DPIS  655

Query  499   psnlnypsLAIAGLKGSMVVKRTVTNVGSTNATYSVEVKAPAGFSVKISPTVLKFMEVGE  320
              SNLN PS+ +  L GS+VV RT+ NVGS   TY   +++P G +V + P  L+F ++GE
Sbjct  656   FSNLNLPSITVPKLNGSIVVTRTLKNVGSP-GTYKAHIRSPIGITVVVEPNTLEFKKIGE  714

Query  319   KQSFSISVKAGSVKKVGEFEFGWYKWSDGIHMVKSPIVV  203
             ++SF I++K    K   ++ FG   WSD  H V+SPIVV
Sbjct  715   EKSFKITLKVKGHKAPKDYVFGHLIWSDNKHYVRSPIVV  753



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3619834308852