BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25075_g1_i2 len=1946 path=[2533:0-213 2747:214-225 2759:226-279
2812:280-306 1630:307-343 2875:344-424 2956:425-460 2991:461-630
2180:631-680 3210:681-756 3286:757-854 3381:855-1588 759:1589-1945]

Length=1946
                                                                      Score     E

ref|XP_009604279.1|  PREDICTED: subtilisin-like protease                703   0.0      
ref|XP_009768078.1|  PREDICTED: subtilisin-like protease SBT5.3         701   0.0      
ref|XP_006355621.1|  PREDICTED: subtilisin-like protease-like           693   0.0      
ref|XP_006355566.1|  PREDICTED: subtilisin-like protease-like           692   0.0      
emb|CDP14569.1|  unnamed protein product                                687   0.0      
ref|XP_006355622.1|  PREDICTED: subtilisin-like protease-like           685   0.0      
ref|XP_004232982.1|  PREDICTED: subtilisin-like protease                684   0.0      
ref|XP_011102273.1|  PREDICTED: subtilisin-like protease SBT5.3         681   0.0      
emb|CDP14572.1|  unnamed protein product                                654   0.0      
emb|CDP14563.1|  unnamed protein product                                647   0.0      
gb|EYU28147.1|  hypothetical protein MIMGU_mgv1a018442mg                641   0.0      
gb|EYU28146.1|  hypothetical protein MIMGU_mgv1a001696mg                640   0.0      
gb|EYU28148.1|  hypothetical protein MIMGU_mgv1a026974mg                630   0.0      
ref|XP_010272679.1|  PREDICTED: subtilisin-like protease SBT5.4         631   0.0      
gb|EYU28149.1|  hypothetical protein MIMGU_mgv1a018291mg                629   0.0      
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4         629   0.0      
gb|EYU28145.1|  hypothetical protein MIMGU_mgv1a021952mg                625   0.0      
ref|XP_009407016.1|  PREDICTED: subtilisin-like protease SBT5.3         619   0.0      
ref|XP_008803738.1|  PREDICTED: subtilisin-like protease SBT5.3         612   0.0      
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease                607   0.0      
ref|XP_010916217.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    606   0.0      
ref|XP_010916207.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    607   0.0      
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease                607   0.0      
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3         604   0.0      
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like           599   0.0      
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg                596   0.0      
ref|XP_009385357.1|  PREDICTED: subtilisin-like protease SBT5.3         585   0.0      
emb|CDM84099.1|  unnamed protein product                                594   0.0      
ref|XP_010232258.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    589   0.0      
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3         592   0.0      
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3         590   0.0      
ref|XP_003569718.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    590   0.0      
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like           587   0.0      
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3         587   0.0      Vitis vinifera
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like           586   0.0      
ref|XP_002269375.1|  PREDICTED: subtilisin-like protease SBT5.3         585   0.0      Vitis vinifera
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3         584   0.0      
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease                581   0.0      
ref|XP_002458431.1|  hypothetical protein SORBIDRAFT_03g033440          580   0.0      Sorghum bicolor [broomcorn]
ref|XP_004969820.1|  PREDICTED: subtilisin-like protease-like           579   0.0      
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease                579   0.0      
gb|EEC71416.1|  hypothetical protein OsI_03596                          578   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease                578   0.0      
dbj|BAB21149.1|  subtilisin-like proteinase-like                        578   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004134922.1|  PREDICTED: subtilisin-like protease-like           578   0.0      
ref|NP_199378.1|  subtilase family protein                              578   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863463.1|  subtilase family protein                           578   0.0      
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3         575   0.0      
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940          574   0.0      
ref|XP_010095116.1|  Subtilisin-like protease                           574   0.0      
emb|CAN61728.1|  hypothetical protein VITISV_036029                     575   0.0      Vitis vinifera
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg             572   0.0      
ref|XP_006280186.1|  hypothetical protein CARUB_v10026090mg             565   0.0      
ref|XP_007025242.1|  Subtilase family protein, putative isoform 1       571   0.0      
ref|XP_010665649.1|  PREDICTED: subtilisin-like protease SBT5.3         571   0.0      
ref|XP_007025243.1|  Subtilase family protein isoform 2                 569   0.0      
ref|XP_009114399.1|  PREDICTED: subtilisin-like protease SBT5.3         568   0.0      
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg             568   0.0      
gb|KHG30296.1|  Subtilisin-like protease                                567   0.0      
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                     566   0.0      
ref|XP_006467568.1|  PREDICTED: subtilisin-like protease-like           566   0.0      
emb|CDY23110.1|  BnaC09g18640D                                          565   0.0      
ref|XP_006398246.1|  hypothetical protein EUTSA_v10000784mg             566   0.0      
emb|CDY13044.1|  BnaA09g17730D                                          565   0.0      
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3         564   0.0      
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                    564   0.0      
ref|XP_010481547.1|  PREDICTED: subtilisin-like protease SBT5.3         563   0.0      
ref|XP_008439697.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    563   0.0      
gb|KDO77986.1|  hypothetical protein CISIN_1g0040471mg                  554   0.0      
ref|XP_010052138.1|  PREDICTED: subtilisin-like protease SBT5.3         560   0.0      
ref|XP_010494682.1|  PREDICTED: subtilisin-like protease SBT5.3         559   0.0      
gb|KDP21172.1|  hypothetical protein JCGZ_21643                         558   0.0      
ref|XP_010441687.1|  PREDICTED: subtilisin-like protease SBT5.3         558   0.0      
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative      556   0.0      Ricinus communis
ref|XP_002317314.1|  subtilase family protein                           550   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011010424.1|  PREDICTED: subtilisin-like protease SBT5.3         549   0.0      
ref|XP_011045349.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    548   0.0      
ref|XP_010518867.1|  PREDICTED: subtilisin-like protease SBT5.3         546   0.0      
tpg|DAA57792.1|  TPA: putative subtilase family protein                 546   0.0      
ref|XP_008675086.1|  PREDICTED: subtilisin-like protease isoform X3     546   3e-180   
ref|XP_011045348.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    541   2e-179   
ref|XP_008675084.1|  PREDICTED: subtilisin-like protease isoform X1     542   9e-179   
ref|XP_008675085.1|  PREDICTED: subtilisin-like protease isoform X2     542   1e-178   
gb|EPS68445.1|  hypothetical protein M569_06321                         533   3e-178   
dbj|BAK03173.1|  predicted protein                                      535   3e-178   
dbj|BAJ85613.1|  predicted protein                                      538   6e-178   
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like           536   3e-177   
dbj|BAJ94880.1|  predicted protein                                      529   4e-177   
gb|AIC80766.1|  subtilase                                               535   5e-177   
dbj|BAJ86327.1|  predicted protein                                      527   2e-176   
ref|XP_010529231.1|  PREDICTED: subtilisin-like protease                533   2e-176   
ref|XP_006449588.1|  hypothetical protein CICLE_v10014347mg             517   5e-173   
emb|CBI30770.3|  unnamed protein product                                523   6e-173   
gb|KDO77991.1|  hypothetical protein CISIN_1g0040471mg                  513   1e-171   
emb|CBI30775.3|  unnamed protein product                                517   1e-170   
gb|KEH36679.1|  subtilisin-like serine protease                         517   6e-170   
gb|KEH36678.1|  subtilisin-like serine protease                         515   3e-169   
ref|XP_006594524.1|  PREDICTED: subtilisin-like protease-like iso...    515   4e-169   
ref|XP_003541678.1|  PREDICTED: subtilisin-like protease-like iso...    515   4e-169   
ref|XP_007147961.1|  hypothetical protein PHAVU_006G168800g             505   3e-165   
ref|XP_010494681.1|  PREDICTED: subtilisin-like protease SBT5.4         502   1e-163   
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              499   9e-163   
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             498   1e-161   
ref|XP_002863464.1|  subtilase family protein                           481   9e-156   
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    479   5e-155   
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661              475   3e-154   
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842              473   8e-154   
ref|XP_002988851.1|  hypothetical protein SELMODRAFT_128873             473   4e-153   
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478             471   8e-153   
ref|XP_006279865.1|  hypothetical protein CARUB_v10028532mg             471   5e-152   
ref|NP_199377.2|  Subtilisin-like serine endopeptidase family pro...    469   1e-151   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38643.1|  Subtilisin-like protease                                458   3e-148   
ref|XP_003538129.1|  PREDICTED: subtilisin-like protease-like           459   1e-147   
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4         459   2e-147   
ref|XP_001777292.1|  predicted protein                                  456   2e-147   
gb|KEH29866.1|  subtilisin-like serine protease                         454   4e-147   
ref|XP_006851499.1|  hypothetical protein AMTR_s00040p00151440          456   5e-147   
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         457   6e-147   
ref|XP_007049441.1|  Subtilisin-like serine endopeptidase family ...    451   2e-146   
gb|AES88343.2|  subtilisin-like serine protease                         454   2e-146   
ref|XP_010107369.1|  Subtilisin-like protease                           454   7e-146   
ref|XP_006469398.1|  PREDICTED: subtilisin-like protease-like iso...    449   1e-145   
ref|XP_007132413.1|  hypothetical protein PHAVU_011G092600g             450   3e-145   
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3         452   4e-145   
emb|CBI39824.3|  unnamed protein product                                453   4e-145   
ref|XP_002299063.2|  hypothetical protein POPTR_0001s47290g             452   8e-145   Populus trichocarpa [western balsam poplar]
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         451   9e-145   
ref|XP_007049440.1|  Subtilisin-like serine endopeptidase family ...    452   2e-144   
ref|XP_007132414.1|  hypothetical protein PHAVU_011G092600g             451   2e-144   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      451   2e-144   Ricinus communis
ref|XP_011044970.1|  PREDICTED: subtilisin-like protease SBT5.3         449   2e-144   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                449   3e-144   
ref|XP_006469397.1|  PREDICTED: subtilisin-like protease-like iso...    449   6e-144   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         449   7e-144   
ref|XP_002320540.2|  subtilisin-like protease family protein            449   7e-144   Populus trichocarpa [western balsam poplar]
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         449   1e-143   
ref|XP_010647520.1|  PREDICTED: subtilisin-like protease SBT5.3         446   2e-143   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                448   2e-143   
ref|XP_006447869.1|  hypothetical protein CICLE_v10014351mg             448   2e-143   
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                448   3e-143   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      447   3e-143   Ricinus communis
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             447   4e-143   
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           447   4e-143   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                447   5e-143   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             446   5e-143   
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    446   5e-143   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         447   6e-143   
ref|XP_002974964.1|  hypothetical protein SELMODRAFT_415194             446   7e-143   
ref|XP_010092360.1|  Subtilisin-like protease                           445   8e-143   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                446   8e-143   
ref|XP_011039832.1|  PREDICTED: subtilisin-like protease SBT5.4         446   1e-142   
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             446   1e-142   
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    446   2e-142   
ref|XP_004167057.1|  PREDICTED: subtilisin-like protease-like           442   2e-142   
ref|XP_010096499.1|  Subtilisin-like protease                           446   2e-142   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     445   2e-142   
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                446   2e-142   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     445   2e-142   
emb|CBI38460.3|  unnamed protein product                                446   2e-142   
ref|XP_002977384.1|  hypothetical protein SELMODRAFT_417382             445   2e-142   
ref|XP_002299062.1|  hypothetical protein POPTR_0001s47280g             445   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_011039899.1|  PREDICTED: subtilisin-like protease SBT5.4         448   4e-142   
emb|CDY12840.1|  BnaC07g15930D                                          444   5e-142   
ref|XP_002269456.2|  PREDICTED: subtilisin-like protease SBT5.4         438   5e-142   Vitis vinifera
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         444   5e-142   
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                444   6e-142   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             443   6e-142   
gb|KDO42093.1|  hypothetical protein CISIN_1g038881mg                   445   6e-142   
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         444   7e-142   
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             444   7e-142   
gb|KEH35215.1|  subtilisin-like serine protease                         439   7e-142   
gb|KGN43389.1|  hypothetical protein Csa_7G030520                       443   8e-142   
gb|KEH35216.1|  subtilisin-like serine protease                         439   1e-141   
ref|XP_010693559.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    452   1e-141   
ref|XP_004144624.1|  PREDICTED: subtilisin-like protease-like           442   2e-141   
ref|XP_002299064.1|  hypothetical protein POPTR_0001s47300g             444   2e-141   Populus trichocarpa [western balsam poplar]
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             443   2e-141   
gb|KDP32632.1|  hypothetical protein JCGZ_13182                         442   2e-141   
gb|ACP18876.1|  subtilisin-like serine protease                         442   2e-141   Carica papaya [mamon]
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease-like           442   2e-141   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             442   3e-141   
gb|KDP45154.1|  hypothetical protein JCGZ_15019                         442   4e-141   
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                442   4e-141   
ref|XP_002313670.2|  hypothetical protein POPTR_0009s14680g             439   5e-141   Populus trichocarpa [western balsam poplar]
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         442   5e-141   
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      441   6e-141   Ricinus communis
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    437   7e-141   
emb|CDY65487.1|  BnaA03g57660D                                          441   8e-141   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         441   8e-141   
ref|NP_569048.1|  subtilisin-like protease                              441   8e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         441   1e-140   
ref|XP_010252985.1|  PREDICTED: subtilisin-like protease SBT5.4         441   2e-140   
ref|XP_008462020.1|  PREDICTED: subtilisin-like protease isoform X2     436   3e-140   
ref|XP_003601486.1|  Subtilisin-like protease                           440   3e-140   
dbj|BAB09207.1|  subtilisin-like protease                               438   3e-140   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF95887.1|  subtilase                                              439   4e-140   Lotus japonicus
dbj|BAK01624.1|  predicted protein                                      439   7e-140   
ref|XP_011088876.1|  PREDICTED: subtilisin-like protease SBT5.3         437   7e-140   
ref|NP_001267495.1|  SUB1 homolog precursor                             439   9e-140   
gb|EYU27629.1|  hypothetical protein MIMGU_mgv1a001914mg                437   1e-139   
ref|XP_002523782.1|  Xylem serine proteinase 1 precursor, putative      438   1e-139   Ricinus communis
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         437   3e-139   
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         437   3e-139   
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         437   4e-139   
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    437   4e-139   Vitis vinifera
emb|CDP06146.1|  unnamed protein product                                437   5e-139   
ref|XP_009759676.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    432   5e-139   
ref|XP_008462019.1|  PREDICTED: subtilisin-like protease isoform X1     436   6e-139   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       436   7e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    436   7e-139   
gb|AFV08661.1|  subtilisin-like protease                                436   8e-139   
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4         435   9e-139   Vitis vinifera
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         436   1e-138   
ref|XP_008229443.1|  PREDICTED: cucumisin-like                          436   1e-138   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         436   1e-138   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         436   1e-138   
ref|XP_004243217.1|  PREDICTED: subtilisin-like protease SBT5.3         436   2e-138   
ref|XP_004506157.1|  PREDICTED: subtilisin-like protease-like           435   2e-138   
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    435   2e-138   
emb|CBI38462.3|  unnamed protein product                                435   2e-138   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease                430   2e-138   
ref|XP_007015857.1|  Subtilisin-like serine endopeptidase family ...    435   2e-138   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                434   3e-138   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             434   3e-138   
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3         435   3e-138   
emb|CDY57437.1|  BnaAnng14520D                                          434   3e-138   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                434   3e-138   
ref|XP_008224681.1|  PREDICTED: subtilisin-like protease                434   4e-138   
ref|XP_002530614.1|  Cucumisin precursor, putative                      434   5e-138   Ricinus communis
ref|XP_003608826.1|  Subtilisin-like protease                           434   6e-138   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             433   6e-138   
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease                434   7e-138   
ref|XP_004515893.1|  PREDICTED: subtilisin-like protease-like           434   7e-138   
emb|CDY15084.1|  BnaC03g44450D                                          434   7e-138   
ref|XP_006377976.1|  hypothetical protein POPTR_0011s16870g             434   7e-138   
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         433   7e-138   
gb|KHN21134.1|  Subtilisin-like protease                                429   8e-138   
ref|XP_007213363.1|  hypothetical protein PRUPE_ppa026835mg             432   8e-138   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    433   8e-138   
emb|CDP06171.1|  unnamed protein product                                433   9e-138   
ref|XP_006350127.1|  PREDICTED: subtilisin-like protease-like           433   9e-138   
ref|XP_007206725.1|  hypothetical protein PRUPE_ppa024702mg             432   1e-137   
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           433   1e-137   
gb|KEH29867.1|  subtilisin-like serine endopeptidase family protein     430   1e-137   
emb|CAA59963.1|  subtilisin-like protease                               432   1e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62337.1|  hypothetical protein VITISV_004299                     427   2e-137   Vitis vinifera
ref|XP_010063229.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    432   2e-137   
ref|XP_002885743.1|  hypothetical protein ARALYDRAFT_899224             432   2e-137   
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         432   2e-137   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg                433   3e-137   
emb|CBI38458.3|  unnamed protein product                                431   3e-137   
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         432   3e-137   
ref|XP_011000330.1|  PREDICTED: subtilisin-like protease SBT5.4         432   3e-137   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             431   3e-137   
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             432   3e-137   
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3         432   3e-137   
ref|XP_009611073.1|  PREDICTED: subtilisin-like protease SBT5.3         432   4e-137   
ref|XP_009759675.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    432   4e-137   
ref|XP_003614591.1|  Subtilisin-like protease                           428   4e-137   
emb|CBI28350.3|  unnamed protein product                                430   6e-137   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         431   6e-137   
gb|KHM99088.1|  Subtilisin-like protease                                431   8e-137   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                431   9e-137   
ref|XP_008385530.1|  PREDICTED: subtilisin-like protease                432   1e-136   
ref|XP_010651909.1|  PREDICTED: cucumisin-like                          430   1e-136   
gb|KGN55998.1|  hypothetical protein Csa_3G045120                       430   1e-136   
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like           431   1e-136   
ref|XP_006469402.1|  PREDICTED: subtilisin-like protease-like           431   1e-136   
ref|XP_003545192.1|  PREDICTED: subtilisin-like protease-like           431   2e-136   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    429   2e-136   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             429   2e-136   Populus trichocarpa [western balsam poplar]
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                430   2e-136   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          429   2e-136   
ref|XP_009590448.1|  PREDICTED: subtilisin-like protease                431   2e-136   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           429   3e-136   
emb|CDP06940.1|  unnamed protein product                                427   5e-136   
ref|XP_008348301.1|  PREDICTED: subtilisin-like protease                429   5e-136   
ref|XP_008380083.1|  PREDICTED: subtilisin-like protease                423   6e-136   
ref|XP_009107091.1|  PREDICTED: subtilisin-like protease SBT5.4         428   6e-136   
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690          429   7e-136   
ref|XP_006447860.1|  hypothetical protein CICLE_v10014355mg             428   7e-136   
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           428   8e-136   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    428   9e-136   
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg             428   1e-135   
gb|AES91027.2|  subtilisin-like serine protease                         429   1e-135   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         428   1e-135   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             428   1e-135   
emb|CDY29697.1|  BnaA04g17300D                                          427   2e-135   
gb|AES91025.2|  subtilisin-like serine protease                         426   2e-135   
ref|XP_008344750.1|  PREDICTED: subtilisin-like protease                422   2e-135   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           427   2e-135   
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg             426   3e-135   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                427   3e-135   
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         426   4e-135   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             426   5e-135   
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    426   6e-135   
gb|AES91026.2|  subtilisin-like serine protease                         426   8e-135   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             426   1e-134   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    425   1e-134   
ref|XP_010063228.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    426   1e-134   
emb|CDY40408.1|  BnaA02g27220D                                          425   1e-134   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                425   1e-134   
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                    425   1e-134   
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             424   2e-134   
gb|KHN04600.1|  Subtilisin-like protease                                424   2e-134   
emb|CDY37334.1|  BnaC02g33520D                                          425   2e-134   
gb|KHN15704.1|  Subtilisin-like protease                                424   2e-134   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                425   2e-134   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    425   2e-134   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    424   2e-134   
ref|XP_006468177.1|  PREDICTED: subtilisin-like protease-like           425   3e-134   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    424   3e-134   
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    418   3e-134   
ref|XP_006398487.1|  hypothetical protein EUTSA_v10001201mg             424   3e-134   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                424   3e-134   
ref|XP_002977793.1|  hypothetical protein SELMODRAFT_107351             422   3e-134   
emb|CDP15554.1|  unnamed protein product                                425   3e-134   
gb|KDO78650.1|  hypothetical protein CISIN_1g048642mg                   424   4e-134   
ref|XP_003606146.1|  Xylem serine proteinase                            435   4e-134   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like           425   4e-134   
gb|EPS59495.1|  hypothetical protein M569_15309                         422   5e-134   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           424   5e-134   
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                423   5e-134   
ref|XP_002517380.1|  Xylem serine proteinase 1 precursor, putative      422   6e-134   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    423   7e-134   
ref|XP_010108994.1|  Subtilisin-like protease                           425   7e-134   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                423   8e-134   
emb|CBI29567.3|  unnamed protein product                                419   8e-134   
ref|XP_006447864.1|  hypothetical protein CICLE_v10017839mg             421   9e-134   
ref|XP_009587856.1|  PREDICTED: subtilisin-like protease SBT5.4         423   9e-134   
ref|XP_011102282.1|  PREDICTED: subtilisin-like protease                417   1e-133   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             423   1e-133   
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     423   1e-133   
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     422   1e-133   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                422   1e-133   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          423   2e-133   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           422   2e-133   
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    422   2e-133   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                422   2e-133   
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease                423   2e-133   
ref|XP_003608829.1|  Subtilisin-like serine protease                    422   2e-133   
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3         422   2e-133   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             422   2e-133   
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         422   2e-133   
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    422   2e-133   
emb|CDY63302.1|  BnaCnng41810D                                          421   3e-133   
ref|XP_004231532.1|  PREDICTED: subtilisin-like protease                422   3e-133   
ref|XP_003608828.1|  Subtilisin-like serine protease                    422   3e-133   
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    421   4e-133   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                421   4e-133   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                422   5e-133   
ref|XP_002994398.1|  hypothetical protein SELMODRAFT_236958             420   6e-133   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             420   6e-133   
ref|XP_007206786.1|  hypothetical protein PRUPE_ppa025514mg             421   6e-133   
gb|KGN55997.1|  hypothetical protein Csa_3G045110                       416   7e-133   
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                421   7e-133   
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                421   8e-133   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    419   9e-133   
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           419   1e-132   
ref|XP_010089708.1|  Subtilisin-like protease                           421   1e-132   
gb|KHN31561.1|  Subtilisin-like protease                                416   1e-132   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                419   1e-132   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     420   1e-132   
dbj|BAJ87780.1|  predicted protein                                      420   1e-132   
ref|XP_002986912.1|  hypothetical protein SELMODRAFT_425827             419   2e-132   
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                419   2e-132   
emb|CDX82491.1|  BnaA03g33300D                                          419   2e-132   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             420   2e-132   
ref|XP_010661611.1|  PREDICTED: subtilisin-like protease                419   2e-132   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           419   2e-132   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                419   2e-132   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...    419   3e-132   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                419   3e-132   
ref|XP_003608824.1|  Subtilisin-like protease                           419   3e-132   
gb|KGN55995.1|  hypothetical protein Csa_3G045090                       418   3e-132   
ref|XP_010089852.1|  Subtilisin-like protease                           418   4e-132   
ref|XP_008661010.1|  PREDICTED: subtilisin-like protease SBT5.3         419   4e-132   
ref|XP_004164572.1|  PREDICTED: subtilisin-like protease-like           419   4e-132   
gb|ABR17987.1|  unknown                                                 419   4e-132   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                419   4e-132   
ref|XP_009374900.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    419   4e-132   
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...    418   5e-132   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                418   5e-132   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                418   6e-132   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                418   6e-132   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4         417   7e-132   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                418   8e-132   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                418   8e-132   
ref|XP_006857622.1|  hypothetical protein AMTR_s00061p00122710          418   9e-132   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                418   1e-131   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                417   1e-131   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           417   1e-131   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         417   1e-131   
ref|XP_001757585.1|  predicted protein                                  417   1e-131   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                419   1e-131   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           417   1e-131   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             417   1e-131   
gb|KCW72879.1|  hypothetical protein EUGRSUZ_E01327                     416   1e-131   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         419   1e-131   
gb|KCW75459.1|  hypothetical protein EUGRSUZ_E04225                     416   2e-131   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                417   2e-131   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                417   2e-131   
ref|XP_011096569.1|  PREDICTED: subtilisin-like protease                415   2e-131   
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         420   2e-131   
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease           417   2e-131   
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                417   2e-131   
gb|KGN64982.1|  hypothetical protein Csa_1G171040                       416   3e-131   
ref|XP_007047459.1|  Subtilase family protein                           416   3e-131   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                416   3e-131   
ref|NP_566483.1|  Subtilase family protein                              416   3e-131   
ref|XP_010675634.1|  PREDICTED: subtilisin-like protease SBT5.4         416   4e-131   
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like           415   4e-131   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                416   5e-131   
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    415   5e-131   
ref|XP_003533568.1|  PREDICTED: subtilisin-like protease-like           416   6e-131   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           416   7e-131   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                416   8e-131   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             415   8e-131   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                415   9e-131   
ref|XP_010059708.1|  PREDICTED: subtilisin-like protease SBT5.4         415   1e-130   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease                416   1e-130   
ref|XP_008448997.1|  PREDICTED: subtilisin-like protease                415   1e-130   
gb|KHN11556.1|  Subtilisin-like protease                                415   1e-130   
ref|NP_001046210.1|  Os02g0198700                                       416   1e-130   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                415   1e-130   
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             414   1e-130   
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         415   1e-130   
ref|XP_006369092.1|  subtilase family protein                           415   1e-130   
gb|AAM60964.1|  subtilisin-like serine protease                         415   1e-130   
ref|XP_006380388.1|  hypothetical protein POPTR_0007s04520g             416   1e-130   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           414   1e-130   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         414   2e-130   
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4         414   2e-130   
gb|EAY84890.1|  hypothetical protein OsI_06255                          415   2e-130   
ref|XP_003560594.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    414   2e-130   
ref|XP_009759335.1|  PREDICTED: subtilisin-like protease SBT5.4         414   2e-130   
gb|KCW88582.1|  hypothetical protein EUGRSUZ_A00959                     415   2e-130   
gb|KEH27645.1|  subtilisin-like serine protease                         413   2e-130   
ref|XP_010227516.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    414   2e-130   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    414   3e-130   
gb|KHN13888.1|  Subtilisin-like protease                                413   3e-130   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      413   3e-130   
ref|XP_004293077.1|  PREDICTED: subtilisin-like protease-like           414   3e-130   
ref|XP_010090327.1|  Subtilisin-like protease                           414   3e-130   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                414   4e-130   
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           414   4e-130   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             414   4e-130   
ref|XP_006849918.1|  hypothetical protein AMTR_s00022p00110120          410   5e-130   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                413   5e-130   
gb|AAC62611.1|  subtilisin-like protease                                413   5e-130   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                413   5e-130   
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    413   5e-130   
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             413   5e-130   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  413   5e-130   
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     413   5e-130   
ref|XP_006447865.1|  hypothetical protein CICLE_v10018333mg             410   5e-130   
ref|XP_001755716.1|  predicted protein                                  412   5e-130   
ref|XP_003571633.1|  PREDICTED: subtilisin-like protease SBT5.3         413   5e-130   
ref|XP_003612438.1|  Subtilisin-like protease                           413   6e-130   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             413   6e-130   
ref|XP_009591665.1|  PREDICTED: subtilisin-like protease SBT5.3         427   6e-130   
gb|EAZ09847.1|  hypothetical protein OsI_32138                          413   6e-130   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    413   7e-130   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           413   7e-130   
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         413   7e-130   
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                412   7e-130   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    413   8e-130   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                412   8e-130   
ref|XP_004957134.1|  PREDICTED: subtilisin-like protease-like           414   9e-130   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     412   9e-130   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          412   9e-130   
ref|XP_002986914.1|  hypothetical protein SELMODRAFT_425830             412   9e-130   
ref|XP_007141639.1|  hypothetical protein PHAVU_008G213000g             413   1e-129   
emb|CDO96926.1|  unnamed protein product                                412   1e-129   
ref|XP_010087293.1|  Subtilisin-like protease                           411   1e-129   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           412   1e-129   
ref|XP_010661613.1|  PREDICTED: subtilisin-like protease                412   1e-129   
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                412   1e-129   
ref|XP_002309930.2|  hypothetical protein POPTR_0007s04500g             411   1e-129   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                412   1e-129   
emb|CDO97802.1|  unnamed protein product                                413   1e-129   
ref|XP_010109770.1|  hypothetical protein L484_008446                   411   1e-129   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    428   1e-129   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                412   1e-129   
gb|KHN27220.1|  Subtilisin-like protease                                411   1e-129   
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease                412   2e-129   
ref|XP_010048342.1|  PREDICTED: subtilisin-like protease SBT5.3         412   2e-129   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                411   2e-129   
ref|XP_003534221.1|  PREDICTED: subtilisin-like protease-like           411   2e-129   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    412   2e-129   
gb|KHN40225.1|  Subtilisin-like protease                                410   2e-129   
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                412   2e-129   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    411   3e-129   
ref|XP_003616914.1|  Subtilisin-like protease                           412   3e-129   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             411   3e-129   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                411   3e-129   
emb|CDX97560.1|  BnaA05g25190D                                          411   3e-129   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                411   3e-129   
ref|XP_010063230.1|  PREDICTED: subtilisin-like protease SBT5.4         411   4e-129   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          411   4e-129   



>ref|XP_009604279.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/588 (61%), Positives = 445/588 (76%), Gaps = 6/588 (1%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++K YEA FGP+N T DFRS RD+ GHGTHTA+TVGGR+VANASA
Sbjct  181   FNSSHCNRKLIGARYYLKSYEANFGPLNETRDFRSPRDVDGHGTHTAATVGGRRVANASA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G ATGGA   RLAIYK CW  P   + +   C  DD++AAFD A+ADGV ++SV
Sbjct  241   IGGFAKGTATGGAQNVRLAIYKVCWPFPDQSLAEGNACLADDIIAAFDDAIADGVHLLSV  300

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             SLG  P+  Y+TQDG+A+G+LHA+KRNI V  SAGN    P +V NVAPWI TVGASSID
Sbjct  301   SLGSQPRTTYYTQDGIAIGSLHALKRNIVVACSAGNDGPTPSTVGNVAPWIITVGASSID  360

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGST--TIPGFCRQDTLSPEK  1238
             RVFS+P++LGN ++V+G++VT I++    PLVYAGDVEI G+T     G C   TLS   
Sbjct  361   RVFSSPIMLGNGMIVEGQTVTPIRRNRLHPLVYAGDVEIRGTTASNTTGGCFPGTLSRNL  420

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKY  1058
             V+GKVV C    +  ++EV+RAGG A ILG+  +EIQV  FL + T  F+  G   I  Y
Sbjct  421   VRGKVVLCRGSSMQASMEVKRAGGVAAILGTPFNEIQVTPFLDSTTVAFS-YGLHTIRTY  479

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T KNP+ATL+PG+T+ G KP+P MAPFTS GP+  +PNILKPDITAPGLNILAAWSEA
Sbjct  480   IQTEKNPMATLLPGQTLIGTKPAPVMAPFTSKGPNIVDPNILKPDITAPGLNILAAWSEA  539

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSPL+ PED R VKYN+ SGTSMSCPHVSAV+ALLK+IHPDWS AAI+SA+MTT+T  NV
Sbjct  540   SSPLKLPEDRRVVKYNMQSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMTTSTINNV  599

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
              G  I +A G+ A PF YGAGH +PS+A DPGL+YD+TY DYLL++CS    +LD S+ C
Sbjct  600   VGRPITNATGDDANPFEYGAGHFRPSRAVDPGLIYDATYEDYLLYLCSQ-NISLDSSFNC  658

Query  517   PKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTELK  338
             P++    SNLNYPSLAIA +KGS  V+R VTNVG  ++TY + +++P GY V I P  L+
Sbjct  659   PEEVPEASNLNYPSLAIANIKGSRTVRRVVTNVGKDSSTYILAMRSPPGYVVDIIPKTLR  718

Query  337   FMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             F ++GEK SF ++V+ +SV++  EF FGWY WSDG+H+V+SPI  SSA
Sbjct  719   FSKLGEKLSFNITVRAQSVERRNEFAFGWYTWSDGVHVVQSPIAASSA  766



>ref|XP_009768078.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/588 (60%), Positives = 444/588 (76%), Gaps = 6/588 (1%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK++GARY++K YEA FGP+N T DFRS RD++GHGTH A+TVGGR+VANASA
Sbjct  184   FNSSHCNRKLVGARYYLKSYEANFGPLNETRDFRSPRDVNGHGTHAAATVGGRRVANASA  243

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G ATGGAP  RLAIYK CW VP   + +   C  DD++AAFD A+ADGV V+SV
Sbjct  244   IGGFAKGTATGGAPNVRLAIYKVCWPVPDQSLAEGNTCLTDDIIAAFDDAIADGVDVLSV  303

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             SLG  P+  Y+TQ+G+A+G+LHA+KRNI V  SAGN    P +V NVAPWI TVGASSID
Sbjct  304   SLGSQPRTTYYTQNGIAIGSLHALKRNIVVACSAGNDGPTPSTVGNVAPWIITVGASSID  363

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGST--TIPGFCRQDTLSPEK  1238
             RVFS+P++LGN ++V+G++VT I++    PLVYAGDVEI G+T     G C   TLS   
Sbjct  364   RVFSSPIMLGNGMIVEGQTVTPIRRSRLHPLVYAGDVEIRGTTASNTTGLCFPGTLSRNL  423

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKY  1058
             V+GKVV C    +  ++EV+RAGG A ILG+  +EIQV  FL + T  F+  G + I  Y
Sbjct  424   VRGKVVVCRGSSMQASMEVKRAGGVAAILGTPFNEIQVTPFLDSTTVAFS-YGLNTIRTY  482

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T KNP+ATL+PG+T+ G K +P MAPFTS GP+  +PNILKPDITAPGLNILAAWSEA
Sbjct  483   IQTEKNPMATLLPGQTLIGTKSAPVMAPFTSKGPNIVDPNILKPDITAPGLNILAAWSEA  542

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSPL  PED R VKYN+ SGTSMSCPHVSAV+ALLK+IHPDWS AAI+SA+MTT+T  N+
Sbjct  543   SSPLNLPEDRRVVKYNMQSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMTTSTINNL  602

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
              G  I +A G  A PF YGAGH +PS+A DPGL+YD+TY DYLL++CS    +LD S+ C
Sbjct  603   VGRPITNATGNDANPFEYGAGHFRPSRAVDPGLIYDATYEDYLLYLCSQ-NISLDSSFNC  661

Query  517   PKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTELK  338
             P++    SNLNYPSLAIA +KGS  V+R VTNVG  N+TY + +++P GY V I P  L+
Sbjct  662   PEEVPEASNLNYPSLAIANIKGSRTVRRVVTNVGKDNSTYVLAMRSPPGYDVDIIPKTLR  721

Query  337   FMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             F ++GEK SF ++++ +SV++  EF FG Y WSDG+H+V+SPI  SSA
Sbjct  722   FSKLGEKLSFNITIRAQSVERRNEFAFGRYTWSDGVHVVQSPIAASSA  769



>ref|XP_006355621.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=758

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/590 (60%), Positives = 442/590 (75%), Gaps = 9/590 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KGYEA  GP+N T DFRS RD+ GHGTHTA TVGGR+VANASA
Sbjct  170   FNSSHCNRKLIGARYYLKGYEAAAGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASA  229

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G ATGGAP  RLAIYK CW VP   + +   C  DD+LAAFD A+ADGV V+S+
Sbjct  230   IGGFAKGTATGGAPNVRLAIYKVCWPVPDQSLAEGNACATDDILAAFDDAIADGVHVLSI  289

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             SLG LP+  Y+T++ +A+G+LHA+K+NI V  SAGN    P +V NVAPWI TVGASSID
Sbjct  290   SLGSLPKSTYYTENAIAIGSLHAVKKNIVVACSAGNDGPTPSTVGNVAPWIITVGASSID  349

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEI--PGSTTIPGFCRQDTLSPEK  1238
             RVFS+P++LGN ++V+G++VT I+++   PLVYAGDVEI    +    G C   TLS   
Sbjct  350   RVFSSPIMLGNGMIVEGQTVTPIRRRRLHPLVYAGDVEIRGTTTNNTSGTCLPGTLSRNL  409

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKY  1058
             V+GKVV C+    + ++EV+RAGG A ILG+  +EIQV  FL T T +F+ S  + +L Y
Sbjct  410   VRGKVVLCINNLRAASMEVKRAGGVAAILGNRFNEIQVTPFLDTTTVVFSYS-LNTLLTY  468

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T KNP+ATL+PG T+ G KP+P MA FTS GP+  +PNILKPDITAPG NILAAWSEA
Sbjct  469   IRTEKNPMATLVPGNTLIGTKPAPVMASFTSKGPNIVDPNILKPDITAPGFNILAAWSEA  528

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSPL+ PED R VKYN+ SGTSMSCPHVSAV+ALLK+IHPDWS AAI+SA+MTT+T  NV
Sbjct  529   SSPLKMPEDRRVVKYNMQSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMTTSTINNV  588

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
              G  IK+A G+ A PF YG+GH +PS+A DPGLVYD+TY DYLL++CS    +LD S+ C
Sbjct  589   VGRPIKNATGDDANPFEYGSGHFRPSRAVDPGLVYDATYTDYLLYLCSQ-NISLDSSFSC  647

Query  517   PKKASSPSNLNYPSLAIAQLKGSM-VVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTEL  341
             P+K  + SNLNYPSLAIA ++GS+  V R VTNVG  N+TY + V++P GY V I P  L
Sbjct  648   PEKVPTASNLNYPSLAIANMRGSIRTVTRVVTNVGKDNSTYVLGVRSPPGYVVDIVPKSL  707

Query  340   KFMEVGEKQs--ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              F ++GEK S    +     SV++  EF FGWY W+DG+H+V+SPI VSS
Sbjct  708   HFSKLGEKHSFNITIIRAQSSVERRNEFSFGWYTWNDGVHVVRSPIAVSS  757



>ref|XP_006355566.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/591 (60%), Positives = 440/591 (74%), Gaps = 9/591 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +SHCNRK+IGARY++KGYEA  GP+N T DFRS RD+ GHGTHTA TVGGR+VANASA
Sbjct  188   FNASHCNRKLIGARYYLKGYEAAAGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASA  247

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G ATGGAP  RLAIYK CW  P   + +   C  DD+LAAFD A+ADGV V+S+
Sbjct  248   IGGFAKGTATGGAPNVRLAIYKVCWPAPDQSLAEGNICATDDILAAFDDAIADGVHVLSI  307

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             SLG LP+  Y+T++ +A+G+LHA+K+NI V  SAGN    P +V NVAPW+ TVGAS+ID
Sbjct  308   SLGSLPKSTYYTENAIAIGSLHAVKKNIVVACSAGNDGPTPSTVANVAPWVITVGASTID  367

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGST--TIPGFCRQDTLSPEK  1238
             RVFS+P++LGN ++V+G+++T+I+++   PLVYAGDVEI G+T     G C   TLS   
Sbjct  368   RVFSSPIMLGNGMIVEGQTITQIRRRRLHPLVYAGDVEIRGTTASNTTGACLPGTLSRNL  427

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKY  1058
             V+GKVV CL   +  ++EV+RAGG A ILG+  +EIQV  FL   T  F   G + +L Y
Sbjct  428   VRGKVVLCLNSDIQASMEVKRAGGVAAILGNPFNEIQVIPFLNPTTVTF-LDGLNTLLTY  486

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T K+P ATL+PG T+ G K +P MAPF+S GP+  +PNILKPDITAPG NILAAWSEA
Sbjct  487   IRTEKHPTATLVPGNTMIGTKTAPVMAPFSSKGPNVVDPNILKPDITAPGFNILAAWSEA  546

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSPL  PEDHR VKYNI SGTSMSCPHVSAV+ALLK+IHPDWS AA++SA+MTT+T  NV
Sbjct  547   SSPLNIPEDHRVVKYNIDSGTSMSCPHVSAVIALLKSIHPDWSSAAVRSALMTTSTINNV  606

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
              G  IK+A G+ A PF YG+GH +PSKAADPGL+YD+TY DYLL++CS      D SY C
Sbjct  607   VGRPIKNATGDDANPFEYGSGHFRPSKAADPGLIYDATYTDYLLYLCSQ-NIRPDLSYNC  665

Query  517   PKKASSPSNLNYPSLAIAQLKG-SMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTEL  341
             P K  + SNLNYPSLAIA ++G S  V R VTNVG  N+TY V V++P GY+V I P  L
Sbjct  666   PAKVPAASNLNYPSLAIANMRGSSKTVTRVVTNVGKDNSTYVVAVRSPPGYAVDIVPKSL  725

Query  340   KFMEVGEKQsffvs--vkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             +F ++GEK SF ++      SV +  EF FG Y WSDG+H+V+SPI VSS+
Sbjct  726   RFSKLGEKHSFNITIIRAQSSVDRRNEFSFGRYTWSDGVHVVQSPIAVSSS  776



>emb|CDP14569.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/591 (62%), Positives = 440/591 (74%), Gaps = 12/591 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRKIIGARY++K YEA  GPV    +FRS RD +GHGTHTAST+GGR+V NAS+
Sbjct  181   FNSSHCNRKIIGARYYLKHYEAEHGPVKEKMEFRSPRDKNGHGTHTASTIGGRRVPNASS  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQV-PFDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFANG A+GGAPL RLAIYK CWQ  P D++    C D D LAAFD A+ DGV VIS+
Sbjct  241   LGGFANGTASGGAPLVRLAIYKICWQPDPLDEV---LCPDGDTLAAFDDAIKDGVHVISL  297

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G      Y  +DG A+G+LHA+KR+I VV SAGN    P SV+NVAPW+ +VGASSID
Sbjct  298   SIGGNTSSPY-AEDGTAIGSLHALKRDIIVVCSAGNSGPTPSSVSNVAPWLISVGASSID  356

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTT--IPGFCRQDTLSPEK  1238
             R+F + ++LGN L+V+G +VT  +K +  PLVYA DVEIPG TT    G C   TLS + 
Sbjct  357   RIFQSTIVLGNGLIVQGRTVTPFRKTKKYPLVYAVDVEIPGKTTNLTTGGCFPGTLSKKL  416

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGS-IGSEIQVES-FLITATNIFNPSGTDAIL  1064
             VKGKVVFC  G + Q LEV RAGG A I G+  G +  VES FL+  T +   +    I+
Sbjct  417   VKGKVVFCWVGYIYQALEVRRAGGVAAIFGNPYGGKGVVESPFLLPGTTVLQ-NDRATIV  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YIL N+NP ATL PG+TI G  P+P MAPFT+LGP+  EPNILKPDITAPGLNILAAW+
Sbjct  476   SYILNNENPTATLFPGRTIIGTGPAPFMAPFTALGPNGIEPNILKPDITAPGLNILAAWT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EAS P +  +DHR VKYNI SGTSMSCPHVSAV ALLKAIHPDWS AAI+S++MTTA   
Sbjct  536   EASPPTQLLQDHRVVKYNIASGTSMSCPHVSAVAALLKAIHPDWSSAAIRSSLMTTARRV  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSY  524
             N     I DA G +A PFHYGAGH QPSKAADPGLVYD++Y DYLLF+CSS    LDPS+
Sbjct  596   NNVQIPITDAAGNIATPFHYGAGHFQPSKAADPGLVYDASYTDYLLFLCSSGTAFLDPSF  655

Query  523   KCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTE  344
             KCPK    PS+LNYPSLAIA+L G+M V RTVTNVG+ N+TY+V +  P GY+VKI PT+
Sbjct  656   KCPKHVPPPSDLNYPSLAIAKLNGNMTVSRTVTNVGTGNSTYTVIIVPPPGYTVKILPTK  715

Query  343   LKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGI-HMVKSPIVVSSA  194
             L F + GEKQSF ++VKV +  K  +FEFGWY WSDG  H+V+SPIVVS+A
Sbjct  716   LYFSKTGEKQSFSITVKVAASIKETKFEFGWYAWSDGAGHVVRSPIVVSAA  766



>ref|XP_006355622.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/589 (59%), Positives = 438/589 (74%), Gaps = 8/589 (1%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +SHCNRK+IGARY++KGYEA  GP+N T DFRS RD+ GHGTHTA TVGGR+VANASA
Sbjct  170   FNASHCNRKLIGARYYLKGYEAIAGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASA  229

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G ATGGAP  RLAIYK CW VP   + +   C  DD+LAAFD A+ADGV V+S+
Sbjct  230   IGGFAKGTATGGAPNVRLAIYKVCWPVPDQSLAEGNACVMDDILAAFDDAIADGVHVLSI  289

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             SLG LP+  Y+T++ +A+G+LHA+K+NI V  SAGN    P +V NVAPWI TVGAS+ID
Sbjct  290   SLGSLPKSTYYTENAIAIGSLHAVKKNIVVSCSAGNDGPTPSTVANVAPWIITVGASTID  349

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGST--TIPGFCRQDTLSPEK  1238
             RVFS+P+LLGN ++V+G++ T I+++   PLVYAGDVEI G+T     G C   TLS + 
Sbjct  350   RVFSSPILLGNGMIVEGQTATPIRRRRLHPLVYAGDVEIRGTTASNTTGTCLPGTLSRKL  409

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKY  1058
             V+GKVV C+   +  ++EV+RAGG A ILG+  +EIQV  FL   T +F+ S    I+ Y
Sbjct  410   VRGKVVLCINSDIQASMEVKRAGGVAAILGNSFNEIQVTPFLDPTTVVFSYS-LITIMTY  468

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T K P+ATL+PG T+ G K +P MA F+S GP+  + NILKPDITAPG NILAAWSEA
Sbjct  469   IRTEKYPMATLVPGNTLIGTKTAPVMAHFSSKGPNIVDLNILKPDITAPGFNILAAWSEA  528

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSPL  PED R VKYNI SGTSMSCPHVSAV+ALLK+IHPDWS AA++SA+MTT+T  NV
Sbjct  529   SSPLNIPEDRRVVKYNIDSGTSMSCPHVSAVIALLKSIHPDWSSAAVRSALMTTSTINNV  588

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
              G  IK+A G+ A PF YG+GH +PS+A DPGLVYD+TY DYLL++CS    +LD S+ C
Sbjct  589   VGRPIKNATGDDANPFEYGSGHFRPSRAVDPGLVYDATYTDYLLYLCSQ-NVSLDSSFSC  647

Query  517   PKKASSPSNLNYPSLAIAQLKGS-MVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTEL  341
             P+K  + SNLNYPSLAIA ++GS   V+R VTNVG  N+TY + V++P GY V I P  L
Sbjct  648   PEKVPTASNLNYPSLAIANIRGSGRTVRRVVTNVGRDNSTYFLVVRSPPGYVVDIVPKSL  707

Query  340   KFMEVGEKQs-ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             +F ++GEK S         SV++  EF FGWY WSDG+H+V+SPI VSS
Sbjct  708   RFNKLGEKSSFNITVRAQSSVERRNEFSFGWYTWSDGVHVVRSPIAVSS  756



>ref|XP_004232982.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=773

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/590 (59%), Positives = 438/590 (74%), Gaps = 10/590 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +SHCNRK+IGARY++KGYEA  GP+N T DFRS RD+ GHGTHTA TVGGR+VANASA
Sbjct  188   FNASHCNRKLIGARYYLKGYEAAVGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASA  247

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G A GGAP  RLAIYK CW VP   +     C  DD+LAAFD A+ADGV V+S+
Sbjct  248   IGGFAKGTAIGGAPNVRLAIYKVCWPVPDQSLADGNACATDDILAAFDDAIADGVHVLSI  307

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             SLG LP   Y+T++ +A+G+LHA+K+NI V  SAGN    P +V NVAPW+ TVGASSID
Sbjct  308   SLGSLPTSTYYTENPIAVGSLHAVKKNIVVSCSAGNDGPTPSTVGNVAPWVITVGASSID  367

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGST--TIPGFCRQDTLSPEK  1238
             RVFS+P++LGN ++V+G++VT I+++   PLVYAGDVEI G T     G C   TLS   
Sbjct  368   RVFSSPIMLGNGMIVEGQTVTPIRRRRLHPLVYAGDVEIRGITASNTTGTCLPGTLSRNL  427

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKY  1058
             V+GKVV C   G+  ++EV+RAGG A ILG+  +EI+V  +L   T +F+ S    IL Y
Sbjct  428   VRGKVVLCGNTGIQASMEVKRAGGVAAILGNPFNEIKVTPYLDPTTVVFSYS-LATILTY  486

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T KNP+ATL+PG T+ G KP+P MA FTS GP+  +PNILKPDITAPG NILAAWSEA
Sbjct  487   IRTEKNPMATLVPGNTLIGTKPAPVMASFTSKGPNVVDPNILKPDITAPGFNILAAWSEA  546

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSPL+ PED R VKYN+ SGTSMSCPHVS V+ALLK++HPDWS AAI+SA+MTT+T  NV
Sbjct  547   SSPLKMPEDRRVVKYNMQSGTSMSCPHVSGVIALLKSVHPDWSSAAIRSALMTTSTMNNV  606

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
              G+ IK+A G+ A PF YG+GH +PS+A DPGLVYD+TY DYLL++C+    +LD S+ C
Sbjct  607   VGQPIKNATGDDASPFEYGSGHFRPSRAVDPGLVYDATYTDYLLYLCTQ-NVSLDSSFSC  665

Query  517   PKKASSPSNLNYPSLAIAQLKGSMV--VKRTVTNVGSANTTYSVEVKAPTGYSVKISPTE  344
             P+K  + SNLNYPSLAIA ++G  +  V R VTNVG  N+TY + V +P GY V I P  
Sbjct  666   PEKIPTASNLNYPSLAIANMRGGSIRSVTRVVTNVGKDNSTYVLGVSSPPGYVVDIVPKR  725

Query  343   LKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             L F ++GEK     ++ + SV++  +F FGWY WSDG+H+V+SPI VSSA
Sbjct  726   LHFSKLGEKH--SFNITITSVQRRNDFSFGWYTWSDGVHVVRSPIAVSSA  773



>ref|XP_011102273.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=776

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/591 (62%), Positives = 433/591 (73%), Gaps = 11/591 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK++GARY++K YEA FGP++   DFRS RDI+GHGTHT+ST+GGR+V NA+A
Sbjct  190   FNSSHCNRKLVGARYYLKSYEANFGPLDPKLDFRSPRDINGHGTHTSSTIGGRRVRNAAA  249

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGF  G ATGGAPL RLAIYK CW +P     +   C DDD+LAAFD A+ADGVQVISV
Sbjct  250   IGGFGYGTATGGAPLVRLAIYKVCWPIPGQTPAEGNTCLDDDMLAAFDDAIADGVQVISV  309

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G      Y  QDG+A+G+LHA+KRNI V  SAGN    P++VTNVAPWI TVGASSID
Sbjct  310   SIGRNTSTPYI-QDGIAIGSLHAVKRNIVVACSAGNSGPTPFTVTNVAPWIITVGASSID  368

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIP--GFCRQDTLSPEK  1238
             RVFS+PVLLGN   V+G+S+T  KK  T PLVYA DVEIPG+TT    G C   TLSP  
Sbjct  369   RVFSSPVLLGNGAQVQGQSITPFKKG-TYPLVYAADVEIPGTTTTLTNGLCLNGTLSPRL  427

Query  1237  VKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQV--ESFLITATNIFNPSG-TDAI  1067
             V+GK VFC  G   Q LEV+RAGG A +LG++   I V    +LI  T +  PS  T  I
Sbjct  428   VRGKAVFCWRGDTFQALEVQRAGGVATVLGNVFDGIGVIGRPYLIPGTVV--PSNQTLGI  485

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               YI T+ NP ATL P KT+ G KP+P MA FTS GP++ EPNILKPDITAPGLNILAAW
Sbjct  486   YNYIATHLNPTATLTPAKTLIGTKPAPFMAAFTSRGPNFIEPNILKPDITAPGLNILAAW  545

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             SEASSPL  P D R VK+ I SGTSM+CPHV+AV ALLKAIHPDWS AAI+SA+MTTA  
Sbjct  546   SEASSPLNVPSDRRVVKFQIDSGTSMACPHVAAVAALLKAIHPDWSSAAIRSALMTTAKL  605

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPS  527
              N  G+ I D+ G  A PF YGAGHIQPSKAADPGLVYD++Y DYLLF+CSS    LDPS
Sbjct  606   SNNVGKPITDSLGNTATPFQYGAGHIQPSKAADPGLVYDASYTDYLLFLCSSSSNLLDPS  665

Query  526   YKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPT  347
             + CP+   SPSN NYPSLAI+ L+  + V+R+VTNVG  N+TYSV +  P GYSV+ISP 
Sbjct  666   FTCPQVLPSPSNFNYPSLAISNLRSVLTVRRSVTNVGMGNSTYSVTINPPPGYSVRISPA  725

Query  346   ELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              L F   GEKQ+F ++V+     +   F FGWY WSDGIH+V+SPI VS A
Sbjct  726   TLYFGAAGEKQNFSITVRAGRAARRNVFAFGWYSWSDGIHLVRSPISVSKA  776



>emb|CDP14572.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/576 (60%), Positives = 418/576 (73%), Gaps = 10/576 (2%)
 Frame = -2

Query  1903  YHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANGVATGGAP  1724
             Y    YEA  GPV    +FRS RD SGHGTHTAST+GGR+V NAS+LGGFANG A+GGAP
Sbjct  175   YKKSHYEAELGPVKEKMEFRSPRDKSGHGTHTASTIGGRRVPNASSLGGFANGTASGGAP  234

Query  1723  LTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLPQDNYFTQDG  1544
               RLAIYK CWQ   D +    C D D LAAFD A+ DGV VIS+S+G      Y  +DG
Sbjct  235   FVRLAIYKVCWQP--DPLNVVVCPDGDTLAAFDDAIKDGVHVISLSIGGNTSFPY-AEDG  291

Query  1543  VALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFSAPVLLGNNLLV  1367
              A+G+LHA+KR+I VV +AGN    P SV NVAPW+ +VGASSIDR+F + ++LGN L+V
Sbjct  292   TAIGSLHALKRDIIVVCAAGNSGPTPSSVANVAPWLISVGASSIDRIFQSTIVLGNGLIV  351

Query  1366  KGESVTEIKKQETLPLVYAGDVEIPGSTT--IPGFCRQDTLSPEKVKGKVVFCLTGGLSQ  1193
             +G +VT  +K +  PLVYA  VEIPG TT    G+C   TLS + VKGKVVFC  G +SQ
Sbjct  352   QGRTVTPFRKTKKYPLVYAVHVEIPGKTTNLTTGWCFPGTLSKKHVKGKVVFCRVGFISQ  411

Query  1192  TLEVERAGGAAVILGS--IGSEIQVESFLITATNIFNPSGTDAILKYILTNKNPVATLIP  1019
              LEV RAGG A I G+  +G  +    FL+  T +   +    I+ YIL N+NP ATL P
Sbjct  412   ALEVRRAGGVAAIFGNPYVGKGVYEIPFLLPGTTVLQ-NDRATIVSYILNNENPTATLFP  470

Query  1018  GKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEASSPLEQPEDHRSV  839
             G+TI G  P+P MAPFT+LGP+  EPNILKPDITAPGLNILAAW+EAS P    +DHR V
Sbjct  471   GRTIIGTGPAPFMAPFTALGPNGIEPNILKPDITAPGLNILAAWTEASPPTHLHQDHRVV  530

Query  838   KYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNVKGEAIKDAYGEVA  659
             KYNI SGTSMSCPH SAV ALLKAIHPDWS AAI+S++MTTA   N     I DA G +A
Sbjct  531   KYNIASGTSMSCPHASAVAALLKAIHPDWSSAAIRSSLMTTARRVNNVQIPITDAVGNIA  590

Query  658   GPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKCPKKASSPSNLNYP  479
              PFHYGAGH QPSKAADPGLVYD++Y DYLLF+CSS    LDPS+KCPK    PS+LNYP
Sbjct  591   TPFHYGAGHFQPSKAADPGLVYDASYTDYLLFLCSSGTAFLDPSFKCPKHVPPPSDLNYP  650

Query  478   SLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvs  299
             SLAIA+L G+M V RTVTNVG+ N+TY+V +  P GY+V+I PT+L F ++GEKQSF ++
Sbjct  651   SLAIAKLNGTMTVSRTVTNVGTGNSTYTVSIVPPPGYTVEILPTKLYFSKIGEKQSFSIT  710

Query  298   vkvesvkkvgefeFGWYKWSDGI-HMVKSPIVVSSA  194
             VKV +  K  +FEFGWY WSDG+ H+V SPIVVS+A
Sbjct  711   VKVAASIKETKFEFGWYTWSDGVGHVVSSPIVVSAA  746



>emb|CDP14563.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/590 (58%), Positives = 420/590 (71%), Gaps = 13/590 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FTSS+CNRK+IGARY+ K YEA +GPVN   D+RS+RD  GHGTHTASTVGGR+VAN S+
Sbjct  164   FTSSNCNRKLIGARYYAKEYEAIYGPVNSQVDYRSARDKDGHGTHTASTVGGRRVANISS  223

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             +GGFANG  TGGAPL RLA YK CW++P ++     C D  ++ AFD A+ DGVQVISVS
Sbjct  224   IGGFANGTVTGGAPLVRLAAYKVCWKLP-NETSKDACYDASIIKAFDDAIQDGVQVISVS  282

Query  1585  LGLLPQDNY-FTQDGVALGALHAMKRNIAVVGSAGNYREPYS--VTNVAPWIFTVGASSI  1415
             +G      Y +  DG+A+G+LHA K NI V  SAGN     S  VTNVAPW+ TVGASSI
Sbjct  283   IG--GDRGYPYASDGIAIGSLHASKNNIVVACSAGNNGRNGSSTVTNVAPWLITVGASSI  340

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTT--IPGFCRQDTLSPE  1241
             DR+F + ++LGN L ++G+++T   +    PLVYAGDVE+PG+T+    GFC   TLS  
Sbjct  341   DRMFPSTIVLGNGLNIQGQTITPFSQMRNQPLVYAGDVEVPGTTSSSTRGFCLNGTLSRS  400

Query  1240  KVKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEI-QVESFLITATNIFNPSGTDAIL  1064
              V+GKVV C  GG+ Q+ EV RAGG A +LG    +I QV   L+    I      +AI 
Sbjct  401   LVRGKVVICRFGGVDQSAEVGRAGGVAAVLGKPPIDIFQVAPLLLPGLTITYADVNNAI-  459

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              Y  T++NP  TL PG T+    P+P MA FTSLGP+  EPNILKPDITAPGLNILAAWS
Sbjct  460   SYTRTSRNPTVTLNPGTTVVNVSPAPFMAVFTSLGPNGIEPNILKPDITAPGLNILAAWS  519

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EAS P   P D+R VKYNI+SGTSMSCPHVSAV AL+KAIHPDWS AAI+SAIMTTA T 
Sbjct  520   EASPPTSSPYDNRIVKYNIVSGTSMSCPHVSAVAALIKAIHPDWSSAAIRSAIMTTARTT  579

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSY  524
             N  G  I DA G VA PFHYG+GH QPSKAADPGLVY++TY DYLLF+C +    +    
Sbjct  580   NNVGNPITDARGNVANPFHYGSGHFQPSKAADPGLVYNATYNDYLLFLCYARSRLVS---  636

Query  523   KCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTE  344
              CP    SPSNLNYPSLAIA L   + V+R+VTNVG+AN+TY V+++ P GYSV I P+ 
Sbjct  637   NCPNVVPSPSNLNYPSLAIANLNRPITVRRSVTNVGAANSTYQVKIEQPLGYSVNIFPST  696

Query  343   LKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             L+F ++GE +SF ++V+  +  +   F FG + WSDG+H+V+SPI VSS+
Sbjct  697   LRFSQIGEIKSFNITVQATNTAQRNVFTFGSFTWSDGVHLVRSPIAVSSS  746



>gb|EYU28147.1| hypothetical protein MIMGU_mgv1a018442mg [Erythranthe guttata]
Length=773

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/590 (57%), Positives = 420/590 (71%), Gaps = 13/590 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK++GARY++KG+EA FGP++ T +FRS+RD  GHGTHTAST GGR V  A+A
Sbjct  188   FNSSHCNRKLVGARYYLKGFEANFGPLDPTINFRSARDALGHGTHTASTAGGRNVPGAAA  247

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             +GGF  G ATGGAPL RLA+YK CW +P      + C DDD+LAAF+ A+ DGV V+S+S
Sbjct  248   IGGFGVGNATGGAPLVRLAMYKVCWNIPAVKGGGSSCLDDDMLAAFEDAITDGVDVLSIS  307

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             +G      Y  + G+A+GALHA+KRNI VV SAGN   +P++VTN++PWI TVGASSIDR
Sbjct  308   IGGRTGKPY-AESGIAVGALHAVKRNIVVVCSAGNSGPDPFTVTNISPWIITVGASSIDR  366

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTT--IPGFCRQDTLSPEKV  1235
             VFS+PV+LGN ++V+G+SVT   K  T PLVYA DVEIPG+TT    G C   TLSP   
Sbjct  367   VFSSPVVLGNGMVVEGQSVTPFVKG-TYPLVYASDVEIPGTTTSDTSGRCFAGTLSPALT  425

Query  1234  KGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQV--ESFLITATNIFNPSGTDAILK  1061
              GK VFC +G  +Q LEV+RAGG AV+LG+  + + V    +LI  T I +  G  ++ +
Sbjct  426   VGKAVFCWSGDTTQALEVQRAGGVAVVLGNRYNGVGVVGRPYLIPGTVILS-GGKWSVYR  484

Query  1060  YILTNKNPVATLIPGKTIFG---AKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             Y   +  P ATL P  T+ G   + P+P MA FTS GP+  EPNILKPDITAPGLNILAA
Sbjct  485   YTQNDLAPTATLTPAITLIGGNTSSPTPFMAAFTSRGPNVIEPNILKPDITAPGLNILAA  544

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             WSEA+SPL  P D+R VK+ I SGTSM+CPHV+ V AL+KA+HPDWS AAI+SA+MTTAT
Sbjct  545   WSEAASPLRVPSDNRVVKFQIDSGTSMACPHVAGVAALIKAVHPDWSSAAIRSALMTTAT  604

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDP  530
               N  G+ I D  G  A P  YGAGHIQP+KAADPGLVYD++Y DYLLF+CS+ G  LDP
Sbjct  605   ANNNLGKLITDVVGNFATPLQYGAGHIQPAKAADPGLVYDASYEDYLLFLCSTTGNLLDP  664

Query  529   SYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISP  350
             ++ CP    SPSN NYPS+ I +L G + V+RT+TNVG  N TY+V V  P G+SV ISP
Sbjct  665   TFVCPLILPSPSNFNYPSVTITKLTGVVTVQRTLTNVGVGNATYTVTVATPPGFSVTISP  724

Query  349   TELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               L F   GEKQ    S+ V+++       FGW+ WSDGIH V SPI++S
Sbjct  725   ATLFFSATGEKQ--SFSITVQAMVIAPVDAFGWFYWSDGIHQVISPILLS  772



>gb|EYU28146.1| hypothetical protein MIMGU_mgv1a001696mg [Erythranthe guttata]
Length=772

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/589 (58%), Positives = 418/589 (71%), Gaps = 11/589 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             + SSHCNRK++GARY+++GYEA FGP++ T DFRS+RD  GHGTHTASTVGGR V NA+A
Sbjct  188   YDSSHCNRKLVGARYYLRGYEANFGPLDPTIDFRSARDSDGHGTHTASTVGGRNVPNAAA  247

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             +GGF  G ATGGAPL RLA+YK CW  P D      C DDD+LAA+D A+ADGV +ISVS
Sbjct  248   VGGFGIGNATGGAPLVRLAVYKVCWNKPVDRGGGGTCLDDDMLAAYDDAIADGVDIISVS  307

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             +G     +Y   DG A+GALHA+KRNI VV SAGN    P+SVTN+APWI TVGASSIDR
Sbjct  308   IGSTTGKSY-VDDGGAIGALHAVKRNIVVVCSAGNSGPRPFSVTNIAPWIITVGASSIDR  366

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTT--IPGFCRQDTLSPEKV  1235
             VFS+PV+LGN ++ +G+S+T   +  T PLVYA DVEIPG+TT    G C   TLSP  V
Sbjct  367   VFSSPVVLGNGVVAEGQSITPFVRG-TFPLVYAADVEIPGTTTNLTFGLCNPGTLSPALV  425

Query  1234  KGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVES--FLITATNIFNPSGTDAILK  1061
              GK VFC  G  ++ LEV+RAGG AV+LG+    + V    ++I A+ + +      I  
Sbjct  426   AGKAVFCWRGSTAEALEVQRAGGVAVVLGNPDDGVGVSQTPYVIPASVVLSDQKLK-IFN  484

Query  1060  YILTNKNPVATLIPGKTIFG-AKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
             Y  +   P ATL P +T+ G + P+P MAPFTS GP+  EPN+LKPDITAPG NILAAWS
Sbjct  485   YTQSTATPTATLTPARTLIGGSSPTPFMAPFTSRGPNVIEPNLLKPDITAPGFNILAAWS  544

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             E +SP   P D+R  K+NIISGTSM+CPHV+ V AL+KAIHPDWS AAI+SA+MTT +  
Sbjct  545   EVASPFGVPSDNRVAKFNIISGTSMACPHVAGVAALIKAIHPDWSSAAIRSALMTTTSPV  604

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSY  524
             N  G  I DA G  A P  YG+GHIQPSKAADPGLVYD+TY DYLLF+CSSIG  LDP++
Sbjct  605   NNLGNLITDALGNFATPLQYGSGHIQPSKAADPGLVYDATYSDYLLFLCSSIGNFLDPTF  664

Query  523   KCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTE  344
              CP    S SN NYPSLAI  L G++ V+RTVTNVG+ NTTY+V    P GY+  ISP+ 
Sbjct  665   TCPIVPPSASNFNYPSLAITNLIGAVTVERTVTNVGAGNTTYTVSTSVPRGYTFTISPST  724

Query  343   LKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             L F   GEKQSF ++V   +      F   WY W DG H+V+SP+V+++
Sbjct  725   LHFSATGEKQSFSITVAAAAGAPGNAFG--WYTWFDGTHVVRSPVVINT  771



>gb|EYU28148.1| hypothetical protein MIMGU_mgv1a026974mg [Erythranthe guttata]
Length=726

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/590 (57%), Positives = 411/590 (70%), Gaps = 20/590 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KG+EA FGP++ T D RS+R+I GHGTHTAST GGR V  A+ 
Sbjct  148   FNSSHCNRKLIGARYYLKGFEANFGPLDPTIDVRSAREIDGHGTHTASTAGGRNVPGAAC  207

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
                     ATGGAPL RLA+YK CW +P      + C DDD+LAAFD A+ DGV VISVS
Sbjct  208   -------NATGGAPLARLAMYKVCWNIPAAQGGGSTCLDDDMLAAFDDAINDGVDVISVS  260

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             +G      Y  + G+A+GALHA+ RNI VV SAGN   + ++VTN++PWI TVGASSIDR
Sbjct  261   IGGKTGKPY-AESGIAVGALHAVSRNIVVVCSAGNSGPDSFTVTNISPWIITVGASSIDR  319

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTT--IPGFCRQDTLSPEKV  1235
             VFS+PV+LGN ++V+G+S+T   K  T PLVYA DVEIPG+TT    G C   TLSP   
Sbjct  320   VFSSPVVLGNGMVVEGQSITPFVKG-TYPLVYASDVEIPGTTTDDTSGLCLAGTLSPALT  378

Query  1234  KGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVES--FLITATNIFNPSGTDAILK  1061
              GK VFC +GG  Q LEV+RAGG AV+LG+    + V S  FLI  T I +  G  ++ +
Sbjct  379   VGKAVFCWSGGTRQALEVQRAGGVAVVLGNNHDGVGVSSRPFLIPGTVILS-DGKLSVYE  437

Query  1060  YILTNKNPVATLIPGKTIFG---AKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             Y  T+  P ATL P  T+ G   + P+P MAPFTS GP+  EPNILKPDITAPG NILAA
Sbjct  438   YTQTDLAPTATLTPAITLIGGTTSTPTPFMAPFTSRGPNVIEPNILKPDITAPGFNILAA  497

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             WSE SSP   P D+R  K+NIISGTSMSCPHV+ V ALLKA+HPDWS AAI+SA+MTTAT
Sbjct  498   WSEVSSPFGVPTDNRVAKFNIISGTSMSCPHVAGVAALLKAVHPDWSSAAIRSALMTTAT  557

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDP  530
               N  G+ I D  G  A P  +GAGHIQP+KAADPGLVYD++Y DYLLF+CS+ G  LDP
Sbjct  558   ANNNLGKLITDVEGNYATPLQFGAGHIQPAKAADPGLVYDASYEDYLLFLCSTTGNLLDP  617

Query  529   SYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISP  350
             ++ CP    SPSN NYPS+ I +L G + V+RT+TNVG  N TY+V V  P G+SV ISP
Sbjct  618   TFACPLILPSPSNFNYPSVTITKLTGVVTVQRTLTNVGVGNATYTVTVATPPGFSVTISP  677

Query  349   TELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               L F   GEKQ    S+ V++ +      FGW+ WSD IH V SPI++S
Sbjct  678   ATLFFSATGEKQ--SFSITVQATEIAPVDAFGWFYWSDEIHQVVSPILLS  725



>ref|XP_010272679.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=773

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/599 (57%), Positives = 431/599 (72%), Gaps = 18/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SSHCNRK+IGARY++KGYEA +G P+N + DFRS RD  GHG+HT+S  GGR V   S
Sbjct  178   FNSSHCNRKLIGARYYLKGYEAYYGAPLNTSMDFRSPRDHDGHGSHTSSIAGGRLVHGVS  237

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G  +GGAPL RLA+YK CW +P  D  +   C D D+LAA D A+ DGV V+S
Sbjct  238   ALGGFAGGTVSGGAPLARLAMYKVCWPLPNKDPSEGNICIDVDMLAAMDDAIGDGVDVLS  297

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSI  1415
             +S+G     NY T DG+A+GALHA+KR+I V  SAGN    P +++NVAPWI TVGASSI
Sbjct  298   ISIGSFSPVNY-TNDGIAIGALHAVKRDIVVACSAGNNGPGPGTLSNVAPWIITVGASSI  356

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             DR F +PV+LGN + ++G+SV   K ++ + PLVYAGD  +PG    I G C  D+LS E
Sbjct  357   DRAFPSPVVLGNGVGIQGQSVAPYKLEDKMYPLVYAGDAVVPGVPKNIVGQCLPDSLSSE  416

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSIG---SEIQVESFLITATNI-FNPS  1082
             KVKGK+V CL G    + + LEV+RAGGAA+ILG+ G   +E+ ++S+L+  T + F+ +
Sbjct  417   KVKGKIVLCLRGNGTRVGKGLEVKRAGGAAIILGNSGLNGNELTMDSYLLPGTAVGFDDA  476

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                 IL YI + K P+A ++PGK++  AKP+P MA F+S GP+  EPNI+KPDITAPG+N
Sbjct  477   --KRILDYINSTKKPMAKIVPGKSVLNAKPAPYMAGFSSTGPNVIEPNIIKPDITAPGVN  534

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILA WSE SSP +   DHRSVKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SAIM
Sbjct  535   ILATWSEKSSPTKLLADHRSVKYNFDSGTSMSCPHVAATAALLKAIHPSWSSAAIRSAIM  594

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTATT+N  G+ + +A G  A PF+YG+GH+ P+KAADPGLVYD++Y DYLLF+C S G 
Sbjct  595   TTATTRNNMGKPLTNAAGTSANPFNYGSGHLDPTKAADPGLVYDASYTDYLLFLCGSSGL  654

Query  541   T-LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               LDP++KCPK + S SNLNYPSLAI++L G+M V RTVTNVG   + Y   +  P G S
Sbjct  655   KGLDPAFKCPKVSPSASNLNYPSLAISKLNGTMTVNRTVTNVGGGKSVYFASIIPPLGVS  714

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkk--vgefeFGWYKWSDGIHMVKSPIVVSSA  194
             VKI P  L F  VGEK+SF ++VK +  +     E+ FGWY WSDGIH V+SP+ +S A
Sbjct  715   VKIYPRVLSFSRVGEKKSFTITVKAKDSQVHIRDEYVFGWYIWSDGIHHVRSPMAISLA  773



>gb|EYU28149.1| hypothetical protein MIMGU_mgv1a018291mg [Erythranthe guttata]
Length=721

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/573 (57%), Positives = 404/573 (71%), Gaps = 12/573 (2%)
 Frame = -2

Query  1921  KIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANGV  1742
             K++GARY++ GYEA +GP++ T DFRS RDISGHGTHT+STVGGR V NA++LGG   G 
Sbjct  143   KLVGARYYLSGYEAVYGPLDQTIDFRSPRDISGHGTHTSSTVGGRNVPNAASLGGLGVGN  202

Query  1741  ATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLPQDN  1562
             ATGGAPL RLAIYK CW +P +    + C DDD+LAAFD A+ADGV ++SVS+G      
Sbjct  203   ATGGAPLVRLAIYKVCWNIPENQGGRSTCMDDDMLAAFDAAIADGVDILSVSIGARNGSR  262

Query  1561  YFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFSAPVLL  1385
              +T+D +A+G+LHA+KRNI V  SAGN    P +V+N+APW  TVGASSIDRVFS+PVLL
Sbjct  263   PYTRDAIAIGSLHAVKRNIVVACSAGNLGPTPSTVSNIAPWFITVGASSIDRVFSSPVLL  322

Query  1384  GNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGF--CRQDTLSPEKVKGKVVFCL  1211
             GN ++ +G+S+T  +   T PLVYA +VEIPG+TT      CR  TLSPE V GK VFC 
Sbjct  323   GNGIVAEGQSITPFETG-TYPLVYAANVEIPGTTTNLTTGLCRNGTLSPELVVGKAVFCW  381

Query  1210  TGGLSQTLEVERAGGAAVILGSI--GSEIQVESFLITATNIFNPSGTDAILKYILTNKNP  1037
             TG   Q LEV+RAGG A +LG++  G  +    +LI  T + +      I  Y  T+  P
Sbjct  382   TGDTFQALEVQRAGGVAAVLGNLYPGVGVIGRPYLIPGTVVLSDERMK-IYNYTQTDPTP  440

Query  1036  VATLIPGKTIFGA---KPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEASSPL  866
               TL P  T+ G     P+P MAPF+S GP+  EPNILKPDITAPGLNILAAWSEA+ PL
Sbjct  441   TVTLTPATTLIGGTTNSPTPFMAPFSSRGPNAIEPNILKPDITAPGLNILAAWSEAAPPL  500

Query  865   EQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNVKGEA  686
               P D+R  KY + SGTSMSCPHV+ V AL+KAIHPDWS AAI+SA+MTTA   N  G  
Sbjct  501   VIPSDNRVTKYQLASGTSMSCPHVAGVAALIKAIHPDWSSAAIRSALMTTANPNNNLGNI  560

Query  685   IKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKCPKKA  506
             + DA G +A PF YG GHIQPSKAADPGLVY+++Y DYLLF+CSSIG  LD ++ CP   
Sbjct  561   MTDAVGNIATPFQYGGGHIQPSKAADPGLVYNASYSDYLLFLCSSIGNVLDTTFNCPTTL  620

Query  505   SSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTELKFMEV  326
              SPSNLNYPSLAIA L G + V+RTVTNVG+ N TY+V++  P GY+V ISP  L F   
Sbjct  621   PSPSNLNYPSLAIANLNGVLTVERTVTNVGAGNATYTVQIVNPQGYTVGISPPTLFFNAT  680

Query  325   GEKQsffvsvkvesvkkvgefeFGWYKWSDGIH  227
             GEKQ    ++ V++  +     FGWY WSDGIH
Sbjct  681   GEKQ--TFNITVQATVRPCGNAFGWYVWSDGIH  711



>ref|XP_010273518.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=779

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/602 (56%), Positives = 425/602 (71%), Gaps = 20/602 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATF-GPVNHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SSHCNRK+IGARY++KGYEA +  P+N + D+RS RD  GHG+HT+S VGGR V   S
Sbjct  180   FNSSHCNRKLIGARYYLKGYEAYYDAPLNTSTDYRSPRDKDGHGSHTSSIVGGRVVEGVS  239

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLA+YK CW VP  D  +   C D D+LAA D A+ DGV V+S
Sbjct  240   ALGGFAQGTASGGAPLARLAMYKVCWPVPGRDPSEGNICMDTDMLAAIDDAIGDGVDVLS  299

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSI  1415
             +S+G     NY T DG+A+GALHA+KRNI V  SAGN    P +++N+APWI TVGASSI
Sbjct  300   ISIGTFSPVNY-TDDGIAIGALHAVKRNIVVACSAGNNGPGPGTLSNIAPWIITVGASSI  358

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             DRVF +PV+LGN+L V+G+SV      + + PLVYAGD  +PG + ++   C   +LSPE
Sbjct  359   DRVFPSPVVLGNSLTVQGQSVAPYMLDDKMYPLVYAGDAVVPGVNNSVADQCLPGSLSPE  418

Query  1240  KVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KVKGK+V CL      + + LEV RAGGAA+ LG+    G+E+ ++S+ +  T +     
Sbjct  419   KVKGKIVLCLRRLGTRVGKGLEVRRAGGAAIFLGNSRLNGNELPIDSYFLPGTAVAFEDA  478

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
             T+ IL YI + KNP A ++PG T+   KP+P+MA F+S GP+  EPNILKPDITAPG+NI
Sbjct  479   TN-ILSYINSTKNPTAKVVPGMTVINVKPAPSMASFSSRGPNVIEPNILKPDITAPGINI  537

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LA+WSE SSP +   DHR VKYN  SGTSMSCPHV+ + ALLKAIHP WS AAI+SAIMT
Sbjct  538   LASWSEKSSPTKLLSDHRRVKYNFDSGTSMSCPHVAGIAALLKAIHPSWSSAAIRSAIMT  597

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA T+N  G  + DA G+ A PF YG+GH+ P+  ADPGLVYD++Y DYLLF+C S G  
Sbjct  598   TARTRNNMGMPLTDATGDTANPFSYGSGHLDPTNVADPGLVYDASYTDYLLFLCGSSGLK  657

Query  538   -LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S+KCPKK+ S SNLNYPSL+I++L G+M VKRTVTNVG   + Y V ++ P G SV
Sbjct  658   GLDSSFKCPKKSPSASNLNYPSLSISKLNGTMTVKRTVTNVGDGESVYLVTIRPPAGVSV  717

Query  361   KISPTELKFMEVGEKQsffvsvkvesvk------kvgefeFGWYKWSDGIHMVKSPIVVS  200
             KI+P  L F  VGEK+SF ++VK +            +F FG Y W+DGIH V+SP+ VS
Sbjct  718   KIAPRVLNFSRVGEKKSFTITVKAKKDSQVDWRGTEEKFAFGSYTWTDGIHHVRSPMAVS  777

Query  199   SA  194
              A
Sbjct  778   LA  779



>gb|EYU28145.1| hypothetical protein MIMGU_mgv1a021952mg [Erythranthe guttata]
Length=775

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/589 (57%), Positives = 412/589 (70%), Gaps = 11/589 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK++GARY+++ YEA FGP++ T DFRS+RD  GHGTHT+STVGGR V NA+A
Sbjct  190   FDSSHCNRKLVGARYYLRAYEANFGPLDPTIDFRSARDSVGHGTHTSSTVGGRSVPNAAA  249

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             +GGF  G ATGGAPL RLA+YK CW +P D      C D DV+AAFD A+ADGV +ISVS
Sbjct  250   IGGFGIGNATGGAPLVRLAMYKVCWNIPADLGGGNTCADADVIAAFDDAIADGVDIISVS  309

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG      Y  +DG A+GAL+A+KR+I VV SAGN   +P++VTN+APWI TVGASSIDR
Sbjct  310   LGSETPTPY-VEDGTAIGALNAVKRDIVVVCSAGNSGPDPFTVTNIAPWIITVGASSIDR  368

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIP--GFCRQDTLSPEKV  1235
             VFS+PVLLGN ++ +G+S+T   K  T PLVYA DVEIPG+TT    G C   TLSP  V
Sbjct  369   VFSSPVLLGNGVVAEGQSITPFVKG-TYPLVYAADVEIPGTTTADTFGLCLPGTLSPALV  427

Query  1234  KGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVES--FLITATNIFNPSGTDAILK  1061
              GK VFC  G     LEV+RAGG A +LG+    + V    ++I A+ + +      I  
Sbjct  428   AGKAVFCWKGDTVSALEVQRAGGVAAVLGNPKEGVGVSQTPYVIPASVVLSDQKLK-IYN  486

Query  1060  YILTNKNPVATLIPGKTIFG-AKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
             YI +   P ATL P +T+ G + P+P MAPFTS GP+  EPN+LKPDITAPG NILAAWS
Sbjct  487   YIRSTATPTATLTPARTLIGGSSPTPFMAPFTSRGPNAIEPNLLKPDITAPGFNILAAWS  546

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             E +SP     D+R  KYNIISGTSMSCPHV+ V AL+KAIHPDWS AAI+SA+MTT +  
Sbjct  547   EVASPFGVASDNRVAKYNIISGTSMSCPHVAGVAALIKAIHPDWSSAAIRSALMTTTSPI  606

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSY  524
             N     I DA G  A P  YG+GHIQPSKAADPGLVYD++Y DYLLF+CSS G  LDP++
Sbjct  607   NNLDNLITDALGIFATPLQYGSGHIQPSKAADPGLVYDASYSDYLLFLCSSTGNFLDPTF  666

Query  523   KCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTE  344
              CP    S SNLNYPSLAI  L G++ V+RTVTNVG+ NTTY+V    P GY+  ISP+ 
Sbjct  667   NCPIIPPSASNLNYPSLAITNLIGAVTVERTVTNVGAGNTTYTVSTSVPRGYTFTISPSI  726

Query  343   LKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             L F   GEKQ    ++ V +        FGWY W DG H+V SP+V+++
Sbjct  727   LHFSATGEKQ--SFTITVAAAATASGNAFGWYVWFDGTHVVTSPVVINT  773



>ref|XP_009407016.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/598 (56%), Positives = 426/598 (71%), Gaps = 16/598 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN KIIGARY+VK YE  +GP+N T+ +RS RD  GHGTHTASTV GR V N SA
Sbjct  155   FNSSHCNNKIIGARYYVKSYEYYYGPLNRTYAYRSPRDNDGHGTHTASTVAGRVVRNVSA  214

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G ATGGAPL RLAIYK CW +P    +I+ T C D D+LAAFD A+ADGV VIS
Sbjct  215   LGGFAWGTATGGAPLARLAIYKVCWPIPGPNPNIENT-CFDADMLAAFDDAIADGVHVIS  273

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSI  1415
             +S+G   +   ++QD +A+GALHA KR+I VV SAGN    P +VTN+APW  TVGASSI
Sbjct  274   MSIGATGEPPEYSQDSMAIGALHAAKRDIVVVCSAGNDGPGPATVTNLAPWTITVGASSI  333

Query  1414  DRVFSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F + VLLGN + +KG++VT   +   +  PLVYA D  +PG+ + I G C  ++L  
Sbjct  334   DRAFDSLVLLGNGVTIKGQTVTPYVLNSSDFYPLVYARDAVLPGTPSNISGQCLPNSLDG  393

Query  1243  EKVKGKVVFCLTGGLSQT---LEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             +KV+GKVV CL G  S+    LEV+RAGGAA+ILG+    G+EI V++ ++  T + +  
Sbjct  394   DKVRGKVVLCLRGSGSRVAKGLEVKRAGGAAIILGNAVANGNEIPVDAHVLPGTAVSSDD  453

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                AILKYI   + P A +   +T+    P+PAMA F+S GP+  EPNILKPDITAPGLN
Sbjct  454   AI-AILKYIDATRRPRAKVGSARTVLSVTPAPAMAAFSSRGPNRVEPNILKPDITAPGLN  512

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSE+SSP +  +DHR VKY++ SGTSMSCPHVSAV AL+K++HPDWS AAI+SA+M
Sbjct  513   ILAAWSESSSPTKLEDDHRRVKYDLSSGTSMSCPHVSAVAALIKSLHPDWSSAAIRSAMM  572

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTAT +N +GEA+ DA G VAGP  YG+GHI+P+ A+DPGLVYD+ Y DYLLF CSSIG 
Sbjct  573   TTATVENARGEALTDASGRVAGPMDYGSGHIRPTHASDPGLVYDAGYEDYLLFACSSIGA  632

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              +DPS+ CP+     S+LNYPS+A++ L GS+ V+RTVTNVG  +  Y V    PTG SV
Sbjct  633   QMDPSFPCPETPPPTSDLNYPSIAVSNLNGSVTVRRTVTNVGRGSARYRVTATEPTGVSV  692

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgef--eFGWYKWSDGIHMVKSPIVVSSA  194
              ISP +L+F   GE++ F V++KV   +         G Y WSDG H+V+SPIVVS A
Sbjct  693   HISPQKLRFKRSGERRRFSVTLKVRGRRDKPSGDYVAGSYTWSDGTHVVRSPIVVSLA  750



>ref|XP_008803738.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=600

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/591 (56%), Positives = 421/591 (71%), Gaps = 16/591 (3%)
 Frame = -2

Query  1924  RKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANG  1745
             RK+IGARY+VK YEA  GP+N T+ FRS RD  GHGTHTASTV GR V  ASALGGFA G
Sbjct  12    RKLIGARYYVKAYEAYHGPLNTTYAFRSPRDNDGHGTHTASTVAGRVVRRASALGGFACG  71

Query  1744  VATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              A+GGAPL RLA+YK CW +P    +I+ T C D D+LAA D A+ DGV ++S+S+G + 
Sbjct  72    TASGGAPLARLAVYKVCWPIPGPNPNIENT-CFDADMLAAIDDAIGDGVHILSISIGAVG  130

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
                 +++DG+ALGALHA K  I V  S GN    P +V+N+APW+ TV ASSIDR F +P
Sbjct  131   TPPVYSEDGIALGALHAAKHGIVVSCSGGNSGPTPATVSNLAPWMITVAASSIDRAFDSP  190

Query  1393  VLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSPEKVKGKV  1223
             +LLGN   +KG++VT  ++K  E  PLVYAGD  +PG+ + + G C  +TLS +KV+GK+
Sbjct  191   ILLGNGTTMKGQTVTPYKLKGNELYPLVYAGDAVVPGTPSNVSGQCLPNTLSAKKVRGKI  250

Query  1222  VFCLTG-GL--SQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             V CL G GL  ++ LEV+RAGGAA+ILG+    G EI V+S ++  T + +     AILK
Sbjct  251   VLCLRGSGLRAAKGLEVKRAGGAAIILGNAPPNGKEIPVDSHVLPGTAVSSDDAI-AILK  309

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI + + P AT+   +TI   +P+P M  F+S GP+  +PNILKPDITAPGLNILAAWSE
Sbjct  310   YINSTRRPSATIGRARTILDVRPAPVMTAFSSRGPNRVDPNILKPDITAPGLNILAAWSE  369

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             +SSP +  +DHRSVKYN++SGTSMSCPHVSA   LLK++HP WS AAI+SAIMTTAT +N
Sbjct  370   SSSPTKLEDDHRSVKYNLLSGTSMSCPHVSATATLLKSMHPYWSSAAIRSAIMTTATVRN  429

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYK  521
              KG  I +A GE AGP  YG+GH++P+ A+DPGLVY+++Y DYLLF CSSIG  +DP++ 
Sbjct  430   AKGGLIANAAGEEAGPLDYGSGHVRPTHASDPGLVYEASYRDYLLFACSSIGVQMDPTFP  489

Query  520   CPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTEL  341
             CPK   S  NLNYPS++++ L GS+ V RTVTNVG     Y V V  P+G SVKISP  L
Sbjct  490   CPKSPPSTFNLNYPSVSVSNLNGSIDVHRTVTNVGQQKAWYRVSVVEPSGVSVKISPNIL  549

Query  340   KFMEVGEKQsffvsvkv--esvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             KF  VGE++SF + ++V        GE+  G Y WSDG H V+SPIVVS A
Sbjct  550   KFERVGEEKSFTIKLQVDGRKGAGSGEYVAGSYTWSDGTHDVRSPIVVSVA  600



>ref|XP_011096454.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=686

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/601 (55%), Positives = 424/601 (71%), Gaps = 21/601 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRKIIGARY++KGYEA +GP+N T D+ S RD+ GHGTHT+STVGGR+V + SA
Sbjct  90    FNSSHCNRKIIGARYYIKGYEAYYGPLNRTLDYLSPRDMDGHGTHTSSTVGGRRVNSVSA  149

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGAPL RLAIYK CW +P    +    C ++D+LAA D A+ADGV V+S+
Sbjct  150   LGGFASGTASGGAPLARLAIYKVCWAIPGQGKEGGNTCFEEDMLAAIDDAIADGVDVLSI  209

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G      Y  +DG+A+GALHA+K+NI V  SAGN    P +++N APWI T+GASS+D
Sbjct  210   SIGTRVPVGY-DEDGIAIGALHAIKKNIVVACSAGNSGPAPSTLSNPAPWIITIGASSVD  268

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDV---EIPGSTTIPGFCRQDTLSP  1244
             R FSAPV+LGN + + G++VT  K ++ L PLVYA  V   ++P    I G C   +LSP
Sbjct  269   RKFSAPVVLGNGVKIMGQTVTPYKLEKKLYPLVYAAQVTNSDVP--NNISGQCLPGSLSP  326

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             EK KGK+V CL G    + + +EV+RAGG   ILG+    G E+  ++ L+ AT + N  
Sbjct  327   EKAKGKIVLCLRGNGTRVGKGMEVKRAGGIGFILGNSKANGDELAADAHLLPATAV-NYG  385

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                 IL YI + K P A +   KT+ GA+P+P MA F+S GP+   P+ILKPDITAPGLN
Sbjct  386   DALKILNYIESAKAPKAHIERAKTVLGAQPAPFMAAFSSRGPNTISPDILKPDITAPGLN  445

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +  EDHR VKYNI+SGTSMSCPHV+A  ALLKAIHP WS AAI+SA++
Sbjct  446   ILAAWSEASSPTKMAEDHRVVKYNILSGTSMSCPHVAAASALLKAIHPSWSSAAIRSALI  505

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             T+A   N +   I DA G  A PF +G+GH +P+KAADPGLVYD++Y DYLLF+CSS   
Sbjct  506   TSAGLNNNEHNLITDASGNSADPFQFGSGHFRPTKAADPGLVYDASYKDYLLFLCSSGSK  565

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
             +LD S+KCPK + SP NLNYPSLAI +L GS+   RTVTNVG +N+ Y V VK P G SV
Sbjct  566   SLDSSFKCPKNSPSPVNLNYPSLAIPKLNGSVSAIRTVTNVGGSNSVYFVSVKPPPGISV  625

Query  361   KISPTELKFMEVGEKQsffvsvk-----vesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             K+SP  L F   G+K+SF ++VK          +  ++ FGWY WSDGIH V+SP+ VS 
Sbjct  626   KVSPPILFFNRAGQKKSFTITVKLDNGITADSIEKDKYAFGWYTWSDGIHNVRSPMAVSV  685

Query  196   A  194
             A
Sbjct  686   A  686



>ref|XP_010916217.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Elaeis 
guineensis]
Length=681

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/599 (54%), Positives = 420/599 (70%), Gaps = 19/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+K+IGARY+VKGYEA +G +N T+ FRS RD  GHGTHTASTV GR V   SA
Sbjct  87    FNSSHCNKKLIGARYYVKGYEAYYGSLNTTYAFRSPRDNDGHGTHTASTVAGRVVRRVSA  146

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL RLA+YK CW +P    +I+ T C D D+LAA D A+ DGV ++S
Sbjct  147   LGGFARGTASGGAPLARLAVYKVCWPIPGPNPNIENT-CFDADMLAAIDDAIGDGVHILS  205

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSI  1415
             +S+G +     +++DG+A+GALHA K  I V  S GN      +V+N+APW+ TV ASSI
Sbjct  206   ISIGAVGTPPKYSEDGIAIGALHAAKHGIVVSCSGGNSGPALATVSNLAPWMITVAASSI  265

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F + +LLGN + +KG++VT  E+K  E+ PLVYAGD  +P + + + G C  ++LS 
Sbjct  266   DRAFDSAILLGNGMTIKGQTVTPYELKGNESYPLVYAGDAVVPATPSNVSGQCLPNSLSA  325

Query  1243  EKVKGKVVFCLTG-GL--SQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
              KV+GK+V CL G GL  ++ LEV+RAGGAA+ILG+    G+EI V+  ++  + +   S
Sbjct  326   RKVRGKIVLCLRGSGLRAAKGLEVKRAGGAAIILGNAPANGNEIPVDCHVLPGSAV---S  382

Query  1081  GTDAI--LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
               DAI  LKYI +   P AT+   +T    +P+P M  F+S GP+  EPNILKPDITAPG
Sbjct  383   SDDAITILKYINSTGQPSATIGRARTTLDVRPAPVMTAFSSRGPNRVEPNILKPDITAPG  442

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWSE+SSP +  +DHRSV YN++SGTSMSCPHVSA  +LLK++HP WS AAI+SA
Sbjct  443   LNILAAWSESSSPTKLEDDHRSVAYNLLSGTSMSCPHVSATASLLKSMHPHWSSAAIRSA  502

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTAT +N +   IK+A GEVAGP  YG+GH++P+ A+DPGLVY+++Y DYLLF CSSI
Sbjct  503   MMTTATVRNAQKGLIKNAAGEVAGPLEYGSGHLRPTHASDPGLVYEASYRDYLLFACSSI  562

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             G  +DP++ CP+   S  +LNYPS++++ L GS+ V RTVTNVG     Y V +  P+G 
Sbjct  563   GVQMDPTFPCPESPPSTFDLNYPSVSVSNLNGSITVHRTVTNVGQWKARYHVSIVEPSGV  622

Query  367   SVKISPTELKFMEVGEKQ-sffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SVKISP  LKF E  EK     + V      + GE+  G Y WSDG H V+SPIVVS A
Sbjct  623   SVKISPKILKFKEGEEKSFRIKLQVDGSKGARSGEYVAGSYTWSDGTHDVRSPIVVSVA  681



>ref|XP_010916207.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Elaeis 
guineensis]
Length=776

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/599 (54%), Positives = 420/599 (70%), Gaps = 19/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+K+IGARY+VKGYEA +G +N T+ FRS RD  GHGTHTASTV GR V   SA
Sbjct  182   FNSSHCNKKLIGARYYVKGYEAYYGSLNTTYAFRSPRDNDGHGTHTASTVAGRVVRRVSA  241

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL RLA+YK CW +P    +I+ T C D D+LAA D A+ DGV ++S
Sbjct  242   LGGFARGTASGGAPLARLAVYKVCWPIPGPNPNIENT-CFDADMLAAIDDAIGDGVHILS  300

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSI  1415
             +S+G +     +++DG+A+GALHA K  I V  S GN      +V+N+APW+ TV ASSI
Sbjct  301   ISIGAVGTPPKYSEDGIAIGALHAAKHGIVVSCSGGNSGPALATVSNLAPWMITVAASSI  360

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F + +LLGN + +KG++VT  E+K  E+ PLVYAGD  +P + + + G C  ++LS 
Sbjct  361   DRAFDSAILLGNGMTIKGQTVTPYELKGNESYPLVYAGDAVVPATPSNVSGQCLPNSLSA  420

Query  1243  EKVKGKVVFCLTG-GL--SQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
              KV+GK+V CL G GL  ++ LEV+RAGGAA+ILG+    G+EI V+  ++  + +   S
Sbjct  421   RKVRGKIVLCLRGSGLRAAKGLEVKRAGGAAIILGNAPANGNEIPVDCHVLPGSAV---S  477

Query  1081  GTDAI--LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
               DAI  LKYI +   P AT+   +T    +P+P M  F+S GP+  EPNILKPDITAPG
Sbjct  478   SDDAITILKYINSTGQPSATIGRARTTLDVRPAPVMTAFSSRGPNRVEPNILKPDITAPG  537

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWSE+SSP +  +DHRSV YN++SGTSMSCPHVSA  +LLK++HP WS AAI+SA
Sbjct  538   LNILAAWSESSSPTKLEDDHRSVAYNLLSGTSMSCPHVSATASLLKSMHPHWSSAAIRSA  597

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTAT +N +   IK+A GEVAGP  YG+GH++P+ A+DPGLVY+++Y DYLLF CSSI
Sbjct  598   MMTTATVRNAQKGLIKNAAGEVAGPLEYGSGHLRPTHASDPGLVYEASYRDYLLFACSSI  657

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             G  +DP++ CP+   S  +LNYPS++++ L GS+ V RTVTNVG     Y V +  P+G 
Sbjct  658   GVQMDPTFPCPESPPSTFDLNYPSVSVSNLNGSITVHRTVTNVGQWKARYHVSIVEPSGV  717

Query  367   SVKISPTELKFMEVGEKQ-sffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SVKISP  LKF E  EK     + V      + GE+  G Y WSDG H V+SPIVVS A
Sbjct  718   SVKISPKILKFKEGEEKSFRIKLQVDGSKGARSGEYVAGSYTWSDGTHDVRSPIVVSVA  776



>ref|XP_011102178.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=787

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/601 (55%), Positives = 424/601 (71%), Gaps = 21/601 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRKIIGARY++KGYEA +GP+N T D+ S RD+ GHGTHT+STVGGR+V + SA
Sbjct  191   FNSSHCNRKIIGARYYIKGYEAYYGPLNRTLDYLSPRDMDGHGTHTSSTVGGRRVNSVSA  250

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGAPL RLAIYK CW +P    +    C ++D+LAA D A+ADGV V+S+
Sbjct  251   LGGFASGTASGGAPLARLAIYKVCWAIPGQGKEGGNTCFEEDMLAAIDDAIADGVDVLSI  310

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G      Y  +DG+A+GALHA+K+NI V  SAGN    P +++N APWI T+GASS+D
Sbjct  311   SIGTRVPVGY-DEDGIAIGALHAIKKNIVVACSAGNSGPAPSTLSNPAPWIITIGASSVD  369

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDV---EIPGSTTIPGFCRQDTLSP  1244
             R FSAPV+LGN + + G++VT  K ++ L PLVYA  V   ++P    I G C   +LSP
Sbjct  370   RKFSAPVVLGNGVKIMGQTVTPYKLEKKLYPLVYAAQVTNSDVP--NNISGQCLPGSLSP  427

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             EK KGK+V CL G    + + +EV+RAGG   ILG+    G E+  ++ L+ AT + N  
Sbjct  428   EKAKGKIVLCLRGNGTRVGKGMEVKRAGGIGFILGNSKANGDELAADAHLLPATAV-NYG  486

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                 IL YI + K P A +   KT+ GA+P+P MA F+S GP+   P+ILKPDITAPGLN
Sbjct  487   DALKILNYIESAKAPKAHIERAKTVLGAQPAPFMAAFSSRGPNTISPDILKPDITAPGLN  546

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +  EDHR VKYNI+SGTSMSCPHV+A  ALLKAIHP WS AAI+SA++
Sbjct  547   ILAAWSEASSPTKMAEDHRVVKYNILSGTSMSCPHVAAASALLKAIHPSWSSAAIRSALI  606

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             T+A   N +   I DA G  A PF +G+GH +P+KAADPGLVYD++Y DYLLF+CSS   
Sbjct  607   TSAGLNNNEHNLITDASGNSADPFQFGSGHFRPTKAADPGLVYDASYKDYLLFLCSSGSK  666

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
             +LD S+KCPK + SP NLNYPSLAI +L GS+   RTVTNVG +N+ Y V VK P G SV
Sbjct  667   SLDSSFKCPKNSPSPVNLNYPSLAIPKLNGSVSAIRTVTNVGGSNSVYFVSVKPPPGISV  726

Query  361   KISPTELKFMEVGEKQsffvsvk-----vesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             K+SP  L F   G+K+SF ++VK          +  ++ FGWY WSDGIH V+SP+ VS 
Sbjct  727   KVSPPILFFNRAGQKKSFTITVKLDNGITADSIEKDKYAFGWYTWSDGIHNVRSPMAVSV  786

Query  196   A  194
             A
Sbjct  787   A  787



>ref|XP_004232973.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=775

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/598 (54%), Positives = 415/598 (69%), Gaps = 16/598 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS+CN+KIIGARY++KGYE  +GP+N T D+ S RD  GHGTHT+ST GG+KV N SA
Sbjct  180   FNSSNCNKKIIGARYYIKGYEQFYGPLNRTLDYLSPRDKDGHGTHTSSTAGGKKVPNVSA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIK-ATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA+G A+GGAPL RLA+YK CW +P +  +    C D+D+LAA D A+ADGV VIS+
Sbjct  240   IGGFASGTASGGAPLARLAMYKVCWAIPREGKEDGNTCFDEDMLAALDDAIADGVDVISI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   F QD +A+GALHAMK+NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  300   SIGT-KQPQPFDQDSIAIGALHAMKKNIVVSCSAGNSGPAPSTLSNTAPWIITVGASSVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGSTT-IPGFCRQDTLSPEK  1238
             R F +P++LGN     G++VT  K K++  PLVYAG+V     T  + G C   +LSPEK
Sbjct  359   RKFLSPIVLGNGKKFMGQTVTPYKLKKKMYPLVYAGEVINTNVTKDLAGQCLPGSLSPEK  418

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
              KGK+V CL G    + +  EV+RAGG   ILG+    G+E+  ++ L+ AT +   SG 
Sbjct  419   AKGKIVMCLRGNGTRVGKGGEVKRAGGIGYILGNSKANGAELAADAHLLPATAVDYKSGV  478

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               IL YI + K+PVA +IP KT+  AKP+P MA FTS GPS   P+ILKPDITAPGLNIL
Sbjct  479   Q-ILNYISSTKSPVAYIIPAKTVLHAKPAPYMASFTSRGPSAVAPDILKPDITAPGLNIL  537

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWS  SSP +   D R V+YNI+SGTSMSCPHV    ALLKAIHP WS AAI+SA++T+
Sbjct  538   AAWSGGSSPTKLDIDKRVVEYNILSGTSMSCPHVGGAAALLKAIHPTWSSAAIRSALITS  597

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTL  536
             A  +N  GE I DA G+ A PF +G GH +PSKAADPGLVYD++Y DYLLF+C+S    L
Sbjct  598   AELQNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCASGVKHL  657

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKI  356
             D S+KCPKK+ SP +LNYPSLAI  L G++  +R +TNVG+  + Y   VK P G+S++I
Sbjct  658   DKSFKCPKKSHSPRDLNYPSLAIPNLNGTVTARRRLTNVGAPKSVYFASVKPPLGFSIEI  717

Query  355   SPTELKFMEVGEKQsffvsvkvesvkk----vgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SP  L F  VG K++F ++VK            ++ FGWY W+DGIH V+SPI V  A
Sbjct  718   SPPILSFNHVGSKKTFTITVKAHRDMMHRIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  775



>ref|XP_006355620.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=775

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/598 (54%), Positives = 414/598 (69%), Gaps = 16/598 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS+CN+KIIGARY++KGYE  +GP+N T D+ S RD  GHGTHT+ST GG+KV NASA
Sbjct  180   FNSSNCNKKIIGARYYIKGYEQYYGPLNRTLDYLSPRDKDGHGTHTSSTAGGKKVPNASA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIK-ATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA+G A GGAPL RLA+YK CW +P +  +    C ++D+LAA D A+ADGV VIS+
Sbjct  240   IGGFASGTALGGAPLARLAMYKVCWAIPREGKEDGNTCFEEDMLAALDDAIADGVDVISI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   F QD +A+GALHAMK+NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  300   SIGT-KQPQPFDQDSIAIGALHAMKKNIVVSCSAGNSGPAPSTLSNTAPWIITVGASSVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGSTT-IPGFCRQDTLSPEK  1238
             R F +P++LGN     G++VT  K K++  PLVYAG+V     T  + G C   +LSPEK
Sbjct  359   RKFLSPIVLGNGKKFMGQTVTPYKLKKKMYPLVYAGEVINTNVTKDLAGQCLPGSLSPEK  418

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
              KGK+V CL G    + +  EV+RAGG   ILG+    G+E+  ++ L+ AT +   SG 
Sbjct  419   AKGKIVMCLRGNGTRVGKGGEVKRAGGIGYILGNSKANGAELAADAHLLPATAVDYKSGV  478

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               IL YI + K+PVA ++P KT+  AKP+P MA FTS GPS   P+ILKPDITAPGLNIL
Sbjct  479   Q-ILNYISSTKSPVAYIVPAKTVLHAKPAPYMASFTSRGPSAVAPDILKPDITAPGLNIL  537

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWS  SSP +   D+R V+YNI+SGTSMSCPHV    ALLKAIHP WS AAI+SA++T+
Sbjct  538   AAWSGGSSPTKLDIDNRVVEYNILSGTSMSCPHVGGAAALLKAIHPTWSSAAIRSALITS  597

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTL  536
             A  +N  GE I DA G+ A PF +G GH +PSKAADPGLVYD++Y DYLLF+C+S    L
Sbjct  598   AELQNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCASGVKDL  657

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKI  356
             D S+KCPKK+ SP +LNYPSLAI  L  ++  +R +TNVG+  + Y    K P G+S++I
Sbjct  658   DKSFKCPKKSHSPRDLNYPSLAIPNLNDTVTARRRLTNVGAPKSIYYASAKPPLGFSIEI  717

Query  355   SPTELKFMEVGEKQsffvsvkvesvkk----vgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SP  L F  VG +++F ++VK            ++ FGWY W+DGIH V+SPI V  A
Sbjct  718   SPPVLAFNHVGSERTFTITVKAHRDMMHRIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  775



>gb|EYU28144.1| hypothetical protein MIMGU_mgv1a001682mg [Erythranthe guttata]
Length=773

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/595 (54%), Positives = 404/595 (68%), Gaps = 13/595 (2%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY++KGYEA +GP+N T DF S RD  GHGTHT+ST  GR+V N SA
Sbjct  181   FNSSHCNKKIIGARYYIKGYEAYYGPLNRTLDFLSPRDKDGHGTHTSSTAAGRRVNNVSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGAPL RLAIYK CW VP         C + D+LAA D A++DGV V+S+
Sbjct  241   LGGFASGTASGGAPLARLAIYKVCWAVPGHGKEDGNTCFEADMLAAIDDAISDGVDVLSI  300

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G       F QDG+A+G+LHA+K+NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  301   SIGT-KDPTPFNQDGIAIGSLHAVKKNIVVACSAGNAGPTPSTLSNPAPWIITVGASSVD  359

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             R FSAPV+LGN + + G++VT  K +  L PLVYAG V  P     + G C   +LSP K
Sbjct  360   RKFSAPVVLGNGIKLAGQTVTPYKLENRLYPLVYAGQVINPDVQKNLSGQCLPGSLSPSK  419

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
              KGK+V CL G    + + +EV+RAGG   ILG+    G E+  ++ L+ AT + N    
Sbjct  420   AKGKIVLCLRGNGTRVGKGMEVKRAGGIGFILGNSEANGDELAADAHLLPATAV-NHVNA  478

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               ILKYI + + P A + P KT+   KP+P MA F+S GPS   P+ILKPDITAPG+NIL
Sbjct  479   LEILKYINSTRAPKAYIEPAKTVLDTKPAPFMAAFSSRGPSTVSPDILKPDITAPGINIL  538

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWSEASSP +   D+R VKYNI+SGTSMSCPH+    AL+KAIHP WS AAI+SA++T+
Sbjct  539   AAWSEASSPTKLAADNRIVKYNILSGTSMSCPHIGGASALIKAIHPTWSSAAIRSALVTS  598

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTL  536
             A   N +G  I DA G  A PF +G+GH +P+KAADPGLVYD++Y DYLLF+C +    L
Sbjct  599   AGLTNNEGNPISDASGNPADPFQFGSGHFRPTKAADPGLVYDASYKDYLLFLCGNGIKNL  658

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKI  356
             D S+KCPKK+ S  +LNYPSLAI +L G+    RTVTNVG   + Y V VK P G SVKI
Sbjct  659   DSSFKCPKKSPSMGDLNYPSLAIPKLNGTYTTVRTVTNVGGGKSVYFVSVKPPPGISVKI  718

Query  355   SPTELKFMEVGEKQs-ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SP  + F   G+K+S         S  +  ++ FGWY W DGIH V+SPI VS A
Sbjct  719   SPPIIYFSRAGQKRSFTITVKIETSTVEKDKYVFGWYTWFDGIHNVRSPIAVSVA  773



>ref|XP_009385357.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Musa acuminata 
subsp. malaccensis]
Length=545

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/537 (56%), Positives = 387/537 (72%), Gaps = 14/537 (3%)
 Frame = -2

Query  1924  RKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANG  1745
             RKIIGARY++KGYEA +G +N T+ +RS RD  GHGTHTASTV GR V   SALGG+A G
Sbjct  10    RKIIGARYYLKGYEAYYGSLNRTYAYRSPRDHDGHGTHTASTVAGRVVPGVSALGGYARG  69

Query  1744  VATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              A GG PL RLAIYK CW +P    +I+ T C D D+LAAFD A+ DGV V+SVS+G   
Sbjct  70    TAAGGVPLARLAIYKVCWPIPGPNPNIENT-CFDADMLAAFDDAIGDGVHVLSVSIGATG  128

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
                 ++ DG+A+GALHA K +I V  SAGN    P +V+N+APW+ TVGASSIDR F + 
Sbjct  129   VPPKYSNDGIAIGALHAAKHDIVVACSAGNDGPAPATVSNLAPWMITVGASSIDRAFDSL  188

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGST-TIPGFCRQDTLSPEKVKGKV  1223
             VLLGN + +KG++VT   +K  E  PLVYAGD  +PG+   + G C  ++L  +KV+GK+
Sbjct  189   VLLGNGVTIKGQTVTPSVLKSSEFYPLVYAGDAVVPGTPGNVSGQCLPNSLDAKKVRGKI  248

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             V CL G    +++ LEV+RAGGAA+ILG+    G+EI V++ ++  T + +     AILK
Sbjct  249   VVCLRGSGLRVAKGLEVKRAGGAAIILGNAVANGNEIPVDAHVLPGTAVSSDDAI-AILK  307

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI   + P A +   +T+ G  P+P MA F+S GP+  EPNILKPDITAPGLNILAAWSE
Sbjct  308   YIEAARRPSAKIGSARTVLGVTPAPVMAAFSSRGPNRVEPNILKPDITAPGLNILAAWSE  367

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             +SSP +  +DHRSVKYN+ SGTSMSCPHVSAV ALLK++HP WS AAI+SA+MTTA   N
Sbjct  368   SSSPTKLEDDHRSVKYNLYSGTSMSCPHVSAVAALLKSLHPSWSSAAIRSAMMTTAAVVN  427

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYK  521
              +G  + DA G+ AGP  +G+GH++P+ A+DPGLVYD++Y DYLLF CSSIG  +DPS+ 
Sbjct  428   TRGGPLTDAAGQAAGPLEFGSGHVRPNHASDPGLVYDASYEDYLLFACSSIGAQMDPSFP  487

Query  520   CPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISP  350
             CP+ + SPS+LNYPS+A++ L GS+ V+RTVTNVG     Y V V  PTG SV+ISP
Sbjct  488   CPETSPSPSDLNYPSIAVSDLNGSVTVRRTVTNVGRGPARYRVTVTEPTGVSVRISP  544



>emb|CDM84099.1| unnamed protein product [Triticum aestivum]
Length=813

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/596 (53%), Positives = 407/596 (68%), Gaps = 17/596 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRK+IGARY++K YEA  G +N T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  217   FNSSSCNRKVIGARYYLKAYEAHHGRLNATNAYRSPRDHDGHGTHTASTVAGRTVPGVAA  276

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL RLAIYK CW +P    +I+ T C D D+LAA D AV DGV V+S
Sbjct  277   LGGFAAGTASGGAPLARLAIYKVCWPIPGPNPNIENT-CFDADMLAAMDDAVGDGVDVMS  335

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G   +      DG+A+GALHA +R + VV S GN    P +V+N+APWI TVGASSI
Sbjct  336   VSIGSSGKPPRLPDDGIAVGALHAARRGVVVVCSGGNSGPAPATVSNLAPWILTVGASSI  395

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F++P+ LGN +++ G++VT  ++    T P+VYA    +PG+   +   C  ++LSP
Sbjct  396   DRSFNSPITLGNGMVIMGQTVTPYQLPPNRTYPMVYAAQAVVPGTPANVTNQCLPNSLSP  455

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
             +KV+GK+V CL G    + + LEV+RAGGAA++LG+    GSE+ V++ ++  T + + +
Sbjct  456   QKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPLYGSEVPVDAHVLPGTAV-SMA  514

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + ILKYI ++ NP A L   +T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLN
Sbjct  515   DVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLN  574

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNIISGTSMSCPHVSA   LLK+ HPDWS AAI+SAIM
Sbjct  575   ILAAWSEASSPTKLDGDNRVVKYNIISGTSMSCPHVSATAVLLKSAHPDWSAAAIRSAIM  634

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTAT  N +   I +A G VAGP  YG+GHI+P  A DPGLVYD+++ DYLL+ C+S G 
Sbjct  635   TTATANNAESGPIMNADGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLLYACASGGA  694

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S+ CP     P  LNYPS+AI  L GS  V+RTVTNVG     YSV V  P G+SV
Sbjct  695   QLDRSFPCPATPPRPHELNYPSVAIHGLNGSATVRRTVTNVGEHGAHYSVAVVEPMGFSV  754

Query  361   KISPTELKFMEVGEKQs---ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             K+SPT L F   GEK++      + +  S +   ++  G Y WSDG+H V+SP+VV
Sbjct  755   KVSPTSLAFARAGEKKTFTIKIAATEKRSRRPKRKYLAGSYTWSDGVHAVRSPVVV  810



>ref|XP_010232258.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brachypodium 
distachyon]
Length=691

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/596 (54%), Positives = 402/596 (67%), Gaps = 17/596 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+ S CNRK+IGARY++K YEA +G +N T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  95    FSPSSCNRKVIGARYYLKAYEARYGRLNATNGYRSPRDHDGHGTHTASTVAGRTVPGVAA  154

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAP  RLAIYK CW +P    +I+ T C D D+LAA D AV DGV V+S
Sbjct  155   LGGFAAGTASGGAPRARLAIYKVCWPIPGPNPNIENT-CFDADMLAAMDDAVGDGVDVMS  213

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G   Q      DG+A+GALHA +R + VV S GN    P +V+N+APW  TVGASSI
Sbjct  214   VSIGSSGQPVRLADDGIAVGALHAARRGVVVVCSGGNSGPAPATVSNLAPWFLTVGASSI  273

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F +P+ LGN  LV G++VT  +++     P+VYA    +PG+   +   C  ++L+ 
Sbjct  274   DRSFDSPIRLGNGKLVMGQTVTPYQLQGNRAYPMVYAAHAVVPGTPANVSDQCLPNSLAA  333

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
             EKV+GK+V CL G    +++ LEV+RAGGAAV+LG+    GSE+ V++ ++  T + + +
Sbjct  334   EKVRGKIVVCLRGAGLRVAKGLEVKRAGGAAVVLGNPPMYGSEVPVDAHVLPGTAV-SMA  392

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + ILKYI +   P A L    T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLN
Sbjct  393   NVNTILKYINSTAKPTAYLDSSTTVLDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLN  452

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HPDWS AAI+SAIM
Sbjct  453   ILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSAAAVLLKSAHPDWSPAAIRSAIM  512

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTATT N +G  I +A G VAGP  YG+GHI+P  A  PGLVYD++Y DYLLF C+S G 
Sbjct  513   TTATTHNAEGSPIMNADGTVAGPMDYGSGHIRPKHALGPGLVYDASYQDYLLFACASGGA  572

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S++CPKK   P  LNYPSLA+  L GS+ V RTVTNVG     Y V V  P G SV
Sbjct  573   QLDHSFRCPKKPPRPYELNYPSLAVHGLNGSITVHRTVTNVGQHEAHYRVAVVEPKGVSV  632

Query  361   KISPTELKFMEVGEKQs---ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             K+SP  L F   GEK++     V+    S +   ++  G Y WSDGIH V+SPIVV
Sbjct  633   KVSPKRLSFSSKGEKKAFVIKIVARGRRSARVNRKYLAGSYTWSDGIHAVRSPIVV  688



>ref|XP_009604273.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=775

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/599 (54%), Positives = 412/599 (69%), Gaps = 18/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS+CN+KIIGARY++KGYE  +GP+N T D+ S RD  GHGTHT+ST GGRKV N SA
Sbjct  180   FNSSNCNKKIIGARYYIKGYEQYYGPLNRTLDYLSPRDKDGHGTHTSSTAGGRKVPNVSA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIK-ATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA+G A+GGAPL RLA+YK CW +P +  +    C D+D+LAA D A+ADGV VIS+
Sbjct  240   IGGFASGTASGGAPLARLAMYKVCWAIPKEGKEDGNTCFDEDMLAAMDDAIADGVDVISI  299

Query  1588  SLGLL-PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             S+G   PQ   F QD +A+GAL+A+K+NI V  SAGN    P +++N APWI TVGASS+
Sbjct  300   SIGTKEPQP--FDQDSIAIGALYAVKKNIVVSCSAGNSGPAPSTLSNTAPWIITVGASSV  357

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTT-IPGFCRQDTLSPE  1241
             DR F +PV+LGN     G++VT  K ++ + PLVYAG V     T  + G C   +LSP+
Sbjct  358   DRAFLSPVILGNGKKFTGQTVTPYKLEKKMYPLVYAGQVINSNVTKDVAGQCLPGSLSPK  417

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSG  1079
             K KGK+V CL G    + +  EV+RAGG   ILG   + G+E+  +   + AT +   S 
Sbjct  418   KAKGKIVICLRGNGTRVGKGGEVKRAGGIGYILGNNKANGAELVADPHFLPATAVDYKSA  477

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
                IL YI + K+PVA ++P KT+  +KP+P MA FTS GPS   P+ILKPDITAPGLNI
Sbjct  478   MQ-ILNYINSTKSPVAYIVPAKTVLHSKPAPYMASFTSRGPSAVAPDILKPDITAPGLNI  536

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWS  SSP +   D R V+YNIISGTSMSCPHV    ALLKAIHP WS AAI+SA++T
Sbjct  537   LAAWSGGSSPTKLDIDDRVVEYNIISGTSMSCPHVGGAAALLKAIHPTWSSAAIRSALIT  596

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             +A  +N  GE I DA G+ A PF +G GH +PSKAADPGLVYD++Y DYLLF+C+S    
Sbjct  597   SAGLRNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCASGIKD  656

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             LD S+KCPKK+  P+NLNYPSLAI  L G++ V R +TNVG+  + Y    K P G+SV+
Sbjct  657   LDKSFKCPKKSHLPNNLNYPSLAIPNLNGTVTVSRRLTNVGAPKSVYFASAKPPLGFSVE  716

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvg----efeFGWYKWSDGIHMVKSPIVVSSA  194
             ISP  L F  VG K++F ++VK  S         ++ FGWY W+DGIH V+SPI V  A
Sbjct  717   ISPPVLSFKHVGSKRTFTITVKARSDMIDSIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  775



>ref|XP_009803454.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=776

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/599 (54%), Positives = 410/599 (68%), Gaps = 18/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS+CN+KIIGARY++KGYE  +GP+N T D+ S RD  GHGTHT+ST GGRKV N SA
Sbjct  181   FNSSNCNKKIIGARYYIKGYEQYYGPLNRTLDYLSPRDKDGHGTHTSSTAGGRKVPNVSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIK-ATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA+G A+GGAPL RLA+YK CW +P +  +    C D+D+LAA D A+ADGV VIS+
Sbjct  241   IGGFASGTASGGAPLARLAMYKVCWAIPKEGKEDGNTCFDEDMLAAMDDAIADGVDVISI  300

Query  1588  SLGLL-PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             S+G   PQ   F QD +A+GALHA+K+NI V  SAGN    P +++N APWI TVGASS+
Sbjct  301   SIGTKEPQP--FDQDSIAIGALHAVKKNIVVSCSAGNSGPAPSTLSNTAPWIITVGASSV  358

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTT-IPGFCRQDTLSPE  1241
             DR F APV+LGN     G++VT  K ++ + PLVYAG V     T  + G C   +L P+
Sbjct  359   DRAFLAPVILGNGKKFMGQTVTPYKLEKKMYPLVYAGQVINSNVTKDVAGQCLPGSLLPK  418

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSG  1079
             K KGK+V CL G    + +  EV+RAGG   ILG   + G+E+  +   + AT +   S 
Sbjct  419   KAKGKIVICLRGNGTRVGKGGEVKRAGGIGYILGNNKANGAELVADPHFLPATAVDYKSA  478

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
                IL YI + K+PVA ++P KT+  +KP+P MA FTS GPS   P+ILKPDITAPGLNI
Sbjct  479   VQ-ILNYINSTKSPVAYIVPAKTVLHSKPAPYMASFTSRGPSAVAPHILKPDITAPGLNI  537

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWS  SSP +   D R V+YNIISGTSMSCPHV    ALLKAIHP WS AAI+SA++T
Sbjct  538   LAAWSGGSSPTKLDIDDRVVEYNIISGTSMSCPHVGGAAALLKAIHPTWSSAAIRSALIT  597

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             +A  +N  GE I DA G+ A PF +G GH +PSKAADPGLVYD++Y DYLLF+C+S    
Sbjct  598   SAGLRNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCASGIKD  657

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             LD S+KCPKK+  P++LNYPSLAI  L G++ V R +TNVG   + Y    K P G+SV+
Sbjct  658   LDKSFKCPKKSHLPNSLNYPSLAIPNLNGTVTVSRRLTNVGGPKSVYFASAKPPLGFSVE  717

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvg----efeFGWYKWSDGIHMVKSPIVVSSA  194
             ISP  L F  VG K++F ++VK  S         ++ FGWY W+DGIH V+SPI V  A
Sbjct  718   ISPPVLSFKRVGSKRTFTITVKARSDMSDSIPKDQYVFGWYSWNDGIHNVRSPIAVKLA  776



>ref|XP_003569718.2| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brachypodium 
distachyon]
Length=786

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/596 (54%), Positives = 402/596 (67%), Gaps = 17/596 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+ S CNRK+IGARY++K YEA +G +N T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  190   FSPSSCNRKVIGARYYLKAYEARYGRLNATNGYRSPRDHDGHGTHTASTVAGRTVPGVAA  249

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAP  RLAIYK CW +P    +I+ T C D D+LAA D AV DGV V+S
Sbjct  250   LGGFAAGTASGGAPRARLAIYKVCWPIPGPNPNIENT-CFDADMLAAMDDAVGDGVDVMS  308

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G   Q      DG+A+GALHA +R + VV S GN    P +V+N+APW  TVGASSI
Sbjct  309   VSIGSSGQPVRLADDGIAVGALHAARRGVVVVCSGGNSGPAPATVSNLAPWFLTVGASSI  368

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F +P+ LGN  LV G++VT  +++     P+VYA    +PG+   +   C  ++L+ 
Sbjct  369   DRSFDSPIRLGNGKLVMGQTVTPYQLQGNRAYPMVYAAHAVVPGTPANVSDQCLPNSLAA  428

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
             EKV+GK+V CL G    +++ LEV+RAGGAAV+LG+    GSE+ V++ ++  T + + +
Sbjct  429   EKVRGKIVVCLRGAGLRVAKGLEVKRAGGAAVVLGNPPMYGSEVPVDAHVLPGTAV-SMA  487

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + ILKYI +   P A L    T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLN
Sbjct  488   NVNTILKYINSTAKPTAYLDSSTTVLDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLN  547

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HPDWS AAI+SAIM
Sbjct  548   ILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSAAAVLLKSAHPDWSPAAIRSAIM  607

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTATT N +G  I +A G VAGP  YG+GHI+P  A  PGLVYD++Y DYLLF C+S G 
Sbjct  608   TTATTHNAEGSPIMNADGTVAGPMDYGSGHIRPKHALGPGLVYDASYQDYLLFACASGGA  667

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S++CPKK   P  LNYPSLA+  L GS+ V RTVTNVG     Y V V  P G SV
Sbjct  668   QLDHSFRCPKKPPRPYELNYPSLAVHGLNGSITVHRTVTNVGQHEAHYRVAVVEPKGVSV  727

Query  361   KISPTELKFMEVGEKQs---ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             K+SP  L F   GEK++     V+    S +   ++  G Y WSDGIH V+SPIVV
Sbjct  728   KVSPKRLSFSSKGEKKAFVIKIVARGRRSARVNRKYLAGSYTWSDGIHAVRSPIVV  783



>ref|XP_004309900.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=778

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/598 (54%), Positives = 415/598 (69%), Gaps = 18/598 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KG+E  +GP+N + D RS RD+ GHGTHT+STV GR V N SA
Sbjct  182   FNSSHCNRKLIGARYYLKGFEQYYGPLNVSEDSRSPRDMDGHGTHTSSTVAGRVVPNTSA  241

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G ATGGAPL  +A+YK CW +P     +   C ++D+ AA D A+ADGV V+S+
Sbjct  242   LGGFARGYATGGAPLAHIAVYKVCWAIPGQSKAEGNTCFEEDMFAAMDDAIADGVVVMSL  301

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   FT+DG+ALGALHA K+NI V  SAGN    P +++N APWIFTVGASS+D
Sbjct  302   SIGP-SQPVKFTEDGIALGALHAAKKNIVVACSAGNSGPSPSTLSNPAPWIFTVGASSLD  360

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             R F +PV+LGN L ++GE+VT  K +E    PLVYAGDV  PG +  + G C   +LSP+
Sbjct  361   RTFLSPVVLGNGLSIEGETVTPSKLEENKKYPLVYAGDVVNPGVAQNLTGQCLAGSLSPD  420

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KVKGK+VFCL G    +S+ +EV+RAGG   ILG+I   G EI V+  ++ AT +   S 
Sbjct  421   KVKGKIVFCLRGAGMRVSKGMEVKRAGGVGFILGNIKANGGEISVDPHVLPATAVAY-SN  479

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + I++YI + KNP AT+IP +T+   KP+P M  FTS GPS  +PNILKPDITAPGLNI
Sbjct  480   ANRIMEYINSTKNPEATIIPARTVLHTKPAPYMTAFTSRGPSVIDPNILKPDITAPGLNI  539

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAW+EA +P +   DHR  +Y I SGTSMSCPH++A  ALLKAIHP WS AAIKSA+MT
Sbjct  540   LAAWTEAEAPTKLAMDHRVAQYTIESGTSMSCPHIAAAAALLKAIHPTWSSAAIKSALMT  599

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA  KN     + D  G  A PF YGAGH +P+KAA PGLVYD++Y DYLL+ CS     
Sbjct  600   TAGIKNNLDMPLNDESGNAATPFAYGAGHFRPTKAAYPGLVYDASYKDYLLYFCSIGVKN  659

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              DP++KCP+   + +NLNYPS+ I +L G++ +KRT+ NVG+A + Y    K P   SVK
Sbjct  660   FDPNFKCPRSPPTAANLNYPSIEIPKLNGTITIKRTLKNVGNAKSVYFFTSKPPLEISVK  719

Query  358   ISPTELKFMEVGEKQsffvsvkvesvk-----kvgefeFGWYKWSDGIHMVKSPIVVS  200
              SP+ L F  VG+++SF ++VK  +          E+ FGWY W+DG H+V+SPI VS
Sbjct  720   ASPSILFFDHVGQRKSFTITVKARTEMPNEKPLKDEYAFGWYTWTDGPHIVRSPIAVS  777



>ref|XP_002269555.2| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=777

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/600 (54%), Positives = 413/600 (69%), Gaps = 19/600 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KGYE+  GP+N T D+RS RD  GHGTHTASTV GR+V N SA
Sbjct  181   FNSSHCNRKLIGARYYLKGYESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD-DIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LG +A G A+GGAPL RLAIYK CW +P    +K   C ++D+LAA D A+ADGV V+S+
Sbjct  241   LG-YAPGTASGGAPLARLAIYKVCWPIPGQTKVKGNTCYEEDMLAAIDDAIADGVHVLSI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   + +DG+A+GALHA K NI V  SAGN    P +++N APWI TVGASSID
Sbjct  300   SIGT-SQPFTYAKDGIAIGALHATKNNIVVACSAGNSGPAPSTLSNPAPWIITVGASSID  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPG--STTIPGFCRQDTLSPE  1241
             R F  P++LGN + + G+SVT  K K++  PLV+A D  +PG         C   +L P+
Sbjct  359   RAFVTPLVLGNGMKLMGQSVTPYKLKKKMYPLVFAADAVVPGVPKNNTAANCNFGSLDPK  418

Query  1240  KVKGKVVFCLTGGLS----QTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             KVKGK+V CL GG++    + +EV+RAGG   ILG+    G ++  +  L+ AT + +  
Sbjct  419   KVKGKIVLCLRGGMTLRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAVSSED  478

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  I  YI + K P+AT+IPG+T+  AKP+P MA F S GP+  +PNILKPDIT PGLN
Sbjct  479   VTK-IRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFISRGPNTIDPNILKPDITGPGLN  537

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSE SSP     D R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+M
Sbjct  538   ILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALM  597

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA   N  G+ I D+ G    PF YG+GH +P+KAADPGLVYD+TY DYLL++C+    
Sbjct  598   TTAGLVNNIGKPITDSSGNPTNPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVK  657

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
             +LD S+KCPK + S +NLNYPSL I++LK  + V RT TNVGSA + Y   VK+P G+SV
Sbjct  658   SLDSSFKCPKVSPSSNNLNYPSLQISKLKRKVTVTRTATNVGSARSIYFSSVKSPVGFSV  717

Query  361   KISPTELKFMEVGEKQs----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             ++ P+ L F  VG+K+S            S K   E+ FGWY W+DGIH V+SP+ VS A
Sbjct  718   RVEPSILYFNHVGQKKSFDITVEARNPKASKKNDTEYAFGWYTWNDGIHNVRSPMAVSLA  777



>ref|XP_004295413.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/600 (54%), Positives = 417/600 (70%), Gaps = 18/600 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KG+E  +G +N + D RS RD+ GHGTHT+STV GR V NASA
Sbjct  183   FNSSHCNRKLIGARYYLKGFEQYYGLLNVSEDSRSPRDMDGHGTHTSSTVAGRVVPNASA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGAPL  +A+YK CW +P     +   C ++D+ AA D A+ADGV V+S+
Sbjct  243   LGGFASGSASGGAPLAHIAVYKVCWAIPGQSKAEGNTCFEEDMFAAMDDAIADGVDVMSL  302

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G       FT+DG+ALGALHA K+NI V  SAGN    P +++N APWIFTVGASS+D
Sbjct  303   SIGT-SHPVKFTEDGIALGALHAAKKNILVACSAGNSGPSPSTLSNPAPWIFTVGASSLD  361

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             R F +PV+LGN L ++GE+VT  K +E    PLVYAGDV  PG +  + G C   +LSP+
Sbjct  362   RTFMSPVVLGNGLSIEGETVTPSKLEENKKYPLVYAGDVVNPGVAQNLTGQCLAGSLSPD  421

Query  1240  KVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KVKGK+VFCL G    +S+ +EV+RAGGA  ILG+    G EI V+  ++ AT +   S 
Sbjct  422   KVKGKIVFCLRGVGMRVSKGMEVKRAGGAGFILGNSKANGGEISVDPHVLPATAV-TYSN  480

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + I++YI + +NP AT+IP +T+   KP+P M  FTS GPS  +PNILKPDITAPGLNI
Sbjct  481   ANRIMEYINSTENPEATIIPARTVLHTKPAPYMTAFTSRGPSVIDPNILKPDITAPGLNI  540

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAW+   +P +   DHR  +Y I SGTSMSCPH++A  ALLKAIHP WS AAIKSA+MT
Sbjct  541   LAAWTGGEAPTKLAMDHRVAQYTIESGTSMSCPHIAAAAALLKAIHPTWSSAAIKSALMT  600

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA  KN     + D  G  A PF YGAGH +P+KAADPGLVYD++Y DYLL+ CS     
Sbjct  601   TAGIKNNLHMPLNDESGNAATPFAYGAGHFRPTKAADPGLVYDASYKDYLLYFCSIGVKN  660

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              DP++KCP+   +  NLNYPS+AI +L G++ +KRTVTNVG+A + Y    K P G SVK
Sbjct  661   FDPNFKCPRSPPTAVNLNYPSIAIPKLNGTITIKRTVTNVGNAKSVYFFTSKPPLGISVK  720

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvge-----feFGWYKWSDGIHMVKSPIVVSSA  194
              SP+ L F  VG+++SF ++VK  +     +     + FGWY W+DG H+V+SPI VS A
Sbjct  721   ASPSILFFDHVGQRKSFTITVKARTEMLNEKPLKDEYAFGWYTWTDGPHIVRSPIAVSLA  780



>ref|XP_002269375.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=778

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/601 (54%), Positives = 414/601 (69%), Gaps = 20/601 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRK+IGARY++KGYE+  GP+N T D+RS RD  GHGTHTASTV GR+V N SA
Sbjct  181   FNSSDCNRKLIGARYYLKGYESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD-DIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LG +A G A+GGAPL RLAIYK CW +P    +K   C ++D+LAA D A+ADGV V+S+
Sbjct  241   LG-YAPGTASGGAPLARLAIYKVCWPIPGQTKVKGNTCYEEDMLAAIDDAIADGVHVLSI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSID  1412
             S+G      Y  +DG+A+GALHA K NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  300   SIGTSTPFTY-AKDGIAIGALHATKNNIVVACSAGNSGPGPSTLSNPAPWIITVGASSVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPG--STTIPGFCRQDTLSPE  1241
             R F  P++LGN + + GESVT  K K++  PLV+A DV +PG         C   +L P+
Sbjct  359   RAFVTPLVLGNGMKLMGESVTPYKLKKKMYPLVFAADVVVPGVPKNNTAANCNFGSLDPK  418

Query  1240  KVKGKVVFCLTGGLS----QTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             KVKGK+V CL GG++    + +EV+RAGG   ILG+    G ++  +  L+ AT + +  
Sbjct  419   KVKGKLVLCLRGGIALRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAVSSED  478

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  I  YI + K P+AT+IPG+T+  AKP+P MA FTS GP+  +PNILKPDIT PGLN
Sbjct  479   VTK-IRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDITGPGLN  537

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSE SSP     D R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+M
Sbjct  538   ILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALM  597

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA   N  G+ I D+ G  A PF YG+GH +P+KAADPGLVYD+TY DYLL++C+    
Sbjct  598   TTAGLVNNIGKPITDSSGNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVK  657

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
             +LD S+ CPK + S +NLNYPSL I++LK  + + RTVTNVGSA + Y   VK+P G+SV
Sbjct  658   SLDSSFNCPKVSPSSNNLNYPSLQISKLKRKVTITRTVTNVGSARSIYFSSVKSPVGFSV  717

Query  361   KISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             ++ P+ L F  VG+K+S        + K        E+ FGWY W+DGIH V+SP+ VS 
Sbjct  718   RVEPSILYFNHVGQKKSFCITVEARNPKASKKNDAEEYAFGWYTWNDGIHNVRSPMAVSL  777

Query  196   A  194
             A
Sbjct  778   A  778



>ref|XP_009351978.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/602 (54%), Positives = 412/602 (68%), Gaps = 20/602 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV-NHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SSHCNRK+IGARY++KGYE  +G V N + D+RS RD+ GHGTHT+STV GR V NA+
Sbjct  182   FNSSHCNRKLIGARYYLKGYEQYYGHVVNASEDYRSPRDMDGHGTHTSSTVAGRVVPNAA  241

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLAIYK CW +P    +    C ++D+LAA D A+ DGV V+S
Sbjct  242   ALGGFALGTASGGAPLARLAIYKVCWAIPGHSKVGGNTCFEEDMLAAIDDAIGDGVDVLS  301

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             +S+GL    NY T DG+A+GALHA K+NI V  SAGN    P ++ N APWI TVGASS+
Sbjct  302   ISVGLSQPVNY-TNDGIAIGALHATKKNIVVACSAGNSGPAPSTLVNSAPWIITVGASSL  360

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             DR F APV+LGN + ++GE+VT  K +E    PLVYA DV   G    + G C   +LSP
Sbjct  361   DRAFIAPVVLGNGITIEGETVTPSKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSP  420

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             EKVKGK+V C+ G    + + +EV+RAGG   ILG+    G EI  ++ +I AT++    
Sbjct  421   EKVKGKIVLCMRGSGMRVVKGMEVKRAGGVGFILGNSAENGVEIACDAHVIPATSVLYKD  480

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + IL+YI + K P AT+IP +T+   KP+P MA FTS GP+  +PN LKPDITAPGLN
Sbjct  481   A-NRILQYINSTKIPTATIIPARTVLNRKPAPFMAAFTSRGPNIIDPNFLKPDITAPGLN  539

Query  901   ILAAWSEASSPLEQPE-DHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             ILAAW+EA  P +    D R V+YNI SGTSMSCPHV+A  AL+KAIHP WSGAAI+SAI
Sbjct  540   ILAAWTEADPPTKLSGIDRRVVQYNIYSGTSMSCPHVAAAAALVKAIHPTWSGAAIRSAI  599

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MTTA  +N  G  + D  G VA PF YGAGH +P+KAADPGLVYD++Y DYL ++CS  G
Sbjct  600   MTTAGIRNNLGLPLNDESGSVATPFAYGAGHFRPTKAADPGLVYDASYKDYLQYICSIGG  659

Query  544   TT-LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 DP++KCP    +  NLNYPS+AI +LK +M++KRTVTNVG++ + Y    K P G 
Sbjct  660   AKDFDPTFKCPTSPPAAINLNYPSIAIPKLKDAMIIKRTVTNVGNSKSIYFFTAKPPLGI  719

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF----GWYKWSDGIHMVKSPIVVS  200
             SVK SP+ L F  VG+K+SF ++VK          +     GWY W+DG++ V+S I VS
Sbjct  720   SVKASPSILFFDNVGQKKSFTITVKARREVLSKHSKDEYVFGWYTWTDGLYTVRSAIAVS  779

Query  199   SA  194
              A
Sbjct  780   LA  781



>ref|XP_008371534.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=780

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/603 (54%), Positives = 410/603 (68%), Gaps = 22/603 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV-NHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SSHCNRK+IGARY++KGYE  +G V N + D+RS RD+ GHGTHT+STV GR V NA+
Sbjct  181   FNSSHCNRKLIGARYYLKGYEQYYGNVVNASEDYRSPRDMDGHGTHTSSTVAGRVVPNAA  240

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLAIYK CW +P    +    C ++D+LAA D A+ DGV V+S
Sbjct  241   ALGGFALGTASGGAPLARLAIYKVCWAIPGQSKVGGNTCFEEDMLAAIDDAIGDGVDVLS  300

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             +S+G     NY T DG+A+GALHA K+NI V  SAGN    P ++ N APWI TVGASSI
Sbjct  301   ISIGPSQPVNY-TNDGMAIGALHATKKNIVVACSAGNSGPAPSTLVNSAPWIITVGASSI  359

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             DR F APV+LGN + ++GE+VT  K +E    PLVYA DV   G    + G C   +LSP
Sbjct  360   DRAFIAPVVLGNGITIEGETVTPSKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSP  419

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             EKVKGK+V C+ G    + + +EV+RAGG   ILG+    G EI  ++ +I AT++    
Sbjct  420   EKVKGKIVLCMRGSGMRVVKGMEVKRAGGVGFILGNSAENGVEIACDAHVIPATSVLYKD  479

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + IL+YI + K P AT+IP +T+   KP+P MA FTS GP+  +PN LKPDITAPGLN
Sbjct  480   A-NRILQYINSTKIPTATIIPARTVLNRKPAPFMAAFTSRGPNIIDPNFLKPDITAPGLN  538

Query  901   ILAAWSEASSPLEQPE-DHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             ILAAW+EA  P +    DHR V YNI SGTSMSCPHV+A  AL+KAIHP WSGAAI+SAI
Sbjct  539   ILAAWTEADPPTKLSGIDHRVVLYNIHSGTSMSCPHVAAAAALVKAIHPTWSGAAIRSAI  598

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MTTA  +N     + D  G VA PF YGA H +P+KAADPGLVYD++Y DYL ++C SIG
Sbjct  599   MTTAGIRNNVXLPLNDESGSVATPFAYGAXHFRPTKAADPGLVYDASYKDYLQYIC-SIG  657

Query  544   TT--LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
                  DP++KCPK   +  NLNYPS+AI +LK +M++KRTVTNVG++ + Y    K P G
Sbjct  658   EAKDFDPTFKCPKSPPAAINLNYPSIAIPKLKDAMIIKRTVTNVGNSKSIYFFTAKPPLG  717

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF----GWYKWSDGIHMVKSPIVV  203
              SVK SP+ L F  VG+K+SF ++VK                GWY W+DG + V+SPI V
Sbjct  718   ISVKASPSILFFDHVGQKKSFTITVKARREMLSKHSTDDYVFGWYTWTDGFYTVRSPIAV  777

Query  202   SSA  194
             S A
Sbjct  778   SLA  780



>ref|XP_002458431.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
 gb|EES03551.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
Length=785

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/598 (53%), Positives = 412/598 (69%), Gaps = 19/598 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+SS CNRKIIGARY+VK YEA +  +N T  FRS RD  GHGTHTASTV GR V   SA
Sbjct  187   FSSSSCNRKIIGARYYVKAYEAHYKGLNTTNAFRSPRDHDGHGTHTASTVAGRTVPGVSA  246

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFANG A+GGAPL RLA+YK CW +P    +I+ T C + D+LAA D AV DGV V+S
Sbjct  247   LGGFANGTASGGAPLARLAVYKVCWPIPGPNPNIENT-CFEADMLAAMDDAVGDGVDVMS  305

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G       F  DG+ALGALHA KR + V  S GN   +P +V+N+APW+ TV ASSI
Sbjct  306   VSIGSSGAPLRFADDGIALGALHAAKRGVVVSCSGGNSGPKPATVSNLAPWMLTVAASSI  365

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGST-TIPGFCRQDTLSP  1244
             DR F +P+ LGN ++V G++VT  ++   +  PLVYA D  +PG+   +   C  ++LS 
Sbjct  366   DRAFHSPIKLGNGVMVMGQTVTPYQLPGNKPYPLVYAADAVVPGTAANVSNQCLPNSLSS  425

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPS  1082
             +KV+GK+V CL G    + + LEV+RAGGAA++LG   + GSE+ V++ ++  T +   +
Sbjct  426   DKVRGKIVVCLRGAGLRVEKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTAVA-AA  484

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + IL YI ++ +P A L P +T+   +PSP MA F+S GP+  EP+ILKPDITAPGLN
Sbjct  485   DANTILSYIKSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITAPGLN  544

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS+ASSP +   DHR V+YNI+SGTSMSCPHVSA   L+KA HPDWS AAI+SAIM
Sbjct  545   ILAAWSQASSPTKLDGDHRVVQYNIMSGTSMSCPHVSAAAVLVKAAHPDWSSAAIRSAIM  604

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI--  548
             TTATT N +G  + +  G VAGP  YG+GHI+P  A DPGLVYD++Y DYLLF C+S   
Sbjct  605   TTATTNNAEGGPLMNGDGSVAGPMDYGSGHIRPKHALDPGLVYDASYQDYLLFACASAGS  664

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             G+ LDPS+ CP +   P  LN+PS+A+  L GS+ V RTVTNVGS    Y+V V  P G 
Sbjct  665   GSQLDPSFPCPARPPPPYQLNHPSVAVHGLNGSVTVHRTVTNVGSGEARYTVAVVEPAGV  724

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefe--FGWYKWSD-GIHMVKSPIVV  203
             SVK+SP  L F   GEK++F ++++ ++   V   +   G Y WSD G H+V+SPIVV
Sbjct  725   SVKVSPKRLSFARTGEKKAFRITMEAKAGSSVVRGQFVAGSYAWSDGGAHVVRSPIVV  782



>ref|XP_004969820.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=785

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/596 (53%), Positives = 408/596 (68%), Gaps = 24/596 (4%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRKIIGARY++K YEA +  +N T+ FRS RD  GHGTHTASTV GR V   SALGGFA
Sbjct  191   CNRKIIGARYYLKAYEAHYKALNTTYAFRSPRDHDGHGTHTASTVAGRTVPGVSALGGFA  250

Query  1750  NGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
              G A+GGAPL RLA+YK CW +P    +I+ T C + D+LAA D AV DGV V+SVS+G 
Sbjct  251   AGTASGGAPLARLAVYKVCWPIPGPNPNIENT-CFEADMLAAMDDAVGDGVDVMSVSIGS  309

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
                   F  DG+A+GALHA +R + V  S GN   +P +V+N+APW+ TVGASSIDR F 
Sbjct  310   SGAPMRFEDDGIAVGALHAARRGVVVSCSGGNSGPKPATVSNLAPWMLTVGASSIDRAFD  369

Query  1399  APVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSPEKVKG  1229
             +P+ LGN + + G++VT  ++   +  P+VYA D  +PG+   +   C  ++LS +KV+G
Sbjct  370   SPIKLGNGVGIMGQTVTPFQLPGNKPYPMVYAADAVVPGTPANVSNQCLPNSLSADKVRG  429

Query  1228  KVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDA-  1070
             K+V CL G    + + LEV+RAGGAA++LG   + GSE+ V++ ++  T +   S  DA 
Sbjct  430   KIVVCLRGSGLRVGKGLEVKRAGGAAILLGNPPASGSEVPVDAHILPGTAV---SAADAK  486

Query  1069  -ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              IL YI ++ +P A L+P +T+   +PSP MA F+S GP+  EPNILKPDITAPGLNILA
Sbjct  487   TILGYINSSSSPTAVLVPSRTVVDVRPSPVMAQFSSRGPNVLEPNILKPDITAPGLNILA  546

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWSEASSP +   DHR V+YNI+SGTSMSCPHVSA V LLKA HPDWS AAI+SAIMTTA
Sbjct  547   AWSEASSPTKLDGDHRVVQYNIMSGTSMSCPHVSAAVLLLKAAHPDWSAAAIRSAIMTTA  606

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLD  533
             TT N +G  I +  G V GP  YG+GHI+P+ A DPGLVYD++Y DYL F C+S G+ LD
Sbjct  607   TTNNAEGGPIMNGDGSVGGPMDYGSGHIRPNHALDPGLVYDASYEDYLSFACASAGSQLD  666

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKIS  353
              S  CP +   P  LN+PS+A+  L G++ V+RTVTNVGS    Y+V V  P G SVK+S
Sbjct  667   RSVPCPARPPPPYQLNHPSVAVHGLNGTVTVRRTVTNVGSGEARYAVAVAEPAGVSVKVS  726

Query  352   PTELKFMEVGEKQsffvsvkvesvkkvg------efeFGWYKWSDGIHMVKSPIVV  203
             P  L+F   GEK+ F + ++  +           +F  G Y WSDG+H+V+SPIVV
Sbjct  727   PRRLRFARAGEKKVFTIRMEARATGTSNGGVVRGQFVAGSYAWSDGVHVVRSPIVV  782



>ref|XP_008383532.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=778

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/600 (53%), Positives = 405/600 (68%), Gaps = 18/600 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY+ KG+E  +G +N + D+RS RD+ GHGTHT+STV GR V N SA
Sbjct  181   FNSSHCNRKLIGARYYXKGFEQFYGHLNASEDYRSPRDMDGHGTHTSSTVAGRVVPNTSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G A+GGAPL RLAIYK CW +P         C ++D+LAA D A+ DGV V+S+
Sbjct  241   LGGFALGTASGGAPLARLAIYKVCWAIPGQSKADGNTCFEEDMLAAIDDAIGDGVDVLSI  300

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G     NY T DG+A+GALHA K+NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  301   SIGTKKPVNY-TNDGIAIGALHATKKNIVVACSAGNNGPAPSTLSNPAPWIITVGASSLD  359

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             R F APV+LGN + ++GE+VT  K +E    PLVYA DV   G    + G C   +LSPE
Sbjct  360   RAFVAPVVLGNGITIEGETVTPSKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSPE  419

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSIGS---EIQVESFLITATNIFNPSG  1079
             KVKG +V C+ G    + + +EV+RAGG   ILG+  +   EI  ++ +I AT +     
Sbjct  420   KVKGNIVLCMRGSGMRVGKGMEVKRAGGVGFILGNSAANXVEISCDAHVIPATAVLY-ED  478

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + IL+YI + K P AT+IP +T+F  KP+P M  FTS GP+  +PN LKPDITAPGLNI
Sbjct  479   ABRILQYINSTKIPTATIIPARTVFNRKPAPFMXAFTSRGPNLIDPNFLKPDITAPGLNI  538

Query  898   LAAWSEASSPLEQPE-DHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             LAAW+EA  P +    DHR V YNI SGTSMSCPHV+A   L+KAIHP WS AAI+SAIM
Sbjct  539   LAAWTEADPPTKLSGIDHRVVXYNIYSGTSMSCPHVAAAAVLVKAIHPTWSSAAIRSAIM  598

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-SIG  545
             TTA  +N  G  +KD  G VA PF YGAGH +P+KAADPGLVYD++Y DYL ++CS  + 
Sbjct  599   TTAEIRNKLGLPLKDESGSVATPFAYGAGHFRPTKAADPGLVYDASYKDYLQYICSIGVA  658

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               +DP++ CPK   +  NLNYPS+AI +LK +M +KRTVTNVG + + Y    K P G S
Sbjct  659   KNVDPTFNCPKSPPTAINLNYPSIAIPKLKDTMTIKRTVTNVGDSKSIYFFTXKPPLGIS  718

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF---GWYKWSDGIHMVKSPIVVSSA  194
             +K SP+ L F   G+K+SF V+VK        +      GWY W+DG+H V+SPI VS A
Sbjct  719   IKASPSMLFFDHFGQKKSFTVTVKARREMLSKQGNEYVFGWYTWTDGLHTVRSPIAVSLA  778



>gb|EEC71416.1| hypothetical protein OsI_03596 [Oryza sativa Indica Group]
Length=778

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/597 (53%), Positives = 412/597 (69%), Gaps = 18/597 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+ S CNRKIIGARY+VK YEA +G VN T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  181   FSPSSCNRKIIGARYYVKAYEARYGAVNTTNAYRSPRDHDGHGTHTASTVAGRTVPGVAA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL R+A+YK CW +P    +I+ T C + D+LAA D AV DGV V+S
Sbjct  241   LGGFAPGTASGGAPLARVAVYKVCWPIPGPNPNIENT-CFEADMLAAIDDAVGDGVDVMS  299

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G   +   F +DG+A+GALHA  R + +V S GN   +P +V+N+APW+ TV ASSI
Sbjct  300   VSIGSTGKPLPFAEDGIAVGALHAAMRGVVLVCSGGNSGPKPATVSNLAPWMLTVAASSI  359

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F +P+ LGN +++ G++VT  ++   +  PLVYA D  +PG+   +   C   +L+P
Sbjct  360   DRAFISPIKLGNGMVIMGQTVTPYQLPGNKPYPLVYAADAVVPGTPANVSNQCLPKSLAP  419

Query  1243  EKVKGKVVFCLTG-GL--SQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPS  1082
             EKV+GK+V CL G GL   + LEV++AGGAA+ILG   + G E+ V++ ++  T + +  
Sbjct  420   EKVRGKIVVCLRGTGLRVEKGLEVKQAGGAAIILGNPPAFGGEVPVDAHVLPGTAVSSVD  479

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               ++I++YI ++ +P A L P +T+   KPSP MA F+S GP+  EPNILKPD+TAPGLN
Sbjct  480   -VNSIIRYINSSSSPTAVLDPSRTVVDVKPSPVMAQFSSRGPNVNEPNILKPDVTAPGLN  538

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HP WS AAI+SAIM
Sbjct  539   ILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPGWSSAAIRSAIM  598

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTATT N +G  + DA G VAGP  YG+GHI+P  A DPGLVYD++Y DYLLF C+S G 
Sbjct  599   TTATTSNAEGGPMMDADGTVAGPIDYGSGHIRPKHALDPGLVYDASYQDYLLFACASGGA  658

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S  CP     P  LN+PSLAI  L GS+ V+RTVTNVG  +  YSV V  P G SV
Sbjct  659   QLDHSLPCPATPPPPYQLNHPSLAIHGLNGSVTVQRTVTNVGQGSARYSVAVVEPMGVSV  718

Query  361   KISPTELKFMEVGEKQsffvsvkvesv----kkvgefeFGWYKWSDGIHMVKSPIVV  203
             K+SP  L F   GEK+SF + ++        +  G+F  G Y WSDG+H+V+SP+VV
Sbjct  719   KVSPRSLSFARTGEKKSFRIKIEATKGRGGWRVNGQFVAGSYTWSDGVHVVRSPLVV  775



>ref|XP_008225402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=780

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/601 (52%), Positives = 413/601 (69%), Gaps = 19/601 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KG+E  +GP+N + D++S RD+ GHGTHT+STV GR V NASA
Sbjct  182   FNSSHCNRKLIGARYYLKGFEHNYGPLNASEDYQSPRDMDGHGTHTSSTVAGRLVPNASA  241

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G A+GGAPL  LAIYK CW +P         C ++D+ AA D A+ DGV V+S+
Sbjct  242   MGGFARGTASGGAPLAHLAIYKVCWAIPGQSKADGNTCFEEDMFAAIDDAIGDGVDVLSI  301

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G     NY T DG++LGALHA K+NI V  SAGN    P +++N APW+ TVGASS+D
Sbjct  302   SIGTSQPVNY-TSDGISLGALHATKKNIVVACSAGNSGPAPATLSNPAPWVITVGASSLD  360

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             R F +PV+LGN + +KGE+VT  K +E    PLVYA DV   G    + G C   +LSPE
Sbjct  361   RAFVSPVVLGNGIRLKGETVTPSKLEENNMYPLVYAADVINTGVPKDMAGQCLPGSLSPE  420

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KVKGK+V C+ G    + + +EV+RAGG   ILG+    G EI  ++ ++ AT++ +   
Sbjct  421   KVKGKIVLCMRGSGVRVGKGMEVKRAGGVGFILGNSAANGIEIACDAHVLPATSVLHKDA  480

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + IL+YI + K+P+AT+IP +T+   KP+P MA F+S GP+  +PNILKPDITAPGLNI
Sbjct  481   -NRILQYIKSTKHPIATIIPARTVLHTKPAPFMASFSSRGPNVIDPNILKPDITAPGLNI  539

Query  898   LAAWSEASSPLE-QPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             LAAWSEA  P +    DHR  +YNI SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+M
Sbjct  540   LAAWSEADPPSKLNGIDHRVAQYNIYSGTSMSCPHVAAAAALLKAIHPSWSSAAIRSALM  599

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG-  545
             TTA  +N     + D  G  A PF YG+GH +P+KAADPGLVYD++Y DYLL++CS  G 
Sbjct  600   TTAEIRNNLDMPLNDESGNAATPFAYGSGHFRPTKAADPGLVYDASYRDYLLYMCSIGGF  659

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               +DP +KCP+   + +NLNYPS+AI++L  ++ +KRTVTNVG+  + Y    K P G S
Sbjct  660   KDVDPKFKCPRSPPTATNLNYPSIAISKLNSAITIKRTVTNVGAGKSIYFFTSKPPLGIS  719

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF----GWYKWSDGIHMVKSPIVVSS  197
             VK SP+ L F  VG+K+SF ++VK          +     GWY W+DG+H V+SPI VS 
Sbjct  720   VKASPSMLFFDHVGQKKSFTITVKARKEMLSEHDKDEYVFGWYTWTDGLHTVRSPIAVSL  779

Query  196   A  194
             A
Sbjct  780   A  780



>dbj|BAB21149.1| subtilisin-like proteinase-like [Oryza sativa Japonica Group]
 dbj|BAB90087.1| subtilisin-like proteinase-like [Oryza sativa Japonica Group]
Length=778

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/597 (53%), Positives = 411/597 (69%), Gaps = 18/597 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+ S CNRKIIGARY+VK YEA +G VN T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  181   FSPSSCNRKIIGARYYVKAYEARYGAVNTTNAYRSPRDHDGHGTHTASTVAGRTVPGVAA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL R+A+YK CW +P    +I+ T C + D+LAA D AV DGV V+S
Sbjct  241   LGGFAPGTASGGAPLARVAVYKVCWPIPGPNPNIENT-CFEADMLAAIDDAVGDGVDVMS  299

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G   +   F +DG+A+GALHA  R + +V S GN   +P +V+N+APW+ TV ASSI
Sbjct  300   VSIGSTGKPLPFAEDGIAVGALHAAMRGVVLVCSGGNSGPKPATVSNLAPWMLTVAASSI  359

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F +P+ LGN +++ G++VT  ++   +  PLVYA D  +PG+   +   C   +L+P
Sbjct  360   DRAFISPIKLGNGMVIMGQTVTPYQLPGNKPYPLVYAADAVVPGTPANVSNQCLPKSLAP  419

Query  1243  EKVKGKVVFCLTG-GL--SQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPS  1082
             EKV+GK+V CL G GL   + LEV+ AGGAA+ILG   + G E+ V++ ++  T + +  
Sbjct  420   EKVRGKIVVCLRGTGLRVEKGLEVKLAGGAAIILGNPPAFGGEVPVDAHVLPGTAVSSVD  479

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               +AI++YI ++ +P A L P +T+   KPSP MA F+S GP+  EPNILKPD+TAPGLN
Sbjct  480   -VNAIIRYINSSSSPTAVLDPSRTVVDVKPSPVMAQFSSRGPNVNEPNILKPDVTAPGLN  538

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HP WS AAI+SAIM
Sbjct  539   ILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPGWSSAAIRSAIM  598

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTATT N +G  + DA G VAGP  YG+GHI+P  A DPGLVYD++Y DYLLF C+S G 
Sbjct  599   TTATTSNAEGGPMMDADGTVAGPIDYGSGHIRPKHALDPGLVYDASYQDYLLFACASGGA  658

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S  CP     P  LN+PSLAI  L GS+ V+RTVTNVG  +  YSV V  P G SV
Sbjct  659   QLDHSLPCPATPPPPYQLNHPSLAIHGLNGSVTVQRTVTNVGQGSARYSVAVVEPMGVSV  718

Query  361   KISPTELKFMEVGEKQsffvsvkvesv----kkvgefeFGWYKWSDGIHMVKSPIVV  203
             K+SP  L F   GEK+SF + ++        +  G+F  G Y WSDG+H+V+SP+VV
Sbjct  719   KVSPRSLSFARTGEKKSFRIKIEATKGRGGWRVNGQFVAGSYTWSDGVHVVRSPLVV  775



>ref|XP_004134922.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004169531.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN49345.1| hypothetical protein Csa_6G520430 [Cucumis sativus]
Length=791

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/610 (52%), Positives = 416/610 (68%), Gaps = 32/610 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F S+HCNRKIIGARY++KGYE  FG +N T D+RS  D  GHG+HTAS  GGR+V N SA
Sbjct  186   FQSAHCNRKIIGARYYLKGYEHHFGRLNKTADYRSPCDKDGHGSHTASIAGGRRVYNVSA  245

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA--TFCQDDDVLAAFDHAVADGVQVIS  1592
              GG A G A+GGAP  RLAIYK CW +P + +KA    C D D+LAA D A+ADGV V+S
Sbjct  246   FGGVAWGTASGGAPWARLAIYKVCWAIP-NQMKALGNVCFDTDMLAAMDDAIADGVDVLS  304

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSI  1415
             +S+G     NY T DG+A+GALHA+K++I V  SAGNY   P +++NVAPWI TVGAS++
Sbjct  305   LSIGKSEPYNY-TDDGMAIGALHAVKKDIVVSCSAGNYGPTPSALSNVAPWIITVGASTV  363

Query  1414  DRVFSAPVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F +PV+LGN L +KG SV  +++++++  PLVYAGD+  P +     G C   +LS 
Sbjct  364   DREFYSPVILGNGLKIKGLSVAPSKLERKKMYPLVYAGDIMNPHAPRNQSGLCVAGSLSH  423

Query  1243  EKVKGKVVFCLTG-GLSQ---TLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNP  1085
             EK KGK+V C  G G+S+   +LEV+R+GGA +ILG   ++G     +   + AT +   
Sbjct  424   EKAKGKIVLCFRGEGISRFAGSLEVQRSGGAGMILGNVPAVGRRPHADPHFVPATAV---  480

Query  1084  SGTDA--ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAP  911
             S  DA  ILKYI + KNP AT++P  TI+G++P+PAMA F+S GP+  +P+ LKPDITAP
Sbjct  481   SYEDANIILKYIKSRKNPTATIVPPVTIYGSRPAPAMANFSSRGPNPIDPHFLKPDITAP  540

Query  910   GLNILAAWSEASSPLEQPE--DHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAI  737
             G++ILAAWSE  SP + P+  D R V+YN+ SGTSMSCPHVSA  ALL+AIHP WS AAI
Sbjct  541   GVDILAAWSEQDSPTKLPKYLDPRIVQYNLYSGTSMSCPHVSAAAALLRAIHPTWSQAAI  600

Query  736   KSAIMTTATTKNVKGEAIKDAY---GEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLL  566
             +SA+MTT+TT N  G+ I D        A PF +G+GH +PSKAADPGLVYDS Y DYL 
Sbjct  601   RSALMTTSTTNNKYGQPITDDSTLDNSPATPFSFGSGHFRPSKAADPGLVYDSNYTDYLH  660

Query  565   FVCSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV-GSANTTYSVE  389
             ++C     ++DPS+KCP +A  P +LNYPS+A+ QL+  + +KRTVTNV G     Y  +
Sbjct  661   YLCGLKMNSIDPSFKCPPRALHPHDLNYPSIAVPQLRNVVRIKRTVTNVGGGGKNVYFFK  720

Query  388   VKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF------GWYKWSDGIH  227
              +AP G +V  SP  L F  VGE++ F +++  +        +       GW+ WSDGIH
Sbjct  721   SEAPRGVAVSASPNILYFNRVGERKKFTITISRKVNNNNRSSKKGEDYSFGWFAWSDGIH  780

Query  226   MVKSPIVVSS  197
              V+SPI VSS
Sbjct  781   YVRSPIAVSS  790



>ref|NP_199378.1| subtilase family protein [Arabidopsis thaliana]
 dbj|BAB09208.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAC42684.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AAO64099.1| putative subtilisin [Arabidopsis thaliana]
 gb|AED95280.1| subtilase family protein [Arabidopsis thaliana]
Length=791

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/602 (52%), Positives = 411/602 (68%), Gaps = 20/602 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  +G  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  192   FNSSHCNRKIIGARYYVKGYERYYGAFNATANKDFLSPRDPDGHGSHTASTAVGRRVLGA  251

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLAIYKACW  P  + ++   C ++D+LAA D A+ADGV VI
Sbjct  252   SALGGFAKGSASGGAPLARLAIYKACWAKPNAEKVEGNICLEEDMLAAIDDAIADGVHVI  311

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASS  1418
             S+S+G   +   FTQDG+A+GALHA+KRNI V  SAGN   +P +++N+APWI TVGAS+
Sbjct  312   SISIGTT-EPFPFTQDGIAMGALHAVKRNIVVAASAGNSGPKPGTLSNLAPWIITVGAST  370

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             +DR F   ++LGN   +K +S+T  K  +  PLVYA +V +PG +      C  ++L PE
Sbjct  371   LDRAFVGGLVLGNGYTIKTDSITAFKMDKFAPLVYASNVVVPGIALNETSQCLPNSLKPE  430

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
              V GKVV CL G    + + +EV+RAGGA +ILG+I   G+E+  +S  +    +  P+ 
Sbjct  431   LVSGKVVLCLRGAGSRIGKGMEVKRAGGAGMILGNIAANGNEVPSDSHFVPTAGV-TPTV  489

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              D IL+YI T+KNP A + PGKT++  + +P+M  F+S GP+  +PNILKPDITAPGL I
Sbjct  490   VDKILEYIKTDKNPKAFIKPGKTVYKYQAAPSMTGFSSRGPNVVDPNILKPDITAPGLYI  549

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWS A SP +   D R   YNI SGTSMSCPHV+  +ALLKAIHP WS AAI+SA+MT
Sbjct  550   LAAWSGADSPSKMSVDQRVAGYNIYSGTSMSCPHVAGAIALLKAIHPKWSSAAIRSALMT  609

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA   N K + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS   T 
Sbjct  610   TAWMTNDKKKPIQDTTGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNITN  669

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPTGYS  365
             +DP++KCP K     N NYPS+A+  LK ++ VKRTVTNVG+ N  +TY   VK P+G S
Sbjct  670   IDPTFKCPSKIPPGYNHNYPSIAVPNLKKTVTVKRTVTNVGTGNSTSTYLFSVKPPSGIS  729

Query  364   VKISPTELKFMEVGEKQsff-----vsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
             VK  P  L F  +G+KQ F      +  +V +  + G+++FGW+ W+D +H+V+SPI VS
Sbjct  730   VKAIPNILSFNRIGQKQRFKIVIKPLKNQVMNATEKGQYQFGWFSWTDKVHVVRSPIAVS  789

Query  199   SA  194
              A
Sbjct  790   LA  791



>ref|XP_002863463.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39722.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=791

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/603 (52%), Positives = 411/603 (68%), Gaps = 22/603 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVN--HTFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  FG  N   T DF S RD  GHG+HTAST  GR+V  A
Sbjct  192   FNSSHCNRKIIGARYYVKGYERYFGAFNVTETKDFLSPRDPDGHGSHTASTAVGRRVYGA  251

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLAIYKACW  P  + I+   C ++D+LAA D A+ADGV VI
Sbjct  252   SALGGFAMGSASGGAPLARLAIYKACWAKPNVEKIEGNTCLEEDMLAAIDDAIADGVHVI  311

Query  1594  SVSLGLLPQDNY-FTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGAS  1421
             S+S+G    + Y F QDG+A+GALHA+KRNI V  SAGN   +P +++N+APWI TVGAS
Sbjct  312   SISIGT--SEPYPFLQDGIAMGALHAVKRNIVVAASAGNSGPKPGTLSNMAPWIITVGAS  369

Query  1420  SIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             ++DRVF   ++LGN   +K  S+T  K  +  PLVYA +V +PG +      C  ++L P
Sbjct  370   TLDRVFIGGLVLGNGYTIKTNSITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSLKP  429

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             E V GKVV CL G    + + +EV+RAGGA +ILG++   G+EI  +S  +    +  P+
Sbjct  430   ELVTGKVVLCLRGAGTRIGKGIEVKRAGGAGMILGNVAANGNEIPTDSHFVPTAGV-TPT  488

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               D IL+YI T+KNP+A + PGKT++  + +P+M  F+S GP+  +PNILKPDITAPGLN
Sbjct  489   VVDKILEYIKTDKNPMAFIKPGKTVYKYQAAPSMTGFSSRGPNVLDPNILKPDITAPGLN  548

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS A SP +   D R   YNI SGTSMSCPHV+  +ALLKAIHP WS AAI+SA+M
Sbjct  549   ILAAWSGADSPSKMSVDQRVADYNIYSGTSMSCPHVAGAIALLKAIHPKWSSAAIRSALM  608

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             T+A   N K + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS   T
Sbjct  609   TSAWMTNDKKKPIQDTTGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVNIT  668

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPTGY  368
              +DP++KCP K     N NYPS+A+  L  ++ VKRTVTNVG+ N  +TY    K P+G 
Sbjct  669   NIDPTFKCPSKIPPGYNHNYPSIAVPNLNKTVTVKRTVTNVGNGNSTSTYLFSAKPPSGV  728

Query  367   SVKISPTELKFMEVGEKQsff-----vsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SVK  P  L F  +G+KQ F      +  +V +  + G+++FGW+ W+D +H+V+SPI V
Sbjct  729   SVKAIPNVLFFNRIGQKQRFKIVIKPLKNQVMNATEKGQYQFGWFSWTDKVHVVRSPIAV  788

Query  202   SSA  194
             S A
Sbjct  789   SLA  791



>ref|XP_010052139.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=776

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/598 (51%), Positives = 407/598 (68%), Gaps = 18/598 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +SHCNRK+IGAR++VKGYE  +GP++ T D+RS RD  GHGTHTASTVGGR+VAN SA
Sbjct  183   FDASHCNRKLIGARFYVKGYENYYGPLDTTLDYRSPRDKDGHGTHTASTVGGRRVANISA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGAPL  LAIYKACW +P    +    C ++D+LAA D A+ DGV V+S+
Sbjct  243   LGGFAHGTASGGAPLVHLAIYKACWAIPNVSKVDGNTCFEEDMLAAMDDAIGDGVDVMSI  302

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   + +DG+ALGA HA K NI VV SAGN    P +++N APWI TV AS++D
Sbjct  303   SVGTR-QPMPYNKDGIALGAFHAAKSNIVVVCSAGNNGPAPGTLSNPAPWIITVSASTVD  361

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKV  1235
             R F APV LGN + ++G++VT        PL+YAGD   P  S    G C  ++L+P KV
Sbjct  362   RTFVAPVELGNGMSIEGQTVTPYHSNNMYPLIYAGDAVAPDVSKEDSGQCLPNSLNPNKV  421

Query  1234  KGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             +GK+V C+ G    + + +EV RAGGA  ILG+    G++   ++ ++ AT + +   T 
Sbjct  422   RGKIVLCIRGNGTRVGKGMEVRRAGGAGFILGNSPANGADQTCDAHVLPATAVTHSDAT-  480

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I  Y+ + K+P+A ++P +T+   KP+P MA FTS GP+  +P+ILKPDI+APG+NILA
Sbjct  481   RIYDYVRSTKSPMARIVPARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAPGVNILA  540

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWSEA SP +   D R VKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA
Sbjct  541   AWSEADSPTKLESDPRIVKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRSALMTTA  600

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLD  533
                + +G+ I DA G +A PF  GAGH+ P + ADPGLVYD++Y DY  ++C S G   D
Sbjct  601   FHLDNRGKPITDAAGTLATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLC-SFGIK-D  658

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSA-NTTYSVEVKAPTGYSVKI  356
             PS++CPK+     NLNYP+L I++L G++ VKRTVTNVG   N+ Y   VK PTG+ V I
Sbjct  659   PSFQCPKERIVSRNLNYPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVKPPTGFLVTI  718

Query  355   SPTELKFMEVGEKQsffvsvkvesvkkvgef----eFGWYKWSDGIHMVKSPIVVSSA  194
              P+ L F  +G+K+SF ++VK  +            FGWY W+DGIH V SP+ +S A
Sbjct  719   RPSLLVFDRIGQKRSFTITVKARNSMVKRILGDDYAFGWYGWNDGIHNVNSPMAISLA  776



>ref|XP_006859003.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
 gb|ERN20470.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
Length=766

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/599 (51%), Positives = 418/599 (70%), Gaps = 19/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+K+IGARY++K YEA +G +N T +FRS RD  GHGTHT+ST  G+ V   SA
Sbjct  171   FNSSHCNKKLIGARYYLKAYEAQYGRLNTTAEFRSPRDHDGHGTHTSSTAVGQSVHGVSA  230

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G A+GGAP  R+A+YK CW +P  D      C + D+LAA D A+ADGV ++S+
Sbjct  231   LGGFAFGTASGGAPRARVAMYKVCWPLPGGDPALENTCFEADMLAAIDDALADGVDILSI  290

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   +   ++ DG+ALGALHAMK+N+ V  SAGN    P + +N+APWI TV ASSID
Sbjct  291   SIGTTGKQPTYSNDGIALGALHAMKKNVLVACSAGNSGPTPATASNLAPWILTVAASSID  350

Query  1411  RVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGS--TTIPGFCRQDTLSPE  1241
             R+F +PV+LGN ++VKG+++T  K K+   P+V+A +  +PG+      G C  ++L P+
Sbjct  351   RLFPSPVVLGNGVVVKGQTITSFKLKKRFYPIVFAANAVVPGTPKNISAGQCLPNSLDPK  410

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KV+GK+VFCL G    + +  EV+RAGGAA+ILG++   G+EI V++ ++  T + +   
Sbjct  411   KVEGKIVFCLRGNGARVGKGFEVKRAGGAALILGNLPTNGAEISVDAHVLPGTALISTDA  470

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
             T +IL Y+ ++KNP A +IP  T+ G KP+P MA F+S GP+  +PNILKPDITAPGLNI
Sbjct  471   T-SILHYLNSSKNPTAKIIPATTVNGYKPAPVMAAFSSTGPNVLDPNILKPDITAPGLNI  529

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWS+ASSP +   D R VKYN++SGTSMSCPHV+ V ALLKAIHP    + +K   + 
Sbjct  530   LAAWSKASSPTKLAADKRRVKYNVLSGTSMSCPHVAGVAALLKAIHPRCL-SNLKPHSLA  588

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
              + T N+ G+ ++DA G  AGPF+YG+GH+ P+ AADPGLVYD++Y+DYL+F+C S G  
Sbjct  589   ASLTNNM-GKPLEDASGSPAGPFNYGSGHLNPAMAADPGLVYDASYIDYLVFLCKS-GIK  646

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             +D SY CPK   +PS+LN  S+ I++LKG+  V RTVTNVG+    YS+ + +P G  V 
Sbjct  647   IDRSYTCPKSPPNPSDLNLASVTISKLKGTKTVTRTVTNVGAKKALYSLSLASPNGVLVD  706

Query  358   ISPTELKFMEVGEKQsffvsvkve----svkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             I P EL F   GEK+SF ++ KV        K G + FGWY WSDG+H V+SPIVVS A
Sbjct  707   IEPKELYFRRDGEKKSFSLTFKVGPRVPRSMKNGSYSFGWYMWSDGMHKVRSPIVVSLA  765



>ref|XP_010095116.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB58282.1| Subtilisin-like protease [Morus notabilis]
Length=784

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/603 (53%), Positives = 405/603 (67%), Gaps = 21/603 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRKIIGARY++KG+E  FGP+N T D+ S RD  GHGTHTASTV GR V N +A
Sbjct  184   FNSSHCNRKIIGARYYLKGFEKQFGPLNTTEDYPSPRDKDGHGTHTASTVAGRTVPNVAA  243

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD-DIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA+G A+GGAPL RLAIYK CW +P    +    C  +D+LAA D A+ADGV VIS+
Sbjct  244   IGGFAHGTASGGAPLARLAIYKVCWALPGKPKVAGNVCLMEDMLAAIDDAIADGVHVISI  303

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSID  1412
             S+G     NY T DG+A+GALHA K+NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  304   SIGTSSPVNY-TDDGIAIGALHATKKNIVVSCSAGNSGPTPGTLSNPAPWIITVGASSVD  362

Query  1411  RVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPE  1241
             R F APV+LGN   V+G++VT  ++  ++  PL YA D+  PG        C  D+LSP+
Sbjct  363   REFIAPVVLGNGKRVEGQTVTPSKLNPKKMYPLAYATDLAEPGVLRDNASLCLPDSLSPK  422

Query  1240  KVKGKVVFCLTGGLSQT---LEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             K KGK+V C+ G  S+    L V+ AGG   IL +    G+EI  +  L+ AT +   + 
Sbjct  423   KTKGKIVLCMRGNNSRVGKGLVVKSAGGVGFILANTRANGAEIPCDPHLLPATAVTYKNA  482

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
                IL+YI + K P A ++PG T+   KP+P MA FTS GP+  EPNILKPDITAPGLNI
Sbjct  483   MR-ILEYINSTKWPRANILPGMTVLHTKPAPFMAAFTSRGPNVIEPNILKPDITAPGLNI  541

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAW+E  SP + P D R VKYN++SGTSM+CPHV+A  ALLKAIHP WS AAI+SAIMT
Sbjct  542   LAAWTEEDSPTKLPNDPRIVKYNLVSGTSMACPHVAATAALLKAIHPTWSSAAIRSAIMT  601

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA  KN  G    +  G +A  F YG+GH +P+K ADPGLVYD++Y DYLL++CS     
Sbjct  602   TAIQKNNLGLPFNEEDGNLANSFSYGSGHFRPAKVADPGLVYDASYTDYLLYLCSIGVKV  661

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             +D S+ CP K  +  +LNYPSLAI++L G++ VKRTVTNVG   +TY      P+  SVK
Sbjct  662   VDSSFSCPVKPPTAMDLNYPSLAISKLNGTVTVKRTVTNVGQPKSTYFFSSTPPSRVSVK  721

Query  358   ISPTELKFMEVGEKQsffvsvkvesvk--------kvgefeFGWYKWSDGIHMVKSPIVV  203
               P+ L F  VG+K+SF ++V+  S K        K  E+ FGWY W+DG H V+SPI V
Sbjct  722   AKPSILFFNHVGQKKSFTITVEATSEKPVTSKNDEKEEEYAFGWYSWTDGPHNVRSPIAV  781

Query  202   SSA  194
             S A
Sbjct  782   SLA  784



>emb|CAN61728.1| hypothetical protein VITISV_036029 [Vitis vinifera]
Length=860

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/589 (54%), Positives = 404/589 (69%), Gaps = 19/589 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KGYE+  GP+N T D+RS RD  GHGTHTASTV GR+V N SA
Sbjct  208   FNSSHCNRKLIGARYYLKGYESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVSA  267

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD-DIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LG +A G A+GGAPL RLAIYK CW +P    +K   C ++D+LAA D A+ADGV V+S+
Sbjct  268   LG-YAPGTASGGAPLARLAIYKVCWPIPGQTKVKGNTCYEEDMLAAIDDAIADGVHVLSI  326

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   + +DG+A+GALHA K NI V  SAGN    P +++N APWI TVGASSID
Sbjct  327   SIGT-SQPFTYAKDGIAIGALHATKNNIVVACSAGNSGPAPSTLSNPAPWIITVGASSID  385

Query  1411  RVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPG--STTIPGFCRQDTLSPE  1241
             R F  P++LGN + + G+SVT  K K++  PLV+A D  +PG         C   +L P+
Sbjct  386   RAFVTPLVLGNGMKLMGQSVTPYKLKKKMYPLVFAADAVVPGVPKNNTAANCNFGSLDPK  445

Query  1240  KVKGKVVFCLTGGLS----QTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             KVKGK+V CL GG++    + +EV+RAGG   ILG+    G ++  +  L+ AT + +  
Sbjct  446   KVKGKIVLCLRGGMTLRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAVSSED  505

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  I  YI + K P+AT+IPG T+  AKP+P MA F S GP+  +PNILKPDIT PGLN
Sbjct  506   VTK-IRNYIKSTKKPMATIIPGXTVLHAKPAPFMASFXSRGPNTIDPNILKPDITGPGLN  564

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSE SSP     D R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+M
Sbjct  565   ILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALM  624

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA   N  G+ I D+ G  A PF YG+GH +P+KAADPGLVYD+TY DYLL+ C+    
Sbjct  625   TTAGLVNNIGKPITDSSGNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYHCNIGVK  684

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
             +LD S+KCPK + S +NLNYPSL I++LK  + V RT TNVGSA + Y   VK+P G+SV
Sbjct  685   SLDSSFKCPKVSPSSNNLNYPSLQISKLKRKVTVTRTATNVGSARSIYFSSVKSPVGFSV  744

Query  361   KISPTELKFMEVGEKQs----ffvsvkvesvkkvgefeFGWYKWSDGIH  227
             ++ P+ L F  VG+K+S            S K   E+ FGWY W+DGIH
Sbjct  745   RVEPSILYFNHVGQKKSFDITVEARNPKASKKNDTEYAFGWYTWNDGIH  793



>ref|XP_007213640.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
 gb|EMJ14839.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
Length=779

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/601 (52%), Positives = 409/601 (68%), Gaps = 19/601 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KG+E  +GP+N + D++S RD+ GHGTHT+STV GR V  ASA
Sbjct  181   FNSSHCNRKLIGARYYLKGFEHNYGPLNASEDYQSPRDMDGHGTHTSSTVAGRLVPKASA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G A+GGAPL  LAIYK CW +P         C ++D+ AA D A+ DGV V+S+
Sbjct  241   LGGFARGTASGGAPLAHLAIYKVCWAIPGQSKADGNTCFEEDMFAAIDDAIGDGVDVLSI  300

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G     NY T DG++LGALHA K+NI V  SAGN    P +++N APWI TVGASS+D
Sbjct  301   SIGTSHPVNY-TSDGISLGALHATKKNIVVACSAGNSGPSPATLSNPAPWIITVGASSLD  359

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             R F +PV+LGN + ++GE+VT  K +E    PLVYA DV   G    + G C   +LSPE
Sbjct  360   RAFVSPVVLGNGIRLEGETVTPSKLEENNMYPLVYAADVINTGVPKDMAGQCLPGSLSPE  419

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KVKGK+V C+ G    + + +EV+RAGG   ILG+    G EI  ++ ++ AT++     
Sbjct  420   KVKGKIVLCMRGSGLRIGKGMEVKRAGGVGFILGNSAANGIEIACDAHVLPATSVLYKDA  479

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + ILKYI + K+P+AT+IP +T+   KP+P MA F+S GP+  + NILKPDITAPGLNI
Sbjct  480   -NRILKYINSTKHPIATIIPARTVLHTKPAPFMASFSSRGPNVIDSNILKPDITAPGLNI  538

Query  898   LAAWSEASSPLE-QPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             LAAWSEA  P +    DHR  +YNI SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+M
Sbjct  539   LAAWSEADPPTKLNGIDHRVAQYNIYSGTSMSCPHVAAAAALLKAIHPSWSSAAIRSALM  598

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG-  545
             TTA  +N     + D  G  A PF YG+GH +P+KAADPGLVYD++Y DYLL++CS  G 
Sbjct  599   TTAEIRNNLDMPLNDESGNAATPFAYGSGHFRPTKAADPGLVYDASYRDYLLYMCSIGGF  658

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               +DP +KCP+   + +NLNYPS+AI++L  ++ +KRTVTNVG   + Y    K P G S
Sbjct  659   KDVDPKFKCPRSPPTATNLNYPSIAISKLNRAITIKRTVTNVGEGKSIYFFTSKPPLGIS  718

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF----GWYKWSDGIHMVKSPIVVSS  197
             VK SP+ L F  VG+K+SF ++VK          +     GWY W+DG+H V+SPI VS 
Sbjct  719   VKASPSMLFFDHVGQKKSFTITVKARKEMLSKHDKDEYVFGWYTWTDGLHTVRSPIAVSL  778

Query  196   A  194
             A
Sbjct  779   A  779



>ref|XP_006280186.1| hypothetical protein CARUB_v10026090mg [Capsella rubella]
 gb|EOA13084.1| hypothetical protein CARUB_v10026090mg [Capsella rubella]
Length=618

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/606 (52%), Positives = 406/606 (67%), Gaps = 27/606 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  FG  N T   DF S RD  GHG+HTASTV GR+V  A
Sbjct  18    FNSSHCNRKIIGARYYVKGYERYFGAFNVTANKDFLSPRDPDGHGSHTASTVVGRRVYGA  77

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLA+YKACW  P  + +    C  +D+LAA D A+ADGV VI
Sbjct  78    SALGGFAMGSASGGAPLARLAVYKACWAKPNAEKVDGNVCLQEDMLAAIDDAIADGVHVI  137

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVG  1427
             S+S+G    LP      QDG+A+GALHA+K+NI V  SAGN   +P +++N APWI TVG
Sbjct  138   SISIGTTDPLP----LQQDGIAIGALHAIKKNIVVAASAGNSGPKPGTLSNPAPWIITVG  193

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   ++LGN   VK ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  194   ASTLDRAFVGGLVLGNGFTVKTESITAFKMDKFAPLVYAANVVVPGIALNDTSQCLPNSL  253

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGGA +ILG+    G+EI  +S  + AT    
Sbjct  254   KPELVAGKVVLCLRGAGSRIGKGIEVKRAGGAGMILGNSPANGNEIPSDSHFV-ATAPVT  312

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL+YI T+KNP A + PGKT++  + +P M  F+S GP+  +PNILKPDITAPG
Sbjct  313   PAVVEKILEYIKTDKNPKALIKPGKTVYKYQAAPLMTGFSSRGPNVIDPNILKPDITAPG  372

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   +NI +GTSMSCPHVS  VALLKAIHP WS AAI+SA
Sbjct  373   LNILAAWSGADSPSKVAVDQRVADFNIYTGTSMSCPHVSGAVALLKAIHPKWSSAAIRSA  432

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+DA G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  433   LMTTAWMTNDENKPIQDANGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVN  492

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN---TTYSVEVKAP  377
              T +DP++KCP K     NLNYPS+++  L  ++ VKRTVTNVG  N   +TY    K P
Sbjct  493   LTNIDPTFKCPSKIPPGYNLNYPSISVPNLTKTVTVKRTVTNVGIGNSTTSTYLFNAKPP  552

Query  376   TGYSVKISPTELKFMEVGEKQsff-----vsvkvesvkkvgefeFGWYKWSDGIHMVKSP  212
             +G SVK  P  L F  +G+K+ F       + +V +  + G+++FGW+ W+D  H+V+SP
Sbjct  553   SGVSVKAIPNVLSFNRIGQKKRFKIVIKPRTGQVMNATEKGQYQFGWFSWTDSDHVVRSP  612

Query  211   IVVSSA  194
             I VS A
Sbjct  613   IAVSLA  618



>ref|XP_007025242.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY27864.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=780

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/597 (52%), Positives = 405/597 (68%), Gaps = 21/597 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRKIIGARY+VKG+E   G VN T D+ S RD+ GHG+HTAST  GR+V + +A
Sbjct  186   FNSSHCNRKIIGARYYVKGFEHEKGTVNATEDYLSPRDMDGHGSHTASTAAGRQVPDVAA  245

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA--TFCQDDDVLAAFDHAVADGVQVIS  1592
             LGG A G A+GGAPL RLAIYK CW +P +  KA    C  +D+LA  D A+ADGV +IS
Sbjct  246   LGGLARGTASGGAPLARLAIYKVCWAIP-NQSKADGNLCMFEDILAGIDDAIADGVDIIS  304

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSI  1415
             +S+G      Y  +D +A+GALHA KRNI VV SAGN    P +++N APW+ TVGASS+
Sbjct  305   ISIGTSDPVPY-EEDYLAVGALHAAKRNILVVCSAGNNGPAPGTLSNPAPWLMTVGASSL  363

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDV---EIPGSTTIPGFCRQDTLS  1247
             DR F APV+LGN   + G++V   K + E  PLVYAGD    ++P ++T  G C   +L+
Sbjct  364   DRAFLAPVMLGNGREIMGQTVAPDKLENEMYPLVYAGDAVFPDVPQNST--GQCLPGSLN  421

Query  1246  PEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             P+ VKGK+V C+ G    L + LEV+RAGG  +ILG+    G+ +  +   + A+ +   
Sbjct  422   PDMVKGKIVVCMRGAGRRLDKGLEVKRAGGVGLILGNAEANGNRLSCDPHFLPASAVSYN  481

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
               T  IL+YI + +NP+AT+ P +T+   KP+P MA FTS GP+  + NILKPDITAPG+
Sbjct  482   DATK-ILEYIRSTENPMATISPAQTVMHYKPAPFMAGFTSQGPNVIDLNILKPDITAPGI  540

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
              ILAAWSEASSP +   DHR VKYN  SGTSM+CPHVS   ALLKAIHPDWS AAI+SA+
Sbjct  541   QILAAWSEASSPTKLEYDHRIVKYNFDSGTSMACPHVSGAAALLKAIHPDWSVAAIRSAL  600

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MTTA   N   + I+D  G  A PF YGAGH QP KAADPGL+YD++Y DYLL++CS   
Sbjct  601   MTTARITNNLDQLIRDEVGNTATPFQYGAGHFQPIKAADPGLIYDASYDDYLLYLCSLGL  660

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               LD ++KCP+   SP NLNYPS AI  L G++ + RTVTNVGS+N+ Y   VK P G  
Sbjct  661   NKLDSTFKCPEDPPSPVNLNYPSFAIPNLNGTVTITRTVTNVGSSNSKYYFSVKPPPGVH  720

Query  364   VKISPTELKFMEVGEKQsffvsvkves---vkkvgefeFGWYKWSDGIHMVKSPIVV  203
             VK SP+ L F  +G+KQSF ++V  +    + K   + FG+Y W+DG + V+SP+ V
Sbjct  721   VKASPSILFFDHIGQKQSFSITVSPKDFGPIAKRSAYGFGFYTWTDGFYRVRSPMAV  777



>ref|XP_010665649.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=780

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/599 (53%), Positives = 409/599 (68%), Gaps = 17/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK++GARY+VKGYE+ +GP+N T D  S RD  GHGTHT+STVGGR V +A+ 
Sbjct  184   FNSSHCNRKVVGARYYVKGYESYYGPLNRTVDCLSPRDKDGHGTHTSSTVGGRTVPDAAF  243

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             +G  A G A+GGAPL  LAIYK CW +P  D +    C + D+LAA D A+ DGV V+S+
Sbjct  244   MGSLAQGTASGGAPLVHLAIYKVCWGIPGKDKVNGNTCFEADMLAAMDDAINDGVHVLSI  303

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G      Y  +DG+++GALHA+K+ I V  SAGNY  +P +++N APW+ TVGASS+D
Sbjct  304   SIGTTTPVKYH-EDGISIGALHAVKKGIVVACSAGNYGPQPGTLSNPAPWVITVGASSLD  362

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQE-TLPLVYAGDVEIPGST-TIPGFCRQDTLSPEK  1238
             R FSAPV+LGN L+V+GE++T  +    + PLVYAG++ IP  T  + G C  ++LS EK
Sbjct  363   RKFSAPVVLGNGLIVEGETITTYRLDNISYPLVYAGEITIPNVTRELSGQCLPNSLSSEK  422

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
               GK+VFC  G    + + +EV+RAGG   ILG+    G EI  +  ++ AT++      
Sbjct  423   ANGKIVFCFRGNGTRVGKGMEVKRAGGIGYILGNAKGQGEEIVADPHVLPATSVGEHEAM  482

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               I KYI + K PVA ++P  T+ G  P+P MA FTS GP+  +P ILKPDITAPGLNIL
Sbjct  483   K-IYKYIKSTKFPVAKILPAATVVGTSPAPFMASFTSRGPNVVDPTILKPDITAPGLNIL  541

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWS A SP +   D R V++NI SGTSMSCPHV+A  ALLKAIHP WS AAI+S++MTT
Sbjct  542   AAWSGADSPSKLASDDRIVEWNIYSGTSMSCPHVAAAAALLKAIHPTWSSAAIRSSLMTT  601

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTL  536
             A  +N  G  I DA G  A PF YGAGH+QP+KAADPGLVYD++Y DYL ++CS      
Sbjct  602   AGLENNNGTLITDAMGNPANPFQYGAGHLQPTKAADPGLVYDTSYTDYLTYLCSIGMPGF  661

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGS-ANTTYSVEVKAPTGYSVK  359
             D S+KCPK     ++LN PSLAI++L GS+ V RTVTNVG    T+Y   VK P GY VK
Sbjct  662   DSSFKCPKVLPKTNDLNTPSLAISKLNGSLTVTRTVTNVGHPGKTSYFASVKPPMGYRVK  721

Query  358   ISPTELKFMEVGEKQsffvsvkvesv----kkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             ISP+ L F   G+K+SF ++V+ E          E+EFGW  W DG+H V+SP+VVSSA
Sbjct  722   ISPSILIFKHKGQKKSFKITVEKERDVIQGVSAQEYEFGWLSWFDGVHTVRSPMVVSSA  780



>ref|XP_007025243.1| Subtilase family protein isoform 2 [Theobroma cacao]
 gb|EOY27865.1| Subtilase family protein isoform 2 [Theobroma cacao]
Length=754

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/597 (52%), Positives = 405/597 (68%), Gaps = 21/597 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRKIIGARY+VKG+E   G VN T D+ S RD+ GHG+HTAST  GR+V + +A
Sbjct  160   FNSSHCNRKIIGARYYVKGFEHEKGTVNATEDYLSPRDMDGHGSHTASTAAGRQVPDVAA  219

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA--TFCQDDDVLAAFDHAVADGVQVIS  1592
             LGG A G A+GGAPL RLAIYK CW +P +  KA    C  +D+LA  D A+ADGV +IS
Sbjct  220   LGGLARGTASGGAPLARLAIYKVCWAIP-NQSKADGNLCMFEDILAGIDDAIADGVDIIS  278

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSI  1415
             +S+G      Y  +D +A+GALHA KRNI VV SAGN    P +++N APW+ TVGASS+
Sbjct  279   ISIGTSDPVPY-EEDYLAVGALHAAKRNILVVCSAGNNGPAPGTLSNPAPWLMTVGASSL  337

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDV---EIPGSTTIPGFCRQDTLS  1247
             DR F APV+LGN   + G++V   K + E  PLVYAGD    ++P ++T  G C   +L+
Sbjct  338   DRAFLAPVMLGNGREIMGQTVAPDKLENEMYPLVYAGDAVFPDVPQNST--GQCLPGSLN  395

Query  1246  PEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             P+ VKGK+V C+ G    L + LEV+RAGG  +ILG+    G+ +  +   + A+ +   
Sbjct  396   PDMVKGKIVVCMRGAGRRLDKGLEVKRAGGVGLILGNAEANGNRLSCDPHFLPASAVSYN  455

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
               T  IL+YI + +NP+AT+ P +T+   KP+P MA FTS GP+  + NILKPDITAPG+
Sbjct  456   DATK-ILEYIRSTENPMATISPAQTVMHYKPAPFMAGFTSQGPNVIDLNILKPDITAPGI  514

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
              ILAAWSEASSP +   DHR VKYN  SGTSM+CPHVS   ALLKAIHPDWS AAI+SA+
Sbjct  515   QILAAWSEASSPTKLEYDHRIVKYNFDSGTSMACPHVSGAAALLKAIHPDWSVAAIRSAL  574

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MTTA   N   + I+D  G  A PF YGAGH QP KAADPGL+YD++Y DYLL++CS   
Sbjct  575   MTTARITNNLDQLIRDEVGNTATPFQYGAGHFQPIKAADPGLIYDASYDDYLLYLCSLGL  634

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               LD ++KCP+   SP NLNYPS AI  L G++ + RTVTNVGS+N+ Y   VK P G  
Sbjct  635   NKLDSTFKCPEDPPSPVNLNYPSFAIPNLNGTVTITRTVTNVGSSNSKYYFSVKPPPGVH  694

Query  364   VKISPTELKFMEVGEKQsffvsvkves---vkkvgefeFGWYKWSDGIHMVKSPIVV  203
             VK SP+ L F  +G+KQSF ++V  +    + K   + FG+Y W+DG + V+SP+ V
Sbjct  695   VKASPSILFFDHIGQKQSFSITVSPKDFGPIAKRSAYGFGFYTWTDGFYRVRSPMAV  751



>ref|XP_009114399.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=790

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/604 (52%), Positives = 405/604 (67%), Gaps = 25/604 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT--FDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  +G  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  192   FNSSHCNRKIIGARYYVKGYEKYYGAFNVTANRDFLSPRDPDGHGSHTASTAVGRRVKGA  251

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLA+YKACW  P  + +    C  +D+LAA D A+ DGV VI
Sbjct  252   SALGGFAMGSASGGAPLARLAVYKACWAKPNQEKVDGNVCLQEDMLAAIDDAIGDGVHVI  311

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             SVS+G    LP    ++QDG+A+GALHA+KRNI V  SAGN   +P +++N APWI TVG
Sbjct  312   SVSIGTTDPLP----YSQDGIAIGALHAVKRNIVVAASAGNSGPKPGTLSNPAPWIITVG  367

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DRVF   ++LGN   VK ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  368   ASTLDRVFVGGLVLGNGYTVKTESITAFKMDKFAPLVYAANVAVPGIALNNTSQCLPNSL  427

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGG  +ILG+    G+EI  +S  + AT    
Sbjct  428   KPELVNGKVVLCLRGAGSRIGKGMEVKRAGGVGMILGNSLANGNEIPSDSHFV-ATAAVT  486

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL YI T+KNP+A + PG T++  +P+P M  F+S GP+  +PNILKPDITAPG
Sbjct  487   PTVVEKILDYIKTDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPG  546

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   YNI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA
Sbjct  547   LNILAAWSGADSPSKLWVDQRVADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSA  606

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  607   LMTTAWMTNDEKKPIQDISGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVG  666

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
              T +DP++KCP K     NLNYPS++I  L  ++ VKRTVTNVG+ N  +TY    ++P 
Sbjct  667   FTNIDPTFKCPSKIPPGYNLNYPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFSARSPL  726

Query  373   GYSVKISPTELKFMEVGEKQ----sffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
             G SVK  P+ L F  +G+K+       +     +V + G+++FGW+ W+D  H+V+SPI 
Sbjct  727   GVSVKAKPSVLSFNRIGQKKRFKIMVTIRKDKMNVTEKGQYQFGWFSWTDKYHVVRSPIA  786

Query  205   VSSA  194
             +S A
Sbjct  787   ISLA  790



>ref|XP_006449587.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62827.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=777

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/597 (52%), Positives = 406/597 (68%), Gaps = 15/597 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CN+KIIGARY++KG E  +GP+N T D RS RD+ GHGTHTASTV GR+V NASA
Sbjct  183   FNSSLCNKKIIGARYYLKGLEQVYGPLNATEDDRSPRDMDGHGTHTASTVAGRRVPNASA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVISV  1589
              GGFA G A+GGAPL RLAIYKACW  P     A   C + D+LAA D A+ DGV V+S+
Sbjct  243   FGGFAEGTASGGAPLARLAIYKACWATPKASKAAGNTCFEADMLAAIDDAIRDGVHVLSI  302

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   F +DG+A+GAL+A+K NI V  SAGN    P S++N APW+ TVGA S+D
Sbjct  303   SIGT-NQPFAFNRDGIAIGALNAVKHNILVACSAGNSGPAPSSLSNPAPWLITVGAGSLD  361

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKV  1235
             R F  PV+LGN + + G++VT    ++  PLVYA DV +PG        C   +L+PEKV
Sbjct  362   RDFVGPVVLGNGMEIIGKTVTPYNLKKMHPLVYAADVVVPGVHQNETNQCLPGSLTPEKV  421

Query  1234  KGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK+V C+ G    LS+ +EV+RAGG  +ILG+    G+E   ++  + AT +       
Sbjct  422   KGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATAVLYDDAIK  481

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I +YI +  NP A +   +T+   +P+P MA FTS GP+  +P ILKPDITAPGLNILA
Sbjct  482   -IHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILA  540

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWSEASSP +   D R VKY I SGTSMSCPHV+A  ALLKAIHPDWS AAI+SA+MTTA
Sbjct  541   AWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTA  600

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLD  533
               KN KG  I +A G +A PF +G+GH +P+KAADPGLVYD++Y DYLL++CS   +  +
Sbjct  601   WMKNNKGLPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTN  660

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKIS  353
             P ++CP K  S  NLNYPS+AI  L G+++VKRTVTNVG + + Y    K P G SVK +
Sbjct  661   PVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKAN  720

Query  352   PTELKFMEVGEKQsffvs----vkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             P+ L F  +G+K+SF ++     +        ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  721   PSILFFDHIGQKKSFTITVRLGSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  777



>gb|KHG30296.1| Subtilisin-like protease [Gossypium arboreum]
Length=778

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/598 (54%), Positives = 402/598 (67%), Gaps = 22/598 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS+CN+KIIGARY+VKG++  +GPVN T D+ S RD+ GHGTHTAST  GR+V++ +A
Sbjct  183   FNSSNCNKKIIGARYYVKGFQNAYGPVNATEDYLSPRDMDGHGTHTASTAAGRQVSDVAA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD-DIKATFCQDDDVLAAFDHAVADGVQVISV  1589
              GGFA G A+GGAPL RLAIYKACW +P         C D+D+LAA D A+ADGV ++SV
Sbjct  243   FGGFAKGTASGGAPLARLAIYKACWAIPNQPKADGNTCFDEDMLAALDDAIADGVHILSV  302

Query  1588  SLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGAS  1421
             S+G    LP    F  D + L AL A KRNI VV SAGN    P +++N APWI TVGAS
Sbjct  303   SIGTAKPLP----FEHDVIGLAALEAAKRNILVVCSAGNSGPAPGTLSNPAPWIITVGAS  358

Query  1420  SIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             S+DR F APV LGN L + G+SVT    ++  PLVYAGDV +PG    + G C   +L P
Sbjct  359   SLDRAFFAPVKLGNGLKLIGQSVTPYNMKKMSPLVYAGDVVVPGVPLNVTGQCLPGSLDP  418

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
              KVKGK+V C  G    + + LEV+RAGG   +L +    G EI  ++ L+ AT +   S
Sbjct  419   NKVKGKIVVCTRGAGLRVGKGLEVKRAGGVGFVLANAKANGDEIACDAHLLPATTLTYDS  478

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             G   IL+YI + KNP+A + PG+T+   KP+P MA FTS GP+  +PNILKPDITAPGLN
Sbjct  479   GIK-ILEYINSTKNPMAVVSPGRTVLKYKPAPFMAGFTSRGPNVVDPNILKPDITAPGLN  537

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP + PED RSVKYNI SGTSMSCPHVS   ALLKAIHPDWS AAIKSA+M
Sbjct  538   ILAAWSEASSPSKLPEDKRSVKYNIYSGTSMSCPHVSGAAALLKAIHPDWSIAAIKSALM  597

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA   N  G+AI DA G  A PF +GAGH +P KA DPGL+YD++Y DYLL++C++   
Sbjct  598   TTAAITNSLGKAITDAGGNNATPFQFGAGHFRPIKAVDPGLIYDASYDDYLLYLCTAGPK  657

Query  541   T---LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             +   L  ++KCP    S  NLNYPS AI  L  ++ + RTVTN+G   +TY    K P G
Sbjct  658   SLIELSSTFKCPPNPPSTLNLNYPSFAIPNLNTTVTITRTVTNIGRPKSTYFFSAKPPPG  717

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesv--kkvgefeFGWYKWSDGIHMVKSPIVV  203
               VK SP+ L+F  +GEK SF ++V   +    K  E+ FGWY W    + V+SP+ V
Sbjct  718   VRVKASPSILQFKRIGEKLSFNITVSPINDPPVKKSEYGFGWYSWDGRYYHVRSPMAV  775



>gb|KCW76039.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
 gb|KCW76040.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
Length=771

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/598 (51%), Positives = 401/598 (67%), Gaps = 23/598 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +SHCNRK+IGAR++VKGYE  +GP++ T D+RS RD  GHGTHTASTVGGR+VAN SA
Sbjct  183   FDASHCNRKLIGARFYVKGYENYYGPLDTTLDYRSPRDKDGHGTHTASTVGGRRVANISA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGAPL  LAIYKACW +P    +    C ++D+LAA D A+ DGV V+S+
Sbjct  243   LGGFAHGTASGGAPLVHLAIYKACWAIPNVSKVDGNTCFEEDMLAAMDDAIGDGVDVMSI  302

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   + +DG+ALGA HA K NI VV SAGN    P +++N APWI TV AS++D
Sbjct  303   SVGTR-QPMPYNKDGIALGAFHAAKSNIVVVCSAGNNGPAPGTLSNPAPWIITVSASTVD  361

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKV  1235
             R F APV LGN + ++G++VT        PL+YAGD   P  S    G C  ++L+P KV
Sbjct  362   RTFVAPVELGNGMSIEGQTVTPYHSNNMYPLIYAGDAVAPDVSKEDSGQCLPNSLNPNKV  421

Query  1234  KGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             +GK+V C+ G    + + +EV RAGGA  ILG+    G++   ++ ++ AT + +   T 
Sbjct  422   RGKIVLCIRGNGTRVGKGMEVRRAGGAGFILGNSPANGADQTCDAHVLPATAVTHSDAT-  480

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I  Y+ + K+P+A ++P +T+   KP+P MA FTS GP+  +P+ILKPDI+APG+NILA
Sbjct  481   RIYDYVRSTKSPMARIVPARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAPGVNILA  540

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWSEA SP +   D R VKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+MTTA
Sbjct  541   AWSEADSPTKLESDPRIVKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRSALMTTA  600

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLD  533
                + +G  I DA G +A PF  GAGH+ P + ADPGLVYD++Y DY  ++CS       
Sbjct  601   FQLDNRGRPITDAAGTLATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLCSF------  654

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSA-NTTYSVEVKAPTGYSVKI  356
                K PKK    SNLNYP+L I++L G++ VKRTVTNVG   N+ Y   VK PTG+ V I
Sbjct  655   -GIKDPKKRIVSSNLNYPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVKPPTGFLVTI  713

Query  355   SPTELKFMEVGEKQsffvsvkvesvkkvgef----eFGWYKWSDGIHMVKSPIVVSSA  194
              P+ L F  +G+K+SF +++K  +            FGWY W+DGIH V SP+ +S A
Sbjct  714   RPSLLVFDRIGQKRSFTITIKARNSMVKRILGDDYAFGWYGWNDGIHNVNSPMAISLA  771



>ref|XP_006467568.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=777

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/597 (52%), Positives = 406/597 (68%), Gaps = 15/597 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CN+KIIGARY++KG+E  +GP+N T D RS RD+ GHGTHTASTV GR+V NASA
Sbjct  183   FNSSLCNKKIIGARYYLKGFEQVYGPLNATEDDRSPRDMDGHGTHTASTVAGRRVPNASA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVISV  1589
              GGFA G A+GGAPL RLAIYKACW  P     A   C + D+LAA D A+ DGV V+S+
Sbjct  243   FGGFAEGTASGGAPLARLAIYKACWATPKASKAAGNTCFEADMLAAIDDAIRDGVHVLSI  302

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   F +DG+A+GAL+A+K NI V  SAGN    P S++N+APW+ TVGA S+D
Sbjct  303   SIGT-NQPFAFNRDGIAIGALNAVKHNILVACSAGNSGPAPSSLSNLAPWLITVGAGSLD  361

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKV  1235
             R F  PV+LG  + + G++VT    ++  PLVYA DV +PG        C   +L+PEKV
Sbjct  362   RDFVGPVVLGTGMEIIGKTVTPYNLKKMHPLVYAADVVVPGVHQNETNQCLPGSLTPEKV  421

Query  1234  KGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK+V C+ G    LS+ +EV+RAGG  +ILG+    G+E   ++  + AT +       
Sbjct  422   KGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATAVLYDDAIK  481

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I +YI +  NP A +   +T+   +P+P MA FTS GP+  +P ILKPDITAPGLNILA
Sbjct  482   -IHEYIKSTNNPTAIIKHARTVLHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILA  540

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWSEASSP +   D R VKY I SGTSMSCPHV+A  ALLKAIHPDWS AAI+SA+MTTA
Sbjct  541   AWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTA  600

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLD  533
               KN K   I +A G +A PF +G+GH +P+KAADPGLVYD++Y DYLL++CS   +  +
Sbjct  601   WMKNNKALPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTN  660

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKIS  353
             P ++CP K  S  NLNYPS+AI  L G+++VKRTVTNVG + + Y    K P G SVK +
Sbjct  661   PVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKAN  720

Query  352   PTELKFMEVGEKQsffvs----vkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             P+ L F  +G+K+SF ++     +        ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  721   PSILFFDHIGQKKSFTITVRLGSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  777



>emb|CDY23110.1| BnaC09g18640D [Brassica napus]
Length=776

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/604 (51%), Positives = 404/604 (67%), Gaps = 25/604 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT--FDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  +G  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  178   FNSSHCNRKIIGARYYVKGYEKYYGAFNVTANRDFLSPRDPDGHGSHTASTAVGRRVKGA  237

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLA+YKACW  P  + +    C  +D+LAA D A+ DGV VI
Sbjct  238   SALGGFAMGSASGGAPLARLAVYKACWAKPNQEKVDGNVCLQEDMLAAIDDAIGDGVHVI  297

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             SVS+G    LP    ++QDG+A+GALHA+KRNI V  SAGN   +P +++N APWI TVG
Sbjct  298   SVSIGTTDPLP----YSQDGIAIGALHAVKRNIVVAASAGNSGPKPGTLSNPAPWIITVG  353

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   ++LGN   VK ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  354   ASTLDRAFVGGLVLGNGYTVKTESITAFKMDKFAPLVYAANVAVPGIALNNTSQCLPNSL  413

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGG  +ILG+    G+EI  +S  + AT    
Sbjct  414   KPELVNGKVVLCLRGAGSRIGKGMEVKRAGGVGMILGNSLANGNEIPSDSHFV-ATAAVT  472

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL YI  +KNP+A + PG T++  +P+P M  F+S GP+  +PNILKPDITAPG
Sbjct  473   PTVVEKILDYIKIDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPG  532

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   YNI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA
Sbjct  533   LNILAAWSGADSPSKLWVDQRVADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSA  592

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  593   LMTTAWMTNDEKKPIQDISGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVG  652

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
              T +DP++KCP K     NLNYPS++I  L  ++ VKRTVTNVG+ N  +TY    ++P 
Sbjct  653   FTNIDPTFKCPSKIPPGYNLNYPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFSARSPL  712

Query  373   GYSVKISPTELKFMEVGEKQ----sffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
             G SVK  P+ L F  +G+K+       V +   +V + G+++FGW+ W+D  H+V+SPI 
Sbjct  713   GVSVKAKPSVLSFNRIGQKKRFKIMVTVRMDKMNVTEKGQYQFGWFSWTDKYHVVRSPIA  772

Query  205   VSSA  194
             +S A
Sbjct  773   ISLA  776



>ref|XP_006398246.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
 gb|ESQ39699.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
Length=792

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/603 (52%), Positives = 399/603 (66%), Gaps = 26/603 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  +G  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  193   FNSSHCNRKIIGARYYVKGYEKYYGSFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGA  252

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             +ALGGFA G A+GGAPL RLA+YKACW  P  + +    C  +D+LAA D A+ADGV VI
Sbjct  253   AALGGFAMGSASGGAPLARLAVYKACWAKPNQEKVDGNVCLQEDMLAAIDDAIADGVHVI  312

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             SVS+G    LP    ++QDG+A+GALHA+KRNI V  SAGN   +P +++NVAPWI TVG
Sbjct  313   SVSIGTTEPLP----YSQDGIAIGALHAVKRNIVVAASAGNSGPKPGTLSNVAPWIITVG  368

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   ++LGN   VK ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  369   ASTLDRAFVGGLVLGNGYTVKTESITAFKMDKFAPLVYASNVTVPGIALNNTSQCLPNSL  428

Query  1249  SPEKVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGG  +ILG+    G++I  +S  + AT    
Sbjct  429   KPELVTGKVVLCLRGTGSRIGKGMEVKRAGGVGMILGNSLANGNDIPSDSHFV-ATAAVT  487

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             PS  + IL+YI T+KNP+A + PG T++  +P+P M  F+S GPS  + NILKPDITAPG
Sbjct  488   PSSVEKILEYIKTDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPSLIDANILKPDITAPG  547

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   YNI +GTSMSCPHVS  +ALLKA HP WS AAI+SA
Sbjct  548   LNILAAWSGADSPSKVSLDQRVAAYNIYTGTSMSCPHVSGAIALLKATHPKWSSAAIRSA  607

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  608   LMTTAWMTNDEKKPIQDTNGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVG  667

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
                +DP++KCP K     NLNYPS+AI  L  ++ VKRTVTNVG  N  +TY    K+P 
Sbjct  668   FIDIDPTFKCPSKIPPGYNLNYPSIAIPNLNRTVTVKRTVTNVGDGNSTSTYIFSAKSPP  727

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF-----GWYKWSDGIHMVKSPI  209
             G SVK  P+ L F  +G+K+ F + V     K +   E      GW+ W+D  H+V+SPI
Sbjct  728   GVSVKAKPSVLSFNRIGQKKRFKIVVTARRDKMMNVTEKGQYQFGWFSWTDNYHVVRSPI  787

Query  208   VVS  200
              VS
Sbjct  788   AVS  790



>emb|CDY13044.1| BnaA09g17730D [Brassica napus]
Length=776

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/604 (51%), Positives = 403/604 (67%), Gaps = 25/604 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT--FDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  +G  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  178   FNSSHCNRKIIGARYYVKGYEKYYGAFNVTANRDFLSPRDPDGHGSHTASTAVGRRVKGA  237

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLA+YKACW  P  + +    C  +D+LAA D A+ DGV VI
Sbjct  238   SALGGFAMGSASGGAPLARLAVYKACWAKPNQEKVDGNVCLQEDMLAAIDDAIGDGVHVI  297

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             SVS+G    LP    ++QDG+A+GALHA+KRNI V  SAGN   +P +++N APWI TVG
Sbjct  298   SVSIGTTDPLP----YSQDGIAIGALHAVKRNIVVAASAGNSGPKPGTLSNPAPWIITVG  353

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   ++LGN   VK ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  354   ASTLDRAFVGGLVLGNGYTVKTESITAFKMDKFAPLVYAANVAVPGIALNNTSQCLPNSL  413

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGG  +ILG+    G+EI  +S  + AT    
Sbjct  414   KPELVNGKVVLCLRGAGSRIGKGMEVKRAGGVGMILGNSLANGNEIPSDSHFV-ATAAVT  472

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL YI  +KNP+A + PG T++  +P+P M  F+S GP+  +PNILKPDITAPG
Sbjct  473   PTVVEKILDYIKIDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITAPG  532

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   YNI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA
Sbjct  533   LNILAAWSGADSPSKLWVDQRVADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSA  592

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  593   LMTTAWMTNDEKKPIQDISGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVG  652

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
              T +DP++KCP K     NLNYPS++I  L  ++ VKRTVTNVG+ N  +TY    ++P 
Sbjct  653   FTNIDPTFKCPSKIPPGYNLNYPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFSARSPL  712

Query  373   GYSVKISPTELKFMEVGEKQ----sffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
             G SVK  P+ L F  +G+K+       +     +V + G+++FGW+ W+D  H+V+SPI 
Sbjct  713   GVSVKAKPSVLSFNRIGQKKRFKIMVTIRKDKMNVTEKGQYQFGWFSWTDKYHVVRSPIA  772

Query  205   VSSA  194
             +S A
Sbjct  773   ISLA  776



>ref|XP_009360803.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/600 (52%), Positives = 402/600 (67%), Gaps = 18/600 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KG+E  +G +N + D+RS RD+ GHGTHT+S V GR V N SA
Sbjct  181   FNSSHCNRKLIGARYYLKGFEQFYGHLNASEDYRSPRDMDGHGTHTSSIVAGRVVPNTSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G A+GGAPL RLAIYK CW +P         C ++D+LAA D A+ DGV V+S+
Sbjct  241   LGGFALGTASGGAPLARLAIYKVCWAIPGQSKADGNTCFEEDMLAAIDDAIGDGVDVLSI  300

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G     NY T DG+A+GALHA K+ I V  SAGN    P +++N APWI TVGASS+D
Sbjct  301   SIGTKKPVNY-TNDGIAIGALHATKKKIVVACSAGNSGPAPSTLSNPAPWIITVGASSLD  359

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQET--LPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             R F APV+L N + ++GE+VT  K +E    PLVYA DV   G    + G C   +LSPE
Sbjct  360   RAFVAPVVLVNGITIEGETVTPSKLEENKKYPLVYAADVINSGVPKDMAGQCLPGSLSPE  419

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             KVKGK+V C+ G    + + +EV+RAGG   ILG+    G EI  ++ +I AT +     
Sbjct  420   KVKGKIVLCMRGSGMRVGKGMEVKRAGGVGFILGNSAANGVEISCDAHVIPATAVLY-ED  478

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + IL+YI + K P A +IP +T+   KP+P MA FTS GP+  +PN LKPDITAPGLNI
Sbjct  479   ANRILQYINSTKIPTAAIIPARTVLNRKPAPFMAAFTSRGPNLIDPNFLKPDITAPGLNI  538

Query  898   LAAWSEASSPLEQPE-DHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             LAAW+EA  P +    DHR V+YNI SGTSMSCPHV+A   L+KAIHP WS AAI+SAIM
Sbjct  539   LAAWTEADPPTKLSGIDHRVVQYNIDSGTSMSCPHVAAAAVLVKAIHPTWSSAAIRSAIM  598

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-SIG  545
             TTA  +N  G  + D  G VA PF YGAGH +P+KAADPGLVYD++Y DYL ++CS  + 
Sbjct  599   TTAEIRNNLGLPLNDESGSVATPFAYGAGHFRPTKAADPGLVYDASYKDYLQYICSIGVA  658

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               +DP++ CPK   +  NLNYPS+AI +L+ +M +KRTVTNVG + + Y    K P G S
Sbjct  659   KNVDPTFHCPKSPPTAINLNYPSIAIPKLEDTMTIKRTVTNVGDSKSIYFFTAKPPLGIS  718

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF---GWYKWSDGIHMVKSPIVVSSA  194
             +K  P+ L F  VG+K+SF ++VK        +      GWY W+D +H V+SPI VS A
Sbjct  719   IKAFPSMLFFDHVGQKKSFTITVKARREMLSKQGNEYVFGWYTWTDRLHTVRSPIAVSLA  778



>gb|KFK31536.1| hypothetical protein AALP_AA6G125100 [Arabis alpina]
Length=788

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/602 (52%), Positives = 399/602 (66%), Gaps = 20/602 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRK+IGARY+VKGYE  +G  N T   DF S RD  GHGTHTAST  GR+V  A
Sbjct  189   FNSSHCNRKLIGARYYVKGYERYYGSFNVTANKDFLSPRDPDGHGTHTASTAVGRRVNGA  248

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL RLA+YKACW  P  + I    C ++D+LAA D A+ADGV VI
Sbjct  249   SALGGFAMGSASGGAPLARLAVYKACWAKPNVEKIDGNMCIEEDMLAAIDDAIADGVHVI  308

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASS  1418
             S+S+G      Y   DG+A+GALHA+KRNI V  SAGN   +P +++N APWI TVGAS+
Sbjct  309   SISIGTTDPVPYLL-DGIAIGALHAVKRNIVVAASAGNAGPKPGTLSNPAPWIITVGAST  367

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             +DR F   ++LGN   +K ES+T  K  +  PLVYA +V  PG +      C  ++L PE
Sbjct  368   LDRSFVGGLVLGNGYTIKTESITAFKMDKFAPLVYAANVVAPGIALNNSAQCLPNSLKPE  427

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
              V GKVV CL G    + + +EV+RAGG  +ILG+    G+E   +S  + AT    P+ 
Sbjct  428   LVSGKVVLCLRGAGSRIGKGIEVKRAGGVGMILGNSPANGNETMPDSHFV-ATAAVTPTV  486

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              D IL+YI T+K P+A + PG+T++  KP+P +  F+S GPS  +PNILKPDITAPGLNI
Sbjct  487   VDKILQYIKTDKKPIAFIKPGETVYKNKPAPFVTGFSSRGPSMIDPNILKPDITAPGLNI  546

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWS A  P +   D R  +YN +SGTSMSCPHVS  +ALLKAIHP WS AAI+SA+MT
Sbjct  547   LAAWSGADGPSKISVDQRVAEYNFVSGTSMSCPHVSGAIALLKAIHPKWSSAAIRSALMT  606

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA   N + + I+D  G  A PF  G+G  +P+KAADPGLVYD++Y  YLL+ C    T 
Sbjct  607   TAWMTNDEKKPIQDTNGLPANPFALGSGQFRPTKAADPGLVYDASYRAYLLYGCLVGLTK  666

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPTGYS  365
             +DP++KCP K     NLNYPS+AI  L G++ VKRTVTNVG+ N  +TY    +AP G+S
Sbjct  667   IDPTFKCPSKIPPGYNLNYPSIAIPNLNGTVTVKRTVTNVGNGNSTSTYLFSAQAPLGFS  726

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF-----GWYKWSDGIHMVKSPIVVS  200
             VK  P+ L F  +G+K+ F + V  +  K +   E      GW+ W+D  H+VKSP+ VS
Sbjct  727   VKAKPSVLSFNRIGQKKRFKIVVTAQKEKMMNVTEKGHYQFGWFSWTDRYHVVKSPVAVS  786

Query  199   SA  194
              A
Sbjct  787   LA  788



>ref|XP_010481547.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/605 (52%), Positives = 403/605 (67%), Gaps = 26/605 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  FG  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  193   FNSSHCNRKIIGARYYVKGYEKYFGAFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGA  252

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL+RLA+YKACW  P ++ +    C  +D+LAA D A+ADGV VI
Sbjct  253   SALGGFAMGSASGGAPLSRLAVYKACWAKPNEEKVGGNVCLQEDMLAAIDDAIADGVHVI  312

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             S+S+G    LP    F QDG+A+GALHA+KRNI V  SAGN   +P +++N APWI TVG
Sbjct  313   SISIGTTDPLP----FQQDGIAIGALHAIKRNIVVAASAGNSGPKPGTLSNPAPWIITVG  368

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   + LGN   +K ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  369   ASTLDRAFVGGLALGNGYTIKTESITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSL  428

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGGA +ILG+    G+EI  +S  + AT    
Sbjct  429   RPELVAGKVVLCLRGAGSRIGKGIEVKRAGGAGMILGNAPANGNEIPSDSHFV-ATATVT  487

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL YI T+KNP+A + PGKT++    +P M  F+S GP+  +PNILKPDITAPG
Sbjct  488   PTVVEKILDYIKTDKNPMAFIKPGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITAPG  547

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   +NI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA
Sbjct  548   LNILAAWSGADSPSKVSIDQRVADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSA  607

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  608   LMTTAWMTNDEKKPIQDVDGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVN  667

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
              T +DP++KCP K     NLNYPS+AI  L  ++ VKRTVTNVG  N  +TY      P+
Sbjct  668   FTDIDPTFKCPSKIPPGYNLNYPSIAIPNLNRTVTVKRTVTNVGIGNWTSTYVFNANPPS  727

Query  373   GYSVKISPTELKFMEVGEKQsff-----vsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             G +VK  P  L F  +G+KQ F       +  V +  + G+++FGW+ W+D  H+V+SPI
Sbjct  728   GVTVKAIPNVLVFNRIGQKQRFKIVIKPRTDLVLNATEKGQYQFGWFSWTDSDHVVRSPI  787

Query  208   VVSSA  194
              VS A
Sbjct  788   AVSLA  792



>ref|XP_008439697.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=793

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/610 (51%), Positives = 412/610 (68%), Gaps = 30/610 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F S+HCNRKIIGARY++KGYE  FG +N T D+RS  D  GHG+HTAS  GGR+V N SA
Sbjct  187   FQSAHCNRKIIGARYYLKGYEHHFGRLNETADYRSPCDKDGHGSHTASIAGGRRVYNVSA  246

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA--TFCQDDDVLAAFDHAVADGVQVIS  1592
              GG A G A+GGAP  RLAIYK CW +P + +KA    C D D+LAA D A+ADGV V+S
Sbjct  247   FGGVAWGTASGGAPWARLAIYKVCWAIP-NQMKALGNVCFDTDMLAAMDDAIADGVDVLS  305

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSI  1415
             +S+G     NY T DG+A+GALHA+K++I V  SAGNY   P +++NVAPWI TVGAS++
Sbjct  306   LSIGKSEPYNY-TDDGIAIGALHAVKKDIVVSCSAGNYGPTPSALSNVAPWIITVGASTV  364

Query  1414  DRVFSAPVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F +PV+LGN L +KG SV  +++++++  PLVYAGD+  P +     G C   +LS 
Sbjct  365   DREFYSPVILGNGLKIKGLSVAPSKLERKKMYPLVYAGDIMNPHAPRNQSGLCVAGSLSH  424

Query  1243  EKVKGKVVFCLTG-GLSQ---TLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNP  1085
             EK KGK V C  G G+S+   +LEV+R+GGA +ILG   ++G     +   + AT + + 
Sbjct  425   EKAKGKXVLCFRGEGISRFAGSLEVQRSGGAGMILGNVPAVGRRPHADPHFVPATAV-SY  483

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
                + ILKYI +  NP AT++P  TI+G++P+PAMA F+S GP+  +P+ LKPDITAPG+
Sbjct  484   EDANVILKYIKSRTNPTATIVPPVTIYGSRPAPAMANFSSRGPNPIDPHFLKPDITAPGV  543

Query  904   NILAAWSEASSP--LEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKS  731
             +ILAAWSE  SP  L +  D R V+YN+ SGTSMSCPHVSA  ALL+AIHP WS AAI+S
Sbjct  544   DILAAWSEQDSPTKLSKYLDPRIVQYNLYSGTSMSCPHVSAAAALLRAIHPTWSQAAIRS  603

Query  730   AIMTTATTKNVKGEAIKDAY---GEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFV  560
             A+MTT+TT N  G+ I D        A PF +G+GH +PSKAADPGLVYDS Y DYL ++
Sbjct  604   ALMTTSTTNNKSGQPITDDSTPDNSPATPFSFGSGHFRPSKAADPGLVYDSNYTDYLHYL  663

Query  559   CSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV-GSANTTYSVEVK  383
             C     ++DPS+ CP +   P +LNYPS+A+ QL+  + +KRTVTNV G   + Y  + +
Sbjct  664   CGLKMNSIDPSFTCPPRPLHPHDLNYPSIAVPQLRDVVRIKRTVTNVGGGGKSVYFFKSE  723

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkv--------gefeFGWYKWSDGIH  227
             AP G +V  SP  L F  VGE++ F +++  +              E+ FGW+ WSD IH
Sbjct  724   APPGVAVSASPNILYFNRVGERKKFTITISRKVNSSSSSRRSKKGEEYSFGWFAWSDEIH  783

Query  226   MVKSPIVVSS  197
              V+SPI VS+
Sbjct  784   YVRSPIAVST  793



>gb|KDO77986.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
 gb|KDO77987.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
Length=587

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/589 (52%), Positives = 400/589 (68%), Gaps = 15/589 (3%)
 Frame = -2

Query  1921  KIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANGV  1742
             KIIGARY++KG+E  +GP+N T D RS RD+ GHGTHTASTV GR+V NASA GGFA G 
Sbjct  1     KIIGARYYLKGFEQLYGPLNATEDDRSPRDMDGHGTHTASTVAGRRVPNASAFGGFAEGT  60

Query  1741  ATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVISVSLGLLPQD  1565
             A+GGAPL RLAIYKACW  P     A   C + D+LAA D A+ DGV V+S+S+G   Q 
Sbjct  61    ASGGAPLARLAIYKACWATPKASKAAGNTCFEADMLAAIDDAIRDGVHVLSISIGT-NQP  119

Query  1564  NYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAPVL  1388
               F +DG+A+GAL+A+K NI V  SAGN    P S++N+APW+ TVGA S+DR F  PV+
Sbjct  120   FAFNRDGIAIGALNAVKHNILVACSAGNSGPAPSSLSNLAPWLITVGAGSLDRDFVGPVV  179

Query  1387  LGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGKVVFCL  1211
             LG  + + G++VT    ++  PLVYA DV +PG        C   +L+PEKVKGK+V C+
Sbjct  180   LGTGMEIIGKTVTPYNLKKMHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLCM  239

Query  1210  TGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILKYILT  1049
              G    LS+ +EV+RAGG  +ILG+    G+E   ++  + AT +        I +YI +
Sbjct  240   RGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATAVLYDDAIK-IHEYIKS  298

Query  1048  NKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEASSP  869
               NP A +   +T+   +P+P MA FTS GP+  +P ILKPDITAPGLNILAAWSEASSP
Sbjct  299   TNNPTAIIKQARTVLHTQPAPFMANFTSRGPNALDPYILKPDITAPGLNILAAWSEASSP  358

Query  868   LEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNVKGE  689
              +   D R VKY I SGTSMSCPHV+A  ALLKAIHPDWS AAI+SA+MTTA  KN K  
Sbjct  359   SKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIRSALMTTAWMKNNKAL  418

Query  688   AIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKCPKK  509
              I +A G +A PF +G+GH +P+KAADPGLVYD++Y DYLL++CS   +  +P ++CP K
Sbjct  419   PITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCSHGFSFTNPVFRCPNK  478

Query  508   ASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTELKFME  329
               S  NLNYPS+AI  L G+++VKRTVTNVG + + Y    K P G SVK +P+ L F  
Sbjct  479   PPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSAKPPMGVSVKANPSILFFDH  538

Query  328   VGEKQsffvs----vkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             +G+K+SF ++     +        ++ FGWY+W+DG+H+V+SP+ VS A
Sbjct  539   IGQKKSFTITVRLGSETTRQGLTKQYVFGWYRWTDGLHLVRSPMAVSFA  587



>ref|XP_010052138.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=771

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/601 (51%), Positives = 402/601 (67%), Gaps = 29/601 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +SHCNRK+I AR++VKGYE  FGP+N T D+RS  D  GHGTHTASTVGGR+VAN SA
Sbjct  183   FDASHCNRKLIRARFYVKGYETHFGPLNTTLDYRSPHDRDGHGTHTASTVGGRRVANVSA  242

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA+G A+GGA L  LAIYKACW +P    +    C ++D+LAA D A+ DG+ V+S+
Sbjct  243   LGGFAHGTASGGAALVHLAIYKACWAIPNVSKVDGNKCFEEDMLAAMDDAIGDGIDVMSI  302

Query  1588  SLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGAS  1421
             S+G    LP    + QD +ALGA +A K NI VV SAGN    P +++N APWI TVGAS
Sbjct  303   SIGTRRPLP----YHQDNIALGAFYAAKSNIVVVCSAGNNGPAPGTLSNPAPWIITVGAS  358

Query  1420  SIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             +IDR F APV LGN + ++G++VT     +  PL+YAGD   P  S    G C  ++L+P
Sbjct  359   TIDRTFVAPVELGNGMSIEGQTVTPYHSNKMYPLIYAGDAVAPNVSKEDSGQCLPNSLNP  418

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             +KV+GK+V C++G    + + +EV RAGGA  ILG+    G+++  ++ ++ AT + +  
Sbjct  419   KKVRGKIVLCISGNGPRVGKGMEVRRAGGAGFILGNSPADGADLTCDAHVLPATAVTHYD  478

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  I  YI + K+P A ++P +T+   KP+PA+A  TS GP+  +P+ILKPDI+APG+N
Sbjct  479   AT-RIYDYIRSTKSPTARIVPARTVLYTKPAPAIAALTSRGPNVIDPDILKPDISAPGVN  537

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEA SP +   D R VKYN  SGTSMSCPHV+A  ALLKAIHP WS AAI+SA+M
Sbjct  538   ILAAWSEADSPTKLESDPRIVKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRSALM  597

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA   + +G  I DA G +A PF  GAGH+ P + ADPGLVYD++Y DY  ++CS    
Sbjct  598   TTAFQLDNRGRPITDAAGTLATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLCSF---  654

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSA-NTTYSVEVKAPTGYS  365
                   K PKK    SNLNYP+L I++L G++ VKRTVTNVG   N+ Y   VK PTG+ 
Sbjct  655   ----GIKDPKKRIVSSNLNYPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVKPPTGFL  710

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgef----eFGWYKWSDGIHMVKSPIVVSS  197
             V I P+ L F  +G+K+SF +++K  +            FGWY W+DGIH V SP+ +S 
Sbjct  711   VTIRPSLLVFDRIGQKRSFTITIKARNSMVKRILGDDYAFGWYGWNDGIHNVNSPMAISL  770

Query  196   A  194
             A
Sbjct  771   A  771



>ref|XP_010494682.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/605 (52%), Positives = 401/605 (66%), Gaps = 26/605 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  FG  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  193   FNSSHCNRKIIGARYYVKGYEKYFGAFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGA  252

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL+RLA+YKACW  P ++ +    C  +D+LAA D A+ADGV VI
Sbjct  253   SALGGFAMGSASGGAPLSRLAVYKACWAKPNEEKVGGNVCLQEDMLAAIDDAIADGVHVI  312

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             S+S+G    LP    F QDG+A+GALHA+KRNI V  SAGN   +P +++N APWI TVG
Sbjct  313   SISIGTTDPLP----FQQDGIAIGALHAIKRNIVVAASAGNSGPKPGTLSNPAPWIITVG  368

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   + LGN   +K ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  369   ASTLDRAFVGGLALGNGYTIKTESITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSL  428

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGGA +ILG+    G+EI  +S  + AT    
Sbjct  429   RPELVAGKVVLCLRGAGSRIGKGIEVKRAGGAGMILGNAPANGNEIPSDSHFV-ATAAVT  487

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL YI T+KNP+A + PGKT++    +P M  F+S GP+  +PNILKPDITAPG
Sbjct  488   PTVVEKILDYIKTDKNPMAFIKPGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITAPG  547

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   +NI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA
Sbjct  548   LNILAAWSGADSPSKVSVDQRVADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSA  607

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y  YLL+ CS  
Sbjct  608   LMTTAWMTNDEKKPIQDVDGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCSVN  667

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
              T +DP++KCP K     NLNYPS+AI  L   + VKRTVTNVG  N  +TY      P+
Sbjct  668   FTDIDPTFKCPSKIPPGYNLNYPSVAIPNLNRMVTVKRTVTNVGIGNSTSTYLFNANPPS  727

Query  373   GYSVKISPTELKFMEVGEKQsff-----vsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
               SV+  P  L F  +G+KQ F       +  V +  + G+++FGW+ W+D  H+V+SPI
Sbjct  728   SVSVEAIPNVLVFNRIGQKQRFKIVIKPRTDLVLNATEKGQYQFGWFSWTDSDHVVRSPI  787

Query  208   VVSSA  194
              VS A
Sbjct  788   AVSLA  792



>gb|KDP21172.1| hypothetical protein JCGZ_21643 [Jatropha curcas]
Length=782

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/604 (50%), Positives = 411/604 (68%), Gaps = 30/604 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY+VKG+E  +G +N T DFRS RD+ GHGTHTASTV GR V NASA
Sbjct  185   FNSSHCNKKIIGARYYVKGFETYYGRLNATEDFRSPRDVDGHGTHTASTVAGRVVHNASA  244

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
              GGFA G A+GGAPL  LAIYKACW +P  +      C ++D+LAA D A+ADGV V+SV
Sbjct  245   YGGFAAGTASGGAPLAHLAIYKACWAIPNQEKANGNTCFEEDMLAAIDDAIADGVHVLSV  304

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G      Y  QDG+A+GA  A+K+NI +  +AGN    P +++N APWI TVGAS++D
Sbjct  305   SIGTTEPITY-DQDGLAIGAFRAIKKNIVMACAAGNSGPAPSTLSNPAPWIITVGASTLD  363

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSPEKV  1235
             R F  P++LGN + + G++VT  K  +  PLVYAGDV   G        C  ++LSP+KV
Sbjct  364   RAFLGPLVLGNGIKIMGQTVTPGKLDKAHPLVYAGDVAAHGVLRNQTNQCLPNSLSPKKV  423

Query  1234  KGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNI-FNPSGT  1076
             KGK+V C+ G    + + +EV RAGGA  ILG   + G++I  ++ ++ AT + +N    
Sbjct  424   KGKIVLCIRGAGTRIEKGMEVRRAGGAGFILGNSKAYGNDIPADAHVLPATALGYN----  479

Query  1075  DA--ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             DA  +LKYI + KNP A +    T+    P+P+MA FTS GP+  +PNILKPDITAPG+N
Sbjct  480   DALKVLKYIRSTKNPTAIIEKAHTLLRHTPAPSMASFTSRGPNTVDPNILKPDITAPGVN  539

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  SSP +   DHR V+YNI SGTSM+ PHV+A  ALLKAIHP WS AAI+SAIM
Sbjct  540   ILAAWSGGSSPTKLSSDHRIVEYNIESGTSMATPHVAATAALLKAIHPTWSSAAIRSAIM  599

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA TKN +G  I D++G++A PF  G+GH +P+KAADPGLVYD+++ DY+ ++C   G 
Sbjct  600   TTAWTKNNEGNPITDSFGKIADPFQLGSGHFRPAKAADPGLVYDASFKDYVQYLC---GY  656

Query  541   TLDPSYK----CPKKASSPSNLNYPSLAIAQLKGS-MVVKRTVTNVGSANTTYSVEVKAP  377
               D ++K    CPKK     NLNYPS+A++++K + +++KR+VTNVG  N+ Y    K P
Sbjct  657   DHDGTHKKRFGCPKKPEPTYNLNYPSIAVSKIKETAVIIKRSVTNVGDENSIYFFTAKPP  716

Query  376   TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvge-----feFGWYKWSDGIHMVKSP  212
              G+S++ SP+ L F  + +K+SF ++V+  +     +     + FGWY W+D  H V+SP
Sbjct  717   FGFSIEASPSVLYFDRIDQKKSFNITVRARNFGMAKKIYKDDYAFGWYTWTDNYHYVRSP  776

Query  211   IVVS  200
             I VS
Sbjct  777   IAVS  780



>ref|XP_010441687.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/605 (52%), Positives = 402/605 (66%), Gaps = 26/605 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGYE  FG  N T   DF S RD  GHG+HTAST  GR+V  A
Sbjct  193   FNSSHCNRKIIGARYYVKGYEKYFGAFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGA  252

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVI  1595
             SALGGFA G A+GGAPL+RLA+YKACW  P ++ +    C  +D+LAA D A+ADGV VI
Sbjct  253   SALGGFAMGSASGGAPLSRLAVYKACWAKPNEEKVGGNVCLQEDMLAAIDDAIADGVHVI  312

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             S+S+G    LP    F QDG+A+GALHA+KRNI V  SAGN   +  +++N APWI TVG
Sbjct  313   SISIGTTDPLP----FQQDGIAIGALHAIKRNIVVAASAGNSGPKAGTLSNPAPWIITVG  368

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTL  1250
             AS++DR F   + LGN   VK ES+T  K  +  PLVYA +V +PG +      C  ++L
Sbjct  369   ASTLDRAFVGGLALGNGYTVKTESITAFKMDKFAPLVYAANVVVPGIALNDSSQCLPNSL  428

Query  1249  SPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFN  1088
              PE V GKVV CL G    + + +EV+RAGGA +ILG+    G+EI  +S  + AT    
Sbjct  429   KPELVAGKVVLCLRGAGPRIGKGIEVKRAGGAGMILGNAPANGNEIPSDSHFV-ATAAVT  487

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
             P+  + IL YI T+KNP+A + PGKT++    +P M  F+S GP+  +PNILKPDITAPG
Sbjct  488   PTVVEKILDYIKTDKNPMAFIKPGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITAPG  547

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             LNILAAWS A SP +   D R   +NI +GTSMSCPHVS  +ALLKAIHP WS AAI+SA
Sbjct  548   LNILAAWSGADSPSKVSIDQRVADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIRSA  607

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +MTTA   N + + I+D  G  A PF  G+GH +P+KAA+PGLVYD++Y  YLL+ CS  
Sbjct  608   LMTTAWMTNDEKKPIQDTNGLPANPFALGSGHFRPTKAANPGLVYDASYRAYLLYGCSVN  667

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPT  374
              T +DP++KCP K     NLNYPS+AI  L  ++ VKRTVTNVG  N  +TY      P+
Sbjct  668   FTDIDPTFKCPSKIPPGYNLNYPSIAIPNLNRTVTVKRTVTNVGIGNSTSTYVFNANPPS  727

Query  373   GYSVKISPTELKFMEVGEKQsff-----vsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             G SV+  P  L F  +G+KQ F       +  V +  + G+++FGW+ W+D  H+V+SPI
Sbjct  728   GVSVEAIPNVLVFDRIGQKQRFKIVIKPRTDLVLNATEKGQYQFGWFSWADRDHVVRSPI  787

Query  208   VVSSA  194
              VS A
Sbjct  788   AVSLA  792



>ref|XP_002522297.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF40155.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=776

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/597 (50%), Positives = 405/597 (68%), Gaps = 15/597 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY++K +E   G +N + D RS RD+ GHGTHTASTV G +V +A+A
Sbjct  182   FNSSHCNKKIIGARYYIKAFEQDNGALNVSEDSRSPRDMDGHGTHTASTVAGNRVHDAAA  241

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
              GGFA G A+GGAPL  LAIYKACW +P  +      C + D+LAA D A+ADGV V+S+
Sbjct  242   YGGFARGTASGGAPLAHLAIYKACWALPNQEKANGNTCYEADMLAAIDDAIADGVHVLSM  301

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSID  1412
             S+G   Q   + QDG+A+GA HA K+NI V  +AGN    P +++N APWI TVGAS++D
Sbjct  302   SIGTT-QPVPYEQDGIAIGAFHAAKKNIVVACAAGNAGPAPSTLSNPAPWIITVGASTVD  360

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSPEKV  1235
             R F  P++LGN   + G++VT  K  +  PLVYA D+  PG        C  ++LSP+KV
Sbjct  361   RAFLGPIVLGNGKTIMGQTVTPDKLDKMYPLVYAADMVAPGVLQNETNQCLPNSLSPDKV  420

Query  1234  KGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK+V C+ G    + + +EV+RAGG   ILG+    G+++ V++ ++  T + +    +
Sbjct  421   KGKIVLCMRGAGMRVGKGMEVKRAGGVGYILGNSPANGNDVSVDAHVLPGTAVTSDQAIE  480

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              ILKYI + +NP AT+   KT+    P+P+MA F+S GP+  +PNILKPDI+APG+NILA
Sbjct  481   -ILKYIKSTENPTATIGKAKTVLHYSPAPSMAAFSSRGPNVIDPNILKPDISAPGVNILA  539

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWS AS P +   D+R+VK+NI SGTSM+CPHV+A  ALLKAIHP WS AAI+SAIMTTA
Sbjct  540   AWSGASPPTKLSTDNRTVKFNIDSGTSMACPHVAAAAALLKAIHPTWSSAAIRSAIMTTA  599

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLD  533
               KN KG+ I D  GE A PF +G+G  +P+KAADPGLVYD+TY DY+ ++C+     +D
Sbjct  600   WMKNNKGQPITDPSGEPATPFQFGSGQFRPAKAADPGLVYDATYKDYVHYLCNYGLKDID  659

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKIS  353
             P YKCP + S   NLNYPS+AI +L G++ +KR+V NVG++N+ Y    K P G+SVK S
Sbjct  660   PKYKCPTELSPAYNLNYPSIAIPRLNGTVTIKRSVRNVGASNSVYFFTAKPPMGFSVKAS  719

Query  352   PTELKFMEVGEKQs----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             P+ L F  V +K+S       + ++    +  E+ FGWY W+D  H V+SPI VS A
Sbjct  720   PSILNFNHVNQKKSFTIRITANPEMAKKHQKDEYAFGWYTWTDSFHYVRSPIAVSLA  776



>ref|XP_002317314.1| subtilase family protein [Populus trichocarpa]
 gb|EEE97926.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/601 (49%), Positives = 410/601 (68%), Gaps = 22/601 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY++KG+E  +GP+N T D RS RD  GHGTHTAST  G +V NA+A
Sbjct  180   FNSSHCNKKIIGARYYIKGFENYYGPLNRTEDSRSPRDKDGHGTHTASTAVGSRVKNAAA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G ATGGAPL  LAIYK CW +P  +      C ++D+LAA D A+ DGV ++S+
Sbjct  240   LGGFARGTATGGAPLAHLAIYKVCWAIPNQEKADGNTCFEEDMLAAIDDAIGDGVHIMSI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   +     +DG+A+GA HA+K+NI V  +AGN    P +++N +PWI TVGAS +D
Sbjct  300   SIGTR-EPTPLKEDGIAIGAFHALKKNIVVACAAGNEGPAPSTLSNPSPWIITVGASGVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDV---EIPGSTTIPGFCRQDTLSPE  1241
             R F  P++LGN + ++G++VT  K  +  PLV+A D     +P + T    C  ++LSP 
Sbjct  359   RAFFGPLVLGNGMKIEGQTVTPYKLDKDCPLVFAADAVASNVPENVT--SQCLPNSLSPR  416

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNI-FNPS  1082
             KVKGK+V C+ G    +++ +EV+RAGG   ILG+    G+++ V++ ++ AT++ +N +
Sbjct  417   KVKGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATSVGYNDA  476

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                 IL YI + KNP+A +   +TI   +P+P MA FTS GP+   P+ILKPDITAPG+N
Sbjct  477   MK--ILNYIRSTKNPMARIGIARTILQYRPAPVMASFTSRGPNVIHPSILKPDITAPGVN  534

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS A++P +  ED R V+YNIISGTSM+CPHV+A  ALL+AIHP+WS AAI+SA+M
Sbjct  535   ILAAWSGATAPSKLYEDKRLVRYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIRSALM  594

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA  KN  G+ I D  G  A PF +G+GH +P+KAADPGLVYD++Y DYLL++CS    
Sbjct  595   TTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCSYGVK  654

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              + P +KCP  + S  N NYPS+++ +L G++ + RTVTNVG++++ Y    + P G++V
Sbjct  655   NVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSARPPLGFAV  714

Query  361   KISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             K SP+ L F  VG+K+S           + +    GE+ FGWY WS+G H V+SP+ VS 
Sbjct  715   KASPSVLFFNHVGQKKSFIITIKAREDSMSNGHNKGEYAFGWYTWSNGHHYVRSPMAVSL  774

Query  196   A  194
             A
Sbjct  775   A  775



>ref|XP_011010424.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=775

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/601 (49%), Positives = 411/601 (68%), Gaps = 22/601 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY++KG+E  +GP+N T D RS RD  GHGTHTAST  G +V NA+A
Sbjct  180   FNSSHCNKKIIGARYYIKGFENYYGPLNMTEDSRSPRDRDGHGTHTASTAVGNRVKNAAA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G ATGGAPL  LAIYK CW +P  +  +   C ++D+LAA D A+ DGV V+S+
Sbjct  240   LGGFARGTATGGAPLAHLAIYKVCWAIPNQEKAEGNTCFEEDMLAAIDDAIGDGVHVMSI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   +     +DG+A+GA HA+K+NI V  +AGN    P +++N +PW+ TVGAS +D
Sbjct  300   SIGTR-EPTPLKEDGIAIGAFHALKKNIVVACAAGNEGPAPSTLSNPSPWVITVGASGVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDV---EIPGSTTIPGFCRQDTLSPE  1241
             R F  P++LGN + ++G++VT  K  +  PLV+A D     +P + T    C  ++LSP 
Sbjct  359   RAFFGPLVLGNGMKIEGQTVTPYKLDKDCPLVFAADAVASNVPKNVT--SQCLPNSLSPR  416

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNI-FNPS  1082
             KV+GK+V C+ G    +++ +EV+RAGG   ILG+    G+++ V++ ++ AT++ +N +
Sbjct  417   KVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATSVGYNDA  476

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                 IL YI + KNP+A +   +T+   +P+P MA FTS GP+   P+ILKPDITAPG+N
Sbjct  477   MK--ILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGPNVIHPSILKPDITAPGVN  534

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS A++P +  ED R VKYNIISGTSM+CPHV+A  ALL+AIHP+WS AAI+SA+M
Sbjct  535   ILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIRSALM  594

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA  KN  G+ I D  G  A PF +G+GH +P+KAADPGLVYD++Y DYLL++CS    
Sbjct  595   TTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCSYGVE  654

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              + P +KCP  + S  N NYPS+++ +L G++ + RTVTNVG++++ Y    + P G++V
Sbjct  655   NVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSARPPLGFAV  714

Query  361   KISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             K SP+ L F  VG+K+S           + +    GE+ FGWY WS+G H V+SP+ VS 
Sbjct  715   KASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHDVRSPMAVSL  774

Query  196   A  194
             A
Sbjct  775   A  775



>ref|XP_011045349.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Populus 
euphratica]
Length=775

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/601 (49%), Positives = 411/601 (68%), Gaps = 22/601 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY++KG+E  +GP+N T D RS RD  GHGTHTAST  G +V NA+A
Sbjct  180   FNSSHCNKKIIGARYYIKGFENYYGPLNMTEDSRSPRDRDGHGTHTASTAVGSRVKNAAA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G ATGGAPL  LAIYK CW +P  +  +   C ++D+LAA D A+ DGV V+S+
Sbjct  240   LGGFARGTATGGAPLAHLAIYKVCWAIPNQEKAEGNTCFEEDMLAAIDDAIGDGVHVMSI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   +     +DG+A+GA HA+K+NI V  +AGN    P +++N +PW+ TVGAS +D
Sbjct  300   SIGTR-EPTPLKEDGIAIGAFHALKKNIVVACAAGNEGPAPSTLSNPSPWVITVGASGVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDV---EIPGSTTIPGFCRQDTLSPE  1241
             R F  P++LGN + ++G++VT  K  +  PLV+A D     +P + T    C  ++LSP 
Sbjct  359   RAFLGPLVLGNGMKIEGQTVTPYKLDKDCPLVFAADAVASNVPKNGT--SQCLPNSLSPR  416

Query  1240  KVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNI-FNPS  1082
             KV+GK+V C+ G    +++ +EV+RAGG   ILG+    G+++ V++ ++ AT++ +N +
Sbjct  417   KVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATSVGYNDA  476

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                 IL YI + KNP+A +   +T+   +P+P MA FTS GP+   P+ILKPDITAPG+N
Sbjct  477   MK--ILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGPNVIHPSILKPDITAPGVN  534

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS A++P +  ED R VKYNIISGTSM+CPHV+A  ALL+AIHP+WS AAI+SA+M
Sbjct  535   ILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIRSALM  594

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA  KN  G+ I D  G  A PF +G+GH +P+KAADPGLVYD++Y DYLL++CS    
Sbjct  595   TTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCSYGVE  654

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              + P +KCP  + S  N NYPS+++ +L G++ + RTVTNVG++++ Y    + P G++V
Sbjct  655   NVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSARPPLGFAV  714

Query  361   KISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             K SP+ L F  VG+K+S           + +    GE+ FGWY WS+G H V+SP+ VS 
Sbjct  715   KASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHDVRSPMAVSL  774

Query  196   A  194
             A
Sbjct  775   A  775



>ref|XP_010518867.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=785

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/606 (51%), Positives = 404/606 (67%), Gaps = 33/606 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGY   +G  N T   DF S RD  GHG+HTAS      +  A
Sbjct  191   FNSSHCNRKIIGARYYVKGYMNGYGTFNVTANKDFLSPRDPDGHGSHTAS------MRRA  244

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             +A+GGFA G A+GGAP  RLAIYKACW  P  + +    C ++D+LAA D A++DGV VI
Sbjct  245   AAIGGFARGTASGGAPKARLAIYKACWAKPDSEKVDGNICFEEDMLAAIDDAISDGVHVI  304

Query  1594  SVSLGL---LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVG  1427
             S S+G    LP    F+QDG+A+GALHA++RNI V  SAGN   +P +++N APWI TVG
Sbjct  305   SASIGTTEPLP----FSQDGIAIGALHAVRRNIVVAASAGNSGPKPGTLSNPAPWIITVG  360

Query  1426  ASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI--PGFCRQDT  1253
             ASS+DR F   ++LGN   VK ESVT  K     PLVYA DV IPG+        C  ++
Sbjct  361   ASSLDRSFIGGLVLGNGFTVKTESVTSYKMDNFAPLVYAADVTIPGAVAANNTAQCLPNS  420

Query  1252  LSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIF  1091
             LSP+ VKGKVV CL G    + + LEV+RAGGA +ILG+    G ++ ++   + A  + 
Sbjct  421   LSPKLVKGKVVLCLRGAGSRIGKGLEVKRAGGAGLILGNALANGDDVPLDPHFVPAAGVI  480

Query  1090  NPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAP  911
              PS  D IL YI T+K P+A + PG+T++ ++P+P +  F+S GP+  +PNILKPDITAP
Sbjct  481   -PSIVDKILYYIRTDKKPIALIKPGETVYQSQPAPFVTGFSSRGPNVIDPNILKPDITAP  539

Query  910   GLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKS  731
             GLNILAAWS A SP +   D R V++N+ SGTSMSCPHVS  +ALLKAIHP+WS AAI+S
Sbjct  540   GLNILAAWSGADSPTKISVDRRVVEFNLYSGTSMSCPHVSGAIALLKAIHPNWSSAAIRS  599

Query  730   AIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS  551
             AIMTTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y DYLL+ CS 
Sbjct  600   AIMTTAWMTNDQEKPIQDVNGLPANPFAIGSGHFRPTKAADPGLVYDASYQDYLLYCCSV  659

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAP  377
               T +DP +KCPKK     NLNYPS++I  L   + V+R+VTNVGS+N  +TY    K P
Sbjct  660   GLTNVDPEFKCPKKPPPGYNLNYPSISIPNLSRRIRVRRSVTNVGSSNGTSTYFFSAKPP  719

Query  376   TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF-----GWYKWSDGIHMVKSP  212
              G SV   P+ +KF  VG+ + F ++VK++  +  GE +      GWY W+D  H V+SP
Sbjct  720   LGVSVTAKPSIMKFNRVGQIKRFTITVKLQKGQLAGEVQKGEFLFGWYTWTDNHHTVRSP  779

Query  211   IVVSSA  194
             I VS A
Sbjct  780   IAVSLA  785



>tpg|DAA57792.1| TPA: putative subtilase family protein [Zea mays]
Length=806

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/604 (52%), Positives = 401/604 (66%), Gaps = 24/604 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATF-GPVNHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SS CNRKIIGARY++K YEA + G +N T+ +RS RD  GHGTHTAST  GR VA AS
Sbjct  201   FPSSSCNRKIIGARYYLKAYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGAS  260

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLA+YKACW +P  D      C + D+LAA D AV DGV V+S
Sbjct  261   ALGGFARGSASGGAPLARLAVYKACWPIPGPDPNVENTCFEADMLAAMDDAVGDGVDVLS  320

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G       F  DG+ALGALHA  R + V  S GN    P +V+N+APW+ TV ASSI
Sbjct  321   VSIGSSGAPPRFADDGIALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTVAASSI  380

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F APV LGN + V G++VT  ++   +  PLVYA D  +PG+   +   C  ++L+ 
Sbjct  381   DRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPGTPANVSNQCLPNSLAS  440

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPS  1082
             +KV+GK+V CL G    + + LEV+RAGGAA++LG   + GSE+ V++ ++  T +   +
Sbjct  441   DKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTAVAA-A  499

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               D IL+YI ++ +P A L P +T+   +PSP MA F+S GP+  EP+ILKPDITAPGLN
Sbjct  500   DADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITAPGLN  559

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS ASSP +   DHR V+YNI+SGTSMSCPH SA  AL+KA HPDWS AAI+SAIM
Sbjct  560   ILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAHPDWSSAAIRSAIM  619

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS---  551
             TTATT + +G  + +  G VAGP  YG+GHI+P  A DPGLVYD++Y DYLLF C++   
Sbjct  620   TTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSYHDYLLFACAASSA  679

Query  550   -IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
               G+ LD S  CP +   P  LN+PS+A+  L GS+ V+RTVTNVG     Y+V V  P 
Sbjct  680   GSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGPGAARYAVAVVEPA  739

Query  373   GYSVKISPTELKFMEVGEKQs------ffvsvkvesvkkvgefeFGWYKWSD-GIHMVKS  215
             G SV +SP  L+F   GEK++           +  +    G+   G Y WSD G H+V+S
Sbjct  740   GVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGSYAWSDGGAHVVRS  799

Query  214   PIVV  203
             PIVV
Sbjct  800   PIVV  803



>ref|XP_008675086.1| PREDICTED: subtilisin-like protease isoform X3 [Zea mays]
Length=854

 Score =   546 bits (1406),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 312/604 (52%), Positives = 401/604 (66%), Gaps = 24/604 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATF-GPVNHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SS CNRKIIGARY++K YEA + G +N T+ +RS RD  GHGTHTAST  GR VA AS
Sbjct  249   FPSSSCNRKIIGARYYLKAYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGAS  308

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLA+YKACW +P  D      C + D+LAA D AV DGV V+S
Sbjct  309   ALGGFARGSASGGAPLARLAVYKACWPIPGPDPNVENTCFEADMLAAMDDAVGDGVDVLS  368

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G       F  DG+ALGALHA  R + V  S GN    P +V+N+APW+ TV ASSI
Sbjct  369   VSIGSSGAPPRFADDGIALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTVAASSI  428

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F APV LGN + V G++VT  ++   +  PLVYA D  +PG+   +   C  ++L+ 
Sbjct  429   DRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPGTPANVSNQCLPNSLAS  488

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPS  1082
             +KV+GK+V CL G    + + LEV+RAGGAA++LG   + GSE+ V++ ++  T +   +
Sbjct  489   DKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTAVAA-A  547

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               D IL+YI ++ +P A L P +T+   +PSP MA F+S GP+  EP+ILKPDITAPGLN
Sbjct  548   DADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITAPGLN  607

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS ASSP +   DHR V+YNI+SGTSMSCPH SA  AL+KA HPDWS AAI+SAIM
Sbjct  608   ILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAHPDWSSAAIRSAIM  667

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS---  551
             TTATT + +G  + +  G VAGP  YG+GHI+P  A DPGLVYD++Y DYLLF C++   
Sbjct  668   TTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSYHDYLLFACAASSA  727

Query  550   -IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
               G+ LD S  CP +   P  LN+PS+A+  L GS+ V+RTVTNVG     Y+V V  P 
Sbjct  728   GSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGPGAARYAVAVVEPA  787

Query  373   GYSVKISPTELKFMEVGEKQs------ffvsvkvesvkkvgefeFGWYKWSD-GIHMVKS  215
             G SV +SP  L+F   GEK++           +  +    G+   G Y WSD G H+V+S
Sbjct  788   GVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGSYAWSDGGAHVVRS  847

Query  214   PIVV  203
             PIVV
Sbjct  848   PIVV  851



>ref|XP_011045348.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Populus 
euphratica]
Length=790

 Score =   541 bits (1395),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 294/614 (48%), Positives = 412/614 (67%), Gaps = 33/614 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCN+KIIGARY++KG+E  +GP+N T D RS RD  GHGTHTAST  G +V NA+A
Sbjct  180   FNSSHCNKKIIGARYYIKGFENYYGPLNMTEDSRSPRDRDGHGTHTASTAVGSRVKNAAA  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDD-IKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G ATGGAPL  LAIYK CW +P  +  +   C ++D+LAA D A+ DGV V+S+
Sbjct  240   LGGFARGTATGGAPLAHLAIYKVCWAIPNQEKAEGNTCFEEDMLAAIDDAIGDGVHVMSI  299

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G   +     +DG+A+GA HA+K+NI V  +AGN    P +++N +PW+ TVGAS +D
Sbjct  300   SIGTR-EPTPLKEDGIAIGAFHALKKNIVVACAAGNEGPAPSTLSNPSPWVITVGASGVD  358

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDV---EIPGSTTI-----------P  1274
             R F  P++LGN + ++G++VT  K  +  PLV+A D     +P + T             
Sbjct  359   RAFLGPLVLGNGMKIEGQTVTPYKLDKDCPLVFAADAVASNVPKNGTRFLSSQNNLRRRL  418

Query  1273  GF--CRQDTLSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVES  1118
             G   C  ++LSP KV+GK+V C+ G    +++ +EV+RAGG   ILG+    G+++ V++
Sbjct  419   GLYQCLPNSLSPRKVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDA  478

Query  1117  FLITATNI-FNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEP  941
              ++ AT++ +N +    IL YI + KNP+A +   +T+   +P+P MA FTS GP+   P
Sbjct  479   HVLPATSVGYNDAMK--ILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGPNVIHP  536

Query  940   NILKPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIH  761
             +ILKPDITAPG+NILAAWS A++P +  ED R VKYNIISGTSM+CPHV+A  ALL+AIH
Sbjct  537   SILKPDITAPGVNILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAALLRAIH  596

Query  760   PDWSGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTY  581
             P+WS AAI+SA+MTTA  KN  G+ I D  G  A PF +G+GH +P+KAADPGLVYD++Y
Sbjct  597   PEWSSAAIRSALMTTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASY  656

Query  580   MDYLLFVCSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTT  401
              DYLL++CS     + P +KCP  + S  N NYPS+++ +L G++ + RTVTNVG++++ 
Sbjct  657   TDYLLYLCSYGVENVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSV  716

Query  400   YSVEVKAPTGYSVKISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSD  236
             Y    + P G++VK SP+ L F  VG+K+S           + +    GE+ FGWY WS+
Sbjct  717   YFFSARPPLGFAVKASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYAFGWYTWSN  776

Query  235   GIHMVKSPIVVSSA  194
             G H V+SP+ VS A
Sbjct  777   GHHDVRSPMAVSLA  790



>ref|XP_008675084.1| PREDICTED: subtilisin-like protease isoform X1 [Zea mays]
Length=864

 Score =   542 bits (1397),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 314/614 (51%), Positives = 403/614 (66%), Gaps = 34/614 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATF-GPVNHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SS CNRKIIGARY++K YEA + G +N T+ +RS RD  GHGTHTAST  GR VA AS
Sbjct  249   FPSSSCNRKIIGARYYLKAYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGAS  308

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLA+YKACW +P  D      C + D+LAA D AV DGV V+S
Sbjct  309   ALGGFARGSASGGAPLARLAVYKACWPIPGPDPNVENTCFEADMLAAMDDAVGDGVDVLS  368

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G       F  DG+ALGALHA  R + V  S GN    P +V+N+APW+ TV ASSI
Sbjct  369   VSIGSSGAPPRFADDGIALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTVAASSI  428

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS---TTIPGF------  1268
             DR F APV LGN + V G++VT  ++   +  PLVYA D  +PG+    + PG       
Sbjct  429   DRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPGTPANVSNPGSTVHDRR  488

Query  1267  --CRQDTLSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFL  1112
               C  ++L+ +KV+GK+V CL G    + + LEV+RAGGAA++LG   + GSE+ V++ +
Sbjct  489   SQCLPNSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPVDAHV  548

Query  1111  ITATNIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNIL  932
             +  T +   +  D IL+YI ++ +P A L P +T+   +PSP MA F+S GP+  EP+IL
Sbjct  549   LPGTAVAA-ADADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSIL  607

Query  931   KPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDW  752
             KPDITAPGLNILAAWS ASSP +   DHR V+YNI+SGTSMSCPH SA  AL+KA HPDW
Sbjct  608   KPDITAPGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAHPDW  667

Query  751   SGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDY  572
             S AAI+SAIMTTATT + +G  + +  G VAGP  YG+GHI+P  A DPGLVYD++Y DY
Sbjct  668   SSAAIRSAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSYHDY  727

Query  571   LLFVCSS----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANT  404
             LLF C++     G+ LD S  CP +   P  LN+PS+A+  L GS+ V+RTVTNVG    
Sbjct  728   LLFACAASSAGSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGPGAA  787

Query  403   TYSVEVKAPTGYSVKISPTELKFMEVGEKQs------ffvsvkvesvkkvgefeFGWYKW  242
              Y+V V  P G SV +SP  L+F   GEK++           +  +    G+   G Y W
Sbjct  788   RYAVAVVEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGSYAW  847

Query  241   SD-GIHMVKSPIVV  203
             SD G H+V+SPIVV
Sbjct  848   SDGGAHVVRSPIVV  861



>ref|XP_008675085.1| PREDICTED: subtilisin-like protease isoform X2 [Zea mays]
Length=858

 Score =   542 bits (1396),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 314/614 (51%), Positives = 403/614 (66%), Gaps = 34/614 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATF-GPVNHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             F SS CNRKIIGARY++K YEA + G +N T+ +RS RD  GHGTHTAST  GR VA AS
Sbjct  243   FPSSSCNRKIIGARYYLKAYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGAS  302

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFCQDDDVLAAFDHAVADGVQVIS  1592
             ALGGFA G A+GGAPL RLA+YKACW +P  D      C + D+LAA D AV DGV V+S
Sbjct  303   ALGGFARGSASGGAPLARLAVYKACWPIPGPDPNVENTCFEADMLAAMDDAVGDGVDVLS  362

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G       F  DG+ALGALHA  R + V  S GN    P +V+N+APW+ TV ASSI
Sbjct  363   VSIGSSGAPPRFADDGIALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTVAASSI  422

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS---TTIPGF------  1268
             DR F APV LGN + V G++VT  ++   +  PLVYA D  +PG+    + PG       
Sbjct  423   DRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPGTPANVSNPGSTVHDRR  482

Query  1267  --CRQDTLSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFL  1112
               C  ++L+ +KV+GK+V CL G    + + LEV+RAGGAA++LG   + GSE+ V++ +
Sbjct  483   SQCLPNSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPVDAHV  542

Query  1111  ITATNIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNIL  932
             +  T +   +  D IL+YI ++ +P A L P +T+   +PSP MA F+S GP+  EP+IL
Sbjct  543   LPGTAVAA-ADADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSIL  601

Query  931   KPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDW  752
             KPDITAPGLNILAAWS ASSP +   DHR V+YNI+SGTSMSCPH SA  AL+KA HPDW
Sbjct  602   KPDITAPGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAHPDW  661

Query  751   SGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDY  572
             S AAI+SAIMTTATT + +G  + +  G VAGP  YG+GHI+P  A DPGLVYD++Y DY
Sbjct  662   SSAAIRSAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSYHDY  721

Query  571   LLFVCSS----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANT  404
             LLF C++     G+ LD S  CP +   P  LN+PS+A+  L GS+ V+RTVTNVG    
Sbjct  722   LLFACAASSAGSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGPGAA  781

Query  403   TYSVEVKAPTGYSVKISPTELKFMEVGEKQs------ffvsvkvesvkkvgefeFGWYKW  242
              Y+V V  P G SV +SP  L+F   GEK++           +  +    G+   G Y W
Sbjct  782   RYAVAVVEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGSYAW  841

Query  241   SD-GIHMVKSPIVV  203
             SD G H+V+SPIVV
Sbjct  842   SDGGAHVVRSPIVV  855



>gb|EPS68445.1| hypothetical protein M569_06321, partial [Genlisea aurea]
Length=639

 Score =   533 bits (1374),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 309/609 (51%), Positives = 404/609 (66%), Gaps = 27/609 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F S+HCNRKIIGARY+VKGYEA +GP+N + D+ S RD  GHGTHTAS   GR+V +ASA
Sbjct  33    FNSTHCNRKIIGARYYVKGYEAYYGPLNRSTDYLSPRDKDGHGTHTASIAVGRRVRSASA  92

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIK-ATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGGFA G A+GGAPL RLA+YK CW +P    +    C + D+LAA D AVADGV V+S+
Sbjct  93    LGGFAAGTASGGAPLARLAVYKVCWPIPGQGKENGNTCFEADMLAAMDQAVADGVHVLSI  152

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G     +Y   DG+A+G+LHA K +I VV SAGN    P +++N APWI TVGAS++D
Sbjct  153   SIGTKASLDY-AADGIAIGSLHAAKNDIVVVCSAGNNGPAPKTLSNPAPWIITVGASTVD  211

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVY--AGDVEIPGSTTIPGF---CRQDTLS  1247
             R F + V LGN   + GE++T  K ++    +Y  A   ++  STT       C   +LS
Sbjct  212   REFVSAVSLGNGQKIPGETLTPYKLKKKKKKLYPLARGSQVSNSTTPKDLLDQCMPGSLS  271

Query  1246  PEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEK  GK++FCL G    + + +EV+RAGG   ILG+    G  + V+   + AT +   
Sbjct  272   PEKTAGKIIFCLRGNGTRIGKGMEVKRAGGIGYILGNSKLNGKLVAVDPHFLPATAVTYE  331

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +    IL YI + ++P A +IP KT+ G KP+P+MA FTS GP+   P++LKPD+TAPG+
Sbjct  332   NSLK-ILDYIDSTEDPRAYIIPAKTVVGTKPAPSMAVFTSRGPNTISPDVLKPDVTAPGV  390

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAWSEASSP +   D R VKYNI+SGTSMSCPH++   ALLKA+H +W+ AAI+SAI
Sbjct  391   NILAAWSEASSPTKMAVDSRVVKYNILSGTSMSCPHIAGAAALLKAVHRNWTSAAIRSAI  450

Query  724   MTTATTKNVKGEAIKDAY-GEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             +TTATT N +G  I ++  G  A PF +GAGH +P+KA DPGLVYD++Y DY+LF+CSS 
Sbjct  451   VTTATTTNKEGAPITESMGGGPADPFQFGAGHFRPTKAVDPGLVYDASYEDYVLFLCSSN  510

Query  547   GT----TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKA  380
             GT    T   S KCP+   SP++LNYPSL I QL  S+ V RTVTNVG+ N+TY  + K 
Sbjct  511   GTNNNITAFTSAKCPENPPSPADLNYPSLQIKQLNKSVTVVRTVTNVGNGNSTYFAKTKP  570

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkves-------vkkvgefeFGWYKWSDGIHMV  221
             P G S++ISP  L+F   G+K SF + V                 F FGWY WSDGIH V
Sbjct  571   PPGISIEISPPVLRFDSSGQKMSFSIVVSKNEQFRVNNGTNTNSTFVFGWYTWSDGIHNV  630

Query  220   KSPIVVSSA  194
              SPI +++A
Sbjct  631   ASPIAINAA  639



>dbj|BAK03173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   535 bits (1378),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 304/586 (52%), Positives = 394/586 (67%), Gaps = 17/586 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +S CNRK+IGARY++K YE   G +N T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  98    FNASSCNRKVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAA  157

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL RLAIYK CW +P    +I+ T C D D+LAA D AV DGV V+S
Sbjct  158   LGGFAAGAASGGAPLARLAIYKVCWPIPGPNPNIENT-CFDADMLAAMDDAVGDGVDVMS  216

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSI  1415
             VS+G   +      DG+A+GALHA +  + VV S GN    P +V+N+APWI TVGASSI
Sbjct  217   VSIGSSGKPPRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSNLAPWILTVGASSI  276

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F++P+ LGN +++ G++VT  ++    T P+VYA    +PG+   +   C  ++LSP
Sbjct  277   DRSFNSPIRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPGTPANVTNQCLPNSLSP  336

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
             +KV+GK+V CL G    + + LEV+RAGGAA++LG+    GSE+ V++ ++  T + + +
Sbjct  337   KKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVPVDAHVLPGTAV-SMA  395

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + ILKYI ++ NP A L   +T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLN
Sbjct  396   DVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLN  455

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HPDWS AAI+SAIM
Sbjct  456   ILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAAIRSAIM  515

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTAT  N +G  I +  G VAGP  YG+GHI+P  A DPGLVYD+++ DYL+F C+S G 
Sbjct  516   TTATANNAEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFACASGGA  575

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S+ CP     P  LNYPS+AI  L  S  V+RTVTNVG     Y+V V  P G+SV
Sbjct  576   QLDHSFPCPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVAVVEPAGFSV  635

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefe---FGWYKWSDG  233
             K+SPT L F   GEK++F + ++    +          G Y WSDG
Sbjct  636   KVSPTSLAFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  681



>dbj|BAJ85613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=785

 Score =   538 bits (1385),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 304/586 (52%), Positives = 395/586 (67%), Gaps = 17/586 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F +S CNRK+IGARY++K YE   G +N T  +RS RD  GHGTHTASTV GR V   +A
Sbjct  189   FNASSCNRKVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAA  248

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             LGGFA G A+GGAPL RLAIYK CW +P    +I+ T C D D+LAA D AV DGV V+S
Sbjct  249   LGGFAAGAASGGAPLARLAIYKVCWPIPGPNPNIENT-CFDADMLAAMDDAVGDGVDVMS  307

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VS+G   +      DG+A+GALHA +  + VV S GN    P +V+N+APWI TVGASSI
Sbjct  308   VSIGSSGKPPRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSNLAPWILTVGASSI  367

Query  1414  DRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSP  1244
             DR F++P+ LGN +++ G++VT  ++    T P+VYA    +PG+   +   C  ++LSP
Sbjct  368   DRSFNSPIRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPGTPANVTNQCLPNSLSP  427

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
             +KV+GK+V CL G    + + LEV+RAGGAA++LG+    GSE++V++ ++  T + + +
Sbjct  428   KKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVRVDAHVLPGTAV-SMA  486

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + ILKYI ++ NP A L   +T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLN
Sbjct  487   DVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLN  546

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWSEASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HPDWS AAI+SAIM
Sbjct  547   ILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAAIRSAIM  606

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTAT  N +G  I +  G VAGP  YG+GHI+P  A DPGLVYD+++ DYL+F C+S G 
Sbjct  607   TTATANNAEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFACASGGA  666

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              LD S+ CP     P  LNYPS+AI  L  S  V+RTVTNVG     Y+V V  P G+SV
Sbjct  667   QLDHSFPCPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVAVVEPAGFSV  726

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefe---FGWYKWSDG  233
             K+SPT L F   GEK++F + ++    +          G Y WSDG
Sbjct  727   KVSPTSLAFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  772



>ref|XP_004486283.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score =   536 bits (1380),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 286/601 (48%), Positives = 394/601 (66%), Gaps = 23/601 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+SS CNRKIIGARY+++GYE+ +GP++   D++S+RD  GHGTHT+S V GR VANASA
Sbjct  188   FSSSKCNRKIIGARYYLQGYESIYGPLDEEEDYKSARDKDGHGTHTSSIVAGRAVANASA  247

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD---DIKATFCQDDDVLAAFDHAVADGVQVI  1595
             LGGFA+G A+GGAPL RLAIYKACW  PF          C D D+L A D A+ DGV V+
Sbjct  248   LGGFASGTASGGAPLARLAIYKACW--PFKGKSKSDGNICTDIDLLKAIDDAINDGVDVL  305

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASS  1418
             S+S+G      Y  +D +A G+L A+K NI VV SAGN    P++++N APWI TVGAS+
Sbjct  306   SLSIGFHEPLTY-DEDVIAKGSLQAIKNNIVVVCSAGNAGPFPHTLSNPAPWIITVGAST  364

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             +DR F APV L N  +++G S+T +  + +  PLV+A DVE P   +    +C  +TL P
Sbjct  365   VDRTFLAPVKLTNGTIIEGRSITPLLIENSFRPLVFASDVENPSVPSANSSYCLDNTLDP  424

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
              KVKGK+V C+ G    + + LEV+RAGG  +ILG+    G+++  +   I+AT + N  
Sbjct  425   SKVKGKIVLCMRGQGTRMKKGLEVQRAGGVGLILGNNKLYGNDLPSDPHFISATGV-NYD  483

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  +++YI ++ NP+A L+PG T+  +KP+P+MA FTS GP+  +PNILKPDITAPG++
Sbjct  484   NTLKLIQYIHSSPNPMAQLLPGTTVLDSKPAPSMAVFTSRGPNIIDPNILKPDITAPGVD  543

Query  901   ILAAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             ILAAW+    P      D R VKYNI SGTSM+CPHVSA   LLKA++P WS AAI+SAI
Sbjct  544   ILAAWTAKDGPTRMTFNDKRVVKYNIFSGTSMACPHVSAAAVLLKAMYPTWSPAAIRSAI  603

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MT+A   +  G+ I D  G+   PF  G+GH  P +A +PGLVYD++Y DYLL++C+   
Sbjct  604   MTSARANDNTGKPITDETGKPTTPFAMGSGHFHPKRATNPGLVYDASYTDYLLYLCNLKT  663

Query  544   T-TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             T  L+ SY CP     P +LNYPS+ I +L  +  ++RTVTNVG   + Y    K P  +
Sbjct  664   TQNLNLSYNCPNPLPEPFDLNYPSIQIHKLNYTKTIQRTVTNVGRNESVYKFIAKPPKEF  723

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF-----GWYKWSDGIHMVKSPIVV  203
             ++   P++LKF  +G+K+ F ++V         + +      GWY W+D  H+VKSP+ V
Sbjct  724   NIIAFPSKLKFTHLGQKREFTITVTENKDHIRTKSDSEKYYFGWYTWTDRRHVVKSPVAV  783

Query  202   S  200
             S
Sbjct  784   S  784



>dbj|BAJ94880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   529 bits (1362),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 298/578 (52%), Positives = 387/578 (67%), Gaps = 15/578 (3%)
 Frame = -2

Query  1924  RKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANG  1745
             RK+IGARY++K YE   G +N T  +RS RD  GHGTHTASTV GR V   +ALGGFA G
Sbjct  1     RKVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAALGGFAAG  60

Query  1744  VATGGAPLTRLAIYKACWQVPFDDIK-ATFCQDDDVLAAFDHAVADGVQVISVSLGLLPQ  1568
              A+GGAPL RLAIYK CW +P  ++     C D D+LAA D AV DGV V+SVS+G   +
Sbjct  61    AASGGAPLARLAIYKVCWPIPGPNLNIENTCFDADMLAAMDDAVGDGVDVMSVSIGSSGK  120

Query  1567  DNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFSAPV  1391
                   DG+A+GALHA +  + VV S GN    P +V+N+APWI TVGASSIDR F++P+
Sbjct  121   PPRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSNLAPWILTVGASSIDRSFNSPI  180

Query  1390  LLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSPEKVKGKVV  1220
              LGN +++ G++VT  ++    T P+VYA    +PG+   +   C  ++LSP+KV+GK+V
Sbjct  181   RLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKIV  240

Query  1219  FCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILKY  1058
              CL G    + + LEV+RAGGAA++LG+    GSE+ V++ ++  T + + +  + ILKY
Sbjct  241   VCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVPVDAHVLPGTAV-SMADVNTILKY  299

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I ++ NP A L   +T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLNILAAWSEA
Sbjct  300   INSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSEA  359

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
             SSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HPDWS AAI+SAIMTTAT  N 
Sbjct  360   SSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANNA  419

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYKC  518
             +G  I +  G VAGP  YG+GHI+P  A DPGLVYD+++ DYL+F C+S G  LD S+ C
Sbjct  420   EGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFACASGGAQLDHSFPC  479

Query  517   PKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTELK  338
             P     P  LNYPS+AI  L  S  V+RTVTNVG     Y+V V  P G+SVK+SPT L 
Sbjct  480   PASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVAVVEPAGFSVKVSPTSLA  539

Query  337   FMEVGEKQsffvsvkvesvkkvgefe---FGWYKWSDG  233
             F   GEK++F + ++    +          G Y WSDG
Sbjct  540   FARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  577



>gb|AIC80766.1| subtilase [Cicer arietinum]
Length=773

 Score =   535 bits (1378),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 286/601 (48%), Positives = 394/601 (66%), Gaps = 23/601 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F+SS CNRKIIGARY+++GYE+ +GP++   D++S+RD  GHGTHT+S V GR VANASA
Sbjct  175   FSSSKCNRKIIGARYYLQGYESIYGPLDEEEDYKSARDKDGHGTHTSSIVAGRAVANASA  234

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPF---DDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             LGGFA+G A+GGAPL RLAIYKACW  PF          C D D+L A D A+ DGV V+
Sbjct  235   LGGFASGTASGGAPLARLAIYKACW--PFKGKSKSDGNICTDIDLLKAIDDAINDGVDVL  292

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASS  1418
             S+S+G      Y  +D +A G+L A+K NI VV SAGN    P++++N APWI TVGAS+
Sbjct  293   SLSIGFHEPLTY-DEDVIAKGSLQAIKNNIVVVCSAGNAGPFPHTLSNPAPWIITVGAST  351

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSP  1244
             +DR F APV L N  +++G S+T +  + +  PLV+A DVE P   +    +C  +TL P
Sbjct  352   VDRTFLAPVKLTNGTIIEGRSITPLLIENSFRPLVFASDVENPSVPSANSSYCLDNTLDP  411

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
              KVKGK+V C+ G    + + LEV+RAGG  +ILG+    G+++  +   I+AT + N  
Sbjct  412   SKVKGKIVLCMRGQGTRMKKGLEVQRAGGVGLILGNNKLYGNDLPSDPHFISATGV-NYD  470

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  +++YI ++ NP+A L+PG T+  +KP+P+MA FTS GP+  +PNILKPDITAPG++
Sbjct  471   NTLKLIQYIHSSPNPMAQLLPGTTVLDSKPAPSMAVFTSRGPNIIDPNILKPDITAPGVD  530

Query  901   ILAAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             ILAAW+    P      D R VKYNI SGTSM+CPHVSA   LLKA++P WS AAI+SAI
Sbjct  531   ILAAWTAKDGPTRMTFNDKRVVKYNIFSGTSMACPHVSAAAVLLKAMYPTWSPAAIRSAI  590

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MT+A   +  G+ I D  G+   PF  G+GH  P +A +PGLVYD++Y DYLL++C+   
Sbjct  591   MTSARANDNTGKPITDETGKPTTPFAMGSGHFHPKRATNPGLVYDASYTDYLLYLCNLKT  650

Query  544   T-TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             T  L+ SY CP     P +LNYPS+ I +L  +  ++RTVTNVG   + Y    K P  +
Sbjct  651   TQNLNLSYNCPNPLPEPFDLNYPSIQIHKLNYTKTIQRTVTNVGRNESVYKFIAKPPKEF  710

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF-----GWYKWSDGIHMVKSPIVV  203
             ++   P++LKF  +G+K+ F ++V         + +      GWY W+D  H+VKSP+ V
Sbjct  711   NIIAFPSKLKFTHLGQKREFTITVTENKDHIRTKSDSEKYYFGWYTWTDRRHVVKSPVAV  770

Query  202   S  200
             S
Sbjct  771   S  771



>dbj|BAJ86327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   527 bits (1357),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 300/579 (52%), Positives = 389/579 (67%), Gaps = 17/579 (3%)
 Frame = -2

Query  1924  RKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANG  1745
             RK+IGARY++K YE   G +N T  +RS RD  GHGTHTASTV GR V   +ALGGFA G
Sbjct  1     RKVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAALGGFAAG  60

Query  1744  VATGGAPLTRLAIYKACWQVP--FDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              A+GGAPL RLAIYK CW +P    +I+ T C D D+LAA D AV DGV V+SVS+G   
Sbjct  61    AASGGAPLARLAIYKVCWPIPGPNPNIENT-CFDADMLAAMDDAVGDGVDVMSVSIGSSG  119

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFSAP  1394
             +      DG+A+GALHA +  + VV S GN    P +V+N+APWI TVGASSIDR F++P
Sbjct  120   KPPRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSNLAPWILTVGASSIDRSFNSP  179

Query  1393  VLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGS-TTIPGFCRQDTLSPEKVKGKV  1223
             + LGN +++ G++VT  ++    T P+VYA    +PG+   +   C  ++LSP+KV+GK+
Sbjct  180   IRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPGTPANVTNQCLPNSLSPKKVRGKI  239

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILK  1061
             V CL G    + + LEV+RAGGAA++LG+    GSE+ V++ ++  T + + +  + ILK
Sbjct  240   VVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVPVDAHVLPGTAV-SMADVNTILK  298

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI ++ NP A L   +T+   KPSP MA F+S GP+  EP+ILKPD+TAPGLNILAAWSE
Sbjct  299   YINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVTAPGLNILAAWSE  358

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             ASSP +   D+R VKYNI+SGTSMSCPHVSA   LLK+ HPDWS AAI+SAIMTTAT  N
Sbjct  359   ASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAAIRSAIMTTATANN  418

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDPSYK  521
              +G  I +  G VAGP  YG+GHI+P  A DPGLVYD+++ DYL+F C+S G  LD S+ 
Sbjct  419   AEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFACASGGAQLDHSFP  478

Query  520   CPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPTEL  341
             CP     P  LNYPS+AI  L  S  V+RTVTNVG     Y+V V  P G+SVK+SPT L
Sbjct  479   CPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVAVVEPAGFSVKVSPTSL  538

Query  340   KFMEVGEKQsffvsvkvesvkkvgefe---FGWYKWSDG  233
              F   GEK++F + ++    +          G Y WSDG
Sbjct  539   AFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  577



>ref|XP_010529231.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=783

 Score =   533 bits (1374),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 306/603 (51%), Positives = 398/603 (66%), Gaps = 25/603 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+VKGY   +G  N T   DF S RD  GHG+HTAST  G   A  
Sbjct  187   FDSSHCNRKIIGARYYVKGYLNNYGSFNVTANKDFLSPRDPDGHGSHTASTAVGGAAAIG  246

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
                   A G A+GGA   RLA+YKACW  P  + +    C ++D+LAA D A+ADGV VI
Sbjct  247   GF----AGGTASGGAQRARLAVYKACWAKPDAEKVDGNVCFEEDMLAAIDDAIADGVHVI  302

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASS  1418
             SVS+G +    Y ++DG+A+GALHA++RNI V  SAGNY  +P +++N APWI TVGAS 
Sbjct  303   SVSIGSIDPLPY-SEDGIAIGALHAVRRNIVVAASAGNYGPKPGTLSNPAPWIITVGASG  361

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG--STTIPGFCRQDTLSP  1244
             +DR F   ++LGN   +K ES+T  K     PLVYA DV IPG  +      C  ++LSP
Sbjct  362   LDRSFVGGLVLGNGFTIKTESITSYKMDNFAPLVYAADVVIPGVVAANDTSQCLPNSLSP  421

Query  1243  EKVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPS  1082
             E VKGKVV C+ G    + ++LEV+RAGGA +ILG+    G +I V++  I A  +  PS
Sbjct  422   ELVKGKVVMCMRGTGSRVGKSLEVKRAGGAGLILGNSPANGDDIPVDAHFIPAAGVI-PS  480

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               D IL YI T+KNPVA + PGKT++ +KP+P +  F+S GP+  +PNILKPDI+APGLN
Sbjct  481   VVDKILHYIKTDKNPVAFIKPGKTVYRSKPAPFVTGFSSRGPNVIDPNILKPDISAPGLN  540

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS A SP +   D R+V++N+ SGTSMSCPHVS  +AL+KAIHP WS AAI+SAIM
Sbjct  541   ILAAWSGADSPTKISADRRTVEFNLFSGTSMSCPHVSGAIALIKAIHPSWSSAAIRSAIM  600

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA   N + + I+D  G  A PF  G+GH +P+KAADPGLVYD++Y +YLL+ CS   T
Sbjct  601   TTAWMTNDEKKPIQDINGLPANPFAIGSGHFRPTKAADPGLVYDASYKEYLLYCCSVSLT  660

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSAN--TTYSVEVKAPTGY  368
              +DP +KCPKK     NLNYPS++I  L  ++ ++R VTNVGS+N  +TY    K P G 
Sbjct  661   DVDPEFKCPKKPPPGYNLNYPSISIPNLNRTVKIQRRVTNVGSSNGTSTYFFSAKPPLGV  720

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGW-----YKWSDGIHMVKSPIVV  203
             SV   P  L F   G+K+ F ++VK  + +  G+ + G      Y W+D  H+V+SPI V
Sbjct  721   SVTAKPNILTFSRAGQKKRFTITVKPRTEQLRGKVQKGQYIFGRYTWTDSYHVVRSPIAV  780

Query  202   SSA  194
             S A
Sbjct  781   SLA  783



>ref|XP_006449588.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 ref|XP_006449589.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62828.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62829.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=557

 Score =   517 bits (1331),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 288/559 (52%), Positives = 377/559 (67%), Gaps = 15/559 (3%)
 Frame = -2

Query  1831  ISGHGTHTASTVGGRKVANASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFC  1655
             + GHGTHTASTV GR+V NASA GGFA G A+GGAPL RLAIYKACW  P     A   C
Sbjct  1     MDGHGTHTASTVAGRRVPNASAFGGFAEGTASGGAPLARLAIYKACWATPKASKAAGNTC  60

Query  1654  QDDDVLAAFDHAVADGVQVISVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-  1478
              + D+LAA D A+ DGV V+S+S+G   Q   F +DG+A+GAL+A+K NI V  SAGN  
Sbjct  61    FEADMLAAIDDAIRDGVHVLSISIGT-NQPFAFNRDGIAIGALNAVKHNILVACSAGNSG  119

Query  1477  REPYSVTNVAPWIFTVGASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVE  1298
               P S++N APW+ TVGA S+DR F  PV+LGN + + G++VT    ++  PLVYA DV 
Sbjct  120   PAPSSLSNPAPWLITVGAGSLDRDFVGPVVLGNGMEIIGKTVTPYNLKKMHPLVYAADVV  179

Query  1297  IPG-STTIPGFCRQDTLSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---G  1139
             +PG        C   +L+PEKVKGK+V C+ G    LS+ +EV+RAGG  +ILG+    G
Sbjct  180   VPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANG  239

Query  1138  SEIQVESFLITATNIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLG  959
             +E   ++  + AT +        I +YI +  NP A +   +T+   +P+P MA FTS G
Sbjct  240   NEYSYDAHYLPATAVLYDDAIK-IHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRG  298

Query  958   PSYPEPNILKPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVA  779
             P+  +P ILKPDITAPGLNILAAWSEASSP +   D R VKY I SGTSMSCPHV+A  A
Sbjct  299   PNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAA  358

Query  778   LLKAIHPDWSGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGL  599
             LLKAIHPDWS AAI+SA+MTTA  KN KG  I +A G +A PF +G+GH +P+KAADPGL
Sbjct  359   LLKAIHPDWSSAAIRSALMTTAWMKNNKGLPITNADGSIATPFSFGSGHFRPTKAADPGL  418

Query  598   VYDSTYMDYLLFVCSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV  419
             VYD++Y DYLL++CS   +  +P ++CP K  S  NLNYPS+AI  L G+++VKRTVTNV
Sbjct  419   VYDASYEDYLLYLCSHGFSFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNV  478

Query  418   GSANTTYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvs----vkvesvkkvgefeFGW  251
             G + + Y    K P G SVK +P+ L F  +G+K+SF ++     +        ++ FGW
Sbjct  479   GGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTKQYVFGW  538

Query  250   YKWSDGIHMVKSPIVVSSA  194
             Y+W+DG+H+V+SP+ VS A
Sbjct  539   YRWTDGLHLVRSPMAVSFA  557



>emb|CBI30770.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   523 bits (1347),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 303/600 (51%), Positives = 388/600 (65%), Gaps = 56/600 (9%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRK+IGARY++KGYE+  GP+N T D+RS RD  GHGTHTASTV GR+V N SA
Sbjct  181   FNSSDCNRKLIGARYYLKGYESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVSA  240

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A G A+GGAPL                                      + V+S+S
Sbjct  241   LG-YAPGTASGGAPL-------------------------------------ALHVLSIS  262

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDR  1409
             +G      Y  +DG+A+GALHA K NI V  SAGN    P +++N APWI TVGASS+DR
Sbjct  263   IGTSTPFTY-AKDGIAIGALHATKNNIVVACSAGNSGPGPSTLSNPAPWIITVGASSVDR  321

Query  1408  VFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPG--STTIPGFCRQDTLSPEK  1238
              F  P++LGN + + GESVT  K K++  PLV+A DV +PG         C   +L P+K
Sbjct  322   AFVTPLVLGNGMKLMGESVTPYKLKKKMYPLVFAADVVVPGVPKNNTAANCNFGSLDPKK  381

Query  1237  VKGKVVFCLTGGLS----QTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             VKGK+V CL GG++    + +EV+RAGG   ILG+    G ++  +  L+ AT + +   
Sbjct  382   VKGKLVLCLRGGIALRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAVSSEDV  441

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
             T  I  YI + K P+AT+IPG+T+  AKP+P MA FTS GP+  +PNILKPDIT PGLNI
Sbjct  442   TK-IRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDITGPGLNI  500

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWSE SSP     D R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MT
Sbjct  501   LAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMT  560

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA   N  G+ I D+ G  A PF YG+GH +P+KAADPGLVYD+TY DYLL++C+    +
Sbjct  561   TAGLVNNIGKPITDSSGNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVKS  620

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             LD S+ CPK + S +NLNYPSL I++LK  + + RTVTNVGSA + Y   VK+P G+SV+
Sbjct  621   LDSSFNCPKVSPSSNNLNYPSLQISKLKRKVTITRTVTNVGSARSIYFSSVKSPVGFSVR  680

Query  358   ISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             + P+ L F  VG+K+S        + K        E+ FGWY W+DGIH V+SP+ VS A
Sbjct  681   VEPSILYFNHVGQKKSFCITVEARNPKASKKNDAEEYAFGWYTWNDGIHNVRSPMAVSLA  740



>gb|KDO77991.1| hypothetical protein CISIN_1g0040471mg [Citrus sinensis]
Length=557

 Score =   513 bits (1322),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 286/559 (51%), Positives = 376/559 (67%), Gaps = 15/559 (3%)
 Frame = -2

Query  1831  ISGHGTHTASTVGGRKVANASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKA-TFC  1655
             + GHGTHTASTV GR+V NASA GGFA G A+GGAPL RLAIYKACW  P     A   C
Sbjct  1     MDGHGTHTASTVAGRRVPNASAFGGFAEGTASGGAPLARLAIYKACWATPKASKAAGNTC  60

Query  1654  QDDDVLAAFDHAVADGVQVISVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-  1478
              + D+LAA D A+ DGV V+S+S+G   Q   F +DG+A+GAL+A+K NI V  SAGN  
Sbjct  61    FEADMLAAIDDAIRDGVHVLSISIGT-NQPFAFNRDGIAIGALNAVKHNILVACSAGNSG  119

Query  1477  REPYSVTNVAPWIFTVGASSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVE  1298
               P S++N+APW+ TVGA S+DR F  PV+LG  + + G++VT    ++  PLVYA DV 
Sbjct  120   PAPSSLSNLAPWLITVGAGSLDRDFVGPVVLGTGMEIIGKTVTPYNLKKMHPLVYAADVV  179

Query  1297  IPG-STTIPGFCRQDTLSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---G  1139
             +PG        C   +L+PEKVKGK+V C+ G    LS+ +EV+RAGG  +ILG+    G
Sbjct  180   VPGVHQNETNQCLPGSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANG  239

Query  1138  SEIQVESFLITATNIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLG  959
             +E   ++  + AT +        I +YI +  NP A +   +T+   +P+P MA FTS G
Sbjct  240   NEYSYDAHYLPATAVLYDDAIK-IHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRG  298

Query  958   PSYPEPNILKPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVA  779
             P+  +P ILKPDITAPGLNILAAWSEASSP +   D R VKY I SGTSMSCPHV+A  A
Sbjct  299   PNALDPYILKPDITAPGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAA  358

Query  778   LLKAIHPDWSGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGL  599
             LLKAIHPDWS AAI+SA+MTTA  KN K   I +A G +A PF +G+GH +P+KAADPGL
Sbjct  359   LLKAIHPDWSSAAIRSALMTTAWMKNNKALPITNADGSIATPFSFGSGHFRPTKAADPGL  418

Query  598   VYDSTYMDYLLFVCSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV  419
             VYD++Y DYLL++CS   +  +P ++CP K  S  NLNYPS+AI  L G+++VKRTVTNV
Sbjct  419   VYDASYEDYLLYLCSHGFSFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNV  478

Query  418   GSANTTYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvs----vkvesvkkvgefeFGW  251
             G + + Y    K P G SVK +P+ L F  +G+K+SF ++     +        ++ FGW
Sbjct  479   GGSKSVYFFSAKPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTKQYVFGW  538

Query  250   YKWSDGIHMVKSPIVVSSA  194
             Y+W+DG+H+V+SP+ VS A
Sbjct  539   YRWTDGLHLVRSPMAVSFA  557



>emb|CBI30775.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   517 bits (1331),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 296/599 (49%), Positives = 379/599 (63%), Gaps = 66/599 (11%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SSHCNRK+IGARY++KGYE+  GP+N T D+RS RD  GHGTHTASTV GR+V N SA
Sbjct  177   FNSSHCNRKLIGARYYLKGYESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVSA  236

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFD-DIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             LG +A G A+GGAPL RLAIYK CW +P    +K   C ++D+                 
Sbjct  237   LG-YAPGTASGGAPLARLAIYKVCWPIPGQTKVKGNTCYEEDI-----------------  278

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSIDR  1409
                                            G++G    P +++N APWI TVGASSIDR
Sbjct  279   ------------------------------AGNSGP--APSTLSNPAPWIITVGASSIDR  306

Query  1408  VFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPG--STTIPGFCRQDTLSPEK  1238
              F  P++LGN + + G+SVT  K K++  PLV+A D  +PG         C   +L P+K
Sbjct  307   AFVTPLVLGNGMKLMGQSVTPYKLKKKMYPLVFAADAVVPGVPKNNTAANCNFGSLDPKK  366

Query  1237  VKGKVVFCLTGGLS----QTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             VKGK+V CL GG++    + +EV+RAGG   ILG+    G ++  +  L+ AT + +   
Sbjct  367   VKGKIVLCLRGGMTLRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPATAVSSEDV  426

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
             T  I  YI + K P+AT+IPG+T+  AKP+P MA F S GP+  +PNILKPDIT PGLNI
Sbjct  427   TK-IRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFISRGPNTIDPNILKPDITGPGLNI  485

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWSE SSP     D R VKYNI SGTSMSCPHV+A VALLKAIHP+WS AAI+SA+MT
Sbjct  486   LAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAIRSALMT  545

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA   N  G+ I D+ G    PF YG+GH +P+KAADPGLVYD+TY DYLL++C+    +
Sbjct  546   TAGLVNNIGKPITDSSGNPTNPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLCNIGVKS  605

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             LD S+KCPK + S +NLNYPSL I++LK  + V RT TNVGSA + Y   VK+P G+SV+
Sbjct  606   LDSSFKCPKVSPSSNNLNYPSLQISKLKRKVTVTRTATNVGSARSIYFSSVKSPVGFSVR  665

Query  358   ISPTELKFMEVGEKQs----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             + P+ L F  VG+K+S            S K   E+ FGWY W+DGIH V+SP+ VS A
Sbjct  666   VEPSILYFNHVGQKKSFDITVEARNPKASKKNDTEYAFGWYTWNDGIHNVRSPMAVSLA  724



>gb|KEH36679.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   517 bits (1331),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 282/602 (47%), Positives = 397/602 (66%), Gaps = 24/602 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRKI+GARY+++GYE  +GP+N   D++S+RD  GHGTHT+S V GR + NA+A
Sbjct  186   FDSSKCNRKIVGARYYLQGYENHYGPLNEEEDYKSARDKDGHGTHTSSIVAGRTIKNAAA  245

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQV---PFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             +GGFA+G A+GGAPL RLAIYKACW +   P ++     C + D+L A D A+ DGV V+
Sbjct  246   IGGFASGTASGGAPLARLAIYKACWPIKGKPKNE--GNTCANIDMLKAIDDAIEDGVDVL  303

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASS  1418
             S+S+G      Y   D +A GAL A+++NI VV SAGN+   P+S++N APWI TVGAS+
Sbjct  304   SISIGHYGPLKY-EDDVIAKGALQAVRKNIVVVCSAGNFGPFPHSLSNPAPWIITVGAST  362

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGS--TTIPGFCRQDTLS  1247
             +DR F AP+ L N   ++G S T +  + +  PLV A DVE       T  G+C+ +TL 
Sbjct  363   VDRTFLAPIKLNNGRTIEGRSFTPVHMENSFRPLVLASDVEEYAGILKTNSGYCQDNTLD  422

Query  1246  PEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNP  1085
             P KVKGK+V C+ G    L+++ EV+RAGG  +ILG   +  +++  + + I AT +   
Sbjct  423   PSKVKGKIVLCMRGQGGRLNKSFEVQRAGGVGIILGNNKTHANDVPSDPYFIPATGV-TY  481

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
               T  +++YI ++ NP+A L+PG+T+   KP+P+MA F+S GP+  +PNILKPDITAPG+
Sbjct  482   ENTLKLVQYIHSSPNPMAQLLPGRTVLDTKPAPSMAMFSSRGPNIIDPNILKPDITAPGV  541

Query  904   NILAAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             +ILAAW+    P      D R VK+NIISGTSMSCPHVSA   LLKA+HP WS AAI+SA
Sbjct  542   DILAAWTAKDGPTRMNFRDKRVVKFNIISGTSMSCPHVSAASVLLKAMHPTWSPAAIRSA  601

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             ++T+A T +  G  I D  G  A PF  G+GH  P +A+DPGL+YD++YMDYLL++C+  
Sbjct  602   LITSAKTTDNTGNPITDETGNPATPFAMGSGHFYPKRASDPGLIYDASYMDYLLYLCNLN  661

Query  547   GTT-LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
              T  ++ +Y CP     P +LNYPS+ I +L  +  +KRTVTNVGS+ + Y      P  
Sbjct  662   LTQHINLTYNCPNPLPQPFDLNYPSIQIHKLNYTKTIKRTVTNVGSSKSVYKFIANTPKE  721

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefe-----FGWYKWSDGIHMVKSPIV  206
             +++  +P  LKF  VG+K++F ++V     +   + +     FGWY W+D  H+V+SPI 
Sbjct  722   FNILATPNVLKFKHVGQKRNFVITVTANKDQLPSKCDPENYFFGWYIWTDKYHVVRSPIA  781

Query  205   VS  200
             VS
Sbjct  782   VS  783



>gb|KEH36678.1| subtilisin-like serine protease [Medicago truncatula]
Length=786

 Score =   515 bits (1327),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 282/601 (47%), Positives = 394/601 (66%), Gaps = 23/601 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS+CNRKIIGARY+++GYE  +GP+N   D++S+RD  GHGTHTAS V GR V NASA
Sbjct  188   FGSSNCNRKIIGARYYLQGYEKIYGPLNEEEDYKSARDKDGHGTHTASIVAGRAVQNASA  247

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQV---PFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             LGGFA G A+GGAPL RLAIYKACW +   P +D     C + D+L A D A+ DGV VI
Sbjct  248   LGGFARGTASGGAPLARLAIYKACWPIKGKPKND--GNVCTNIDMLKAIDDAIEDGVDVI  305

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASS  1418
             ++S+G  P    +  D +A GAL A+++NI VV SAGN    P+S++N +PWI TVGAS+
Sbjct  306   NLSIG-FPAPLKYEDDVIAKGALQAVRKNIVVVCSAGNAGPSPHSLSNPSPWIITVGAST  364

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTI-PGFCRQDTLSP  1244
             +DR F AP+ L N   ++G S+T ++   +  PLV A DVE  G  +    +C  +TL P
Sbjct  365   VDRTFLAPIKLSNGTTIEGRSITPLRMGNSFCPLVLASDVEYAGILSANSSYCLDNTLDP  424

Query  1243  EKVKGKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
              KVKGK+V C+ G    + ++LEV+RAGG  +ILG+     +++  + + I  T +    
Sbjct  425   SKVKGKIVLCMRGQGGRVKKSLEVQRAGGVGLILGNNKVYANDVPSDPYFIPTTGV-TYE  483

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
              T  +++YI ++ NP+A L+PG+T+   KP+P+MA F+S GP+  +PNILKPDITAPG++
Sbjct  484   NTLKLVQYIHSSPNPMAQLLPGRTVLDTKPAPSMAIFSSRGPNIIDPNILKPDITAPGVD  543

Query  901   ILAAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             ILAAW+    P     +D R VKYNI SGTSMSCPHVSA   LLKA+HP WS AAI+SA+
Sbjct  544   ILAAWTAKDGPTRMTFQDKRVVKYNIFSGTSMSCPHVSAASVLLKAMHPTWSPAAIRSAL  603

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG  545
             MT+A   +  G  + D  G    PF  G+GH  P +A+DPGL+YD++YMDYLL++C+   
Sbjct  604   MTSARITDNTGNPMTDETGNPTTPFAMGSGHFYPKRASDPGLIYDASYMDYLLYLCNLNL  663

Query  544   TT-LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             T  ++ +Y CP     P +LNYPS+ I +L  +  +KRTVTNVGS+ + Y      P  +
Sbjct  664   TQHINLTYNCPNPLPQPFDLNYPSIQIHKLNYTKTIKRTVTNVGSSKSVYKFIANTPKEF  723

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefe-----FGWYKWSDGIHMVKSPIVV  203
             ++  + + LKF  VG+K++F ++V     +   + +     FGWY W+D  H+V+SPI V
Sbjct  724   NILATSSVLKFKHVGQKRNFVITVTANRDQLPSKCDPDKYYFGWYIWTDNYHVVRSPIAV  783

Query  202   S  200
             S
Sbjct  784   S  784



>ref|XP_006594524.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=785

 Score =   515 bits (1326),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 281/599 (47%), Positives = 380/599 (63%), Gaps = 19/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRKIIGARY++ GY++ FGP+N   D++S+RD  GHG+HTAS V GR V NASA
Sbjct  187   FDSSQCNRKIIGARYYLHGYQSAFGPLNEKEDYKSARDKDGHGSHTASIVAGRVVPNASA  246

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G A GGAPL RLAIYKACW +      +   C + D+L A D A+ DGV V+S+
Sbjct  247   IGGFAKGTALGGAPLARLAIYKACWPIKGKSKHEGNICTNIDMLKAIDDAIGDGVDVLSI  306

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSID  1412
             S+G     +Y  +D +A GALHA+++NI VV SAGN    P +++N APWI TV AS++D
Sbjct  307   SIGFSAPISY-EEDVIARGALHAVRKNIVVVCSAGNSGPLPQTLSNPAPWIITVAASTVD  365

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             R F AP+ L N  +++G S+T +    +  PLV A DVE PG  +   GFC  +TL P K
Sbjct  366   RSFHAPIKLSNGTIIEGRSITPLHMGNSFYPLVLARDVEHPGLPSNNSGFCLDNTLQPNK  425

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
              +GK+V C+ G    L + LEV+RAGG   ILG+    G ++  +   I AT + +   +
Sbjct  426   ARGKIVLCMRGQGERLKKGLEVQRAGGVGFILGNNKLNGKDVPSDPHFIPATGV-SYENS  484

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               +++Y+ +  NP+A ++PG T+   KP+P+MA F+S GP+  +PNILKPDITAPG++IL
Sbjct  485   LKLIQYVHSTPNPMAQILPGTTVLETKPAPSMASFSSRGPNIVDPNILKPDITAPGVDIL  544

Query  895   AAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             AAW+    P      D R VKYNI SGTSMSCPHV+A   LLKAIHP WS AAI+SA+MT
Sbjct  545   AAWTAEDGPTRMTFNDKRVVKYNIFSGTSMSCPHVAAAAVLLKAIHPTWSTAAIRSALMT  604

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-SIGT  542
             TA T +  G  + D  G  A PF  G+GH  P +AADPGLVYD++YM YLL+ C+  +  
Sbjct  605   TAMTTDNTGHPLTDETGNPATPFAMGSGHFNPKRAADPGLVYDASYMGYLLYTCNLGVTQ  664

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               + +Y CPK    P  LNYPS+ I +L  +  +KRTVTNVG   + Y     +P  YS+
Sbjct  665   NFNITYNCPKSFLEPFELNYPSIQIHRLYYTKTIKRTVTNVGRGRSVYKFSAVSPKEYSI  724

Query  361   KISPTELKFMEVGEK-----QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               +P  LKF  VG+K            ++ +     ++ FGWY W+   H+V+SP+ VS
Sbjct  725   TATPNILKFNHVGQKINFAITVTANWSQIPTKHGPDKYYFGWYAWTHQHHIVRSPVAVS  783



>ref|XP_003541678.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=789

 Score =   515 bits (1326),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 281/599 (47%), Positives = 380/599 (63%), Gaps = 19/599 (3%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRKIIGARY++ GY++ FGP+N   D++S+RD  GHG+HTAS V GR V NASA
Sbjct  191   FDSSQCNRKIIGARYYLHGYQSAFGPLNEKEDYKSARDKDGHGSHTASIVAGRVVPNASA  250

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVP-FDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
             +GGFA G A GGAPL RLAIYKACW +      +   C + D+L A D A+ DGV V+S+
Sbjct  251   IGGFAKGTALGGAPLARLAIYKACWPIKGKSKHEGNICTNIDMLKAIDDAIGDGVDVLSI  310

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSID  1412
             S+G     +Y  +D +A GALHA+++NI VV SAGN    P +++N APWI TV AS++D
Sbjct  311   SIGFSAPISY-EEDVIARGALHAVRKNIVVVCSAGNSGPLPQTLSNPAPWIITVAASTVD  369

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             R F AP+ L N  +++G S+T +    +  PLV A DVE PG  +   GFC  +TL P K
Sbjct  370   RSFHAPIKLSNGTIIEGRSITPLHMGNSFYPLVLARDVEHPGLPSNNSGFCLDNTLQPNK  429

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
              +GK+V C+ G    L + LEV+RAGG   ILG+    G ++  +   I AT + +   +
Sbjct  430   ARGKIVLCMRGQGERLKKGLEVQRAGGVGFILGNNKLNGKDVPSDPHFIPATGV-SYENS  488

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               +++Y+ +  NP+A ++PG T+   KP+P+MA F+S GP+  +PNILKPDITAPG++IL
Sbjct  489   LKLIQYVHSTPNPMAQILPGTTVLETKPAPSMASFSSRGPNIVDPNILKPDITAPGVDIL  548

Query  895   AAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             AAW+    P      D R VKYNI SGTSMSCPHV+A   LLKAIHP WS AAI+SA+MT
Sbjct  549   AAWTAEDGPTRMTFNDKRVVKYNIFSGTSMSCPHVAAAAVLLKAIHPTWSTAAIRSALMT  608

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-SIGT  542
             TA T +  G  + D  G  A PF  G+GH  P +AADPGLVYD++YM YLL+ C+  +  
Sbjct  609   TAMTTDNTGHPLTDETGNPATPFAMGSGHFNPKRAADPGLVYDASYMGYLLYTCNLGVTQ  668

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               + +Y CPK    P  LNYPS+ I +L  +  +KRTVTNVG   + Y     +P  YS+
Sbjct  669   NFNITYNCPKSFLEPFELNYPSIQIHRLYYTKTIKRTVTNVGRGRSVYKFSAVSPKEYSI  728

Query  361   KISPTELKFMEVGEK-----QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               +P  LKF  VG+K            ++ +     ++ FGWY W+   H+V+SP+ VS
Sbjct  729   TATPNILKFNHVGQKINFAITVTANWSQIPTKHGPDKYYFGWYAWTHQHHIVRSPVAVS  787



>ref|XP_007147961.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
 gb|ESW19955.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
Length=787

 Score =   505 bits (1300),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 279/600 (47%), Positives = 379/600 (63%), Gaps = 21/600 (4%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F SS CNRKI+GARY+++GYE+ +GP++   D++S+RD  GHGTHTAS V GR VA+ASA
Sbjct  189   FGSSQCNRKIVGARYYLRGYESQYGPLDEKEDYKSARDKDGHGTHTASIVAGRAVAHASA  248

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDI-KATFCQDDDVLAAFDHAVADGVQVISV  1589
             LGG+A G A GGAPL RLAIYKACW +      +   C + D+L A D A+ DGV V+S+
Sbjct  249   LGGYAKGTAIGGAPLARLAIYKACWSIKGQSKDEGNVCTNIDMLKAIDDAIGDGVDVLSI  308

Query  1588  SLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSID  1412
             S+G     +Y  +D +A GALHA+++NI VV SAGN    P +++N APWI TVGAS++D
Sbjct  309   SIGFSSPLSY-EEDAIARGALHAVRKNIVVVCSAGNSGPTPQTLSNPAPWIITVGASTVD  367

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKK-QETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             R F APV L    +++G S+T +    +  PLV A DVE PG      GFC  +TL P K
Sbjct  368   RSFLAPVKLSTGTVIEGRSITPLHMGNKFYPLVLAHDVEHPGLPRNNSGFCLDNTLEPNK  427

Query  1237  VKGKVVFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
              +GK+V CL G    L + LE++RAGG  ++LG+    G+++  +   I AT +   +  
Sbjct  428   TRGKIVLCLRGQGGRLKKGLEIQRAGGVGLVLGNNQLNGNDVPSDPHFIPATGVSYHNAL  487

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               ++ YI +  NP+   +PGKT+   +P+P MA F+S GP+  + NILKPDITAPG++IL
Sbjct  488   -KLIHYIHSTPNPMVRFLPGKTVLKTRPAPFMASFSSRGPNIIDHNILKPDITAPGVDIL  546

Query  895   AAWSEASSPLEQP-EDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             AAW+    P      D R VKYNI+SGTSMSCPHV+A   LLKAIHP WS  AI+SA+MT
Sbjct  547   AAWTAEDGPTRMTYNDKRVVKYNILSGTSMSCPHVAAAAVLLKAIHPTWSSVAIRSALMT  606

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             TA T +  G  + D  G +A PF  G+GH  P +AADPGLVYD++Y DY L+ C   G T
Sbjct  607   TAITTDNTGHPMVDESGNLATPFAMGSGHFNPKRAADPGLVYDASYNDYFLYTC-RFGET  665

Query  538   --LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               L+ +Y CPK       LNYPS+ I QL  +  +KRTVTNVG   + Y     +P  +S
Sbjct  666   KKLNITYNCPKSLPESFELNYPSIQIHQLNYTRTIKRTVTNVGRRRSVYKFSAFSPKEFS  725

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF-----GWYKWSDGIHMVKSPIVVS  200
             +  +P  LKF +VG+K+ F ++V     + +          GWY W+    +V+SP+ VS
Sbjct  726   ITATPDILKFKDVGQKRKFIITVTANRGQILTNHGQDDYYFGWYAWTHEHTVVRSPVAVS  785



>ref|XP_010494681.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=812

 Score =   502 bits (1292),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 294/612 (48%), Positives = 384/612 (63%), Gaps = 32/612 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH--TFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNRKIIGARY+ +GYE  +GP N     DF S RD  GHG+HTAST  GR+V   
Sbjct  201   FNSSHCNRKIIGARYYARGYERYYGPFNAEANNDFLSPRDADGHGSHTASTAVGRRVKGV  260

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             SALGG A G A+GGA L RLA+YKACW +P  +   T  C D+D+LAAFD A+ADGV VI
Sbjct  261   SALGGIAMGTASGGASLARLAVYKACWAIPNAEKYVTNTCFDEDMLAAFDDAIADGVNVI  320

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREP-YSVTNVAPWIFTVGASS  1418
             S+S+G +    Y  +DG+A+GALHA+KR+I V  SAGN      +++N APWI TVGASS
Sbjct  321   SISIGAVEPQTYL-EDGIAIGALHAVKRDIVVAASAGNDGPAGETLSNPAPWIITVGASS  379

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPE  1241
             +DR F   + LG+    + +S+T +K     PLVYA DV +P GS      C  ++LSP+
Sbjct  380   LDRFFVGGLELGDGYKFESDSLTTLKMDNFAPLVYAPDVVVPWGSRNEASLCLPNSLSPD  439

Query  1240  KVKGKVVFCLTG-----GLSQTLEVERAGGAAVILGSI--GSEIQVESFLITATNIFNPS  1082
              VKGKVV CL G      + + LEV+RAGG  +IL +        V S  +    +F+ S
Sbjct  440   LVKGKVVLCLRGFGSGSTIGKGLEVKRAGGVGMILANSRDNDAFDVVSHFVPTALVFS-S  498

Query  1081  GTDAILKYILTNKNPVATLIPGKTI----------FGAKPSPAMAPFTSLGPSYPEPNIL  932
               D IL YI  +  PVA + P +TI          +  KP+P M  F+S GP++ + NIL
Sbjct  499   TVDRILDYIYNDYEPVAFIKPAETILYRNQPKDSFYPYKPAPFMTSFSSRGPNWVDANIL  558

Query  931   KPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDW  752
             KPDI APGLNILAAWS A S  +   D R   Y++ SGTSM+CPHV+  +ALLK++HP W
Sbjct  559   KPDIIAPGLNILAAWSGADSASKDSIDQRVSDYSLDSGTSMACPHVAGAIALLKSMHPTW  618

Query  751   SGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDY  572
             S AAI+SA+MTTA+  N   E I+D  G  A PF  G+GH +P+KAA PGLVYD++Y  Y
Sbjct  619   SSAAIRSALMTTASMTNQDNEPIQDYDGSPANPFALGSGHFRPTKAASPGLVYDASYGSY  678

Query  571   LLFVCSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVG-SANTT--  401
             LL+ CS   T +DP++KCP +     NLNYPS++I  L G++ V RTVT VG SAN+T  
Sbjct  679   LLYCCSVGLTNIDPTFKCPSEIPPGYNLNYPSISIPYLIGTVTVTRTVTCVGRSANSTSV  738

Query  400   YSVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkv-----esvkkvgefeFGWYKWSD  236
             Y  + + P G +VK  P  L F  +G+K+ F +             +   + FGW+ WSD
Sbjct  739   YVFKAQPPFGVNVKAEPNVLVFDRIGQKKQFNIIFTTNPYEFTGEARRDRYRFGWFSWSD  798

Query  235   GIHMVKSPIVVS  200
             G H+V+SPI VS
Sbjct  799   GHHVVRSPIAVS  810



>ref|XP_002971605.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
 gb|EFJ27354.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
Length=800

 Score =   499 bits (1285),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 283/608 (47%), Positives = 390/608 (64%), Gaps = 32/608 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVN--HTFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F +S CN+K+IGAR+++KGYE  +G +N   T DFRS+RD  GHGTHTAST GG  V  A
Sbjct  198   FNASSCNKKLIGARFYLKGYENFYGKLNLTATEDFRSARDKDGHGTHTASTAGGSFVPGA  257

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             +  G FANG A GGAPL R+A+YK CW +P   +     C D+D+LAA D  + DGV + 
Sbjct  258   NVFG-FANGTAKGGAPLARIAMYKVCWPIPSGSLSGQDSCFDEDMLAALDQGIKDGVDIF  316

Query  1594  SVSLGL-LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVT--NVAPWIFTVGA  1424
             S+S+G   PQ  Y  +D +A+GA HA+KRNI V  SAGN   P S T  NV+PWI TV A
Sbjct  317   SISIGSGNPQPAYL-EDSIAIGAFHAIKRNILVSCSAGN-SGPTSATVANVSPWILTVAA  374

Query  1423  SSIDRVFSAPVLLGNNLLVKGESV-----TEIKKQETLPLVYAGDVEIPGSTTIPGFCRQ  1259
             SS+DR F + V+LG+   ++G+S+     +E    E +    AG+  +P +      C  
Sbjct  375   SSLDRDFPSNVVLGDGTTLQGKSIAPKSLSESNWYELIDGGRAGNSSVPVANA--SQCLP  432

Query  1258  DTLSPEKVKGKVVFCLTG---GLSQTLEVERAGGAAVILG---SIGSEIQVESFLITATN  1097
             DTL   KV GKVV CL G    + ++ E  RAG A  ILG   +  +E+ V+++++  T 
Sbjct  433   DTLDASKVAGKVVICLRGLGTRVGKSQEAIRAGAAGFILGNSAAQANEVSVDAYMLPGTA  492

Query  1096  IFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDIT  917
             I N    +A+L YI +   P+  ++P +T+   KP+P+MA F+S GP+   P+ILKPDI+
Sbjct  493   I-NADNANAVLTYINSTNFPLVKIVPARTVLDFKPAPSMAAFSSQGPNSLNPDILKPDIS  551

Query  916   APGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAI  737
             APGLNILAAW+EA+SP + P D+R VKYNIISGTSMSCPHV+   ALL+AI+P WS AAI
Sbjct  552   APGLNILAAWTEANSPTKLPIDNRIVKYNIISGTSMSCPHVAGTAALLRAIYPSWSPAAI  611

Query  736   KSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC  557
             KSA+MTTA+  N   + I +  G  A PF++G G + P  AADPGLVYD++  DYLLF+C
Sbjct  612   KSALMTTASIVNNLQQPILNGSGATANPFNFGGGEMNPEAAADPGLVYDTSPRDYLLFLC  671

Query  556   ------SSIGTTLD-PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANT-T  401
                   S+I    D  ++ CP   SS +++NYPS+A+A L  +  ++RTVTNVGS +T  
Sbjct  672   SVGYNSSTIQNVTDTANFTCPNTLSSIADMNYPSVAVANLTAAKTIQRTVTNVGSQDTAV  731

Query  400   YSVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMV  221
             Y    +AP G  + I+P +L F  +GEK+  F      + +  G++ FG Y+WSDG+H+V
Sbjct  732   YIASFQAPDGIDIVITPNKLTFQSLGEKK-SFNITLTPTKRSKGDYVFGTYQWSDGMHVV  790

Query  220   KSPIVVSS  197
             +SPI V +
Sbjct  791   RSPIAVRT  798



>ref|XP_002965730.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
 gb|EFJ33150.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
Length=863

 Score =   498 bits (1282),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 282/609 (46%), Positives = 391/609 (64%), Gaps = 34/609 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVN--HTFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F +S CN+K+IGAR+++KGYE  +G +N   T +FRS+RD  GHGTHTAST GG  V  A
Sbjct  261   FNASSCNKKLIGARFYLKGYEKFYGKLNLTATEEFRSARDKDGHGTHTASTAGGSFVPGA  320

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             +  G FANG A GGAPL R+A+YK CW +P   +     C D+D+LAA D  + DGV V 
Sbjct  321   NVFG-FANGTAKGGAPLARIAMYKVCWPIPSGSLSGQDSCFDEDMLAALDQGIKDGVDVF  379

Query  1594  SVSLGL-LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVT--NVAPWIFTVGA  1424
             S+S+G   PQ  Y  +D +A+GA HA+KRNI V  SAGN   P S T  NV+PWI TV A
Sbjct  380   SISIGSGNPQPAYL-EDSIAIGAFHAIKRNILVSCSAGN-SGPTSATVANVSPWILTVAA  437

Query  1423  SSIDRVFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIP----GFCR  1262
             SS+DR F + V+LG+   ++G+S+    + +     L+  G     G++++P      C 
Sbjct  438   SSLDRDFPSNVVLGDGTTLQGKSIAPKSLSESNWYELIDGGRA---GNSSVPVVNASQCL  494

Query  1261  QDTLSPEKVKGKVVFCLTG---GLSQTLEVERAGGAAVILG---SIGSEIQVESFLITAT  1100
              DTL   KV G+VV CL G    + ++ E  RAG A  ILG   +  +E+ V+++++  T
Sbjct  495   PDTLDASKVAGRVVICLRGLGTRVGKSQEAIRAGAAGFILGNSAAQANEVSVDAYMLPGT  554

Query  1099  NIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDI  920
              I N    +A+L YI +   P+  ++P +T+   KP+P+MA F+S GP+   P+ILKPDI
Sbjct  555   AI-NADNANAVLTYINSTNFPLVKIVPARTVLDFKPAPSMAAFSSQGPNSLNPDILKPDI  613

Query  919   TAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAA  740
             +APGLNILAAW+EA+SP + P D+R VKYNIISGTSMSCPHV+   ALL+AI+P WS AA
Sbjct  614   SAPGLNILAAWTEANSPTKLPIDNRIVKYNIISGTSMSCPHVAGTAALLRAIYPSWSPAA  673

Query  739   IKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFV  560
             IKSA+MTTA+  N   + I +  G  A PF++G G + P  AADPGLVYD++  DYLLF+
Sbjct  674   IKSALMTTASIVNNLQQPILNGSGATANPFNFGGGEMNPEAAADPGLVYDTSPRDYLLFL  733

Query  559   C------SSIGTTLD-PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANT-  404
             C      S+I    D  ++ CP   SS S++NYPS+A+A L  +  ++RTVTNVGS +T 
Sbjct  734   CSVGYNSSTIQNVTDTANFTCPNTLSSISDMNYPSVAVANLTAAKTIQRTVTNVGSQDTA  793

Query  403   TYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHM  224
              Y    +AP G  + I+P +L F  +GEK+  F      + +  G++ FG Y+WSDG+H+
Sbjct  794   VYIASFQAPDGIDIVITPNKLTFQSLGEKK-SFNITLTPTKRSKGDYVFGTYQWSDGMHV  852

Query  223   VKSPIVVSS  197
             V+SPI V +
Sbjct  853   VRSPIAVRT  861



>ref|XP_002863464.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39723.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=797

 Score =   481 bits (1237),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 278/608 (46%), Positives = 365/608 (60%), Gaps = 34/608 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH--TFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNR      Y+ +GYE  +GP N     DF S RD  GHG+HTAST  GR+V   
Sbjct  196   FNSSHCNR------YYARGYERYYGPFNAEANKDFLSPRDADGHGSHTASTGVGRRVNGV  249

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             SALGG A G A+GGA L RLA+YKACW +P  +  AT  C D+D+LAAFD A+ADGV VI
Sbjct  250   SALGGIAMGTASGGASLARLAVYKACWAIPNTEKYATNTCFDEDMLAAFDDAIADGVNVI  309

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREP-YSVTNVAPWIFTVGASS  1418
             S+S+G +    Y  +DG+A+GALHA+KR+I V  SAGN      +++N APWI TVGASS
Sbjct  310   SISIGAVEPHTYM-EDGIAIGALHAVKRDIVVAASAGNDGPAGQTLSNPAPWIITVGASS  368

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPE  1241
             +DR F   + LG+  + + +S+T +K     PLVYA DV +PG S      C  ++LSP+
Sbjct  369   LDRFFVGRLELGDGYIFESDSLTTLKMDNFAPLVYAPDVVVPGVSRNDALLCLPNSLSPD  428

Query  1240  KVKGKVVFCLTG-----GLSQTLEVERAGGAAVILGSI--GSEIQVESFLITATNIFNPS  1082
              V+GKVV CL G      + + +EV+RAGG  +IL +        VES  +    +F+ S
Sbjct  429   LVRGKVVLCLRGYGSGSTIGKGIEVKRAGGVGMILANARDNDAFDVESHFVPTVLVFS-S  487

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILK------PDI  920
               D IL YI     PVA + P +T+                P     NILK      PDI
Sbjct  488   TVDRILDYIYNTYEPVAFIKPAETVLYRNQPEDSVYLYKPAPFMTNANILKVNSFVLPDI  547

Query  919   TAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAA  740
              APGLNILAAWS A S  +   D R + YN+ SGTSMSCPHV+  +ALLK++HP WS AA
Sbjct  548   IAPGLNILAAWSGADSASKDSRDRRVLGYNLDSGTSMSCPHVAGAIALLKSMHPSWSSAA  607

Query  739   IKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFV  560
             I+SA+MTTA+  N   E I+D  G  A PF  G+GH  P+KAA PGLVYD++Y  YLL+ 
Sbjct  608   IRSALMTTASMTNEDNEPIQDYDGSPANPFALGSGHFSPTKAASPGLVYDASYQSYLLYC  667

Query  559   CSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV---GSANTTYSVE  389
             CS   T LDP++KCP +     NLNYPS++I  L G++ V RTVT V   G++ + Y   
Sbjct  668   CSVGLTNLDPTFKCPSRIPPGYNLNYPSISIPYLTGTVAVTRTVTCVGRPGNSTSVYVFN  727

Query  388   VKAPTGYSVKISPTELKFMEVGEKQsffvsvkve-----svkkvgefeFGWYKWSDGIHM  224
              + P G  VK  P  L F  +G+K+ F +    +        +   + FGW+ W+DG+H+
Sbjct  728   AQPPYGVIVKAEPNVLVFDRIGQKKRFNIIFTTQGYGFTGEARRDRYRFGWFSWTDGLHV  787

Query  223   VKSPIVVS  200
             V+SPI VS
Sbjct  788   VRSPISVS  795



>ref|XP_010256205.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3, 
partial [Nelumbo nucifera]
Length=803

 Score =   479 bits (1233),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 277/594 (47%), Positives = 381/594 (64%), Gaps = 28/594 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY +  GP++ ++D  ++RD  GHG+HT ST GG  V  AS  G + 
Sbjct  219   CNRKLIGARYFNKGYSSYVGPLDSSYD--TARDNEGHGSHTLSTAGGNFVPGASIFG-YG  275

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G+A GG+P  R+A YK CW  P  D  +  C D D++AAFD A+ DGV V+S+SLG  P
Sbjct  276   QGIAKGGSPRARVAAYKVCWP-PVGD--SGECFDADIMAAFDAAIHDGVDVLSISLGGSP  332

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
               +Y+ +DG+++GA HA+K+ I VV SAGN      SV+NV+PW+ TVGAS+IDR F++ 
Sbjct  333   --DYYFEDGLSIGAFHAVKKGIVVVCSAGNSGPTDGSVSNVSPWMITVGASTIDREFASY  390

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGKV  1223
             V+LGN L  KGES++   +  +E  PL+ AGD +   ++T     C+   L PEKV+GK+
Sbjct  391   VVLGNKLYFKGESLSTNGLPVKEFYPLISAGDAKAANASTNDALLCKAGALDPEKVRGKI  450

Query  1222  VFCLTGGLSQTLEVE---RAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G  ++  + E   RAG   +IL    +  +EI  ++ ++ A++I    G  A+  
Sbjct  451   LTCLRGETARVDKGEQAARAGAVGMILANDVTTANEIIADAHVLPASHITYTDGL-AVFA  509

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI + K+PVA L  G T+ G KP+P MA F+S GP+   P ILKPDITAPG+NI+AA++E
Sbjct  510   YINSTKSPVAYLTHGTTLLGVKPAPFMASFSSKGPNLVTPEILKPDITAPGVNIIAAFTE  569

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A     +  D R V +NI+SGTSMSCPHVS V  LLK +HPDWS AA+KSAIMTTA  ++
Sbjct  570   AQGAASE-NDKRIVPFNIMSGTSMSCPHVSGVAGLLKTLHPDWSPAAVKSAIMTTAGARD  628

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
               GE I ++    A PF YGAGH+QP++A DPGLVYD T  DYL F+C      + I T 
Sbjct  629   NIGEQILNSSHVEATPFSYGAGHVQPNRAMDPGLVYDLTVKDYLDFLCALGYNQTQIETF  688

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D  Y CPK A+   + NYPS+ +  L GS  V RT+ NVG+   TY+  V AP G SV 
Sbjct  689   SDKPYTCPKSATL-MDFNYPSITVPNLSGSATVTRTLKNVGTPG-TYTASVDAPNGISVS  746

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             + P  LKF ++GE+++F +++K        ++ FG   WSDG+H V+SPIVV +
Sbjct  747   VEPASLKFEKMGEEKTFRLTLKTNKADAAMDYVFGQLIWSDGLHYVRSPIVVKA  800



>ref|XP_002972619.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
 gb|EFJ26705.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
Length=747

 Score =   475 bits (1223),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 292/615 (47%), Positives = 386/615 (63%), Gaps = 36/615 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F  S CN+K+IGAR+++K YE + GP+N T   DFRS RD  GHGTHT+ST  GR V  A
Sbjct  144   FNPSDCNKKLIGARFYIKAYELSKGPLNTTATGDFRSPRDKDGHGTHTSSTASGRFVEGA  203

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             + LG FANG A GGAP  RLA+YK CW           C + D+LAA D A+ADGV +++
Sbjct  204   NILG-FANGTAKGGAPKARLAVYKVCWP--------GGCWEADILAAMDDAIADGVDILT  254

Query  1591  VSLG-LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASS  1418
             +S+G  +P  ++F QDG+ALGA HA+++ I VV SAGN      SV N+ PWI TV ASS
Sbjct  255   LSIGGKVPLPDFF-QDGIALGAFHAIQKGITVVCSAGNDGPKVGSVVNLPPWILTVAASS  313

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPGFCRQDTLSPE  1241
             IDR FSA V+LGNN    G S++E K ++ L P+V + DV    S+     C   +L P+
Sbjct  314   IDRSFSASVILGNNKTYLGSSLSEFKLEDRLYPIVASSDVGYR-SSIGSLLCTVGSLDPK  372

Query  1240  KVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             K +GK+V CL G    LS+   V++AGGA ++L +    G E+  +  ++ ATN+   SG
Sbjct  373   KTEGKIVVCLRGVTTRLSKGTAVKQAGGAGLVLANSDADGGELIADPHVLPATNVDAQSG  432

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + I  Y+   K+ V  + P KT+ G +PSP MA F+S GP+   P+ILKPDIT PG+NI
Sbjct  433   KE-IYAYLKNTKSSVGYITPAKTLLGVEPSPKMASFSSQGPNTLTPDILKPDITGPGMNI  491

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAA++ A++P     D R V++N+ SGTSMSCPH++ +VALLKA+HPDWS AAIKSAIMT
Sbjct  492   LAAFTRATAP---AGDGRLVEFNVESGTSMSCPHLAGIVALLKALHPDWSPAAIKSAIMT  548

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC----SS  551
             TA T +  G  I D   +VAGPF+YGAGH+  + AADPGLVYD+   DY+ F+C    SS
Sbjct  549   TAITYDNTGNKILDGSNKVAGPFNYGAGHVNVNAAADPGLVYDAAIEDYIFFLCGLGYSS  608

Query  550   IGTTLDPSYK--CPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV-GSANTTYSVEVKA  380
             +       Y+  CP    S S+ NYPS+ ++ LKGS  V RTVTNV G     Y V +  
Sbjct  609   VAMETLTGYEVHCPDAKLSLSDFNYPSVTLSNLKGSTTVTRTVTNVGGDGQAEYKVAINP  668

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
             P G SV I+P+ LKF   GEK+  F           G + FG + WSDG H V+SPIVV 
Sbjct  669   PPGVSVSITPSILKFSSTGEKK-SFTLTFTAERSSKGAYVFGDFSWSDGKHQVRSPIVVK  727

Query  199   SA*LSTFGFQLRRFP  155
             +   +T G Q  + P
Sbjct  728   AT--ATSGIQDVQLP  740



>ref|XP_002964212.1| hypothetical protein SELMODRAFT_81842, partial [Selaginella moellendorffii]
 gb|EFJ34545.1| hypothetical protein SELMODRAFT_81842, partial [Selaginella moellendorffii]
Length=723

 Score =   473 bits (1218),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 273/606 (45%), Positives = 375/606 (62%), Gaps = 33/606 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGP--VNHTFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F +SHCNRK+IGARY++KG+E   GP  VN T DF+S RD  GHGTHT+S  GGR V  A
Sbjct  120   FNTSHCNRKLIGARYYIKGFELENGPLNVNSTGDFKSPRDKKGHGTHTSSIAGGRFVPQA  179

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S LG   NG A GGAPL RLA+YK CWQ    +   T C D D+LAA D A+ DGV +++
Sbjct  180   SFLG-LGNGTAKGGAPLARLAVYKVCWQ---KEATGTLCYDADILAAMDDAIQDGVDILT  235

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSI  1415
             +SLG     +   QD +++GA HA+++ I VV SAGN    + SV NVAPW+ TV ASS 
Sbjct  236   LSLGGSQPLSQLFQDAISIGAYHAVQKGIPVVCSAGNGGPAFGSVVNVAPWVLTVAASST  295

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQE---TLPLVYAGDVEIPGSTTIPGFCRQDTLSP  1244
             DR F + V+LG+N   +G S++E K ++     PL+      +P  T++   C   +L P
Sbjct  296   DRDFCSTVVLGDNSTFRGSSMSEFKLEDGAHQYPLISG--ACLPLVTSL--LCNAGSLDP  351

Query  1243  EKVKGKVVFCLTGGLSQTLE---VERAGGAAVILG---SIGSEIQVESFLITATNIFNPS  1082
             EK KGK+V CL G  SQ  +   V+ AGG  +IL    S GS+ Q    ++ ATN+ N  
Sbjct  352   EKAKGKIVVCLRGSGSQLFKGQVVQLAGGVGMILANSPSDGSQTQATFHVLPATNV-NSE  410

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
                AI  Y+  + +P ATL    T+ G KP+P MAPF+S GP+   P+ILKPD+TAPG+N
Sbjct  411   AAAAIFAYLNASSSPTATLTASTTVTGIKPAPTMAPFSSRGPNMLIPDILKPDVTAPGVN  470

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILA++SEA+SP+      R++K+ + SGTSM+CPHVS V ++LKA++P+WS AAI SAI+
Sbjct  471   ILASFSEAASPITN-NSTRALKFFVASGTSMACPHVSGVASMLKALYPEWSPAAIMSAIV  529

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TTA +++ + + I     +VAG F++G+GH+ P+ AADPGLVYD+   DYLL +CS    
Sbjct  530   TTARSRDNREQLILADDSQVAGAFNFGSGHVDPNAAADPGLVYDAAPQDYLLLLCSLKFN  589

Query  541   TL-------DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYSVE  389
             T          ++ CP      SN NYPS+ IA+L  + +V   RT+T+V + ++TY   
Sbjct  590   TSTVRKISGQDNFSCPVHQEPVSNFNYPSIGIARLNANSLVSVTRTLTSVANCSSTYEAF  649

Query  388   VKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGW--YKWSDGIHMVKS  215
             V+ P G SV + P+ L F   G+KQ F VS K+            W    WSDG H V+S
Sbjct  650   VRPPPGVSVSVWPSRLTFSGSGQKQQFAVSFKLTQPSPALPGGRAWGYMVWSDGKHQVRS  709

Query  214   PIVVSS  197
              I ++S
Sbjct  710   SIAIAS  715



>ref|XP_002988851.1| hypothetical protein SELMODRAFT_128873 [Selaginella moellendorffii]
 gb|EFJ10113.1| hypothetical protein SELMODRAFT_128873 [Selaginella moellendorffii]
Length=745

 Score =   473 bits (1216),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 274/609 (45%), Positives = 374/609 (61%), Gaps = 34/609 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGP--VNHTFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F +SHCNRK+IGARY++KG+E   GP  VN T DF+S RD  GHGTHT+S  GGR V  A
Sbjct  137   FNTSHCNRKLIGARYYIKGFELENGPLNVNSTGDFKSPRDKKGHGTHTSSIAGGRFVPQA  196

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S LG   NG A GGAPL RLA+YK CWQ    +   T C D D+LAA D A+ DGV +++
Sbjct  197   SFLG-LGNGTAKGGAPLARLAVYKVCWQ---KEATGTLCYDADILAAMDDAIQDGVDILT  252

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSI  1415
              SLG     +   +D +++GA HA+++ IAVV SAGN    + SV NVAPW+ TV ASS 
Sbjct  253   FSLGGSQPLSQLFEDAISIGAYHAVQKGIAVVCSAGNGGPAFGSVVNVAPWVLTVAASST  312

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQE---TLPLVYAGDVEIPGSTTIPG---FCRQDT  1253
             DR F + V+LG+N   +G S+++ K  +     PL+  G   IP S++       C   +
Sbjct  313   DRDFCSTVVLGDNSTFRGSSMSDFKLDDGAHQYPLISGG--AIPASSSNASDSLLCNAGS  370

Query  1252  LSPEKVKGKVVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIF  1091
             L PEK KGK+V CL G    LS+   V+ AGG  +IL    S GS+ Q    ++ ATN+ 
Sbjct  371   LDPEKAKGKIVVCLRGSGSQLSKGQVVQLAGGVGMILANSPSDGSQTQAAFHVLPATNV-  429

Query  1090  NPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAP  911
             N     AI  Y+  + +P ATL    T+ G KP+P MAPF+S GP+   P+ILKPD+TAP
Sbjct  430   NSEAAAAIFAYLNASSSPTATLTASTTVTGIKPAPTMAPFSSRGPNMLIPDILKPDVTAP  489

Query  910   GLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKS  731
             G+NILA++SEA+SP+      R++K+ + SGTSM+CPHVS V ++LKA++P+WS AAI S
Sbjct  490   GVNILASFSEAASPITN-NSTRALKFVVASGTSMACPHVSGVASMLKALYPEWSPAAIMS  548

Query  730   AIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS  551
             AI+TTA +++ + + I     +VAG F++G+GH+ P+ AADPGLVYD+   DYLL +CS 
Sbjct  549   AIVTTARSRDNREQLILADDSQVAGAFNFGSGHVDPNAAADPGLVYDAAPQDYLLLLCSL  608

Query  550   IGTTL-------DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTY  398
                T          ++ CP      SN NYPS+ IA+L  + +V   RT+T+V + ++TY
Sbjct  609   KFNTSTVRKISGQDNFSCPAHQEPVSNFNYPSIGIARLNANSLVSVTRTLTSVANCSSTY  668

Query  397   SVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGW--YKWSDGIHM  224
                V+ P G SV + P+ L F   G+KQ F VS K+            W    WSDG H 
Sbjct  669   EAFVRPPPGVSVSVWPSRLTFSGSGQKQQFAVSFKITQPSPALPGGRAWGYMVWSDGKHQ  728

Query  223   VKSPIVVSS  197
             V+S I + S
Sbjct  729   VRSSIAIVS  737



>ref|XP_002972076.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
 gb|EFJ26993.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
Length=742

 Score =   471 bits (1213),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 290/615 (47%), Positives = 384/615 (62%), Gaps = 36/615 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTF--DFRSSRDISGHGTHTASTVGGRKVANA  1772
             F  S CN+K+IGAR+++K YE + GP+N T   DFRS RD  GHGTHT+ST  GR V  A
Sbjct  140   FNPSDCNKKLIGARFYIKAYELSKGPLNTTATGDFRSPRDKDGHGTHTSSTASGRFVEGA  199

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             + LG FANG A GGA   RLA+YK CW           C + D+LAA D A+ADGV +++
Sbjct  200   NILG-FANGTAKGGASKARLAVYKVCWP--------GGCWEADILAAMDDAIADGVDILT  250

Query  1591  VSLG-LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASS  1418
             +S+G  +P  ++F QDG+ALGA HA+++ I VV SAGN      SV N+ PWI TV ASS
Sbjct  251   LSIGGKVPLPDFF-QDGIALGAFHAIQKGITVVCSAGNDGPKVGSVVNLPPWILTVAASS  309

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPGFCRQDTLSPE  1241
             IDR FSA V+LGNN    G S++E K ++ L P+V + DV    S+     C   +L P+
Sbjct  310   IDRSFSASVILGNNKTYLGSSLSEFKLEDRLYPIVASSDVGYR-SSIGSLLCTVGSLDPK  368

Query  1240  KVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             K +GK+V CL G    LS+   V++AGGA ++L +    G E+  +  ++ ATN+   SG
Sbjct  369   KTEGKIVVCLRGVTTRLSKGTAVKQAGGAGLVLANSDADGGELIADPHVLPATNVDAQSG  428

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + I  Y+   K+ V  + P KT+ G +PSP MA F+S GP+   P+ILKPDIT PG+NI
Sbjct  429   KE-IYAYLKNTKSSVGYITPAKTLLGVEPSPKMASFSSQGPNTLTPDILKPDITGPGMNI  487

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAA++ A++P     D R V++N+ SGTSMSCPH++ +VALLKA+HPDWS AAIKSAIMT
Sbjct  488   LAAFTRATAP---AGDGRLVEFNVESGTSMSCPHLAGIVALLKALHPDWSPAAIKSAIMT  544

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC----SS  551
             TA T +  G  I D   +VAGPF+YGAGH+  + AADPGLVYD+   DY+ F+C    SS
Sbjct  545   TAITYDNTGNKILDGSNKVAGPFNYGAGHVNVNAAADPGLVYDAAIEDYIFFLCGLGYSS  604

Query  550   IGTTLDPSYK--CPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNV-GSANTTYSVEVKA  380
             +       Y+  CP    S S+ NYPS+ ++ LKGS  V RTVTNV G     Y V +  
Sbjct  605   VAMETLTGYEVHCPDAKLSLSDFNYPSVTLSNLKGSTTVTRTVTNVGGDGQAEYKVAINP  664

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
             P G SV I+P+ LKF   GEK+  F           G + FG + WSDG H V+SPI V 
Sbjct  665   PPGVSVSITPSILKFSSTGEKK-SFTLTFTAERSSKGAYVFGDFSWSDGKHQVRSPIAVK  723

Query  199   SA*LSTFGFQLRRFP  155
             +   +T G Q  + P
Sbjct  724   AT--ATSGIQDVQLP  736



>ref|XP_006279865.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
 gb|EOA12763.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
Length=796

 Score =   471 bits (1212),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 276/613 (45%), Positives = 375/613 (61%), Gaps = 39/613 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH--TFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNR      Y+ +GYE  +G  N     DF S RD  GHG+HTAST  GR+V   
Sbjct  190   FNSSHCNR------YYSRGYERYYGQFNAEANRDFLSPRDADGHGSHTASTAVGRRVNGV  243

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             SALGG A G A+GGA L RLA+YKACW VP      T  C D+D+LAAFD A+ADGV VI
Sbjct  244   SALGGIARGTASGGASLARLAVYKACWTVPNAQKYVTNTCFDEDMLAAFDDAIADGVNVI  303

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASS  1418
             S+S+G +    Y ++DG+A+G+LHA+KR+I V  SAGN   +  +++N APWI TVGASS
Sbjct  304   SISIGAVEPHTY-SEDGIAIGSLHAVKRDIVVAASAGNDGPDGATLSNPAPWIITVGASS  362

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPE  1241
             +DR F   + LG+    + +S+T +K     PLV + DV +PG T      C  ++LSP+
Sbjct  363   LDRYFVGRLELGDGFQFESDSLTTLKMDNFAPLVNSLDVAVPGCTREEASQCVPNSLSPD  422

Query  1240  KVKGKVVFCLTG------GLSQTLEVERAGGAAVILGS--IGSEIQVESFLITATNIFNP  1085
               +GKV+ C+ G       + +++EV+RAGG  +IL +   G    V S  +    +F+ 
Sbjct  423   LARGKVILCMRGFGSSRSTIGKSIEVKRAGGVGMILANSRAGDGFDVVSHFVPTALVFS-  481

Query  1084  SGTDAILKYILTNKNPVATLIPGKTI----------FGAKPSPAMAPFTSLGPSYPEPNI  935
             S    IL Y+  +  PVA + P +TI          +  KP+P M  F+S GP++ + NI
Sbjct  482   STVGRILDYMYNDYEPVAFIKPAETILYGYQPQDSVYPYKPAPFMTSFSSRGPNWVDANI  541

Query  934   LKPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPD  755
             LKPDI APGLNILAAWS A S  +   D R + YN+ SGTSMSCPHV+  +ALLK++HP 
Sbjct  542   LKPDIIAPGLNILAAWSGADSASKASIDRRVIDYNLDSGTSMSCPHVAGAIALLKSMHPT  601

Query  754   WSGAAIKSAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMD  575
             WS AAI+SA+MTTA+  N   E I+D  G  A PF  G+GH +P+KA  PGLVYD++Y  
Sbjct  602   WSSAAIRSALMTTASMTNEDNEPIQDFDGSPASPFALGSGHFRPTKAQSPGLVYDASYRS  661

Query  574   YLLFVCSSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYS  395
             YLL+ CS   T LDP+++CP +     NLNYPS++I  L G++ V RTVT VG ++ + S
Sbjct  662   YLLYCCSVGLTNLDPTFRCPSQIPPGYNLNYPSVSIPDLIGTVTVTRTVTCVGRSSNSTS  721

Query  394   VEV---KAPTGYSVKISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWS  239
             V V   + P G +V   P  L F  +G+K+           +     +  ++ FGW+ WS
Sbjct  722   VYVFNAQPPFGVNVMAEPNVLVFDRIGQKKRFNIIFRTDRYEFTGEARRNQYRFGWFSWS  781

Query  238   DGIHMVKSPIVVS  200
             DG H+V+SPI VS
Sbjct  782   DGHHVVRSPIAVS  794



>ref|NP_199377.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AED95279.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=754

 Score =   469 bits (1206),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 278/606 (46%), Positives = 364/606 (60%), Gaps = 39/606 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH--TFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNR      Y+ +GYE  +GP N     DF S RD  GHG+HTAST  GR+V   
Sbjct  162   FNSSHCNR------YYARGYERYYGPFNAEANKDFLSPRDADGHGSHTASTAVGRRVDGV  215

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             SALGG A G A+GGA L RLA+YKACW VP  +  AT  C D+D+LAAFD A+ADGV VI
Sbjct  216   SALGGIAMGTASGGASLARLAVYKACWAVPNKEKYATNTCFDEDMLAAFDDAIADGVNVI  275

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGN---YREPYSVTNVAPWIFTVGA  1424
             S+S+G +    Y  +DG+A+GALHA+KR+I V  SAGN    RE  +++N APWI TVGA
Sbjct  276   SISIGTVEPHTYL-EDGIAIGALHAVKRDIVVAASAGNDGPARE--TLSNPAPWIITVGA  332

Query  1423  SSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLS  1247
             SS+DR F   + LG+  + + +S+T +K     PLVYA DV +PG S      C  + LS
Sbjct  333   SSLDRFFVGRLELGDGYVFESDSLTTLKMDNYAPLVYAPDVVVPGVSRNDAMLCLPNALS  392

Query  1246  PEKVKGKVVFCLTG-----GLSQTLEVERAGGAAVILGSI--GSEIQVESFLITATNIFN  1088
             P+ V+GKVV CL G      + + LEV+RAGG  +IL +        VES  +    +F+
Sbjct  393   PDHVRGKVVLCLRGYGSGSTIGKGLEVKRAGGVGMILANSRDNDAFDVESHFVPTALVFS  452

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNI--LKPDITA  914
              S  D IL YI     PVA + P +T+          P  S+ P  P P +    PDI A
Sbjct  453   -STVDRILDYIYNTYEPVAFIKPAETVLYRN-----QPEDSVYPYKPAPFMTSFLPDIIA  506

Query  913   PGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIK  734
             PGLNILAAWS A S  +   D R + YN+ SGTSMSCPHV+  +ALLK++HP WS AAI+
Sbjct  507   PGLNILAAWSGADSASKDSIDRRVLDYNLDSGTSMSCPHVAGAIALLKSMHPTWSSAAIR  566

Query  733   SAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS  554
             SA+MTTA+  N   E I+D  G  A PF  G+ H +P+KAA PGLVYD++Y  YLL+ CS
Sbjct  567   SALMTTASMTNEDNEPIQDYDGSPANPFALGSRHFRPTKAASPGLVYDASYQSYLLYCCS  626

Query  553   SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVT---NVGSANTTYSVEVK  383
                T LDP++KCP +     NLNYPS++I  L G++ V RTVT     G++ + Y    +
Sbjct  627   VGLTNLDPTFKCPSRIPPGYNLNYPSISIPYLSGTVTVTRTVTCVGRTGNSTSVYVFNAQ  686

Query  382   APTGYSVKISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVK  218
              P G  VK  P  L F ++G+K+           +     +   + FGW+ W+DG H+V+
Sbjct  687   PPNGVLVKAEPNVLVFDKIGQKKRFNIIFTTQRYEFTGEARRDRYRFGWFSWTDGHHVVR  746

Query  217   SPIVVS  200
             S I VS
Sbjct  747   SSIAVS  752



>gb|KHN38643.1| Subtilisin-like protease, partial [Glycine soja]
Length=700

 Score =   458 bits (1178),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 270/598 (45%), Positives = 364/598 (61%), Gaps = 36/598 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG EA  GP+   N  F FRS+RD  GHGTHTAST+ G  VAN
Sbjct  113   FTLANCNKKIIGARFYSKGIEAEVGPLETANKIF-FRSARDGDGHGTHTASTIAGSIVAN  171

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS LG  A G A GGAP  RLAIYKACW   FD     FC D DVL+A D A+ DGV ++
Sbjct  172   ASLLG-IAKGTARGGAPSARLAIYKACW---FD-----FCSDADVLSAMDDAIHDGVDIL  222

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + ++ +++GA HA ++ + V  SAGN   P +  NVAPWI TV AS+I
Sbjct  223   SLSLGPDPPQPIYFENAISVGAFHAFQKGVLVSASAGNSVFPRTACNVAPWILTVAASTI  282

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVY-AGDVEIPGSTTIPGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  I+ + +  L+Y +       S T   FC+ +TL P  
Sbjct  283   DREFSSNIYLGNSKVLKGSSLNPIRMEHSNGLIYGSAAAAAGVSATNASFCKNNTLDPTL  342

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C     S     + + + + GG  +IL    ++     F+I +T I    G D
Sbjct  343   IKGKIVICTIETFSDDRRAKAIAIRQGGGVGMILIDHNAKDIGFQFVIPSTLI----GQD  398

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             A+ +   YI T+KNP A + P  T+ G KP+P MA F+S+GP+   P+I+KPDITAPG+N
Sbjct  399   AVQELQAYIKTDKNPTAIINPTITVVGTKPAPEMAAFSSIGPNIITPDIIKPDITAPGVN  458

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  ++  E   +HRSV YNIISGTSMSCPHV+AV A++K+ HP W  AAI S+IM
Sbjct  459   ILAAWSPVAT--EATVEHRSVDYNIISGTSMSCPHVTAVAAIIKSHHPHWGPAAIMSSIM  516

Query  721   TTATT-KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTAT   N +    +D  G    PF YG+GH+ P  + +PGLVYD    D L F+CS+  
Sbjct  517   TTATVIDNTRRVIGRDPNGTQTTPFDYGSGHVNPVASLNPGLVYDFNSQDVLNFLCSNGA  576

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  ++ SN NYPS+ ++ L GS+ V RTVT  G   T Y   V+
Sbjct  577   SPAQLKNLTGVISQCQKPLTASSNFNYPSIGVSSLNGSLSVYRTVTYYGQGPTVYRASVE  636

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              P+G +VK++P ELKF++ GEK   F           G F FG   W++GI  V+SPI
Sbjct  637   NPSGVNVKVTPAELKFVKTGEK-ITFRIDFFPFKNSDGSFVFGALIWNNGIQRVRSPI  693



>ref|XP_003538129.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=758

 Score =   459 bits (1180),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 270/598 (45%), Positives = 364/598 (61%), Gaps = 36/598 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG EA  GP+   N  F FRS+RD  GHGTHTAST+ G  VAN
Sbjct  171   FTLANCNKKIIGARFYSKGIEAEVGPLETANKIF-FRSARDGDGHGTHTASTIAGSIVAN  229

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS LG  A G A GGAP  RLAIYKACW   FD     FC D DVL+A D A+ DGV ++
Sbjct  230   ASLLG-IAKGTARGGAPSARLAIYKACW---FD-----FCSDADVLSAMDDAIHDGVDIL  280

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + ++ +++GA HA ++ + V  SAGN   P +  NVAPWI TV AS+I
Sbjct  281   SLSLGPDPPQPIYFENAISVGAFHAFQKGVLVSASAGNSVFPRTACNVAPWILTVAASTI  340

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVY-AGDVEIPGSTTIPGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  I+ + +  L+Y +       S T   FC+ +TL P  
Sbjct  341   DREFSSNIYLGNSKVLKGSSLNPIRMEHSNGLIYGSAAAAAGVSATNASFCKNNTLDPTL  400

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C     S     + + + + GG  +IL    ++     F+I +T I    G D
Sbjct  401   IKGKIVICTIETFSDDRRAKAIAIRQGGGVGMILIDHNAKDIGFQFVIPSTLI----GQD  456

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             A+ +   YI T+KNP A + P  T+ G KP+P MA F+S+GP+   P+I+KPDITAPG+N
Sbjct  457   AVQELQAYIKTDKNPTAIINPTITVVGTKPAPEMAAFSSIGPNIITPDIIKPDITAPGVN  516

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  ++  E   +HRSV YNIISGTSMSCPHV+AV A++K+ HP W  AAI S+IM
Sbjct  517   ILAAWSPVAT--EATVEHRSVDYNIISGTSMSCPHVTAVAAIIKSHHPHWGPAAIMSSIM  574

Query  721   TTATT-KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTAT   N +    +D  G    PF YG+GH+ P  + +PGLVYD    D L F+CS+  
Sbjct  575   TTATVIDNTRRVIGRDPNGTQTTPFDYGSGHVNPVASLNPGLVYDFNSQDVLNFLCSNGA  634

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  ++ SN NYPS+ ++ L GS+ V RTVT  G   T Y   V+
Sbjct  635   SPAQLKNLTGVISQCQKPLTASSNFNYPSIGVSSLNGSLSVYRTVTYYGQGPTVYRASVE  694

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              P+G +VK++P ELKF++ GEK   F           G F FG   W++GI  V+SPI
Sbjct  695   NPSGVNVKVTPAELKFVKTGEK-ITFRIDFFPFKNSDGSFVFGALIWNNGIQRVRSPI  751



>ref|XP_011039898.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=794

 Score =   459 bits (1181),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 265/592 (45%), Positives = 366/592 (62%), Gaps = 27/592 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CN+K+IGARY  KG+ A  GPV   ++  +  D SGHGTHT ST GG  V   +  G   
Sbjct  211   CNKKLIGARYFNKGFAANNGPVPEEWN-TARDDASGHGTHTLSTAGGSYVPGVNVYG-VG  268

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GGAP  R+A YK CW           C D D+LAA+D A++DGV VISVSLG   
Sbjct  269   NGTAKGGAPKARVATYKVCWPS-----ANGGCTDADILAAYDAAISDGVDVISVSLGS-N  322

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
             +   F +DG+++G+LHA+K+ I V+ + GN      S+TN APW+FT+GAS++DR     
Sbjct  323   EPLQFYEDGISIGSLHAIKKGIPVIAAGGNNGPSDGSITNGAPWLFTIGASTMDREIFTT  382

Query  1393  VLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKV  1223
             V LG+  L KG+++    +   +  PL+   +  +  +T      C   TL P KV GK+
Sbjct  383   VTLGDKKLFKGKTLASKNLPDGKLYPLINGAEAALAEATPRDAQLCLDGTLDPNKVSGKI  442

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G    L +  E ERAG   ++L +    G E+ +E++ + + +I    G ++++ 
Sbjct  443   ILCLRGQSPRLPKGYEAERAGAVGMVLVNDIISGDELYLEAYELPSAHITYADG-ESVMD  501

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI   +NP A++ P  T FG KPSPAMA F+S GPS  EP +LKPDITAPG++++AA++E
Sbjct  502   YIKATRNPTASISPAITNFGVKPSPAMAKFSSRGPSKIEPAVLKPDITAPGVDVIAAFTE  561

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P  +P D R   Y ++SGTSMSCPHVS +V LL+AIHPDWS AA+KSAIMTTA TK+
Sbjct  562   AMGPSRRPFDKRRTPYMVMSGTSMSCPHVSGIVGLLRAIHPDWSPAALKSAIMTTAKTKS  621

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS------IGTT  539
                + + D  G++A PF YGAGH+QP+ AADPGLVYD+   DYL F+C+       +   
Sbjct  622   NNKKRMLDYDGQLATPFMYGAGHVQPNLAADPGLVYDTNVNDYLSFLCAHGYNKTLLNAF  681

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D  Y CP+  S  ++ NYPS+ +  LKG + V R V NVG A  TY+V +KAP   SV 
Sbjct  682   SDGPYTCPENFSF-ADFNYPSITVPDLKGPVTVTRRVKNVG-APGTYTVSIKAPAKVSVV  739

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             + P+ L+F + GE+Q F ++ K        ++EFG   WSDG+H VKSP+VV
Sbjct  740   VEPSSLEFKQAGEEQLFKLTFKPIMDGMPKDYEFGHLTWSDGLHRVKSPLVV  791



>ref|XP_001777292.1| predicted protein [Physcomitrella patens]
 gb|EDQ57947.1| predicted protein [Physcomitrella patens]
Length=703

 Score =   456 bits (1173),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 275/600 (46%), Positives = 350/600 (58%), Gaps = 46/600 (8%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F   +CNRK+IGA+Y++KGYEA  G +N T D+RS RDI GHGTHTAST  G  V  A+ 
Sbjct  131   FGPENCNRKLIGAKYYLKGYEAHIGSINAT-DYRSPRDIDGHGTHTASTSAGNFVEGANT  189

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
                 A G A GGAP   +A YK CWQ          C D D+LAA D A+ADGV V S S
Sbjct  190   FNQ-AWGTAKGGAPHAHIAAYKVCWQ-------GGGCDDSDILAAMDDAIADGVDVFSAS  241

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDR  1409
             LG  P    +  D +A+   HA  + I  V SAGN      SVTNVAPWI TVGA+SIDR
Sbjct  242   LGSDPPLYPYYSDAIAVATFHAQYKGIITVCSAGNAGPTAGSVTNVAPWIVTVGANSIDR  301

Query  1408  VFSAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEKVK  1232
              F + V+ GNN +  G+S T  K   E  PLV   D  + G   +   C  +TL PEKV 
Sbjct  302   KFPSHVVTGNNEIFDGQSSTNEKLPDEYFPLVAGADAGLSGVEMLSALCMNNTLDPEKVA  361

Query  1231  GKVVFCLTGGLSQTLE----VERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTD  1073
             GK+V C+ G ++  +E    V+ AGG  +IL    + G E+  +  L+ AT I       
Sbjct  362   GKIVTCIRG-VNGRVEKGGIVKEAGGTGMILANNAASGEELLADPHLLPATMI-------  413

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
                       +P+A + P  T  G KP+P MA F+S GP+   P+ILKPD+TAPGLNILA
Sbjct  414   ---------TSPMAKITPAYTKLGVKPAPEMAAFSSQGPNTLNPDILKPDVTAPGLNILA  464

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AW+ A SP     D R VKYNIISGTSMS PHVS V ALLKA HP+WS AAIKSA++TTA
Sbjct  465   AWTGAESPTGLAFDPRRVKYNIISGTSMSAPHVSGVAALLKARHPNWSPAAIKSALITTA  524

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT---  542
             T  +  G  +++   ++A PF YG G I P+ A DPGLVYD T +DY LF+C +IG    
Sbjct  525   TQIDNTGHLVRNGSMKIATPFSYGGGQINPNAAHDPGLVYDLTPLDYTLFLC-AIGYNGT  583

Query  541   -----TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAP  377
                  T++P + CP K  S S+LNYPS+ I+ L     V+RTV NVG A  TY++ V  P
Sbjct  584   FLQVFTIEP-FTCPSKVPSVSDLNYPSITISDLSTRRAVRRTVLNVGKAKQTYNLTVVEP  642

Query  376   TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              G  V I+P +L F    EK+  F             ++FG + WSDG H V+SP+ + +
Sbjct  643   FGVRVDINPKQLVFSRKYEKK-TFSVTFTPRNVTTKGYQFGSFTWSDGYHRVRSPLAIQN  701



>gb|KEH29866.1| subtilisin-like serine protease [Medicago truncatula]
Length=657

 Score =   454 bits (1167),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 265/606 (44%), Positives = 357/606 (59%), Gaps = 46/606 (8%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG+E  FGP+   N  F FRS+RD  GHGTHTAST+ GR V N
Sbjct  70    FTLANCNKKIIGARFYSKGFELEFGPLEDFNKIF-FRSARDNDGHGTHTASTIAGRNVVN  128

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS L G A G A GGAP  RLAIYKACW          FC D DVL+A D A+ DGV ++
Sbjct  129   AS-LFGMAKGTARGGAPGARLAIYKACW--------FNFCNDADVLSAMDDAIHDGVDIL  179

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + +DG+++GA HA ++ I V  SAGN   P + +NVAPWI TV AS++
Sbjct  180   SLSLGPDPPQPIYFEDGISIGAFHAFQKGILVSASAGNSVFPRTASNVAPWILTVAASTV  239

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  +K + +  L+Y      PG   T   FC+ +TL P  
Sbjct  240   DREFSSNIYLGNSKVLKGYSLNPVKMEHSYGLIYGSVAAAPGVPETNASFCKNNTLDPSL  299

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVIL-----GSIGSEIQVESFLITATNIFN  1088
             + GK+V C     +     + + +++ GG  +IL       IG +  + S LI   ++  
Sbjct  300   INGKIVICTIESFADNRREKAITIKQGGGVGMILIDHNAKEIGFQFVIPSTLIGQDSV--  357

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
                 + +  YI T KNP+A + P  T+ G KP+P  A F+S+GP+   P+I+KPDIT PG
Sbjct  358   ----EELQAYIKTEKNPIAKIYPTITVVGTKPAPEAAAFSSMGPNIITPDIIKPDITGPG  413

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             +NILAAWS  ++  E   +HR V YNIISGTSMSCPH+SAV  ++K+ HP WS AAI SA
Sbjct  414   VNILAAWSPVAT--EATVEHRPVDYNIISGTSMSCPHISAVATIIKSYHPTWSPAAIMSA  471

Query  727   IMTTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS  551
             IMTTAT  +     I +D  G    PF YG+GH+ P  + +PGLVYD +  D L F+CS 
Sbjct  472   IMTTATVMDNTNHLIGRDPNGTQTTPFDYGSGHVNPLASLNPGLVYDFSSQDALDFLCS-  530

Query  550   IGTTLDPSY---------KCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTY  398
               T   PS          +C K  +   N NYPS+ ++ L GS+ V RTVT  G     Y
Sbjct  531   --TGASPSQLKNITGELTQCQKTPTPSYNFNYPSIGVSNLNGSLSVYRTVTFYGQEPAVY  588

Query  397   SVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVK  218
                V++P G +V ++P  LKF + GEK   F       V   G F FG   W +G   V+
Sbjct  589   VASVESPFGVNVTVTPVALKFWKTGEK-LTFRVDFNPFVNSNGNFVFGALTWKNGKQRVR  647

Query  217   SPIVVS  200
             SPI V+
Sbjct  648   SPIGVN  653



>ref|XP_006851499.1| hypothetical protein AMTR_s00040p00151440 [Amborella trichopoda]
 gb|ERN13080.1| hypothetical protein AMTR_s00040p00151440 [Amborella trichopoda]
Length=738

 Score =   456 bits (1174),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 268/602 (45%), Positives = 360/602 (60%), Gaps = 37/602 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFD--FRSSRDISGHGTHTASTVGGRKVANA  1772
             FT ++CNRKIIGARY+ +G+EA  GP+    +  FRS+RD  GHGTHTAST  G+   NA
Sbjct  151   FTLANCNRKIIGARYYSQGFEAENGPLESHGELFFRSARDTDGHGTHTASTAAGKSAVNA  210

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S LG  A G A GGAP  RLAIYKACW   F+      C D D+LAAFD A  DGV +IS
Sbjct  211   SYLG-IATGTARGGAPGARLAIYKACW---FNQ-----CSDADLLAAFDDAARDGVDIIS  261

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSID  1412
             +S+G  P  + F  D +++ A HA ++ + V  SAGN   P +V NVAPWI TVGASSID
Sbjct  262   LSVGPTPPQHDFFNDAISIAAFHAFRKGVLVSASAGNSGLPGTVINVAPWILTVGASSID  321

Query  1411  RVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPG----FCRQDTLSP  1244
             R+F + V+LGN+ ++KG+++  +  +    ++      +P   TIP     FC+ +TL P
Sbjct  322   RIFVSDVVLGNDKILKGQALNPLDLKGFYGVIPGSAAPLP---TIPAANASFCKSNTLEP  378

Query  1243  EKVKGKVVFC----LTGGLSQTLEVERAGGAA--VILGSIGSEIQVESFLITATNIFNPS  1082
             + + GK+V C    +T   +   EV + GG    +++  I  ++  + F+I AT I    
Sbjct  379   KLIAGKIVVCTIEKITENRTAKSEVVKEGGGVGMILVDPIAKDVGFQ-FVIPATVIGQEE  437

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
               + +  Y+ T KNPVAT+ P  TI   KP+P MA F+S GPS   P+++KPDITAPGLN
Sbjct  438   ALE-LQTYLSTEKNPVATIYPTSTILNVKPAPKMAVFSSAGPSIISPDVIKPDITAPGLN  496

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  ++   +    RSV +NIISGTSMSCPHVS   AL+KA HP WS  A+KSA+M
Sbjct  497   ILAAWSPVAT---KGAAGRSVNFNIISGTSMSCPHVSGAAALVKANHPSWSAMAVKSALM  553

Query  721   TTATT-KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTAT   N KG  ++D  G    PF  G+GH+ P  A DPGLVYD    D + F+C S  
Sbjct  554   TTATRLDNTKGSILRDPQGSSTSPFDLGSGHLNPLAAIDPGLVYDFDTKDIITFLCGSGA  613

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +      +  C        NLNYPS+ +A L+G + V RTVTN G++ +TY   V+
Sbjct  614   TPEQLQNLTGEAICCKIGLVEAYNLNYPSIGVANLRGRVSVYRTVTNYGTSRSTYLPSVE  673

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              P G  + I+P++LKF  +GEKQ  F           G F FG   WSDG + V +PI V
Sbjct  674   LPWGVQISIAPSKLKFSHIGEKQ-TFRVDLTVKKPSNGSFVFGSITWSDGKYQVFTPIAV  732

Query  202   SS  197
             ++
Sbjct  733   NA  734



>ref|XP_010644656.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=768

 Score =   457 bits (1176),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 270/593 (46%), Positives = 372/593 (63%), Gaps = 26/593 (4%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  GP+N +F+  S+RD  GHG+HT ST GG  V  AS  G + 
Sbjct  187   CNRKLIGARYFNKGYAAYAGPLNSSFN--SARDHEGHGSHTLSTAGGSLVYGASVFG-YG  243

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P  R+A YK CW      +    C D D++AAFD A+ DGV V+SVSLG   
Sbjct  244   NGTAKGGSPGARVAAYKVCWP----QVNNGGCFDADIMAAFDAAIHDGVDVLSVSLGGDA  299

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
              D YFT DG+A+G+ HA+KR I VV SAGN   +  SV+NV+PW+ TVGAS+IDR F+  
Sbjct  300   SD-YFT-DGLAIGSFHAVKRGIVVVSSAGNDGPKDASVSNVSPWMITVGASTIDREFTNY  357

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKV  1223
             V LGN   +KG S++   +   +  P++ + D +   ++      C+  TL+P+KVKGK+
Sbjct  358   VALGNRKHLKGMSLSTKGLPSNKFYPVISSLDAKAANASAQDAILCKPGTLNPKKVKGKI  417

Query  1222  VFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIF-----NPSGTDAILKY  1058
             + CL G   +  + E+A  A  +   + +++Q  + LI   ++      N S   A+  Y
Sbjct  418   LVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPHVLPASHVNFSDGAAVFNY  477

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I + KNP+A L   +T  G KP+P MA F+S GP+   P ILKPDITAPG+NI+AA+SE+
Sbjct  478   INSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEILKPDITAPGVNIIAAYSES  537

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
               P +Q  D R + +N  SGTSMSCPH+S +V LLK +HPDWS AAIKSAIMT+A T++ 
Sbjct  538   IGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDWSPAAIKSAIMTSARTRDD  597

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTTL  536
               E + ++    A PF YGAGH++P++A DPGLVYDST  DYL F+C      + +    
Sbjct  598   NMEPMLNSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVNDYLNFLCAIGYNETQLQIFS  657

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKI  356
                YKCP K+ S +  NYPS+    L GS+ + RTV NVG+   TY+  VKAP G SV +
Sbjct  658   QKPYKCP-KSFSLTGFNYPSITAPNLSGSVTISRTVKNVGTPG-TYTASVKAPPGISVAV  715

Query  355   SPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              P +L+F E GE++SF +++K +  +   ++ FG   WSDG H V+S IVV +
Sbjct  716   KPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQHYVRSSIVVKA  768



>ref|XP_007049441.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOX93598.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=624

 Score =   451 bits (1160),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 282/598 (47%), Positives = 369/598 (62%), Gaps = 34/598 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  G +N +FD  + RD  GHGTHT ST GG  VA AS LG F
Sbjct  41    HCNRKLIGARYFNKGYASIVGKLNSSFD--TPRDKEGHGTHTLSTAGGNLVAKASVLG-F  97

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  98    GKGTAKGGSPRARVAAYKVCWP----PVSGDECFDADILAAFDVAIHDGVDVLSVSLGGD  153

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA+K  I VV SAGN    Y +VTN+APW  TVGAS++DR F +
Sbjct  154   PTP--FFNDSVAIGSFHAIKHGIVVVCSAGNSGPAYGTVTNIAPWQITVGASTMDREFPS  211

Query  1396  PVLLGNNLLVKGESVT--EIKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGK  1226
              V+LGNN+  KG+S++  ++  ++  PL+  A       S      C+  T+ PEK  GK
Sbjct  212   IVVLGNNMRYKGQSLSANDLPDKKFFPLISAADAKAANASIENALLCQAGTIDPEKASGK  271

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVILGS---IGSEIQVESFLITATNIFNPSGTD  1073
              + CL G   Q   V++      AG   ++L +    G+EI  ++ ++ A++I    G  
Sbjct  272   FLVCLRG---QNARVDKGQQAALAGAVGMVLANNILAGNEIIADAHVLPASHINYTDGL-  327

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+  YI + K P A + P  T  G KP+P MA F+S GP+   P ILKPDITAPG++++A
Sbjct  328   AVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIA  387

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++EA  P  +  D R V++N +SGTSMSCPHVS +V LLK ++PDWS AAIKSAIMT+A
Sbjct  388   AYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDWSPAAIKSAIMTSA  447

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +   E I +A    AGPF YGAGHIQP+ A DPGLVYD    DYL F+C      + 
Sbjct  448   TTWDNMKEPILNASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATDYLNFLCTLGYNETL  507

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             I       YKCPK  S  +N NYPS+A+  L GS+ V RTV NVGS   TY  +V+ PTG
Sbjct  508   ISMFSQNPYKCPKPISL-ANFNYPSIAVPNLVGSITVTRTVKNVGSPG-TYRAQVQRPTG  565

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              SV++ P +LKF +VGE+++F V++ V     V E+ FG   WSD +H V SPIVV +
Sbjct  566   ISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHVHHVSSPIVVKA  623



>gb|AES88343.2| subtilisin-like serine protease [Medicago truncatula]
Length=734

 Score =   454 bits (1169),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 265/601 (44%), Positives = 357/601 (59%), Gaps = 36/601 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG+E  FGP+   N  F FRS+RD  GHGTHTAST+ GR V N
Sbjct  147   FTLANCNKKIIGARFYSKGFELEFGPLEDFNKIF-FRSARDNDGHGTHTASTIAGRNVVN  205

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS L G A G A GGAP  RLAIYKACW          FC D DVL+A D A+ DGV ++
Sbjct  206   AS-LFGMAKGTARGGAPGARLAIYKACW--------FNFCNDADVLSAMDDAIHDGVDIL  256

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + +DG+++GA HA ++ I V  SAGN   P + +NVAPWI TV AS++
Sbjct  257   SLSLGPDPPQPIYFEDGISIGAFHAFQKGILVSASAGNSVFPRTASNVAPWILTVAASTV  316

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  +K + +  L+Y      PG   T   FC+ +TL P  
Sbjct  317   DREFSSNIYLGNSKVLKGYSLNPVKMEHSYGLIYGSVAAAPGVPETNASFCKNNTLDPSL  376

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             + GK+V C     +     + + +++ GG  +IL    ++     F+I +T I   S  +
Sbjct  377   INGKIVICTIESFADNRREKAITIKQGGGVGMILIDHNAKEIGFQFVIPSTLIGQDS-VE  435

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              +  YI T KNP+A + P  T+ G KP+P  A F+S+GP+   P+I+KPDIT PG+NILA
Sbjct  436   ELQAYIKTEKNPIAKIYPTITVVGTKPAPEAAAFSSMGPNIITPDIIKPDITGPGVNILA  495

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWS  ++  E   +HR V YNIISGTSMSCPH+SAV  ++K+ HP WS AAI SAIMTTA
Sbjct  496   AWSPVAT--EATVEHRPVDYNIISGTSMSCPHISAVATIIKSYHPTWSPAAIMSAIMTTA  553

Query  712   TTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTL  536
             T  +     I +D  G    PF YG+GH+ P  + +PGLVYD +  D L F+CS   T  
Sbjct  554   TVMDNTNHLIGRDPNGTQTTPFDYGSGHVNPLASLNPGLVYDFSSQDALDFLCS---TGA  610

Query  535   DPSY---------KCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
              PS          +C K  +   N NYPS+ ++ L GS+ V RTVT  G     Y   V+
Sbjct  611   SPSQLKNITGELTQCQKTPTPSYNFNYPSIGVSNLNGSLSVYRTVTFYGQEPAVYVASVE  670

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             +P G +V ++P  LKF + GEK   F       V   G F FG   W +G   V+SPI V
Sbjct  671   SPFGVNVTVTPVALKFWKTGEK-LTFRVDFNPFVNSNGNFVFGALTWKNGKQRVRSPIGV  729

Query  202   S  200
             +
Sbjct  730   N  730



>ref|XP_010107369.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC15620.1| Subtilisin-like protease [Morus notabilis]
Length=752

 Score =   454 bits (1167),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 278/602 (46%), Positives = 369/602 (61%), Gaps = 34/602 (6%)
 Frame = -2

Query  1942  TSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             +S HCNRK+IGARY  KGY A  GP+N TFD  S RD  GHG+HT ST  G  V  A+  
Sbjct  166   SSFHCNRKLIGARYFNKGYGAAAGPLNSTFD--SPRDNEGHGSHTLSTASGNFVPAANVF  223

Query  1762  GGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSL  1583
             G F NG A GG+P  R+A YK CW  P D      C D D+LAAFD A+ DGV V+SVSL
Sbjct  224   G-FGNGTAKGGSPRARVAAYKVCWP-PID---GNECFDADILAAFDIAIHDGVDVLSVSL  278

Query  1582  GLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRV  1406
             G  P    F  D VA+G+ HA+K  I VV S GN      +V+NVAPW  TVGAS++DR 
Sbjct  279   GGSPAP--FFNDSVAIGSFHAIKHGIVVVCSGGNSGPADATVSNVAPWEITVGASTMDRE  336

Query  1405  FSAPVLLGNNLLVKGESVTEIKKQ--ETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKV  1235
             F + V+LGN    KG+S++    Q  +  PLV A D +   ++      C+  TL P+KV
Sbjct  337   FPSYVILGNKKSFKGQSLSAKALQIGKFYPLVSALDAKAANASAADALLCKPATLDPKKV  396

Query  1234  KGKVVFCLTGGLSQTLEVER------AGGAAVILGS---IGSEIQVESFLITATNIFNPS  1082
              GK++ CL G   Q   V++      AG   +IL +    G+EI  +  ++ A++I    
Sbjct  397   TGKILVCLRG---QNARVDKGQQALEAGAVGMILANNELTGNEIIADPHVLPASHINYND  453

Query  1081  GTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             G + +  YI + K+P   + P  T  G KP+P MA F+S GP+   P ILKPDITAPG++
Sbjct  454   GIN-VFTYINSTKSPKGYITPATTKLGTKPAPFMAAFSSKGPNTVTPEILKPDITAPGVS  512

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             I+AA++EA  P  +  D R + +N ISGTSMSCPHVS +V LLK +HPDWS AAIKSAIM
Sbjct  513   IIAAYTEAQGPTNEEFDKRRISFNSISGTSMSCPHVSGIVGLLKTLHPDWSPAAIKSAIM  572

Query  721   TTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC-----  557
             TTA T++ + E + ++    A PF YGAGH+ P+ A DPGLVYD ++ DYL F+C     
Sbjct  573   TTARTRDNQMEPLLNSSNFKATPFSYGAGHVNPNGAMDPGLVYDLSFNDYLNFLCALRYN  632

Query  556   -SSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKA  380
              + I    +  YKC KK S  +NLNYPS+ + +L GS+ V RT+ NVG+   TY   V+ 
Sbjct  633   ATQIEMFSEKPYKCSKKISL-TNLNYPSITVPKLSGSIAVTRTLKNVGTPG-TYRARVEN  690

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               G SV + P  LKF  VGE++SF +++K ++ K   ++ FG   WSDG H V+SPIVV 
Sbjct  691   QAGISVSVEPKSLKFKRVGEEKSFTLTLKAKNPKAAKDYAFGKLIWSDGTHYVRSPIVVK  750

Query  199   SA  194
             +A
Sbjct  751   AA  752



>ref|XP_006469398.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=642

 Score =   449 bits (1156),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 266/597 (45%), Positives = 356/597 (60%), Gaps = 30/597 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  GP+N +FD  + RD  GHGTHT ST GG  VA AS  G   
Sbjct  58    CNRKLIGARYFNKGYAAAVGPLNSSFD--TPRDKDGHGTHTLSTAGGNFVAKASVFG-LG  114

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  P
Sbjct  115   KGTAKGGSPKARVAAYKVCWP----PVTGNECYDADILAAFDMAIHDGVDVLSVSLGGGP  170

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSAP  1394
                 F  D  A+G+ HA+K  + V+ SAGN     S V+N+APW  TVGAS++DR F + 
Sbjct  171   SK--FFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQITVGASTMDRDFPSY  228

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGKV  1223
             V++ NN   KG+S++   + + +  PL+  A       ST +   C   TL P+KVKGK+
Sbjct  229   VVVSNNKRYKGQSLSSKGLPRNKLFPLISAADAKAANASTEVALLCEAGTLDPKKVKGKI  288

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G    + +  +   AG   ++L +    G+E+  +  L+ A+++    G D + +
Sbjct  289   LVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELLADPHLLPASHVNYTDGAD-LFR  347

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             Y+ + K PV  L    T  G KP+P MA F+S GPS   P ILKPDITAPG+ I+AA++E
Sbjct  348   YVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSIAPEILKPDITAPGVTIIAAYTE  407

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A+ P  +  D R + +N +SGTSMSCPHVS +V LLK +HP+WS AAIKSAIMTTA+ ++
Sbjct  408   AAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQD  467

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
                  I +A    A PF YGAGHIQP+ A DPGLVYD T  DYL F+C      + I   
Sbjct  468   NNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDLTENDYLNFLCALGYNKTQIALF  527

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D +Y+CP+  S+ +N NYPS+ + +L GS++V RTV NVGS   TY   V+ P G SV 
Sbjct  528   SDKTYRCPEYVST-ANFNYPSITVPKLSGSIIVSRTVRNVGSPG-TYIARVRNPKGISVS  585

Query  358   ISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDG-IHMVKSPIVVSSA  194
             + P  LKF+ VG EK         +      ++ FG   W+D   H V+SPIVV+ A
Sbjct  586   VEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGDLVWADDKQHQVRSPIVVNPA  642



>ref|XP_007132413.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
 gb|ESW04407.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
Length=681

 Score =   450 bits (1157),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 262/598 (44%), Positives = 358/598 (60%), Gaps = 35/598 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVN---HTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG+EA  GP++       FRS+RD  GHGTHTAST+ G  VAN
Sbjct  93    FTLANCNKKIIGARFYSKGFEAENGPLDGFGSKIFFRSARDSDGHGTHTASTIAGSTVAN  152

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS L G A G A GGAP  RL+IYKACW          FC D D+L+A D A+ DGV ++
Sbjct  153   AS-LFGIAKGTARGGAPSARLSIYKACW--------FGFCSDADILSAVDDAIHDGVDIL  203

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + +D V+LG  HA ++ I V  SAGN   P +  NVAPWI TV ASSI
Sbjct  204   SLSLGPNPPQPIYFEDAVSLGTFHAFQKGILVSASAGNSVFPRTACNVAPWILTVAASSI  263

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  IK + +  L+Y       G   I   FC+ +TL+P  
Sbjct  264   DREFSSNIYLGNSKVLKGSSLNPIKMKHSHGLIYGSAAAAAGVPAINASFCKNNTLNPTL  323

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C     S     + +++ + GG  +IL    ++     F+I +T I    G D
Sbjct  324   IKGKIVICTIENFSDDRQEKAIQIRQGGGVGMILIDHNAKDIGFQFVIPSTLI----GQD  379

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             A+ +   Y+ T+KNP A +IP  T+ G KP+P MA F+S+GP+   P+I+KPDIT PG+N
Sbjct  380   AVEELQAYVKTDKNPTARIIPTVTVVGTKPAPEMAAFSSIGPNIITPDIIKPDITGPGVN  439

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS   +  +   + R V YNIISGTSMSCPH++AV A++K+ HP W  AAI S+IM
Sbjct  440   ILAAWSPVGT--DATVEQRPVNYNIISGTSMSCPHITAVAAIIKSHHPSWGPAAIMSSIM  497

Query  721   TTAT-TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTAT T N      +D  G    PF YG+GH+ P  + +PGLVY+    D L F+CS+  
Sbjct  498   TTATVTDNTHHLIRRDPNGTQTTPFDYGSGHVNPVASLNPGLVYEFHSQDVLNFLCSNGA  557

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  ++ +N NYPS+ ++ L GS+ V RTVT  G   T YS  ++
Sbjct  558   SPAQLKNLTGDLTQCHKPLTASNNFNYPSIGVSNLNGSLSVYRTVTYYGQEPTVYSASIE  617

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              P+G  V ++P ELKF + GEK   F        +  G F FG   W++G H V+SPI
Sbjct  618   NPSGVKVTVTPAELKFGKPGEK-ITFRIDFFPFKQSNGNFVFGSLIWNNGKHRVRSPI  674



>ref|XP_008810184.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=775

 Score =   452 bits (1164),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 276/596 (46%), Positives = 380/596 (64%), Gaps = 30/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
              CNRK+IGARY  KGY++  GP++   +  S RD  GHGTHT ST  GR V  A+ L G+
Sbjct  188   RCNRKLIGARYFNKGYQSLVGPLSP--ELNSPRDNEGHGTHTLSTAAGRIVPGAT-LFGY  244

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
             + G+A GGAP  R+A YK CW  P D    + C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  245   STGMAKGGAPNARVAAYKVCWP-PVD---GSECFDADILAAFDAAIHDGVHVLSVSLGGD  300

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY--SVTNVAPWIFTVGASSIDRVFS  1400
             P D ++  DG+A+G+ HA+K  + VV SAGN   P+  +V+NVAPWI TVGAS+IDR F 
Sbjct  301   PVDYFY--DGLAIGSFHAVKNGLTVVCSAGN-SGPFLGTVSNVAPWILTVGASTIDREFP  357

Query  1399  APVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGK  1226
             + V L N   +KG+S++ +  Q+   PL+ + + +    S+     C   +L P KV+GK
Sbjct  358   SYVQLRNRKQMKGQSLSPVGLQQNFHPLISSKEAKATNMSSEDATQCLLGSLEPAKVRGK  417

Query  1225  VVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             VV CL G    + +   V +AGG  +IL    S G+EI  ++ ++ AT+I    G  A+L
Sbjct  418   VVVCLRGNNGRVEKGEAVRQAGGVGMILANDESTGNEIIADAHVLPATHISYSDGV-ALL  476

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+P+  +   KT+    P+P MA F+S GP+   P ILKPDITAPG++I+AA++
Sbjct  477   SYINSTKSPLGYITTPKTMLDTYPAPFMAAFSSRGPNTINPEILKPDITAPGVSIIAAYT  536

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
              AS P   P D R V +N  SGTSMSCPHVS +  LLKA+HPDWS +AIKSAI+T+A T+
Sbjct  537   GASGPTGLPFDSRRVLFNSESGTSMSCPHVSGIAGLLKALHPDWSPSAIKSAIVTSARTQ  596

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-------SIG  545
             +   E + ++    A PF YG+GH++P++A DPGLVYD T  DYL F+CS       +  
Sbjct  597   DNTLEPMSNSSFVKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQNAL  656

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               ++P Y CP +  +  +LNYPS++I  L G++ V RTV NVG+   TY V V  P G S
Sbjct  657   FNVEP-YLCPSRPLNIGDLNYPSISIPYLSGAVSVIRTVKNVGTPG-TYRVRVIEPAGIS  714

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             V + PT LKFM+VGE++ F V++K +S    G++ FG   WSDG+H V+SPIVV +
Sbjct  715   VSVKPTSLKFMKVGEEKKFKVTLKAKSRDAAGDYAFGKLIWSDGMHYVRSPIVVKA  770



>emb|CBI39824.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   453 bits (1166),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 270/599 (45%), Positives = 370/599 (62%), Gaps = 32/599 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  GP+N +F+  S+RD  GHG+HT ST GG  V  AS  G + 
Sbjct  216   CNRKLIGARYFNKGYAAYAGPLNSSFN--SARDHEGHGSHTLSTAGGSLVYGASVFG-YG  272

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P  R+A YK CW      +    C D D++AAFD A+ DGV V+SVSLG   
Sbjct  273   NGTAKGGSPGARVAAYKVCWP----QVNNGGCFDADIMAAFDAAIHDGVDVLSVSLGGDA  328

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
              D YFT DG+A+G+ HA+KR I VV SAGN   +  SV+NV+PW+ TVGAS+IDR F+  
Sbjct  329   SD-YFT-DGLAIGSFHAVKRGIVVVSSAGNDGPKDASVSNVSPWMITVGASTIDREFTNY  386

Query  1393  VLLGNNLLVKGE--------SVTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPE  1241
             V LGN   +K E        S   +   +  P++ + D +   ++      C+  TL+P+
Sbjct  387   VALGNRKHLKNEHLQMGMSLSTKGLPSNKFYPVISSLDAKAANASAQDAILCKPGTLNPK  446

Query  1240  KVKGKVVFCLTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIF-----NPSGT  1076
             KVKGK++ CL G   +  + E+A  A  +   + +++Q  + LI   ++      N S  
Sbjct  447   KVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPHVLPASHVNFSDG  506

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
              A+  YI + KNP+A L   +T  G KP+P MA F+S GP+   P ILKPDITAPG+NI+
Sbjct  507   AAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEILKPDITAPGVNII  566

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AA+SE+  P +Q  D R + +N  SGTSMSCPH+S +V LLK +HPDWS AAIKSAIMT+
Sbjct  567   AAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDWSPAAIKSAIMTS  626

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------S  554
             A T++   E + ++    A PF YGAGH++P++A DPGLVYDST  DYL F+C      +
Sbjct  627   ARTRDDNMEPMLNSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVNDYLNFLCAIGYNET  686

Query  553   SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
              +       YKCP K+ S +  NYPS+    L GS+ + RTV NVG+   TY+  VKAP 
Sbjct  687   QLQIFSQKPYKCP-KSFSLTGFNYPSITAPNLSGSVTISRTVKNVGTPG-TYTASVKAPP  744

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             G SV + P +L+F E GE++SF +++K +  +   ++ FG   WSDG H V+S IVV +
Sbjct  745   GISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQHYVRSSIVVKA  803



>ref|XP_002299063.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
 gb|EEE83868.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
Length=786

 Score =   452 bits (1163),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 265/598 (44%), Positives = 366/598 (61%), Gaps = 33/598 (6%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CN+K+IGARY  KG+ A  GPV   ++  +  D SGHGTHT ST GG  V   +  G   
Sbjct  197   CNKKLIGARYFNKGFAANNGPVPEEWN-TARDDASGHGTHTLSTAGGSYVPGVNVYG-VG  254

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GGAP  R+A YK CW           C D D+LAA+D A++DGV VISVSLG   
Sbjct  255   NGTAKGGAPKARVATYKVCWPS-----ANGGCTDADILAAYDAAISDGVDVISVSLGS-D  308

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
             +   F +DG+++G+LHA+K+ I V+ + GN      S+TN APW+FT+GAS++DR     
Sbjct  309   EPIQFYEDGISIGSLHAIKKGIPVIAAGGNNGPSDGSITNGAPWLFTIGASTMDREIFTT  368

Query  1393  VLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKV  1223
             V LG+  L KG+++    +   +  PL+   +  +  +T      C   TL P KV GK+
Sbjct  369   VTLGDKKLFKGKTLASKNLPDGKLYPLINGAEAALAEATPRDAQLCLDGTLDPNKVSGKI  428

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G    L +  E ERAG   +IL +    G E+ +E++ + + +I    G ++++ 
Sbjct  429   ILCLRGQSPRLPKGYEAERAGAVGMILANDIISGDELYLEAYELPSAHITYADG-ESVMD  487

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILK------PDITAPGLNI  899
             YI   +NP A++ P  T FG KPSPAMA F+S GPS  EP +LK      PD+TAPG+++
Sbjct  488   YIKATRNPTASISPAITNFGVKPSPAMAKFSSRGPSKIEPAVLKVSSASLPDVTAPGVDV  547

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             +AA++EA  P  +P D R   Y ++SGTSMSCPHVS +V LL+AIHPDWS AA+KSAIMT
Sbjct  548   IAAFTEAIGPSRRPFDKRRTPYMVMSGTSMSCPHVSGIVGLLRAIHPDWSPAALKSAIMT  607

Query  718   TATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS----  551
             TA TK    + + D  G++A PF YGAGH+QP+ AADPGLVYD+   DYL F+C+     
Sbjct  608   TAKTKCNNKKRMLDYDGQLATPFMYGAGHVQPNLAADPGLVYDTNVNDYLSFLCAHGYNK  667

Query  550   --IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAP  377
               +    D  Y CP+  S  ++ NYPS+ +  LKG + V R V NVG A  TY+V +KAP
Sbjct  668   TLLNAFSDGPYTCPENFSF-ADFNYPSITVPDLKGPVTVTRRVKNVG-APGTYTVSIKAP  725

Query  376   TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
                SV + P+ L+F + GE+Q F +++K        ++EFG   WSDG+H VKSP+VV
Sbjct  726   AKVSVVVEPSSLEFKQAGEEQLFKLTLKPIMDGMPKDYEFGHLTWSDGLHRVKSPLVV  783



>ref|XP_011012624.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=769

 Score =   451 bits (1161),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 272/594 (46%), Positives = 365/594 (61%), Gaps = 30/594 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  G +N +FD  + RD  GHG+HT ST GG  VA AS     
Sbjct  186   HCNRKLIGARYFNKGYASIVGHLNSSFD--TPRDEDGHGSHTLSTAGGNFVAGASVFY-M  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK C+  P D  +   C D D+LAAFD A++DGV V+SVSLG  
Sbjct  243   GNGTAKGGSPKARVAAYKVCYP-PVDGEE---CFDADILAAFDAAISDGVDVLSVSLGGN  298

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY--SVTNVAPWIFTVGASSIDRVFS  1400
             P    F  D VA+G+ HA+K  I V+ SAGN   P   +V+NVAPW  TVGAS++DR F 
Sbjct  299   P--TAFFNDSVAIGSFHAVKHGIVVICSAGN-SGPVDGTVSNVAPWEITVGASTMDREFP  355

Query  1399  APVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKG  1229
             + V+LGN +  KGES++   + K +  PL+ A D     ++      C+  +L PEK KG
Sbjct  356   SYVVLGNKISFKGESLSAKALPKNKFFPLMSAADARATNASVENALLCKDGSLDPEKAKG  415

Query  1228  KVVFCLTG---GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAI  1067
             K++ CL G    + +  +   AG   ++L +    G+EI  +  ++  ++I   SG  AI
Sbjct  416   KILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPHVLPVSHIKYTSGV-AI  474

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
              KYI + + PVA +    T  G KP+P +A F+S GP+   P ILKPDITAPG++++AA+
Sbjct  475   FKYINSTEYPVAYITHPVTRIGMKPAPVVAAFSSKGPNTVTPEILKPDITAPGVSVIAAY  534

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             ++A  P  Q  D R V +N +SGTSMSCPHVS +V LLK +HP WS A+IKSAIMTTA T
Sbjct  535   TKAQGPTNQDFDTRRVLFNAVSGTSMSCPHVSGIVGLLKTMHPTWSPASIKSAIMTTAMT  594

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIG  545
             ++   E I +A    A PF YGAGHI+P+KA DPGLVYD T  DYL F+C      + I 
Sbjct  595   QDNTMEPILNANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVDDYLNFLCALGYNETQIS  654

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
             T  D  Y+CP K  S +N NYPS+ + +  GS+ + RTV NVGS N TY + ++ PTG S
Sbjct  655   TFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGSPN-TYKLRIRKPTGVS  713

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             V + P +L+F +VGE++  F        K   ++ FG   WSD  H V+SPIVV
Sbjct  714   VYVEPKKLEFKKVGEEK-AFTVTLKGKGKAAKDYVFGELIWSDKKHHVRSPIVV  766



>ref|XP_007049440.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOX93597.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=794

 Score =   452 bits (1162),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 282/598 (47%), Positives = 369/598 (62%), Gaps = 34/598 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  G +N +FD  + RD  GHGTHT ST GG  VA AS LG F
Sbjct  211   HCNRKLIGARYFNKGYASIVGKLNSSFD--TPRDKEGHGTHTLSTAGGNLVAKASVLG-F  267

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  268   GKGTAKGGSPRARVAAYKVCWP----PVSGDECFDADILAAFDVAIHDGVDVLSVSLGGD  323

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA+K  I VV SAGN    Y +VTN+APW  TVGAS++DR F +
Sbjct  324   PTP--FFNDSVAIGSFHAIKHGIVVVCSAGNSGPAYGTVTNIAPWQITVGASTMDREFPS  381

Query  1396  PVLLGNNLLVKGESVT--EIKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGK  1226
              V+LGNN+  KG+S++  ++  ++  PL+  A       S      C+  T+ PEK  GK
Sbjct  382   IVVLGNNMRYKGQSLSANDLPDKKFFPLISAADAKAANASIENALLCQAGTIDPEKASGK  441

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVILGS---IGSEIQVESFLITATNIFNPSGTD  1073
              + CL G   Q   V++      AG   ++L +    G+EI  ++ ++ A++I    G  
Sbjct  442   FLVCLRG---QNARVDKGQQAALAGAVGMVLANNILAGNEIIADAHVLPASHINYTDGL-  497

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+  YI + K P A + P  T  G KP+P MA F+S GP+   P ILKPDITAPG++++A
Sbjct  498   AVFTYINSTKYPTAYITPVTTQIGTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIA  557

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++EA  P  +  D R V++N +SGTSMSCPHVS +V LLK ++PDWS AAIKSAIMT+A
Sbjct  558   AYTEAQGPTNEDFDKRRVQFNCVSGTSMSCPHVSGIVGLLKTLYPDWSPAAIKSAIMTSA  617

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +   E I +A    AGPF YGAGHIQP+ A DPGLVYD    DYL F+C      + 
Sbjct  618   TTWDNMKEPILNASNIKAGPFSYGAGHIQPNLAMDPGLVYDLAATDYLNFLCTLGYNETL  677

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             I       YKCPK  S  +N NYPS+A+  L GS+ V RTV NVGS   TY  +V+ PTG
Sbjct  678   ISMFSQNPYKCPKPISL-ANFNYPSIAVPNLVGSITVTRTVKNVGSPG-TYRAQVQRPTG  735

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              SV++ P +LKF +VGE+++F V++ V     V E+ FG   WSD +H V SPIVV +
Sbjct  736   ISVQVKPKKLKFKKVGEEKTFSVTLNVMKAHPVKEYVFGQLIWSDHVHHVSSPIVVKA  793



>ref|XP_007132414.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
 gb|ESW04408.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
Length=760

 Score =   451 bits (1159),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 262/598 (44%), Positives = 358/598 (60%), Gaps = 35/598 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVN---HTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG+EA  GP++       FRS+RD  GHGTHTAST+ G  VAN
Sbjct  172   FTLANCNKKIIGARFYSKGFEAENGPLDGFGSKIFFRSARDSDGHGTHTASTIAGSTVAN  231

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS L G A G A GGAP  RL+IYKACW          FC D D+L+A D A+ DGV ++
Sbjct  232   AS-LFGIAKGTARGGAPSARLSIYKACW--------FGFCSDADILSAVDDAIHDGVDIL  282

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + +D V+LG  HA ++ I V  SAGN   P +  NVAPWI TV ASSI
Sbjct  283   SLSLGPNPPQPIYFEDAVSLGTFHAFQKGILVSASAGNSVFPRTACNVAPWILTVAASSI  342

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  IK + +  L+Y       G   I   FC+ +TL+P  
Sbjct  343   DREFSSNIYLGNSKVLKGSSLNPIKMKHSHGLIYGSAAAAAGVPAINASFCKNNTLNPTL  402

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C     S     + +++ + GG  +IL    ++     F+I +T I    G D
Sbjct  403   IKGKIVICTIENFSDDRQEKAIQIRQGGGVGMILIDHNAKDIGFQFVIPSTLI----GQD  458

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             A+ +   Y+ T+KNP A +IP  T+ G KP+P MA F+S+GP+   P+I+KPDIT PG+N
Sbjct  459   AVEELQAYVKTDKNPTARIIPTVTVVGTKPAPEMAAFSSIGPNIITPDIIKPDITGPGVN  518

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS   +  +   + R V YNIISGTSMSCPH++AV A++K+ HP W  AAI S+IM
Sbjct  519   ILAAWSPVGT--DATVEQRPVNYNIISGTSMSCPHITAVAAIIKSHHPSWGPAAIMSSIM  576

Query  721   TTAT-TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTAT T N      +D  G    PF YG+GH+ P  + +PGLVY+    D L F+CS+  
Sbjct  577   TTATVTDNTHHLIRRDPNGTQTTPFDYGSGHVNPVASLNPGLVYEFHSQDVLNFLCSNGA  636

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  ++ +N NYPS+ ++ L GS+ V RTVT  G   T YS  ++
Sbjct  637   SPAQLKNLTGDLTQCHKPLTASNNFNYPSIGVSNLNGSLSVYRTVTYYGQEPTVYSASIE  696

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              P+G  V ++P ELKF + GEK   F        +  G F FG   W++G H V+SPI
Sbjct  697   NPSGVKVTVTPAELKFGKPGEK-ITFRIDFFPFKQSNGNFVFGSLIWNNGKHRVRSPI  753



>ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   451 bits (1159),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 267/595 (45%), Positives = 363/595 (61%), Gaps = 35/595 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGG  1757
              CNRK+IGARY  KGY+A  G  +N +FD  ++RD +GHGTHT +T GGR V+ A+ LG 
Sbjct  186   RCNRKLIGARYFNKGYQAATGIRLNSSFD--TARDTNGHGTHTLATAGGRFVSGANFLGS  243

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
              ANG A GG+P  R+  YK CW           C D D+LAAFD A+ DGV ++S+SLG 
Sbjct  244   -ANGTAKGGSPNARVVSYKVCWPS---------CSDADILAAFDAAIHDGVDILSISLGS  293

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
              P+  ++   G+++G+ HA++  I VV SAGN      S +N APWI TV AS+IDR F+
Sbjct  294   RPR--HYYNHGISIGSFHAVRNGILVVCSAGNSGPTASSASNGAPWILTVAASTIDRNFT  351

Query  1399  APVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKG  1229
             +  +LGN  ++KG S     +  ++  PLVY+ D +    T     FC   +L P K+KG
Sbjct  352   SNAILGNKKILKGLSFNTNTLPAKKYYPLVYSLDAKAANDTFDEAQFCTPGSLEPSKIKG  411

Query  1228  KVVFCLTGGLSQTLE----VERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILK  1061
             K+V+C++G  +Q +E    V +AGG  +IL S  +      FL   T++ +     ++L 
Sbjct  412   KIVYCVSG-FNQDVEKSWVVAQAGGVGMILSSFHTSTPEAHFL--PTSVVSEHDGSSVLA  468

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI + K PVA  I G T FG   +P MA F+S GP+   P ILKPDITAPG++ILAA +E
Sbjct  469   YINSTKLPVA-YISGATEFGKTVAPVMALFSSPGPNAITPEILKPDITAPGVDILAANTE  527

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P     DHR + + I+SGTSMSCPHVS + ALLK++ PDWS AAI+SAIMTTA TK+
Sbjct  528   AKGPTSVRMDHRHLPFTILSGTSMSCPHVSGIAALLKSLRPDWSPAAIRSAIMTTARTKS  587

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTT  539
               G +I +   E A PF YG+GHI+PS   DPGLVYD +  DYL F+CS       +   
Sbjct  588   NTGGSILNENLEEATPFDYGSGHIRPSHIVDPGLVYDLSSKDYLNFLCSIGYNNTQMSNF  647

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             +D SY CP    S  + NYPS+ +  LKG++ + RT+ NVG+    Y+V ++AP G S+K
Sbjct  648   VDKSYNCPSAKISLLDFNYPSITVPNLKGNVTLTRTLKNVGTPG-IYTVRIRAPKGISIK  706

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             I P  LKF +V E++  F         +   + FG   WSDG+H V+SPIVV  A
Sbjct  707   IDPMSLKFNKVNEER-SFKVTLKAKKNQSQGYVFGKLVWSDGMHNVRSPIVVKKA  760



>ref|XP_011044970.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=727

 Score =   449 bits (1155),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 262/600 (44%), Positives = 349/600 (58%), Gaps = 35/600 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH---TFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FTS++CNRK++GAR++ KG+EA  GP+      F FRS+RD  GHG+HTAS + G  V+N
Sbjct  141   FTSANCNRKVVGARFYFKGFEAENGPLEDFGGAF-FRSARDSDGHGSHTASAIAGAVVSN  199

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
              S L G A G A GGAP  RLAIYK CW           C D D+L+A D A+ DGV ++
Sbjct  200   VS-LFGMARGTARGGAPHARLAIYKVCW--------FNLCNDADILSAMDDAINDGVDIL  250

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+S G  P +  + +   ++GA HA ++ I V  SAGN   P +  NVAPWI TV ASS+
Sbjct  251   SLSFGANPPEPIYFESATSVGAFHAFRKGIVVSSSAGNSFSPKTAANVAPWILTVAASSL  310

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPEK  1238
             DR F + + LGN  +VKG S+  +K + +  L+   D  +PG T     FC+ +TL P K
Sbjct  311   DREFDSNIYLGNLQIVKGFSLNPLKMETSYGLIAGSDAAVPGVTAKNASFCKDNTLDPAK  370

Query  1237  VKGKVVFCLTGGL-----SQTLEVERAGGAAVIL-GSIGSEIQVESFLITATNIFNPSGT  1076
             +KGK+V C+T  L      + + VE  GG  +IL   I  EI  +S  +  + +      
Sbjct  371   IKGKIVLCITEVLIDDPRKKAVAVELGGGVGMILIDPIVKEIGFQS--VIPSTLIGQEEA  428

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               +  Y+   KNP A + P  T+   KP+P +  F+S GP+   P+I+KPDITAPGLNIL
Sbjct  429   HQLQAYMQAQKNPTARIAPTVTVLNTKPAPKVTVFSSQGPNIITPDIIKPDITAPGLNIL  488

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWS  S+        RSV YNIISGTSMSCPHVSAV A+LK+  P WS AAIKSAIMTT
Sbjct  489   AAWSPVST---DDTAGRSVNYNIISGTSMSCPHVSAVAAILKSYRPSWSPAAIKSAIMTT  545

Query  715   ATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT-  542
             A   +   + I +D     A PF YG+GHI P  A +PGLVYD    D + F+CS+  + 
Sbjct  546   AIVMDNTRKLIGRDPDDTQATPFDYGSGHINPLAALNPGLVYDFDSDDVINFLCSTGASP  605

Query  541   ------TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKA  380
                   T  P+Y CPK+   P + NYPS+ ++ + GS+ V RTVT  G   T Y  +V  
Sbjct  606   AQLKNLTGQPTY-CPKQTKPPYDFNYPSIGVSNMNGSISVYRTVTYYGKGRTAYVAKVDY  664

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
             P+G  V ++P  LKF +  EK   F           G F FG   WS+GIH V+SPI ++
Sbjct  665   PSGVQVTVTPATLKFTKTAEK-LSFKIDFKPLKTSDGNFVFGALTWSNGIHKVRSPIALN  723



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   449 bits (1156),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 279/606 (46%), Positives = 376/606 (62%), Gaps = 45/606 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+SHCNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  173   FTASHCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  232

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FA+G A G +P  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  233   LG-FASGTARGMSPRARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  283

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    + Y  +DGVA+GA  AM+R I V  SAGN     +S++NVAPWI TVGA ++DR
Sbjct  284   LGGGTSEYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDR  341

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  342   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  394

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  395   PEKVKGKIVMCDRGVNARVQKGDVVKEAGGVGMILANTAANGEELVADAHLLPATTVGEK  454

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ +P AT+    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  455   AG-DLIRHYVTTDPHPTATISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  513

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLKA+HP+WS AAI+SA+
Sbjct  514   NILAAWTRAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSAL  573

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C   
Sbjct  574   MTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALN  633

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                S I +    +Y C P K+ S ++LNYPS A+  +  G+    RTVT+VG A  TYSV
Sbjct  634   YTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVEEAGAYKYTRTVTSVGGAG-TYSV  692

Query  391   EVKAPTGYSVKIS--PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVK  218
             ++ + T  +VKIS  P  L F    EKQS+ V+  V+S K  G   FG  +WSDG H+V 
Sbjct  693   KLTSET-TAVKISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIEWSDGKHVVG  751

Query  217   SPIVVS  200
             SP+ +S
Sbjct  752   SPVAIS  757



>ref|XP_006469397.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
Length=773

 Score =   449 bits (1156),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 266/597 (45%), Positives = 356/597 (60%), Gaps = 30/597 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  GP+N +FD  + RD  GHGTHT ST GG  VA AS  G   
Sbjct  189   CNRKLIGARYFNKGYAAAVGPLNSSFD--TPRDKDGHGTHTLSTAGGNFVAKASVFG-LG  245

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  P
Sbjct  246   KGTAKGGSPKARVAAYKVCWP----PVTGNECYDADILAAFDMAIHDGVDVLSVSLGGGP  301

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSAP  1394
                 F  D  A+G+ HA+K  + V+ SAGN     S V+N+APW  TVGAS++DR F + 
Sbjct  302   SK--FFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQITVGASTMDRDFPSY  359

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGKV  1223
             V++ NN   KG+S++   + + +  PL+  A       ST +   C   TL P+KVKGK+
Sbjct  360   VVVSNNKRYKGQSLSSKGLPRNKLFPLISAADAKAANASTEVALLCEAGTLDPKKVKGKI  419

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G    + +  +   AG   ++L +    G+E+  +  L+ A+++    G D + +
Sbjct  420   LVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELLADPHLLPASHVNYTDGAD-LFR  478

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             Y+ + K PV  L    T  G KP+P MA F+S GPS   P ILKPDITAPG+ I+AA++E
Sbjct  479   YVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSIAPEILKPDITAPGVTIIAAYTE  538

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A+ P  +  D R + +N +SGTSMSCPHVS +V LLK +HP+WS AAIKSAIMTTA+ ++
Sbjct  539   AAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQD  598

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
                  I +A    A PF YGAGHIQP+ A DPGLVYD T  DYL F+C      + I   
Sbjct  599   NNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDLTENDYLNFLCALGYNKTQIALF  658

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D +Y+CP+  S+ +N NYPS+ + +L GS++V RTV NVGS   TY   V+ P G SV 
Sbjct  659   SDKTYRCPEYVST-ANFNYPSITVPKLSGSIIVSRTVRNVGSPG-TYIARVRNPKGISVS  716

Query  358   ISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDG-IHMVKSPIVVSSA  194
             + P  LKF+ VG EK         +      ++ FG   W+D   H V+SPIVV+ A
Sbjct  717   VEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGDLVWADDKQHQVRSPIVVNPA  773



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   449 bits (1155),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 263/602 (44%), Positives = 370/602 (61%), Gaps = 42/602 (7%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFG--PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             S HCNRK+IGAR++   ++A     PV +     S RD  GHGTHT ST  G  V  A+ 
Sbjct  185   SFHCNRKLIGARFYDLSHQANSASPPVEY-----SPRDSEGHGTHTLSTAAGGIVRGANI  239

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
              G  ANG A GG+P  R+A YK CW +         C D ++LAAFD A+ DGV VIS+S
Sbjct  240   YGE-ANGTARGGSPHARVAAYKVCWGL---------CADANILAAFDDAIHDGVDVISLS  289

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             +G LP +  F  D +ALG+ HA++R I VV SAGN    P +V+N+APWIFTVGAS+IDR
Sbjct  290   VGGLPYEYIF--DSIALGSFHAVQRGITVVCSAGNDGPTPGTVSNIAPWIFTVGASTIDR  347

Query  1408  VFSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIP-GFCRQDTLSPEK  1238
              F + V LG+N  +KG S++   +   +  PL+   + + P S+    G+C   TL PEK
Sbjct  348   EFYSLVTLGSNKKIKGVSLSSKSLPAHKPYPLIDGSNAKRPNSSAEEAGWCYPGTLDPEK  407

Query  1237  VKGKVVFCLT----GGLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSG  1079
             V+GK+V C        + + ++V +AGGA +IL +    G+ +  +   + A+ I   + 
Sbjct  408   VRGKIVVCTRDTSFARVEKGVDVLKAGGAGMILANSDEEGNSLLADPHFLPASMI---TY  464

Query  1078  TDAIL--KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
              DA+    Y+ + K+P AT+ P  T+ G KP+PAMA F+S GP+   P ILKPDITAPG+
Sbjct  465   KDALRLSSYLKSTKSPTATISPVTTVLGVKPAPAMASFSSRGPNLINPEILKPDITAPGV  524

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             +ILAA++E   P     D R V++N++SGTSMSCPH+S V  LLK +HP WS A I+SA+
Sbjct  525   DILAAFTEEVGPTMLDLDKRRVRFNVMSGTSMSCPHISGVAGLLKKLHPRWSPAVIRSAV  584

Query  724   MTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC----  557
             MTTA T++     +KD   E A PF YGAGH++P++A DPGLVYD T+ DY+ F+C    
Sbjct  585   MTTARTRDNTRTPMKDDNREKAIPFDYGAGHVRPNRAMDPGLVYDITFTDYVHFLCSRGY  644

Query  556   --SSIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
               S++   +   + CP K     +LNYPS+ +  L+ S  V RTV NVG+   TY+V +K
Sbjct  645   NASNMAQFIGKRFACPSKTMRAEDLNYPSITVPNLQKSFTVSRTVRNVGTPG-TYNVRIK  703

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             AP G  V + P  L+F +VGE+++F V ++  S      + FG   W+DG H V+SP+VV
Sbjct  704   APFGIHVSVKPQTLEFAKVGEEKTFQVRLRSRSESVGVGYVFGGLTWTDGKHYVRSPLVV  763

Query  202   SS  197
             ++
Sbjct  764   NA  765



>ref|XP_002320540.2| subtilisin-like protease family protein [Populus trichocarpa]
 gb|EEE98855.2| subtilisin-like protease family protein [Populus trichocarpa]
Length=769

 Score =   449 bits (1155),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 270/594 (45%), Positives = 364/594 (61%), Gaps = 30/594 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  G +N +FD  + RD  GHG+HT ST GG  VA AS     
Sbjct  186   HCNRKLIGARYFNKGYASIVGHLNSSFD--TPRDEDGHGSHTLSTAGGNFVAGASVFY-M  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK C+  P D  +   C D D+LAAFD A++DGV V+SVSLG  
Sbjct  243   GNGTAKGGSPKARVAAYKVCYP-PVDGDE---CFDADILAAFDAAISDGVDVLSVSLGGN  298

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY--SVTNVAPWIFTVGASSIDRVFS  1400
             P    F  D VA+G+ HA+K  I V+ SAGN   P   +V+NVAPW  TVGAS++DR F 
Sbjct  299   P--TAFFNDSVAIGSFHAVKHGIVVICSAGN-SGPVDGTVSNVAPWEITVGASTMDREFP  355

Query  1399  APVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKG  1229
             + V+LGN +  KGES++   + K +  PL+ A D     ++      C+  +L PEK KG
Sbjct  356   SYVVLGNKISFKGESLSAKALPKNKFFPLMSAADARATNASIENALLCKDGSLDPEKAKG  415

Query  1228  KVVFCLTG---GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAI  1067
             K++ CL G    + +  +   AG   ++L +    G+EI  +  ++  ++I   SG  AI
Sbjct  416   KILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPHVLPVSHINYTSGV-AI  474

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
              KYI + + PVA +    T  G KP+P +A F+S GP+   P ILKPDITAPG++++AA+
Sbjct  475   FKYINSTEYPVAYITHPVTRIGTKPAPVVAAFSSKGPNTVTPEILKPDITAPGVSVIAAY  534

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             ++A  P  Q  D R V +N +SGTSMSCPHVS +V LLK +HP WS A+IKSAIMTTA T
Sbjct  535   TKAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPTWSPASIKSAIMTTAMT  594

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIG  545
             ++   E I +A    A PF YGAGHI+P+KA DPGLVYD T  DYL  +C      + I 
Sbjct  595   QDNTMEPILNANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVNDYLNLLCALGYNETQIS  654

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
             T  D  Y+CP K  S +N NYPS+ + +  GS+ + RTV NVGS  +TY + ++ PTG S
Sbjct  655   TFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGSP-STYKLRIRKPTGVS  713

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             V + P +L+F +VGE++  F        K   ++ FG   WSD  H V+SPIVV
Sbjct  714   VSVEPKKLEFKKVGEEK-AFTVTLKGKGKAAKDYVFGELIWSDNKHHVRSPIVV  766



>ref|XP_009361505.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=777

 Score =   449 bits (1154),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 272/598 (45%), Positives = 372/598 (62%), Gaps = 29/598 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KG+ A  GP+N +F+  S RD  GHG+HT ST GG  V  AS  G F
Sbjct  191   HCNRKLIGARYFNKGFAAVAGPLNSSFN--SPRDNDGHGSHTLSTAGGNFVTGASVFG-F  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P +R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  248   GNGTAKGGSPKSRVAAYKVCWP----PMGGGGCFDADILAAFDVAIDDGVDVLSVSLGGN  303

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D V++GA HA+KR I VV SAGN      +V+N++PW  TVGAS++DR F +
Sbjct  304   PTT--FFNDSVSIGAFHAVKRGIVVVCSAGNSGPAEGTVSNISPWQITVGASTMDREFPS  361

Query  1396  PVLLGNNLLVKGESVTEI----KKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVK  1232
              V LGN    KG+S++ +    KK++   L+ A D +   ++      C+ +TL P+KVK
Sbjct  362   YVTLGNWKHFKGQSLSAVALRSKKKKFYQLISAADAKAANASAQEALLCKPNTLDPKKVK  421

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G   +IL +    G+EI  +  ++ A++I N +  + 
Sbjct  422   GKILACLRGDNARVDKGEQAFLAGAVGMILANNELTGNEIIADPHVLPASHI-NFTDGNL  480

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K+P A +    T  G KPSP MA F+S GP+   P ILKPDITAPG++++AA
Sbjct  481   VFAYIYSTKSPRAYIKRAITELGTKPSPFMAAFSSKGPNAITPGILKPDITAPGVSVIAA  540

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D R + +N +SGTSMSCPH+S +  LLK ++P WS AAIKSAIMTTA 
Sbjct  541   YTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHWSPAAIKSAIMTTAV  600

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T++   E + +A    A PF YGAGH+ P+ A DPGLVYD +  DYL F+C      + I
Sbjct  601   TQDNSMEPLLNASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFLCAIGYNETQI  660

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 +  YKC K A S +NLNYPS+ + ++ GS+ V RTV NVGS   TY   ++ P G 
Sbjct  661   EMFSEEMYKCSKPAISLTNLNYPSITVPKISGSLEVTRTVKNVGSPG-TYKARIQNPDGI  719

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SV + P ELKF ++GE++SF V ++V   K+   + FG   WSDG H V+SPIVV +A
Sbjct  720   SVSVEPKELKFKKIGEEKSFKVLLQVREAKQDKNYVFGKLIWSDGKHYVRSPIVVKAA  777



>ref|XP_010647520.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=698

 Score =   446 bits (1147),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 269/597 (45%), Positives = 363/597 (61%), Gaps = 35/597 (6%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGYEA  G + ++  ++++RD  GHGTHT ST GG  V  A+ LG   
Sbjct  113   CNRKLIGARYFNKGYEAALGRLLNS-SYQTARDTYGHGTHTLSTAGGGFVGEANLLGS-G  170

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CWQ          C   D+LAAFD A+ DGV ++S+SLG  P
Sbjct  171   YGTAKGGSPKARVASYKVCWQ---------GCYGADILAAFDAAIHDGVDILSISLGGPP  221

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
             +D +   D + +G+  A+K  I VV SAGN    P SVTN+APWI TV AS+IDR F + 
Sbjct  222   RDYFL--DSITIGSFQAVKNGIVVVCSAGNSGPTPGSVTNLAPWILTVAASTIDREFPSN  279

Query  1393  VLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKV  1223
             V+LGNN   KG S     +  ++  PLVY+ D     ++      C   +L P+KVKGK+
Sbjct  280   VMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARAANASARDAQICSVGSLDPKKVKGKI  339

Query  1222  VFCLTG-------GLSQTLEVERAGGAAVILGS-IGSEIQVESFLITATNIFNPSGTDAI  1067
             V+CL          + ++  V +AGG  +IL + + +   +       T+  + +   AI
Sbjct  340   VYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTTTLIPQAHFVPTSRVSAADGLAI  399

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
             L YI T K PVA  I G T  G   +P MA F+S GP+   P ILKPDITAPG+ I+AA+
Sbjct  400   LLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAAY  458

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             +EA  P     D R V +NI+SGTSMSCPHVS  V LLK IHP+WS +AI+SAIMT ATT
Sbjct  459   TEARGPTFLQSDDRRVLFNIVSGTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTLATT  518

Query  706   K-NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SI  548
             + N++     D   E   PF+YGAGH+ P++A DPGLVYD T  DYL F+CS       +
Sbjct  519   RSNLRQPIANDTLAE-GNPFNYGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNATQL  577

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
              T +D  Y+CP K + P +LNYPS+ +  L G + V RT+ NVG+  +TY+V +KAP+G 
Sbjct  578   STFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-STYTVRIKAPSGI  636

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             SVK+ P  L+F +  E++ F V+++ +     GE+ FG   WSDG H V SPIVV++
Sbjct  637   SVKVEPKRLRFEKKNEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  693



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   448 bits (1152),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 278/607 (46%), Positives = 374/607 (62%), Gaps = 44/607 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYEA  GP++ + + RS RD  GHGTHT+ST  G  V  A+ 
Sbjct  172   FTASLCNRKLIGARFFARGYEAEKGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGANF  231

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FANG A G AP  RLA+YK CW+          C D DVLAA D A+ D V V+S+S
Sbjct  232   LG-FANGTARGMAPGARLAVYKVCWK--------GGCFDSDVLAAIDKAIDDNVNVLSIS  282

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDR  1409
             +  L  D Y  ++ +A+GA  AM+R I V  SAGN     S ++NVAPWI TVGA +IDR
Sbjct  283   MDDLTLDYY--RNDIAIGAFAAMERGILVSCSAGNSGPRSSDISNVAPWITTVGAGTIDR  340

Query  1408  VFSAPVLLGNN------LLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A V+LGN        L+KG+++ E+     LP VYAG+     + T   FC   TL 
Sbjct  341   DFPALVILGNGNNYSGVSLIKGDALPEL-----LPFVYAGNAS---NATNGNFCVSGTLI  392

Query  1246  PEKVKGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G    + +   V+  GG  +IL +    G E+  ++ L+ AT +   
Sbjct  393   PEKVKGKIVMCDRGVNFRVEKGEVVKAVGGLGMILANTAENGEELVADAHLLPATAVGEK  452

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G + I  Y++T+ NP A+++   T+   +PSP +A F+  GP+   PNILKPD+ APG+
Sbjct  453   AG-EIIRHYVITHPNPTASILTQGTVVNVQPSPVVAAFSLRGPNPTTPNILKPDLIAPGV  511

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A  P E   D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+
Sbjct  512   NILAAWTGAKGPTELASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSAL  571

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA +    G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD   +DYL F+C   
Sbjct  572   MTTAYSTYKDGKPLIDIATGKPSTPFDHGAGHVSPTMAVNPGLIYDILTVDYLDFLCALN  631

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                S I      +Y C P K  S  NLNYPS A+  Q  G+    RTVTNVG A  +YSV
Sbjct  632   YTSSQIMKVSRRNYTCDPSKTYSVGNLNYPSFALNVQGSGAYTYTRTVTNVGEAG-SYSV  690

Query  391   EVKAPTG-YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             +V + T   ++ + P  L F EV EK+S+ V+  V+S K  G   FG  +WSDGIH+V S
Sbjct  691   KVTSETTIVNISVVPAVLNFKEVNEKKSYSVTFNVDSSKASGSNSFGSIQWSDGIHVVGS  750

Query  214   PIVVSSA  194
             P+ +S A
Sbjct  751   PVAISWA  757



>ref|XP_006447869.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
 gb|ESR61109.1| hypothetical protein CICLE_v10014351mg [Citrus clementina]
Length=773

 Score =   448 bits (1153),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 266/597 (45%), Positives = 355/597 (59%), Gaps = 30/597 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  GP+N +FD  + RD  GHGTHT ST GG  VA AS  G   
Sbjct  189   CNRKLIGARYFNKGYAAAVGPLNSSFD--TPRDKDGHGTHTLSTAGGNFVAKASVFG-LG  245

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  P
Sbjct  246   KGTAKGGSPKARVAAYKVCWP----PVTGNECYDADILAAFDMAIHDGVDVLSVSLGGGP  301

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSAP  1394
                 F  D  A+G+ HA+K  + V+ SAGN     S V+N+APW  TVGAS++DR F + 
Sbjct  302   SK--FFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQITVGASTMDRDFPSY  359

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGKV  1223
             V++ NN   KG+S++   + + +  PL+  A       ST +   C   TL P+KVKGK+
Sbjct  360   VVVSNNKRYKGQSLSSKGLPRNKLFPLISAADAKAANASTEVALLCEAGTLDPKKVKGKI  419

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G    + +  +   AG   ++L +    G+E+  +  L+ A+++    G D + +
Sbjct  420   LVCLRGDNARIDKGQQALLAGAVGMVLANALENGNELLADPHLLPASHVNYTDGAD-LFR  478

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             Y+ + K PV  L    T  G KP+P MA F+S GPS   P ILKPDITAPG+ I+AA++E
Sbjct  479   YVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSIAPEILKPDITAPGVTIIAAYTE  538

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P  +  D R + +N +SGTSMSCPHVS +V LLK +HP+WS AAIKSAIMTTA+ ++
Sbjct  539   AVGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQD  598

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
                  I +A    A PF YGAGHIQP+ A DPGLVYD T  DYL F+C      + I   
Sbjct  599   NNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDLTENDYLNFLCALGYNKTQIALF  658

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D +Y+CP+  S+ +N NYPS+ + +L GS++V RTV NVGS   TY   V+ P G SV 
Sbjct  659   SDKTYRCPEYVST-ANFNYPSITVPKLSGSIIVSRTVRNVGSPG-TYIARVRNPKGISVS  716

Query  358   ISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDG-IHMVKSPIVVSSA  194
             + P  LKF+ VG EK         +      ++ FG   W+D   H V+SPIVV+ A
Sbjct  717   VEPRSLKFLRVGEEKNFKVTIKFRKVRAATKDYVFGDLVWADDKQHQVRSPIVVNPA  773



>ref|XP_008342263.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=777

 Score =   448 bits (1152),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 271/598 (45%), Positives = 372/598 (62%), Gaps = 29/598 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KG+ A  GP+N +FD  S RD  GHG+HT ST GG  V  ASA G F
Sbjct  191   HCNRKLIGARYFNKGFAAVAGPLNSSFD--SPRDNEGHGSHTLSTAGGNFVTGASAFG-F  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      ++   C D D+LAAFD A+ DGV V+S+SLG  
Sbjct  248   GNGTAKGGSPKARVAAYKVCWP----PMEGGECFDADILAAFDVAIDDGVDVLSISLGGD  303

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D V++GA HA+KR I VV SAGN      +V+N++PW  TVGAS++DR F +
Sbjct  304   PTT--FFNDSVSIGAFHAVKRGIVVVCSAGNSGPAEGTVSNISPWQITVGASTMDREFPS  361

Query  1396  PVLLGNNLLVKGESVTEI----KKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVK  1232
              V LGN    KG+S++ +    KK++   L+ A D +   ++      C+ +TL P+KVK
Sbjct  362   YVTLGNWKHFKGQSLSTVALRSKKKKFYQLISAADAKAANASAQEALLCKPNTLDPKKVK  421

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G   +IL +    G+EI  +  ++ A++I N +  + 
Sbjct  422   GKILACLRGDNARVDKGEQALLAGAVGMILANNELTGNEIIADPHVLPASHI-NFTDGNL  480

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K+P A +    T  G KPSP MA F+S GP+   P ILKPDITAPG++++AA
Sbjct  481   VFTYINSTKSPRAYIKRAITELGTKPSPFMAAFSSRGPNTITPGILKPDITAPGVSVIAA  540

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D R + +N +SGTSMSCPH+S +  LLK ++P WS AAIKSAIMTTA 
Sbjct  541   YTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHWSPAAIKSAIMTTAV  600

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T++   E + +A    A PF YGAGH+ P+ A DPGLVYD +  DYL F+C      + I
Sbjct  601   TRDNSMEPLLNASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFLCAIGYNETQI  660

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 +  Y C K A S ++LNYPS+ + ++ GS+ V RTV NVGS   TY   ++ P G 
Sbjct  661   EMFSEEMYMCSKPAISLTSLNYPSITVPKISGSLEVTRTVKNVGSPG-TYKARIQNPBGI  719

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             SV + P ELKF ++GE++SF V ++V   K+   + FG   WSDG H V+SPIVV +A
Sbjct  720   SVSVEPKELKFKKIGEEKSFKVLLQVXEAKQDKNYVFGKLIWSDGKHYVRSPIVVKAA  777



>ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   447 bits (1149),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 268/597 (45%), Positives = 369/597 (62%), Gaps = 39/597 (7%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  KG+EA  G  +N TF+  ++RD  GHGTHT +T GGR V+ A+ LG  
Sbjct  165   CNRKLIGARYFNKGFEAATGISLNSTFN--TARDKDGHGTHTLATAGGRFVSGANFLGS-  221

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
             ANG   GG+P  R+A YK CW           C D D+LAAFD A+ DGV ++S+SLG  
Sbjct  222   ANGTVKGGSPNARVAAYKVCWPS---------CFDADILAAFDAAIHDGVDILSISLGSR  272

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSIDRVFSAP  1394
             P+  Y    G+++G+ HA++  I VV SAGN     + +NVAPWI TV AS+IDR F + 
Sbjct  273   PRHYY--NHGISIGSFHAVRNGILVVCSAGNSGPIITASNVAPWILTVAASTIDRSFPSD  330

Query  1393  VLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGKV  1223
             V LG+  + KG S     +  ++  PL+Y+G+ +    S +   FC   +L P K+KGK+
Sbjct  331   VTLGSRKIYKGLSYNTNSLPAKKYYPLIYSGNAKAANASVSHARFCVPGSLEPTKMKGKI  390

Query  1222  VFCLTG---GLSQTLEVERAGGAAVILGSIGSEIQVESFLITA----TNIFNPSGTDAIL  1064
             V+C  G    L ++  V +AGG  +IL +   +   E+    A    T++ +     +IL
Sbjct  391   VYCERGLIPDLQKSWVVAQAGGVGMILAN---QFPTENISPQAHFLPTSVVSADDGLSIL  447

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+PV   I G T  G   +P MA F++ GP+     ILKPDITAPG+NILAA++
Sbjct  448   AYIYSTKSPVG-YISGGTEVGEVAAPIMASFSAPGPNAINSEILKPDITAPGVNILAAYT  506

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EAS P   P D+R + +NIISGTSMSCPHVS +  LLK++HPDWS AAIKSAIMTTA T+
Sbjct  507   EASGPSSLPVDNRHLPFNIISGTSMSCPHVSGIAGLLKSVHPDWSPAAIKSAIMTTARTR  566

Query  703   -NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIG  545
              N++     D+  ++A PF+YG+GHI PS+A DPGLVYD +Y DYL F+CS       + 
Sbjct  567   SNIRLPIFTDSL-DLASPFNYGSGHIWPSRAMDPGLVYDLSYKDYLNFLCSIGYNKTQMS  625

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               +D S+ C    +S  N NYPS+ +  L G++ V RT+ NVG+    Y+V V AP G S
Sbjct  626   AFVDRSFNCRSNKTSVLNFNYPSITVPHLLGNVTVTRTLKNVGTPG-VYTVRVDAPEGIS  684

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             VK+ P  LKF +V EK+SF V+++ + ++       G   WSDG+H V+SP+VV  A
Sbjct  685   VKVEPMSLKFNKVNEKKSFRVTLEAKIIESGFYAFGGLV-WSDGVHNVRSPLVVKQA  740



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   447 bits (1149),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 276/605 (46%), Positives = 373/605 (62%), Gaps = 43/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  167   FTASLCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  226

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G AP  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  227   LG-YASGTARGMAPRARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  277

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN     YS++NVAPWI TVGA ++DR
Sbjct  278   LGGGMSDYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDR  335

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  336   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  388

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  389   PEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEK  448

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ NP A++    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  449   AG-DIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  507

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+
Sbjct  508   NILAAWTTAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSAL  567

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD +  DYL F+C   
Sbjct  568   MTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLSTEDYLGFLCALN  627

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                S I +    +Y C P K+ S ++LNYPS A+     G+    RTVT+VG A  TYSV
Sbjct  628   YTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVDGAGAYKYTRTVTSVGGAG-TYSV  686

Query  391   EVKAPT-GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             +V + T G  + + P  L F E  EK+S+ V+  V+S K  G   FG  +WSDG H+V S
Sbjct  687   KVTSETRGAKISVEPAVLNFKEANEKKSYTVTFTVDSSKASGSNSFGSIEWSDGKHVVGS  746

Query  214   PIVVS  200
             P+ +S
Sbjct  747   PVAIS  751



>ref|XP_003524185.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   447 bits (1150),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 273/595 (46%), Positives = 364/595 (61%), Gaps = 29/595 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  GP+N +FD  S RD  GHGTHT ST GG  VA  S  G  
Sbjct  187   HCNRKLIGARYFNKGYASVAGPLNSSFD--SPRDNEGHGTHTLSTAGGNMVARVSVFGQ-  243

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              +G A GG+P+ R+A YK CW      +    C D D+LAAFD A+ DGV V+S+SLG  
Sbjct  244   GHGTAKGGSPMARVAAYKVCWP----PVAGDECFDADILAAFDLAIHDGVDVLSLSLG--  297

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVT--NVAPWIFTVGASSIDRVFS  1400
                + F +D VA+G+ HA K  I VV SAGN   P   T  N+APW  TV AS++DR F 
Sbjct  298   GSASTFFKDSVAIGSFHAAKHGIVVVCSAGN-SGPADATAENLAPWHVTVAASTMDRQFP  356

Query  1399  APVLLGNNLLVKGESVTE-IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
               V LGNN+  KGES++  I   +  P++ A D ++  +       C+  TL P KVKGK
Sbjct  357   TYVFLGNNITFKGESLSATILAPKFYPIIKATDAKLASARAEDAVLCQNGTLDPNKVKGK  416

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             +V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I N +   A+ 
Sbjct  417   IVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPHVLPASHI-NFTDGSAVF  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K PVA +   KT    KP+P MA F+S GP+   P ILKPDITAPG++++AA++
Sbjct  476   TYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTIVPEILKPDITAPGVSVIAAYT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R + +N +SGTSMSCPHVS +V LL+A++P WS AAIKSAIMTTATT 
Sbjct  536   EAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTWSPAAIKSAIMTTATTL  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             + + E + +A    A PF YGAGH+QP++A DPGLVYD+T  DYL F+C      + I  
Sbjct  596   DNEVEPLLNATDGKATPFSYGAGHVQPNRAMDPGLVYDTTIDDYLNFLCALGYNATQISV  655

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  Y+C KK S   NLNYPS+ + +L GS+ V R + NVGS   TY   V+ P G ++
Sbjct  656   FTEGPYQCRKKFSL-LNLNYPSITVPKLSGSVTVTRRLKNVGSPG-TYIAHVQNPHGITI  713

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              + P+ LKF  VGE++SF V+ K    K    + FG   WSDG H V SPIVV +
Sbjct  714   SVKPSILKFKNVGEEKSFKVTFKAMQGKATNNYVFGKLIWSDGKHYVTSPIVVKA  768



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   447 bits (1149),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 279/606 (46%), Positives = 376/606 (62%), Gaps = 45/606 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+SHCNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  173   FTASHCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  232

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G AP  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  233   LG-YASGTARGMAPRARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  283

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    + Y  +DGVA+GA  AM+R I V  SAGN     +S++NVAPWI TVGA ++DR
Sbjct  284   LGGGTSEYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDR  341

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  342   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  394

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  395   PEKVKGKIVLCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEK  454

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ +P AT+    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  455   AG-DLIRHYVTTDPHPTATVSILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  513

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLKA+HP+WS AAI+SA+
Sbjct  514   NILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSAL  573

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C   
Sbjct  574   MTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALN  633

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                S I +    +Y C P K+ S ++LNYPS A+  +  G+    RTVT+VG A  TYSV
Sbjct  634   YTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVEEAGAYKYTRTVTSVGGAG-TYSV  692

Query  391   EVKAPTGYSVKIS--PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVK  218
             ++ + T  +VKIS  P  L F    EKQS+ V+  V+S K  G   FG  +WSDG H+V 
Sbjct  693   KLTSET-TAVKISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIEWSDGKHVVG  751

Query  217   SPIVVS  200
             SP+ +S
Sbjct  752   SPVAIS  757



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   446 bits (1148),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 280/602 (47%), Positives = 371/602 (62%), Gaps = 37/602 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYEAT GPV+ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  172   FTASLCNRKLIGARFFARGYEATMGPVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  231

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FANG A G AP  R+A+YK CWQ          C   D+LAA D A+ D V V+S+S
Sbjct  232   LG-FANGTARGMAPRARVAVYKVCWQ--------GGCFSSDILAAIDKAIDDNVNVLSMS  282

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+G+  AM+R I V  SAGN     +S++NVAPWI TVGA +IDR
Sbjct  283   LGGGMSDYY--RDGVAIGSFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTIDR  340

Query  1408  VFSAPVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEKV  1235
              F A  +LGN     G S+   +    + LP VYAG+     + T    C   TL PEKV
Sbjct  341   DFPALAILGNGKNYSGVSLFKGDALPAKLLPFVYAGNAS---NATNGNLCMTGTLIPEKV  397

Query  1234  KGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   +G D
Sbjct  398   KGKIVMCDRGVNARVQKGDVVKAAGGLGMILANTAANGEELVADAHLLPATTVGEKAG-D  456

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I  Y+LT+ NP AT++   T+   +PSP +A F+S GP+   PNILKPD+ APG+NILA
Sbjct  457   IIRHYVLTDPNPTATILIQGTVVNVQPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILA  516

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
              W+ A  P     D R V++NIISGTSMSCPHVS + AL+K++HP+WS AAI+SA+MTTA
Sbjct  517   GWTGAEGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALIKSVHPEWSPAAIRSALMTTA  576

Query  712   TTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------S  554
                   G+ I D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C      S
Sbjct  577   YKTYKDGKPILDIATGKPSTPFDHGAGHVSPTTAINPGLIYDLTTADYLGFLCALNYTSS  636

Query  553   SIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSVEVKA  380
              I +    +Y C P K+ S ++LNYPS A+     G+    RTVT+VG A  TYSV++ +
Sbjct  637   QIRSVSRRNYTCDPSKSYSIADLNYPSFALNVDGAGAYKYTRTVTSVGGAG-TYSVKITS  695

Query  379   PTGYSVKIS--PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
              T  +VKIS  P  L F E  EK+S+ V+  V+S K  G   FG  +WSDG H+V SP+ 
Sbjct  696   ET-TAVKISVQPAVLNFKEANEKKSYTVTFTVDSSKASGSNSFGSIEWSDGKHVVASPVA  754

Query  205   VS  200
             +S
Sbjct  755   IS  756



>ref|XP_010647021.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=725

 Score =   446 bits (1146),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 269/599 (45%), Positives = 368/599 (61%), Gaps = 39/599 (7%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  +G EA  G P+N ++  ++ RD +GHGTHT ST GGR V  A+ LG  
Sbjct  140   CNRKLIGARYFNRGVEAKLGSPLNSSY--QTVRDTNGHGTHTLSTAGGRFVGGANLLGS-  196

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK+CW           C D DVLAA D A+ DGV ++S+S+  +
Sbjct  197   GYGTAKGGSPSARVASYKSCWPD---------CNDADVLAAIDAAIHDGVDILSLSIAFV  247

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
              +D +   D +A+G+LHA++  I VV + GN    P SVTN APWI TV AS+IDR F +
Sbjct  248   SRDYFL--DSIAIGSLHAVQNGIVVVCAGGNSGPTPGSVTNSAPWIITVAASTIDREFPS  305

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              V+LGNN   KG S     +  ++  PLVY+ D     ++      C   +L P+KVKGK
Sbjct  306   NVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARAANASARDAQLCSVGSLDPKKVKGK  365

Query  1225  VVFCLTG-------GLSQTLEVERAGGAAVILGS-IGSEIQVESFLITATNIFNPSGTDA  1070
             +V+CL          + ++  V +AGG  +IL + + +   +       T+  + +   A
Sbjct  366   IVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTATLIPQAHFVPTSRVSAADGLA  425

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             IL YI T K PVA  I G T  G   +P MA F+S GP+   P ILKPDITAPG+ I+AA
Sbjct  426   ILLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAA  484

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P     DHR V +NI+SGTSMSCPHVS  V LLK IHP+WS +AI+SAIMT+A 
Sbjct  485   YTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTSAR  544

Query  709   TKNVKGEAIKDAYGEVAG--PFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------  554
             T++   + I  A G +AG  PF+YGAGH+ P++A DPGLVYD T  DYL F+CS      
Sbjct  545   TRSNLRQPI--ANGTLAGGNPFNYGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNAT  602

Query  553   SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
              + T +D  Y+CP K + P +LNYPS+ +  L G + V RT+ NVG+   TY+V +KAP+
Sbjct  603   QLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-ATYTVRIKAPS  661

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             G SVK+ P  L+F ++ E++ F V+++ +     GE+ FG   WSDG H V SPIVV++
Sbjct  662   GISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  720



>ref|XP_011082896.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=769

 Score =   447 bits (1149),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 269/596 (45%), Positives = 360/596 (60%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY A  GP+N TFD  S RD  GHG+HT ST GG  V+ AS  G
Sbjct  183   SFHCNRKLIGARYFNKGYSAVVGPLNSTFD--SPRDTEGHGSHTLSTAGGNFVSRASVFG  240

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
              F NG A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG
Sbjct  241   -FGNGTAKGGSPRARVAAYKVCWP----PVAGNECFDADILAAFDIAIHDGVDVLSVSLG  295

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVF  1403
               P    F  D VA+G+ HA+K  I VV SAGN   +  +V+NVAPW  TVGAS++DR F
Sbjct  296   GDPVP--FYNDSVAIGSFHAVKHGIVVVCSAGNSGPDAGTVSNVAPWQITVGASTMDRQF  353

Query  1402  SAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V+LGN +  +GES++   + K+++ P++ A   +   ++      C+  TL P KVK
Sbjct  354   PSYVVLGNKMRFRGESLSAKSLLKKKSFPIISARYAKAANASADEAALCKAGTLDPTKVK  413

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G   ++L +    G+EI  +  ++ A+ I    G  A
Sbjct  414   GKILVCLRGDNARVDKGEQAALAGAVGMVLANNQISGNEILADPHVLPASQINYTDGL-A  472

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + ++PVA +    T    KP+P MA F+S GP+   P ILKPDITAPG++I+AA
Sbjct  473   LFSYIKSTRSPVAYITKATTQLHTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSIIAA  532

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             +++A +P  Q  D R V +N +SGTSMSCPHVS VV LLK +HP+WS AAIKSAIMTTA 
Sbjct  533   YTKAQAPTNQDFDKRRVLFNSVSGTSMSCPHVSGVVGLLKTLHPNWSPAAIKSAIMTTAR  592

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T++   + + DA    A P +YG GH+QP++A DPGLVYD    DYL F+C      + I
Sbjct  593   TRDNTLKPLTDASYLKATPLNYGGGHVQPNRAMDPGLVYDLGANDYLNFLCALGYNQTQI  652

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 +  Y CP+      +LNYPS+ +  L GS+ V R V NVGS   TY   V++P G 
Sbjct  653   QLFSEEPYACPQPIRL-IDLNYPSITVPGLTGSVTVTRKVKNVGSPG-TYRARVRSPHGI  710

Query  367   SVKISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV + P  LKF   G EK+        +    V ++ FG   WSDG H V+SPIVV
Sbjct  711   SVHVEPDSLKFERAGEEKRFRVTLQVKKPGGAVKDYVFGQLIWSDGRHYVRSPIVV  766



>ref|XP_002974964.1| hypothetical protein SELMODRAFT_415194 [Selaginella moellendorffii]
 gb|EFJ23749.1| hypothetical protein SELMODRAFT_415194 [Selaginella moellendorffii]
Length=761

 Score =   446 bits (1148),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 272/597 (46%), Positives = 359/597 (60%), Gaps = 30/597 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT-FDFR-SSRDISGHGTHTASTVGGRKVANA  1772
             FT   CN+KIIGAR++ KG  A   P+N +  +F  S+RD  GHGTHTAST  GR V  A
Sbjct  176   FTRDDCNKKIIGARFYFKGINAE-APLNASGANFTLSARDDDGHGTHTASTAAGRVVLRA  234

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S  G  A+G A GGAPL RLAIYK CW          FC D D+LAA D A+ADGV +IS
Sbjct  235   SFPGNIASGTARGGAPLARLAIYKVCWN--------DFCSDADILAAIDDAIADGVDIIS  286

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSID  1412
             +SLG  P  + F  D +++G+ HAM+  I V  SAGN   P S  NVAPWI TVGASSID
Sbjct  287   MSLGPNPPQSDFFSDTISIGSFHAMRHGIFVSCSAGNSGVPGSAANVAPWIATVGASSID  346

Query  1411  RVFSAPVLLGNNLLVKGESVT-EIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPEK  1238
             R  ++ V+LGNN+ +KGE+   +        LV A  +  PG  ++   FC+ +TL   K
Sbjct  347   RDLASNVVLGNNMSIKGEAANPDSMAAPWSRLVPASSIPAPGVPSVNASFCQNNTLDASK  406

Query  1237  VKGKVVFCLT-GGLS----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             VKG ++ CL    L     ++L +++ GG  +IL    ++   ES+ + ATN+    G  
Sbjct  407   VKGNIILCLQPSALDSRPLKSLVIKQLGGVGMILVDEIAKDIAESYFLPATNVGAKEGA-  465

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I  Y+    +PVAT++P KT+   KP+PA+A F+S GP+   P ILKPDITAPG++ILA
Sbjct  466   VIATYLNQTSSPVATILPTKTVRNFKPAPAVAVFSSRGPNSVTPEILKPDITAPGVSILA  525

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWS  ++   +    RSV +NI+SGTSMSCPH++ V A L A  P WS AAIKSAIMTTA
Sbjct  526   AWSPVAT---KAVGGRSVDFNIVSGTSMSCPHITGVAANLIAKFPRWSPAAIKSAIMTTA  582

Query  712   TTKNVKGEAIKDAYGE-VAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-----S  551
             +T +  G AI + + + V+GPF +GAGH++P+ +  PGLVYD+ + DY+ F+CS      
Sbjct  583   STLDNTGAAINNQFFQTVSGPFDFGAGHVRPNLSLRPGLVYDTGFHDYVSFLCSIGSLKQ  642

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIA-QLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
             +         CP    +P NLNYPS+A+  Q +   VV RTVTNVG+  + Y   VKAP+
Sbjct  643   LHNITHDDTPCPSAPIAPHNLNYPSIAVTLQRQRKTVVYRTVTNVGTPQSLYKATVKAPS  702

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             G  V + P  L F E+ EK+  F           G F FG   WSDG H V SPI V
Sbjct  703   GVVVNVVPECLSFEELHEKK-SFTVEFSAQASSNGSFAFGSLTWSDGRHDVTSPIAV  758



>ref|XP_010092360.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB51036.1| Subtilisin-like protease [Morus notabilis]
Length=732

 Score =   445 bits (1145),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 274/604 (45%), Positives = 374/604 (62%), Gaps = 39/604 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFD------FRSSRDISGHGTHTASTVGGRKVANA  1772
             HCNRK+IGARY  +GY A    +N T          S RD  GHGTHT ST GG  V +A
Sbjct  138   HCNRKLIGARYFNRGYAAYLLTMNTTITPTENSTLFSIRDHEGHGTHTLSTAGGSFVTDA  197

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             +  G   NG A GG+P  R+A YK CW      +    C D D++AAF+ A+ DG+ V+S
Sbjct  198   TVFGN-GNGTAKGGSPRARVAAYKVCWP----PVNGNECFDADIIAAFETAITDGIDVLS  252

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             VSLG  P +  F +DG+++GA HA+K  I VV SAGN    P +V+NV+PW+ TVGAS+I
Sbjct  253   VSLGGEPSE--FFEDGISIGAFHAVKNGIVVVSSAGNSGPTPGTVSNVSPWMVTVGASTI  310

Query  1414  DRVFSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVE---IPGSTTIPGFCRQDTL  1250
             DR FS+ V LG+   +KG S++   +  ++  PL+   +     +P S  +   C+  TL
Sbjct  311   DREFSSYVALGSKKHLKGASLSSKVLPSEKFYPLISGANARAANVPPSEAL--LCKNGTL  368

Query  1249  SPEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGS---IGSEIQVESFLITATNIFN  1088
              P+KVKGK+V CL G +++T +      AG   +IL +    G+EI  ++ L+ A++I N
Sbjct  369   DPKKVKGKIVVCLRGDIARTEKGQYASLAGAVGMILANDLQSGNEIIADAHLLPASHI-N  427

Query  1087  PSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPG  908
              +  +++  Y+ + K P+A +   KT  G KP+P MA F+S GP+  E  +LKPDITAPG
Sbjct  428   FTDGNSVFAYLNSTKTPMAYMTRVKTEVGIKPAPFMASFSSRGPNTIEEALLKPDITAPG  487

Query  907   LNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSA  728
             +NI+AA+++A+ P +Q  D R V +N  SGTSMSCPHVS +V LLK +HPDWS AAIKSA
Sbjct  488   VNIIAAYTQAAGPTDQDFDKRRVPFNTESGTSMSCPHVSGIVGLLKTLHPDWSPAAIKSA  547

Query  727   IMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS-  551
             IMT+A T++   E + D+  + A PF YGAGHIQP+ A DPGLVYD T  DYL F+C+  
Sbjct  548   IMTSARTRDDNKEPLLDSSMKKATPFAYGAGHIQPNHAMDPGLVYDLTTDDYLNFLCARG  607

Query  550   IGTTL-----DPSYKCPKKASSPSNLNYPSLAIAQL-KGSMVVKRTVTNVGSANTTYSVE  389
                TL     D  + CP K+ + +N NYPS+ +  L   S+VV R V NVG+    Y+V 
Sbjct  608   YNETLLKLFSDKPHNCP-KSFTLANFNYPSIVVPNLGSESIVVSRRVKNVGTPG-IYTVY  665

Query  388   VKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgef--eFGWYKWSDGIHMVKS  215
             VK P G SV + P  LKF ++GE++ F V VK + V K  +    FG  KWSDG H V+S
Sbjct  666   VKQPAGVSVSVWPKSLKFSKIGEEKKFNVFVKTKGVGKSTKDGYVFGHLKWSDGKHNVRS  725

Query  214   PIVV  203
             PIVV
Sbjct  726   PIVV  729



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   446 bits (1147),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 279/606 (46%), Positives = 376/606 (62%), Gaps = 45/606 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+SHCNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  172   FTASHCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  231

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G AP  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  232   LG-YASGTARGMAPHARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  282

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    + Y  +DGVA+GA  AM+R I V  SAGN     +S++NVAPWI TVGA ++DR
Sbjct  283   LGGGTSEYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDR  340

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  341   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  393

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  394   PEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEK  453

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ +P AT+    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  454   AG-DLIRHYVTTDPHPTATISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  512

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLKA+HP+WS AAI+SA+
Sbjct  513   NILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSAL  572

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C   
Sbjct  573   MTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALN  632

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                S I +    +Y C P K+ S ++LNYPS A+  +  G+    RTVT+VG A  TYSV
Sbjct  633   YTSSQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVEEAGAYKYTRTVTSVGGAG-TYSV  691

Query  391   EVKAPTGYSVKIS--PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVK  218
             ++ + T  +VKIS  P  L F    EKQS+ V+  V+S K  G   FG  +WSDG H+V 
Sbjct  692   KLTSET-TAVKISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIEWSDGKHVVG  750

Query  217   SPIVVS  200
             SP+ +S
Sbjct  751   SPVAIS  756



>ref|XP_011039832.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=772

 Score =   446 bits (1147),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 260/592 (44%), Positives = 370/592 (63%), Gaps = 27/592 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IG RY  KGY A  G +N +F  +++RD  GHGTHT ST  G  V  A+ LG + 
Sbjct  189   CNRKLIGTRYFNKGYAAYAGHLNSSF--QTARDSEGHGTHTLSTAAGNFVPGANVLG-YG  245

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P  R A YK CW  P +   +  C D D+LAAFD A++DGV V+SVSLG  P
Sbjct  246   NGTAKGGSPHARAAAYKVCWP-PING--SNECFDADILAAFDVAISDGVDVLSVSLGGDP  302

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
              +  F+ D +A+G+ HA+ + I VV SAGN    P +V+NVAPW+ TVGAS++DR F+  
Sbjct  303   AE--FSDDAIAIGSFHAVAKGITVVASAGNSGPSPGTVSNVAPWLITVGASTMDRAFTIY  360

Query  1393  VLLGNNLLVKGESVTEIK--KQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGKV  1223
             V LGN   +KG S++E +   ++  PL+ A D +    +      C+   L  +KVKGK+
Sbjct  361   VALGNRKHLKGASLSEKRLPAEKFYPLISAADAKAADQSEEDALLCKPGALDSKKVKGKI  420

Query  1222  VFCL---TGGLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL    G + +  +   AG A +IL +    G+EI  ++ ++ A +I N +  +A+  
Sbjct  421   LVCLRGENGRVDKGHQALLAGAAGMILANDENSGNEIIADTHVLPAAHI-NFTDGEAVFS  479

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             Y+   K P+A L   +T    KP+P MA F+S GP+  E +ILKPDITAPG++++AA++E
Sbjct  480   YLKLTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESILKPDITAPGISVIAAFTE  539

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P +   D R   YN  SGTSMSCPHVS +  LLK +HP WS AAI+SAIMTTATT++
Sbjct  540   AIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIAGLLKTLHPKWSPAAIRSAIMTTATTRD  599

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTT  539
               GE I D+    A PF  GAGH+QP++AADPGL+YD T  D+L F+C+      +I   
Sbjct  600   NNGEPILDSTNTKATPFADGAGHVQPNRAADPGLIYDLTVNDFLNFLCNRGNTKKNIKLF  659

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D  Y CP K+ S ++ NYPS+ +  L  S+ V R V NVGS  +TY++ ++AP G +V 
Sbjct  660   SDKPYTCP-KSFSLADFNYPSITVTNLNDSITVTRRVKNVGSP-STYNIHIRAPPGVTVS  717

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             ++P+ L+F ++GE++ F V+ K+     + ++ FG   W DG H V+SP+VV
Sbjct  718   VAPSILRFQKIGEEKMFKVTFKLAPNAVLTDYVFGMLTWGDGKHFVRSPLVV  769



>ref|XP_007153620.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 ref|XP_007153621.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25614.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
 gb|ESW25615.1| hypothetical protein PHAVU_003G050900g [Phaseolus vulgaris]
Length=778

 Score =   446 bits (1147),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 277/597 (46%), Positives = 369/597 (62%), Gaps = 32/597 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG-G  1757
              CNRK+IGARY  KGYE+  GP+N +F   S RD  GHG+HT ST  G  VA  S  G G
Sbjct  189   QCNRKLIGARYFNKGYESAAGPLNSSF--HSPRDKEGHGSHTLSTAAGNAVAGVSVFGQG  246

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
             F  G A GGAP  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG 
Sbjct  247   F--GTAKGGAPKARVAAYKVCWP----PVAGDECFDADILAAFDAAIHDGVDVLSVSLG-  299

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVT--NVAPWIFTVGASSIDRVF  1403
                 +    D VA+G+ HA KR I VV SAGN   P   T  N+APW  TV AS++DR F
Sbjct  300   -GSASSLLNDSVAIGSFHAAKRGIVVVCSAGN-SGPADATAENLAPWHVTVAASTMDREF  357

Query  1402  SAPVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKG  1229
              A V+LG+N+ +KGES++  +  Q+  P++ A D ++  + T     C+  TL P+KVKG
Sbjct  358   PAYVVLGDNITLKGESLSAARLAQKFYPIIKATDAQLGSARTEDAVLCQNGTLDPKKVKG  417

Query  1228  KVVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAI  1067
             K+V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I N +   A+
Sbjct  418   KIVVCLRGINARVDKGEQALLAGAVGMVLANDKASGNEIIADPHVLPASHI-NFTDGIAV  476

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               YI + + PVA +   KT    KP+P MA F+S GP+   P ILKPD+TAPG++++AA+
Sbjct  477   FNYINSTRFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTVVPEILKPDVTAPGVSVIAAY  536

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             +EA  P  Q  D R + YN +SGTSMSCPHV+ +VALL+A +P WS AAIKSAIMTTATT
Sbjct  537   TEAQGPTNQVFDKRRIPYNSVSGTSMSCPHVAGIVALLRASYPSWSPAAIKSAIMTTATT  596

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS--SIGTTLD  533
              + + E + +A    A PF YGAGH+QP+ A DPGLVYD+T  DYL F+C+    GT + 
Sbjct  597   LDNEVEPLLNATDGRATPFSYGAGHVQPNTAMDPGLVYDTTIGDYLNFLCALGYNGTKIS  656

Query  532   -----PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                  PSY C KK S   NLNYPS+ +  L GS+ V RT+ NVGS   TY   V+ P G 
Sbjct  657   VFTEGPSYVCRKKFSL-LNLNYPSITVPNLSGSVTVTRTLKNVGSPR-TYIAHVQNPKGI  714

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             +V + P+ L F +VGE++ F V+ K+   K    + FG   WSDG H V+SPIVV +
Sbjct  715   TVSVKPSILNFTKVGEEKRFKVTFKIVKGKATNNYVFGKLIWSDGKHYVRSPIVVKA  771



>ref|XP_010647020.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
Length=771

 Score =   446 bits (1146),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 269/599 (45%), Positives = 368/599 (61%), Gaps = 39/599 (7%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  +G EA  G P+N ++  ++ RD +GHGTHT ST GGR V  A+ LG  
Sbjct  186   CNRKLIGARYFNRGVEAKLGSPLNSSY--QTVRDTNGHGTHTLSTAGGRFVGGANLLGS-  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK+CW           C D DVLAA D A+ DGV ++S+S+  +
Sbjct  243   GYGTAKGGSPSARVASYKSCWPD---------CNDADVLAAIDAAIHDGVDILSLSIAFV  293

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
              +D +   D +A+G+LHA++  I VV + GN    P SVTN APWI TV AS+IDR F +
Sbjct  294   SRDYFL--DSIAIGSLHAVQNGIVVVCAGGNSGPTPGSVTNSAPWIITVAASTIDREFPS  351

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              V+LGNN   KG S     +  ++  PLVY+ D     ++      C   +L P+KVKGK
Sbjct  352   NVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARAANASARDAQLCSVGSLDPKKVKGK  411

Query  1225  VVFCLTG-------GLSQTLEVERAGGAAVILGS-IGSEIQVESFLITATNIFNPSGTDA  1070
             +V+CL          + ++  V +AGG  +IL + + +   +       T+  + +   A
Sbjct  412   IVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTATLIPQAHFVPTSRVSAADGLA  471

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             IL YI T K PVA  I G T  G   +P MA F+S GP+   P ILKPDITAPG+ I+AA
Sbjct  472   ILLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAA  530

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P     DHR V +NI+SGTSMSCPHVS  V LLK IHP+WS +AI+SAIMT+A 
Sbjct  531   YTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTSAR  590

Query  709   TKNVKGEAIKDAYGEVAG--PFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------  554
             T++   + I  A G +AG  PF+YGAGH+ P++A DPGLVYD T  DYL F+CS      
Sbjct  591   TRSNLRQPI--ANGTLAGGNPFNYGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNAT  648

Query  553   SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
              + T +D  Y+CP K + P +LNYPS+ +  L G + V RT+ NVG+   TY+V +KAP+
Sbjct  649   QLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-ATYTVRIKAPS  707

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             G SVK+ P  L+F ++ E++ F V+++ +     GE+ FG   WSDG H V SPIVV++
Sbjct  708   GISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  766



>ref|XP_004167057.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=673

 Score =   442 bits (1138),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 262/596 (44%), Positives = 359/596 (60%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY +  GP+N +F   S RD  GHG+HT ST GG  VA AS  G
Sbjct  87    SFHCNRKLIGARYFNKGYASVVGPLNSSF--HSPRDKEGHGSHTLSTAGGNFVAGASVFG  144

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
                 G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG
Sbjct  145   -LGKGTAKGGSPRARVAAYKVCWPPK----AGNECFDADILAAFDFAIHDGVDVLSVSLG  199

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVF  1403
               P  N    D VA+G+ HA+K  I V+ SAGN      +VTNVAPW  TVGAS++DR F
Sbjct  200   GDP--NPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQITVGASTMDRKF  257

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V+LGN   ++GES+++  +  ++  PL+ A DV +  ++      C+  TL+P K K
Sbjct  258   PSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRLANASVHEAQLCKAGTLNPMKAK  317

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G A +IL +    G+EI  +  ++ A++I N +   A
Sbjct  318   GKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVLPASHI-NFTDGSA  376

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K P A + P  T  G +P+P MA F+S+GP+   P ILKPDITAPGL+++AA
Sbjct  377   VFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAA  436

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D+R + +N +SGTSMSCPHVS +  LLK ++P WS AAIKSAIMTTA+
Sbjct  437   YTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAAIKSAIMTTAS  496

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
               +   E + +A   VA PF+YGAGH+ P+ AADPGLVYD    +YL F+C      + I
Sbjct  497   ILDNNFEPLLNASYSVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFLCALGYNKAQI  556

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 +  + C     SP+NLNYPS+ + +L  S+ + R + NVGS   TY  E++ P G 
Sbjct  557   SQFSNGPFNC-SDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPG-TYKAEIRKPAGI  614

Query  367   SVKISPTELKFMEVGEK-QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV + P +L F  +GE+     +    E       + +G   WSDG H V+SPIVV
Sbjct  615   SVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHHVRSPIVV  670



>ref|XP_010096499.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB64619.1| Subtilisin-like protease [Morus notabilis]
Length=771

 Score =   446 bits (1146),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 270/593 (46%), Positives = 362/593 (61%), Gaps = 27/593 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  +GYEA    +N T   R++RD SGHG+HT ST GG  V  AS LG   
Sbjct  187   CNRKLIGARYFSEGYEAWGRKLNSTE--RTARDHSGHGSHTLSTAGGNFVHGASVLG-VG  243

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P  R+A YK CW  P D  +   C D D++AAFD A+ DGV VIS+S+G  P
Sbjct  244   NGTAKGGSPRARVAAYKVCWP-PVDGGE---CFDADIMAAFDMAIHDGVDVISMSVGGKP  299

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
                 + +DG+++GA HA K+ I VV SAGN      SVTNV+PW+ TV AS++DR F A 
Sbjct  300   AG--YWEDGMSIGAFHAAKKGIVVVASAGNSGPNAGSVTNVSPWMITVAASTLDREFQAF  357

Query  1393  VLLGNNLLVKGESVT-EIKKQETLPLVYAGDV-EIPGSTTIPGFCRQDTLSPEKVKGKVV  1220
             V L N L +KG S++  ++ ++  PL+      E   S      C+  TL P KVKGK++
Sbjct  358   VELKNGLRLKGTSLSPALRAKKFYPLINGAQAKEANASIDDAILCKTGTLDPTKVKGKIL  417

Query  1219  FCLTG---GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILKY  1058
              CL G    + + L   RAG   +IL +    G+ +  ++  + A+++    G  ++L+Y
Sbjct  418   ACLRGENARVEKGLNAARAGAVGMILCNDDLSGNGVLADAHFLPASHLTYEDG-QSLLQY  476

Query  1057  ILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEA  878
             I T KNP ATL+P    FG+KP+P+MA F+S GP+   P ILKPDITAPG++I+AA+SEA
Sbjct  477   INTTKNPQATLLPPIATFGSKPAPSMASFSSTGPNTVTPEILKPDITAPGVSIIAAYSEA  536

Query  877   SSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNV  698
              SP     D R   +N+ SGTSMSCPHV+ VV LL+ IH DWS AAI+SAI+TTA T++ 
Sbjct  537   VSPTGLEFDKRRFPFNVESGTSMSCPHVAGVVGLLRTIHRDWSPAAIRSAIVTTARTRDN  596

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTTL  536
              G + K A  + A PF+YG GHI+P++A DPGLVYD    DYL F+CS       I    
Sbjct  597   TGNSAKTALKQKASPFNYGNGHIRPNRAMDPGLVYDLGTNDYLNFLCSLGYNKTQIQALN  656

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKI  356
             D  +KCP K  +  + NYPS+    L GS+ V RTV NVG    TY V+V  P G SV +
Sbjct  657   DKPHKCPAKNVTVLDFNYPSVTAPNLSGSVTVTRTVKNVGQPG-TYVVKVHEPVGVSVSV  715

Query  355   SPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              P  L+F   GE++  F     +    +  + FG + W+DG H V+SPIVV +
Sbjct  716   EPKILEFKHHGEEK-SFRITLKDRGYGLKGYHFGVFVWTDGKHYVRSPIVVQT  767



>ref|XP_009112374.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=758

 Score =   445 bits (1145),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 274/603 (45%), Positives = 371/603 (62%), Gaps = 39/603 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT S CNRK+IGAR+ V+GYEA  GPV+ + + +S RD  GHGTHTAST  G  V  A+ 
Sbjct  172   FTMSLCNRKLIGARFFVRGYEAINGPVDESKESKSPRDDDGHGTHTASTAAGSVVEGANL  231

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FANG A G A   R+A+YK CWQ          C   D+LA  D A+ D V ++S+S
Sbjct  232   LG-FANGTARGIAYRARVAVYKVCWQ--------PGCFSSDILAGIDKAIEDNVNILSIS  282

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             L  +    Y+T D +A+GA  AM+R I V  SAGN+   P+SVTN+APWI TVGA ++DR
Sbjct  283   LSGI--TTYYTDD-IAIGAFAAMERGIFVSCSAGNFGPSPFSVTNIAPWITTVGAGTLDR  339

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQ---ETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEK  1238
              F A  +LGN     G S+ +   +   + LP +YAG+        I   C   TL PEK
Sbjct  340   DFPALAILGNGKNYTGVSLFKGDDELPAKLLPFIYAGNAS---DDAIGYLCFPGTLIPEK  396

Query  1237  VKGKVVFCLTGGLSQTL---EVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
             VKGK+V C TGG++  +    V+ AGG  +I+ ++   G E+Q E+  + AT +   +G 
Sbjct  397   VKGKIVMCDTGGVAPAMIGEVVKSAGGLGMIIANLAGRGEEVQAEAHFLPATAVGEKAG-  455

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
             D I +Y+LT+ NP A+++   T+   KPSP +A F+S GP+   PNILKPD+ APG+NIL
Sbjct  456   DIIRRYVLTDPNPTASIVIQGTVVNVKPSPVLAAFSSRGPNPITPNILKPDLIAPGVNIL  515

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAW+ +  P     D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+MTT
Sbjct  516   AAWTGSLGPTGLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTT  575

Query  715   ATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------  557
             A      G  I D + G+ + PF +GAGH+ P+ A +PGL+YD T +DYL F+C      
Sbjct  576   AYNTYKDGNPIIDISTGKPSTPFEHGAGHVSPTTAVNPGLIYDLTTVDYLDFLCALKYNS  635

Query  556   SSIGTTLDPSYKC-PKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYSVEV  386
             S IG     +Y C   K  S ++LNYPS A+  ++GS   K  R VT+VG A  +YSV+V
Sbjct  636   SQIGVVSRGNYTCDSSKTYSVADLNYPSFAV-NVEGSDTYKYTRPVTSVGGAG-SYSVKV  693

Query  385   KAP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              +  T   + I P  L F EV EK+S+ V+  V+  K  G   FG  +WSDG H+V SP+
Sbjct  694   TSETTAVKISIEPAVLNFREVNEKKSYSVTFTVDLSKPSGSNSFGSIEWSDGKHVVASPV  753

Query  208   VVS  200
              +S
Sbjct  754   AIS  756



>ref|XP_007020377.1| Xylem serine proteinase 1, putative [Theobroma cacao]
 gb|EOY11902.1| Xylem serine proteinase 1, putative [Theobroma cacao]
Length=770

 Score =   446 bits (1146),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 269/594 (45%), Positives = 377/594 (63%), Gaps = 29/594 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATF-GPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGG  1757
             HCNRK+IGA+Y  KGY A   G +N T +  ++RD  GHGTHT ST GG  V  A+ LG 
Sbjct  186   HCNRKLIGAKYFNKGYAAVLDGKLNATLE--TARDNQGHGTHTLSTAGGSFVPGANVLG-  242

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
             F NG A GG+P  R+A YK CW  P D      C D D+LAAFD A++DGV V+SVSLG 
Sbjct  243   FGNGTAKGGSPKARVAAYKVCWP-PID---GNECFDADILAAFDAAISDGVDVLSVSLG-  297

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
               +   F +DG ++G+ HAM++ I+VV SAGN   +P +VTNV+PW+FT+GAS++DR F 
Sbjct  298   -GETTEFFEDGTSIGSFHAMRKGISVVASAGNDGPDPETVTNVSPWVFTIGASTLDRDFI  356

Query  1399  APVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKG  1229
             + V LGN+  +KG S+  + +  +   PL+ A   +   +       C+  TL P+KVKG
Sbjct  357   SYVELGNDKRLKGASMATSSLSSRSFYPLISAETAKAANAKAADAILCQPGTLDPKKVKG  416

Query  1228  KVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAI  1067
             K++ C+ G  ++T + ++A   G   +IL +    G+ I  +  L+ AT+I    G + +
Sbjct  417   KIIVCVRGVNARTDKSQQALLAGAVGMILANDEKSGNGIMADPHLLPATHISFTDG-ETV  475

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               YI + K P A + P KT  G+KP+P MA F+S GP+  EP+ILKPDITAPG++I+AA+
Sbjct  476   FAYINSTKKPTAYITPAKTELGSKPAPFMASFSSRGPNVIEPSILKPDITAPGVSIIAAF  535

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             SEA  P E+  D R + +  +SGTSMSCPHVS +V LLK++HPDWS +AIKSAIMT+A T
Sbjct  536   SEAVGPSEETSDKRRMPFTSMSGTSMSCPHVSGIVGLLKSLHPDWSPSAIKSAIMTSART  595

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS------IG  545
             ++  G  + D+  + A PF YG GH++P++A DPGLVYD T  DYL ++CS       I 
Sbjct  596   RDNTGNPMVDSTNKKATPFAYGGGHVRPNRAMDPGLVYDLTVDDYLNYLCSRGYNQSMIR  655

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
                D  Y CP K+ S S+ NYPS+++ +  GS  V R V NVGS   TY   V++P G +
Sbjct  656   LFSDKPYTCP-KSFSLSDFNYPSISVDKFGGSATVSRKVKNVGSPG-TYRARVRSPAGVT  713

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             V ++P+ L F + GE++ F V+ K +S  +   F FG   WS+G H V+SP+VV
Sbjct  714   VSVNPSTLTFEKKGEEKKFEVTFKAKSNGQPAGFVFGQLIWSNGHHYVRSPLVV  767



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score =   445 bits (1144),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 274/603 (45%), Positives = 371/603 (62%), Gaps = 39/603 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT S CNRK+IGAR+ V+GYEA  GPV+ + + +S RD  GHGTHTAST  G  V  A+ 
Sbjct  172   FTMSLCNRKLIGARFFVRGYEAINGPVDESKESKSPRDDDGHGTHTASTAAGSVVEGANL  231

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FANG A G A   R+A+YK CWQ          C   D+LA  D A+ D V ++S+S
Sbjct  232   LG-FANGTARGIAYRARVAVYKVCWQ--------PGCFSSDILAGIDKAIEDNVNILSIS  282

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             L  +    Y+T D +A+GA  AM+R I V  SAGN+   P+SVTN+APWI TVGA ++DR
Sbjct  283   LSGI--TTYYTDD-IAIGAFAAMERGIFVSCSAGNFGPSPFSVTNIAPWITTVGAGTLDR  339

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQ---ETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEK  1238
              F A  +LGN     G S+ +   +   + LP +YAG+        I   C   TL PEK
Sbjct  340   DFPALAILGNGKNYTGVSLFKGDDELPAKLLPFIYAGNAS---DDAIGYLCFPGTLIPEK  396

Query  1237  VKGKVVFCLTGGLSQTL---EVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGT  1076
             VKGK+V C TGG++  +    V+ AGG  +I+ ++   G E+Q E+  + AT +   +G 
Sbjct  397   VKGKIVMCDTGGVAPAMIGEVVKSAGGLGMIIANLAGRGEEVQAEAHFLPATAVGEKAG-  455

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
             D I +Y+LT+ NP A+++   T+   KPSP +A F+S GP+   PNILKPD+ APG+NIL
Sbjct  456   DIIRRYVLTDPNPTASIVIQGTVVNVKPSPVLAAFSSRGPNPITPNILKPDLIAPGVNIL  515

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAW+ +  P     D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+MTT
Sbjct  516   AAWTGSLGPTGLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTT  575

Query  715   ATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------  557
             A      G  I D + G+ + PF +GAGH+ P+ A +PGL+YD T +DYL F+C      
Sbjct  576   AYNTYKDGNPIIDISTGKPSTPFEHGAGHVSPTTAVNPGLIYDLTTVDYLDFLCALKYNS  635

Query  556   SSIGTTLDPSYKC-PKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYSVEV  386
             S IG     +Y C   K  S ++LNYPS A+  ++GS   K  R VT+VG A  +YSV+V
Sbjct  636   SQIGVVSRGNYTCDSSKTYSVADLNYPSFAV-NVEGSDTYKYTRPVTSVGGAG-SYSVKV  693

Query  385   KAP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              +  T   + I P  L F EV EK+S+ V+  V+  K  G   FG  +WSDG H+V SP+
Sbjct  694   TSETTAVKISIEPAVLNFREVNEKKSYSVTFTVDLSKPSGSNSFGSIEWSDGKHVVASPV  753

Query  208   VVS  200
              +S
Sbjct  754   AIS  756



>emb|CBI38460.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   446 bits (1146),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 269/599 (45%), Positives = 368/599 (61%), Gaps = 39/599 (7%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  +G EA  G P+N ++  ++ RD +GHGTHT ST GGR V  A+ LG  
Sbjct  198   CNRKLIGARYFNRGVEAKLGSPLNSSY--QTVRDTNGHGTHTLSTAGGRFVGGANLLGS-  254

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK+CW           C D DVLAA D A+ DGV ++S+S+  +
Sbjct  255   GYGTAKGGSPSARVASYKSCWPD---------CNDADVLAAIDAAIHDGVDILSLSIAFV  305

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
              +D +   D +A+G+LHA++  I VV + GN    P SVTN APWI TV AS+IDR F +
Sbjct  306   SRDYFL--DSIAIGSLHAVQNGIVVVCAGGNSGPTPGSVTNSAPWIITVAASTIDREFPS  363

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              V+LGNN   KG S     +  ++  PLVY+ D     ++      C   +L P+KVKGK
Sbjct  364   NVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARAANASARDAQLCSVGSLDPKKVKGK  423

Query  1225  VVFCLTG-------GLSQTLEVERAGGAAVILGS-IGSEIQVESFLITATNIFNPSGTDA  1070
             +V+CL          + ++  V +AGG  +IL + + +   +       T+  + +   A
Sbjct  424   IVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTATLIPQAHFVPTSRVSAADGLA  483

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             IL YI T K PVA  I G T  G   +P MA F+S GP+   P ILKPDITAPG+ I+AA
Sbjct  484   ILLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKPDITAPGVQIIAA  542

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P     DHR V +NI+SGTSMSCPHVS  V LLK IHP+WS +AI+SAIMT+A 
Sbjct  543   YTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHPNWSPSAIRSAIMTSAR  602

Query  709   TKNVKGEAIKDAYGEVAG--PFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------  554
             T++   + I  A G +AG  PF+YGAGH+ P++A DPGLVYD T  DYL F+CS      
Sbjct  603   TRSNLRQPI--ANGTLAGGNPFNYGAGHLSPNRAMDPGLVYDLTITDYLNFLCSIGYNAT  660

Query  553   SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
              + T +D  Y+CP K + P +LNYPS+ +  L G + V RT+ NVG+   TY+V +KAP+
Sbjct  661   QLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-ATYTVRIKAPS  719

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             G SVK+ P  L+F ++ E++ F V+++ +     GE+ FG   WSDG H V SPIVV++
Sbjct  720   GISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKHFVGSPIVVNA  778



>ref|XP_002977384.1| hypothetical protein SELMODRAFT_417382 [Selaginella moellendorffii]
 gb|EFJ21388.1| hypothetical protein SELMODRAFT_417382 [Selaginella moellendorffii]
Length=761

 Score =   445 bits (1144),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 271/595 (46%), Positives = 359/595 (60%), Gaps = 30/595 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT-FDFR-SSRDISGHGTHTASTVGGRKVANA  1772
             FT+  CN+KIIGAR++ KG  A   P+N +  +F  S+RD  GHGTHTAST  GR V  A
Sbjct  176   FTTDDCNKKIIGARFYFKGINAE-APLNASGANFTLSARDDDGHGTHTASTAAGRVVLRA  234

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S  G  A+G A GGAPL RLAIYK CW          FC D D+LAA D A+ADGV +IS
Sbjct  235   SFPGNIASGTARGGAPLARLAIYKVCWN--------DFCSDADILAAIDDAIADGVDIIS  286

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSID  1412
             +SLG  P  + F  D +++G+ HAM+  I V  SAGN   P S  NVAPWI TVGASSID
Sbjct  287   MSLGPNPPQSDFFSDTISIGSFHAMRHGIFVSCSAGNSGVPGSAANVAPWIATVGASSID  346

Query  1411  RVFSAPVLLGNNLLVKGESVT-EIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPEK  1238
             R  ++ V+LGNN+ +KGE+   +        LV A  +  PG  ++   FC+ +TL   K
Sbjct  347   RDLASNVVLGNNMSIKGEAANPDSIAAPWSKLVPASSIPAPGVPSVNASFCQNNTLDASK  406

Query  1237  VKGKVVFCLT-GGLS----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             VKG ++ CL    L     ++L +++ GG  +IL    ++   ES+ + ATN+    G  
Sbjct  407   VKGNIILCLQPSALDSRPLKSLVIKQLGGVGMILVDEIAKDIAESYFLPATNVGAKEGA-  465

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I  Y+    +PVAT++P KT+   KP+PA+A F+S GP+   P ILKPDITAPG++ILA
Sbjct  466   VIATYLNQTSSPVATILPTKTVRNFKPAPAVAVFSSRGPNSVTPEILKPDITAPGVSILA  525

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AWS  ++   +    RSV +NI+SGTSMSCPH++ V A L A  P WS AAIKSAIMTTA
Sbjct  526   AWSPVAT---KAVGGRSVDFNIVSGTSMSCPHITGVAANLIAKFPRWSPAAIKSAIMTTA  582

Query  712   TTKNVKGEAIKDAYGE-VAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-----S  551
             +T +  G AI + + + V+GPF +GAGH++P+ +  PGLVYD+ + DY+ F+CS      
Sbjct  583   STLDNTGAAINNQFFQTVSGPFDFGAGHVRPNLSLRPGLVYDTGFHDYVSFLCSIGSLKQ  642

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIA-QLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
             +         CP    +P NLNYPS+A+  Q +   VV RTVTNVG+  + Y   VKAP+
Sbjct  643   LHNITHDDTPCPSAPIAPHNLNYPSIAVTLQRQRKTVVCRTVTNVGTPQSLYKATVKAPS  702

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             G  V + P  L F E+ EK+  F           G F FG   WSDG H V SPI
Sbjct  703   GVVVNVVPECLSFEELHEKK-SFTVEFSAQASSNGSFAFGSLTWSDGRHDVTSPI  756



>ref|XP_002299062.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
 gb|EEE83867.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
Length=772

 Score =   445 bits (1144),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 259/592 (44%), Positives = 369/592 (62%), Gaps = 27/592 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IG RY  KGY A  G +N +F  +++RD  GHGTHT ST  G  V  A  LG + 
Sbjct  189   CNRKLIGTRYFNKGYAAYAGHLNSSF--QTARDSEGHGTHTLSTAAGNFVPGADVLG-YG  245

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P  R A YK CW  P +   +  C D D+LAAFD A++DGV V+SVSLG  P
Sbjct  246   NGTAKGGSPHARAAAYKVCWP-PING--SNECFDADILAAFDVAISDGVDVLSVSLGGDP  302

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
              +  F+ D +A+G+ HA+ + I VV SAGN    P +V+NVAPW+ TVGAS++DR F+  
Sbjct  303   AE--FSDDAIAIGSFHAVAKGITVVASAGNSGPSPGTVSNVAPWLITVGASTMDRAFTIY  360

Query  1393  VLLGNNLLVKGESVTEIK--KQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGKV  1223
             V LGN   +KG S++E +   ++  PL+ A D +    +      C+   L P+KVKGK+
Sbjct  361   VALGNRKHLKGASLSEKRLPAEKFYPLISAADAKAADQSEEDALLCKPGALDPKKVKGKI  420

Query  1222  VFCL---TGGLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL    G + +  +   AG   +IL +    G+EI  ++ ++ A ++ N +  +A+  
Sbjct  421   LVCLRGENGRVDKGHQALLAGAVGMILANDENSGNEIIADTHVLPAAHV-NFTDGEAVFS  479

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             Y+   K P+A L   +T    KP+P MA F+S GP+  E +ILKPDITAPG++++AA+++
Sbjct  480   YLNFTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESILKPDITAPGVSVIAAFTQ  539

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P +   D R   YN  SGTSMSCPHVS +V LLK +HP+WS AAI+SAIMTTATT++
Sbjct  540   AIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIVGLLKTLHPEWSPAAIRSAIMTTATTRD  599

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTT  539
               GE I D+    A PF  GAGH+QP+ AADPGL+YD T  D+L F+C+      +I   
Sbjct  600   NNGEPIMDSTNTKATPFADGAGHVQPNHAADPGLIYDLTVNDFLNFLCNRGNTKKNIKLF  659

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D  Y CP K+ S ++ NYPS+ +  L  S+ V R V NVGS   TY++ ++AP G +V 
Sbjct  660   SDKPYTCP-KSFSLADFNYPSITVTNLNDSITVTRRVKNVGSPG-TYNIHIRAPPGVTVS  717

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             ++P+ L+F ++GE++ F V+ K+     + ++ FG   W DG H V+SP+VV
Sbjct  718   VAPSILRFQKIGEEKMFKVTFKLAPKAVLTDYVFGMLTWGDGKHFVRSPLVV  769



>ref|XP_011039899.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=894

 Score =   448 bits (1153),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 277/597 (46%), Positives = 369/597 (62%), Gaps = 30/597 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CN+K+IGARY  KG+ A+  P     ++ ++RD  GHG+HT ST GG  V  A   G   
Sbjct  310   CNKKLIGARYFNKGF-ASASPTPIPTEWNTARDTEGHGSHTLSTAGGSFVPGAGIFGN-G  367

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG-LL  1574
             NG A GG+P   +A YK CW  P D+     C D D+LAAFD A+ DGV VIS+SLG   
Sbjct  368   NGTAKGGSPKAHVAAYKVCW--PSDN---GGCFDADILAAFDAAIGDGVDVISMSLGPSF  422

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P +  F QD +A+G+ HA+K+ I VV SAGN   +  SV N APW+FT+GAS++DR FSA
Sbjct  423   PVE--FLQDAMAIGSFHAIKKGIPVVASAGNSGPDAGSVANGAPWLFTIGASTLDRDFSA  480

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              V LGN   VKG SV    +   +  PL+ A +  +P  S+     C+  TL P+KV GK
Sbjct  481   TVTLGNKKFVKGSSVASKSLPAGKFYPLINAAEAGLPTASSADAQLCQNGTLDPKKVAGK  540

Query  1225  VVFCLTGGLSQTL---EVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  S+ +   E E AG   +IL +    GSE+  +  ++ A ++    G  A++
Sbjct  541   IIVCLRGINSRVVKGHEAELAGAVGMILANNEESGSELLSDPHVLPAAHLTFTDG-QAVM  599

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + KNP A++ P  T  G  P+P MA F+S GPS  EP ILKPD+TAPG++++AA++
Sbjct  600   DYIKSTKNPTASISPVHTDLGVVPNPVMAAFSSRGPSVIEPAILKPDVTAPGVDVIAAFT  659

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P E P D R   Y  +SGTSMSCPHVS +V LL+AIHPDWS AAIKSAIMTTA TK
Sbjct  660   EAIGPSELPFDKRRTPYITMSGTSMSCPHVSGIVGLLRAIHPDWSPAAIKSAIMTTAKTK  719

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS---SIGTTLD  533
             +   + I DA G+ A PF YGAGH+ P+ AADPGLVYD+  +DYL F+C+   +    L+
Sbjct  720   SNSKKRILDADGQPATPFAYGAGHVNPNLAADPGLVYDTNVIDYLNFLCAHGYNSTFILE  779

Query  532   PS---YKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
              S   YKCP+KAS  +  NYPS+ +  L G + V R V NVG A  TY+V+ KAP   SV
Sbjct  780   FSGVPYKCPEKASL-AEFNYPSITVPDLNGPVTVTRRVKNVG-APGTYTVKAKAPPQVSV  837

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGI-HMVKSPIVVSSA  194
              + P+ L+F + GE++ F V+ K        ++ FG   WSD   H V+SP+VV  A
Sbjct  838   VVEPSSLEFKKAGEEKIFKVTFKPVVNGTPKDYTFGHLTWSDSNGHRVRSPLVVKHA  894



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   444 bits (1142),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 275/602 (46%), Positives = 373/602 (62%), Gaps = 37/602 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYEAT GPV+ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  174   FTASLCNRKLIGARFFARGYEATMGPVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  233

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FA+G A G  P  R+A+YK CW           C   D+LAA D A+ D V V+S+S
Sbjct  234   LG-FASGTARGMDPRARVAVYKVCWL--------GGCFSSDILAAIDKAIEDNVNVLSMS  284

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN    P+S++NVAPWI TVGA ++DR
Sbjct  285   LGGGMSDYY--RDGVAIGAFAAMERGIFVSCSAGNAGPSPFSLSNVAPWITTVGAGTLDR  342

Query  1408  VFSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEKV  1235
              F A  +LGN     G S+ +      + LP +YAG+     + T    C   TL PEKV
Sbjct  343   DFPAIAILGNGKNFSGVSLFKGVALPDKLLPFIYAGNAS---NATNGNLCMTGTLIPEKV  399

Query  1234  KGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ ++ AT +   +G D
Sbjct  400   KGKIVMCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAG-D  458

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I +Y+LT+ NP A+++   T+   +PSP +A F+S GP+   PNILKPD+ APG+NILA
Sbjct  459   IIRRYVLTDPNPTASVLIQGTVVNVQPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILA  518

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AW+ A+ P   P D R V++NIISGTSMSCPHVS + ALLK+ HP+WS AAI+SA+MTTA
Sbjct  519   AWTGAAGPTGLPSDPRRVEFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTA  578

Query  712   TTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------S  554
                   G+ I D A G+ + PF +GAG++ P+ A +PGLVYD T +DYL F+C      S
Sbjct  579   YRSYKDGKPILDIATGKPSTPFDHGAGYVSPTIATNPGLVYDLTTVDYLGFLCALNYTSS  638

Query  553   SIGTTLDPSYKC-PKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYSVEVK  383
              I +    ++ C P K  S ++LNYPS A+  + GS   K  RTVT+VG A  +Y VEV 
Sbjct  639   QIRSVSRRNFTCDPTKTYSIADLNYPSFAV-NVDGSGAYKYTRTVTSVGGAG-SYKVEVT  696

Query  382   AP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
             +  T   + ++P  L F EV EK+S+ V+  V+S K  G   FG  +WSDG H+V SP+ 
Sbjct  697   SESTAVKISVAPAVLNFKEVNEKKSYTVTFTVDSSKASGSNSFGSIEWSDGKHVVASPVA  756

Query  205   VS  200
             ++
Sbjct  757   IT  758



>ref|XP_002269456.2| PREDICTED: subtilisin-like protease SBT5.4, partial [Vitis vinifera]
Length=575

 Score =   438 bits (1126),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 263/591 (45%), Positives = 354/591 (60%), Gaps = 32/591 (5%)
 Frame = -2

Query  1921  KIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANGV  1742
             K+IGARY  KGY A   P+N + +  S+RD  GHGTHT ST  G  V  AS  G    G 
Sbjct  1     KLIGARYFNKGYSANVEPLNSSMN--SARDYDGHGTHTLSTAAGNFVPGASVYG-VGKGT  57

Query  1741  ATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLPQDN  1562
             A GG+P  R+A YK CW           C D D++AAFD A+ DGV V+S+SLG  P D 
Sbjct  58    AKGGSPHARVAAYKVCWPS---------CYDSDIMAAFDMAIHDGVDVVSMSLGGDPSD-  107

Query  1561  YFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSAPVLL  1385
             YF  DG+A+GA HA+K NI VV SAGN      SV+N APW+FTVGAS++DR F A V L
Sbjct  108   YF-DDGIAIGAFHAVKNNILVVSSAGNSGPSEGSVSNTAPWMFTVGASTMDREFQANVQL  166

Query  1384  GNNLLVKGESVTE-IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKVVFCL  1211
              N    +G S+++ + K +   L+   +     +T+     C + TL PEKVKGK++ CL
Sbjct  167   KNGTFFEGMSLSQPLPKNKFYSLISGAEATAANATSADSVLCLEGTLDPEKVKGKILVCL  226

Query  1210  TG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILKYILT  1049
              G    + + L+  R G   +IL +    G+ +  +   + AT+I    G  A+L YI +
Sbjct  227   RGVTDRVEKGLQAARVGAVGMILCNDEYDGNSLVADPHFLPATHINYTDGL-AVLAYINS  285

Query  1048  NKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEASSP  869
              KNP   + P K     KP+P MA F+S GP+   P ILKPDITAPG++I+AA++EA SP
Sbjct  286   TKNPQGLITPPKGKIHTKPAPVMAAFSSRGPNTVTPEILKPDITAPGVDIIAAFTEAQSP  345

Query  868   LEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNVKGE  689
              EQ  D R + +  +SGTSMSCPHV+ V  LLK IHP WS +AIKSAIMTTA+T +    
Sbjct  346   TEQDFDERRLPFYSLSGTSMSCPHVAGVAGLLKTIHPHWSPSAIKSAIMTTASTSDNTKS  405

Query  688   AIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTTLDPS  527
              +KD+  + A P  YGAGH+QP++AADPGLVYD T  DYL F+C      + +    D  
Sbjct  406   PMKDSSSDKATPLAYGAGHMQPNQAADPGLVYDLTVNDYLDFLCALGYNQTMLKAFSDNP  465

Query  526   YKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKISPT  347
             YKCP   S   + NYPS+ +  L GS+ + R V NVG     Y+  +  PTG SV + P+
Sbjct  466   YKCPASVSL-LDFNYPSITVPNLSGSVTLTRRVKNVGFPG-IYAAHISQPTGVSVTVEPS  523

Query  346   ELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              LKF  +GE++ F V++K  +  +  ++ FG   W+D  H V+SPIVV++A
Sbjct  524   ILKFSRIGEEKKFKVTLKANTNGEAKDYVFGQLIWTDDKHHVRSPIVVAAA  574



>ref|XP_011013366.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=770

 Score =   444 bits (1143),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 266/596 (45%), Positives = 359/596 (60%), Gaps = 32/596 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGYEA  G    + +  ++RD  GHGTHT ST GGR V+ A+ LG  A
Sbjct  184   CNRKLIGARYFNKGYEAALGRALDSSN-NTARDTDGHGTHTLSTAGGRFVSGANFLGS-A  241

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV ++S+SLG   
Sbjct  242   YGTAKGGSPNARVASYKVCWPR---------CYDADILAAFDAAIQDGVDILSISLGRAV  292

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY---SVTNVAPWIFTVGASSIDRVFS  1400
                YF + G+A+GA  A+   I VV SAGN  + +   + +NVAPW+ TV AS+IDR F 
Sbjct  293   AIPYF-RSGIAIGAFQAVMNGILVVCSAGNSGQGFGFGTASNVAPWVLTVAASTIDREFP  351

Query  1399  APVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKG  1229
             + V+LGNN   KG S     +  ++  P+VY+ D +    S  +   C  ++L P+KV+G
Sbjct  352   SNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKAANASAQLAQICYPESLDPKKVRG  411

Query  1228  KVVFCLTG---GLSQTLEVERAGGAAVILGS--IGSEIQVESFLITATNIFNPSGTDAIL  1064
             K+V+CL G    + ++L V +AGG  +IL      S      F +  + +    G  ++L
Sbjct  412   KIVYCLRGMTSDVEKSLVVAQAGGVGMILAHQFADSSSSPRGFFVPTSLVSAIDGL-SVL  470

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+PVA  I G T  G   +P MAPF+S GP+   P ILKPDITAPG++ILAA++
Sbjct  471   SYIHSTKSPVA-YISGSTEIGKVVAPVMAPFSSTGPNEITPEILKPDITAPGVHILAAYT  529

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             +A   L +  D R + +NIISGTSMSCPHVS +  LLK +HPDWS AAIKSAIMTTA T 
Sbjct  530   KAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTS  589

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGT  542
             +   + I  A    A PF+YG+GH++P++A DPGLVYD T  DYL F+CS       +  
Sbjct  590   SNARQPIAKASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSI  649

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  Y CP K  S  N NYPS+ +  L G++ + RT+ NVG+    Y+V VK P G  V
Sbjct  650   FNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGTPG-LYTVRVKKPDGILV  708

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             K+ P  LKF ++ E+++F V +K +       + FG   WSDG+H VKSPIVV  A
Sbjct  709   KVEPKSLKFSKLNEEKTFKVMLKAKDDWFRRSYVFGGLTWSDGVHHVKSPIVVRKA  764



>gb|EYU34388.1| hypothetical protein MIMGU_mgv1a001745mg [Erythranthe guttata]
Length=765

 Score =   444 bits (1142),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 263/600 (44%), Positives = 368/600 (61%), Gaps = 37/600 (6%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY +  GP+N TF  R+ RD  GHG+HT ST GG  VA AS  G
Sbjct  179   SFHCNRKLIGARYFNKGYSSAVGPLNSTF--RTPRDTEGHGSHTLSTAGGNFVAGASVFG  236

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
              F NG A GG+P  R+A YK CW      I    C D D+LAAFD A+ DGV V+SVSLG
Sbjct  237   -FGNGTAKGGSPRARVAAYKVCWP----PIGGNECFDADILAAFDVAIHDGVDVLSVSLG  291

Query  1579  --LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDR  1409
                +P    F  D VA+G+ HA++  + VV SAGN      +V+NVAPW  TVGAS++DR
Sbjct  292   GDAVP----FYNDSVAIGSFHAVRHGVVVVCSAGNSGPGAGTVSNVAPWQITVGASTMDR  347

Query  1408  VFSAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEK  1238
              F + V+LGN + ++GES++   + K+++  ++ A D +   ++      C+  TL  +K
Sbjct  348   QFPSYVVLGNKMRLRGESLSAKSLPKKKSFQIISATDAKAANASADQALLCKAGTLDAKK  407

Query  1237  VKGKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGT  1076
             VKGK++ CL G  ++  + E+A   G   ++L +    G+EI  +  ++ A++I    G 
Sbjct  408   VKGKILVCLRGDNARVDKGEQAALCGAVGMVLANNQISGNEILADPHVLPASHINYTDGL  467

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
              A+  YI + ++P+A +  G T  G KP+P MA F+S GP+   P ILKPDITAPG++++
Sbjct  468   -ALFSYINSTRSPIAYITKGTTELGTKPAPFMAAFSSNGPNTLNPEILKPDITAPGVSVI  526

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AA++EA  P  Q  D R V +N +SGTSMSCPHVS VV LLK +HP WS AAIKSAI+TT
Sbjct  527   AAYTEAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGVVGLLKTLHPHWSPAAIKSAIITT  586

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIG---  545
             A T++   + + +A    A PF+YG GHIQP++A DPGLVYD +  DYL F+C ++G   
Sbjct  587   AKTRDNTMKPLTNASYSKATPFNYGGGHIQPNRAMDPGLVYDLSANDYLDFLC-ALGYNA  645

Query  544   ------TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                   +    +YKC +   S  + NYPS+ +  LKG++ V R V NVG+   TY   V+
Sbjct  646   TQIQQFSNESQTYKC-RDPISLIDFNYPSITVPSLKGTVTVSRKVKNVGTPG-TYKARVR  703

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             +P G SV++ P  L+F   GE++  +    +     V ++ FG   WSDG H V+S IVV
Sbjct  704   SPRGISVRVEPNSLRFEREGEEK-GYRVTLMAKKSGVRDYVFGQLTWSDGRHYVRSSIVV  762



>ref|XP_006377331.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
 gb|ERP55128.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
Length=746

 Score =   443 bits (1140),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 364/597 (61%), Gaps = 34/597 (6%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  KGYEA  G P++ + +  ++RD  GHGTHT ST GGR V+ A+ LG  
Sbjct  160   CNRKLIGARYFNKGYEAALGRPLDSSNN--TARDTDGHGTHTLSTAGGRFVSGANFLGS-  216

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
             A G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV ++S+SLG  
Sbjct  217   AYGTAKGGSPNARVASYKVCWPS---------CYDADILAAFDAAIQDGVDILSISLGRA  267

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS---VTNVAPWIFTVGASSIDRVF  1403
                 YF + G+A+G+  A+K  I VV SAGN  +  S    +NVAPW+ TV AS+IDR F
Sbjct  268   LAIPYF-RYGIAIGSFQAVKNGILVVCSAGNSGQFLSFGTTSNVAPWVLTVAASTIDREF  326

Query  1402  SAPVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVK  1232
              + V+LGNN   KG S     +  ++  P+VY+ D ++   S  +   C  ++L P KV+
Sbjct  327   PSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKVANASAQLAQLCYPESLDPTKVR  386

Query  1231  GKVVFCLTG---GLSQTLEVERAGGAAVILGSIGSEIQV--ESFLITATNIFNPSGTDAI  1067
             GK+V+CL G    + ++L V +AGG  +IL    +E     + F +  T+I +     ++
Sbjct  387   GKIVYCLRGMIPDVEKSLVVAQAGGVGMILADQSAESSSMPQGFFV-PTSIVSAIDGLSV  445

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
             L YI + K+PVA  I G T  G   +P MA F+S GP+   P ILKPDITAPG++ILAA+
Sbjct  446   LSYIYSTKSPVA-YISGSTEIGKVVAPVMAFFSSTGPNEITPEILKPDITAPGVSILAAY  504

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             ++A   L +  D R + +N+ISGTSM+CPHVS +  LLK +HPDWS AAIKSAIMTTA T
Sbjct  505   TKAPRRLSRLIDQRPLSFNVISGTSMACPHVSGIAGLLKTMHPDWSPAAIKSAIMTTART  564

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIG  545
              +   + I  A    A PF+YG+GH++P++A DPGLVYD T  DYL F+CS       + 
Sbjct  565   CSNARQPIVKASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMS  624

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
               ++  Y CP K  S  N NYPS+ +  L G++ + RT+ NVG+    Y+V VK P G  
Sbjct  625   IFIEEPYACPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGTPG-LYTVRVKKPDGIL  683

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             VK+ P  LKF ++ E+++F V +K         + FG   WSDG+H V+SPIVV  A
Sbjct  684   VKVEPESLKFSKLNEEKTFKVMLKAMDNWFDSSYVFGGLTWSDGVHHVRSPIVVRKA  740



>gb|KDO42093.1| hypothetical protein CISIN_1g038881mg [Citrus sinensis]
Length=794

 Score =   445 bits (1144),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 266/597 (45%), Positives = 354/597 (59%), Gaps = 30/597 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  GP+N +FD  + RD  GHGTHT ST GG  VA AS  G   
Sbjct  210   CNRKLIGARYFNKGYAAAVGPLNSSFD--TPRDKDGHGTHTLSTAGGNFVAKASVFG-LG  266

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  P
Sbjct  267   KGTAKGGSPKARVAAYKVCWP----PVTGNECYDADILAAFDMAIHDGVDVLSVSLGGGP  322

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSAP  1394
                 F  D  A+G+ HA+K  + V+ SAGN     S V+N+APW  TVGAS++DR F + 
Sbjct  323   SK--FFNDSTAIGSFHAVKHGMVVICSAGNSGPTDSTVSNIAPWQITVGASTMDRDFPSY  380

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGKV  1223
             V++ NN   KG+S++   +   +  PL+  A       ST +   C   TL P+KVKGK+
Sbjct  381   VVVSNNKRYKGQSLSSKGLPSNKLFPLISAADAKAANASTEVALLCEAGTLDPKKVKGKI  440

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G    + +  +   AG   ++L +    G+E+  +  L+ A++I    G D + +
Sbjct  441   LVCLRGDNARIDKGQQALLAGAVGMVLANAQENGNELLADPHLLPASHINFTDGAD-LFR  499

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
              + + K PV  L    T  G KP+P MA F+S GPS   P ILKPDITAPG+ I+AA++E
Sbjct  500   DVNSTKRPVGYLTRATTELGLKPAPIMAAFSSKGPSSVAPEILKPDITAPGVTIIAAYTE  559

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A+ P  +  D R + +N +SGTSMSCPHVS +V LLK +HP+WS AAIKSAIMTTA+ ++
Sbjct  560   AAGPTNEDYDRRRIPFNALSGTSMSCPHVSGIVGLLKTLHPEWSPAAIKSAIMTTASIQD  619

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
                  I +A    A PF YGAGHIQP+ A DPGLVYD T  DYL F+C      + I   
Sbjct  620   NNKGQILNASSYKATPFSYGAGHIQPNLAMDPGLVYDLTENDYLNFLCALGYNKTQIALF  679

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              D +Y+CP+  S+ +N NYPS+ + +L GS++V RTV NVGS   TY   V+ P G SV 
Sbjct  680   SDKTYRCPEYVST-ANFNYPSITVPKLSGSIIVSRTVRNVGSPG-TYIARVRNPKGISVS  737

Query  358   ISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDG-IHMVKSPIVVSSA  194
             + P  LKF+ VG EK         +      ++ FG   W+D   H V+SPIVV+ A
Sbjct  738   VEPRSLKFLRVGEEKNFKVTIKVRKVRAATKDYVFGDLVWADDKQHQVRSPIVVNPA  794



>ref|XP_010542042.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=772

 Score =   444 bits (1142),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 263/596 (44%), Positives = 357/596 (60%), Gaps = 28/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  G +N TFD  S RD+ GHG+HT ST GG  V  AS  G F
Sbjct  188   HCNRKLIGARYFHKGYSAAVGRLNATFD--SPRDLDGHGSHTLSTAGGAFVPRASVFG-F  244

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +K   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  245   GNGTAKGGSPRARVAAYKVCWP----PVKGNECYDADVLAAFDAAIHDGADVISVSLGGE  300

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA++R + VV SAGN   E  +  N+APW  TVGAS++DR F++
Sbjct  301   PSP--FFNDSVAIGSFHAVRRGVVVVCSAGNSGPEDGTAANLAPWQITVGASTMDREFAS  358

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGK  1226
              ++LGN    KG+S++   ++  +  P++ A   +    S++    C+  +L P K KGK
Sbjct  359   HLVLGNKKHFKGQSLSSSALQHAKFYPIISASTAKAKNTSSSDAQLCKLGSLDPVKAKGK  418

Query  1225  VVFCL---TGGLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL    G + +   V  AGG  ++L     +G+++  ++ ++ AT+I    G  ++ 
Sbjct  419   ILVCLRGLNGRVEKGQTVALAGGVGMVLVNTNVMGNDLTADAHVLPATHITYKDGV-SLS  477

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
             +Y+   +NPVA + P +TI G KP+P +A F+S GP+   P ILKPDI APG++++AA++
Sbjct  478   RYLSQTQNPVAHITPPRTILGTKPAPVVAAFSSKGPNIVTPEILKPDIIAPGVSVIAAYT  537

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA SP  +  D R V +N +SGTSMSCPH+S +V LLK ++P WS AAI SAIMTTATT 
Sbjct  538   EAVSPTNEEFDERRVMFNAVSGTSMSCPHISGIVGLLKTLYPSWSPAAIHSAIMTTATTM  597

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGT  542
             +     I++A    A PF YGAGH++P+ A DPGLVYD T  DYL F+CS       +  
Sbjct  598   DDIPGPIRNATDMTATPFSYGAGHVRPNLAMDPGLVYDLTIKDYLNFLCSLGYNSTQMSV  657

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                 S+ CP    S  +LNYPS+ +  L   + VKRT+ NVG    TY+V V  P G SV
Sbjct  658   FSGKSFACPNPKPSALDLNYPSITVPNLSSVVTVKRTLKNVGKPG-TYAVHVTNPKGVSV  716

Query  361   KISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              + P  LKF + G EK      VK  +      + FG   WSD  H V+SPIVV +
Sbjct  717   SVKPKGLKFTKDGEEKSFRVTLVKKGNGDVAKGYGFGELVWSDKEHYVRSPIVVRT  772



>ref|XP_007217687.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
 gb|EMJ18886.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
Length=773

 Score =   444 bits (1142),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 274/600 (46%), Positives = 366/600 (61%), Gaps = 35/600 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             +CNRK+IGARY  KGY A  G +N +FD  S RD  GHG+HT ST GG  V  AS  G F
Sbjct  189   YCNRKLIGARYFNKGYAAVAGTLNSSFD--SPRDNEGHGSHTLSTAGGNFVTGASVFG-F  245

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +    C + D+LAAFD A+ DGV V+SVSLG  
Sbjct  246   GNGTAKGGSPKARVAAYKVCWP----PVNGDECFEADILAAFDIAIHDGVDVLSVSLGGD  301

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  DGVA+GA HA+K  I VV SAGN      +V++VAPW  TVGAS+IDR F +
Sbjct  302   PTA--FFNDGVAIGAFHAVKHGIVVVCSAGNSGPAEGTVSSVAPWQITVGASTIDREFPS  359

Query  1396  PVLLGNNLLVKGESVTEIKKQETLP-------LVYAGDVEIPGSTTIPGFCRQDTLSPEK  1238
              V LGN    +G+S++     E LP       +  A       S      C+  TL  +K
Sbjct  360   YVTLGNWKHFRGQSLSP----EALPGKRFYQLISAADAKAANASVQEALLCKAGTLDLKK  415

Query  1237  VKGKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGT  1076
             VKGK++ CL G  ++  + E+A   G   +IL +    G+E+  +  ++ A++I N +  
Sbjct  416   VKGKILACLRGESARVDKGEQALLAGAVGMILANDELSGNEVISDPHVLPASHI-NFTDG  474

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               +  YI + K+P A +    T  G KP+P MA F+S GP+   P+ILKPDITAPG+NI+
Sbjct  475   ALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAAFSSKGPNTITPDILKPDITAPGVNII  534

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AA++EA  P  Q  D R V +N +SGTSMSCPH+S +  LLK ++P WS AAIKSAIMTT
Sbjct  535   AAYTEAQGPTNQMFDERRVLFNSVSGTSMSCPHISGICGLLKTLYPHWSPAAIKSAIMTT  594

Query  715   ATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS-----  551
             ATT++   E + +A    A PF YGAGH+ P+ A DPGLVYD +  DYL F+CS+     
Sbjct  595   ATTQDNSREPVLNASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFLCSNGYNKR  654

Query  550   -IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPT  374
              I    + +YKCPK A S +NLNYPS+ + +L GS+VV RTV NVG+   TY   ++ P 
Sbjct  655   QIEMVSEETYKCPKPAISRTNLNYPSITVPKLNGSLVVTRTVKNVGTPG-TYKARIQNPD  713

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             G SV + P +L+F ++GE++SF + ++V+  K    + FG   WSDG H V+SPIVV  A
Sbjct  714   GISVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGKHYVRSPIVVKVA  773



>gb|KEH35215.1| subtilisin-like serine protease [Medicago truncatula]
Length=634

 Score =   439 bits (1130),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 268/598 (45%), Positives = 370/598 (62%), Gaps = 30/598 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             S HCNRK+IGARY  KGY +    P+N +F+  + RD  GHG+HT ST GG  V   S  
Sbjct  49    SFHCNRKLIGARYFNKGYASRLTVPLNSSFE--TPRDNEGHGSHTLSTAGGNMVPGVSVF  106

Query  1762  G-GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             G G+  G A GG+P  R+A YK CW      I    C D D+LAAFD A+ DGV V+SVS
Sbjct  107   GQGY--GTAKGGSPKARVASYKVCWP----PINGDECFDADILAAFDAAIHDGVDVLSVS  160

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG     N F  D VA+G+ HA K+ I VV SAGN      + +N+APW  TVGAS++DR
Sbjct  161   LGG-SASNLF-NDSVAIGSFHAAKKGIVVVCSAGNSGPNDATASNLAPWYITVGASTMDR  218

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPG-FCRQDTLSPEKV  1235
              F + V+LGNNL  KGES++  +  +   P++ A D ++  +T      C+  TL P+KV
Sbjct  219   EFPSYVVLGNNLTFKGESLSAARLADKFYPIIKATDAKLASATNEDAVLCQNGTLDPKKV  278

Query  1234  KGKVVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTD  1073
             KGK+V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I    G +
Sbjct  279   KGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINFSDGVE  338

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              +  Y+ ++K+PVA +    T    KP+P MA F+S GP+   P ILKPDITAPG++++A
Sbjct  339   -VFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIA  397

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++EA  P  Q  D+R +++N +SGTSMSCPH+S +V LL++++P W+ AAIKSAIMTTA
Sbjct  398   AYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTA  457

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT + K E I +A    A PF YGAGH+QP+ A DPGLVYD T  DY  F+C      + 
Sbjct  458   TTLDNKAEPIMNATKSQATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQ  517

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             +       YKC K  S   NLNYPS+ +  L GS+ V RT+ NVG A  TY V V++P+G
Sbjct  518   MSLFSKGPYKCHKNFSI-LNLNYPSITVPNLSGSVTVTRTLKNVG-APGTYIVHVQSPSG  575

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              ++ + P  L+F +VGE++ F V +KV+  K    + FG   WSDG H VKSP+VV +
Sbjct  576   ITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVKA  633



>gb|KGN43389.1| hypothetical protein Csa_7G030520 [Cucumis sativus]
Length=736

 Score =   443 bits (1139),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 262/596 (44%), Positives = 359/596 (60%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY +  GP+N +F   S RD  GHG+HT ST GG  VA AS  G
Sbjct  150   SFHCNRKLIGARYFNKGYASVVGPLNSSF--HSPRDKEGHGSHTLSTAGGNFVAGASVFG  207

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
                 G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG
Sbjct  208   -LGKGTAKGGSPRARVAAYKVCWPPK----AGNECFDADILAAFDFAIHDGVDVLSVSLG  262

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVF  1403
               P  N    D VA+G+ HA+K  I V+ SAGN      +VTNVAPW  TVGAS++DR F
Sbjct  263   GDP--NPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQITVGASTMDRKF  320

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V+LGN   ++GES+++  +  ++  PL+ A DV +  ++      C+  TL+P K K
Sbjct  321   PSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRLANASVHEAQLCKAGTLNPMKAK  380

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G A +IL +    G+EI  +  ++ A++I N +   A
Sbjct  381   GKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVLPASHI-NFTDGSA  439

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K P A + P  T  G +P+P MA F+S+GP+   P ILKPDITAPGL+++AA
Sbjct  440   VFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAA  499

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D+R + +N +SGTSMSCPHVS +  LLK ++P WS AAIKSAIMTTA+
Sbjct  500   YTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAAIKSAIMTTAS  559

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
               +   E + +A   VA PF+YGAGH+ P+ AADPGLVYD    +YL F+C      + I
Sbjct  560   ILDNNFEPLLNASYSVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFLCALGYNKAQI  619

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 +  + C     SP+NLNYPS+ + +L  S+ + R + NVGS   TY  E++ P G 
Sbjct  620   SQFSNGPFNC-SDPISPTNLNYPSITVPKLSRSITITRRLKNVGSPG-TYKAEIRKPAGI  677

Query  367   SVKISPTELKFMEVGEK-QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV + P +L F  +GE+     +    E       + +G   WSDG H V+SPIVV
Sbjct  678   SVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHHVRSPIVV  733



>gb|KEH35216.1| subtilisin-like serine protease [Medicago truncatula]
Length=649

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 268/598 (45%), Positives = 370/598 (62%), Gaps = 30/598 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             S HCNRK+IGARY  KGY +    P+N +F+  + RD  GHG+HT ST GG  V   S  
Sbjct  64    SFHCNRKLIGARYFNKGYASRLTVPLNSSFE--TPRDNEGHGSHTLSTAGGNMVPGVSVF  121

Query  1762  G-GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             G G+  G A GG+P  R+A YK CW      I    C D D+LAAFD A+ DGV V+SVS
Sbjct  122   GQGY--GTAKGGSPKARVASYKVCWP----PINGDECFDADILAAFDAAIHDGVDVLSVS  175

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG     N F  D VA+G+ HA K+ I VV SAGN      + +N+APW  TVGAS++DR
Sbjct  176   LGG-SASNLF-NDSVAIGSFHAAKKGIVVVCSAGNSGPNDATASNLAPWYITVGASTMDR  233

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPG-FCRQDTLSPEKV  1235
              F + V+LGNNL  KGES++  +  +   P++ A D ++  +T      C+  TL P+KV
Sbjct  234   EFPSYVVLGNNLTFKGESLSAARLADKFYPIIKATDAKLASATNEDAVLCQNGTLDPKKV  293

Query  1234  KGKVVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTD  1073
             KGK+V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I    G +
Sbjct  294   KGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINFSDGVE  353

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              +  Y+ ++K+PVA +    T    KP+P MA F+S GP+   P ILKPDITAPG++++A
Sbjct  354   -VFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIA  412

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++EA  P  Q  D+R +++N +SGTSMSCPH+S +V LL++++P W+ AAIKSAIMTTA
Sbjct  413   AYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTA  472

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT + K E I +A    A PF YGAGH+QP+ A DPGLVYD T  DY  F+C      + 
Sbjct  473   TTLDNKAEPIMNATKSQATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQ  532

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             +       YKC K  S   NLNYPS+ +  L GS+ V RT+ NVG A  TY V V++P+G
Sbjct  533   MSLFSKGPYKCHKNFSI-LNLNYPSITVPNLSGSVTVTRTLKNVG-APGTYIVHVQSPSG  590

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              ++ + P  L+F +VGE++ F V +KV+  K    + FG   WSDG H VKSP+VV +
Sbjct  591   ITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVKA  648



>ref|XP_010693559.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Beta vulgaris subsp. vulgaris]
Length=1098

 Score =   452 bits (1163),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 267/598 (45%), Positives = 371/598 (62%), Gaps = 30/598 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGAR+  KGY+A  G V +  +  S+RD  GHG+HT ST GG  V+ A+ + G 
Sbjct  512   HCNRKLIGARHFNKGYKAFGGEVENFME--SARDYDGHGSHTLSTAGGNFVSGAN-MNGL  568

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G+  GG+P  R+A YK CW      I    C D D++AAFD A+ D V V+SVSLG  
Sbjct  569   PLGIVKGGSPRARVASYKVCWT----PINGNECFDSDIMAAFDMAIHDRVDVLSVSLGGD  624

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P D YF +DG+A+G+ HA++  IAVV SAGN    P SV+NVAPWI TVGAS++DR F +
Sbjct  625   PTD-YF-EDGLAIGSFHAVQNGIAVVCSAGNSGPTPGSVSNVAPWILTVGASTMDREFQS  682

Query  1396  PVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGKV  1223
              V LG+    KG S+++   + TL PL+ A   ++  ++      C+  TL  +KVKGK+
Sbjct  683   FVELGDGHRFKGTSLSKALPKNTLYPLMSAAQAKLANASASDALLCKPGTLDEKKVKGKI  742

Query  1222  VFCLTGG---LSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL GG   + + ++ + AG A +IL +    G+E+  +  ++ A +I    G+ A+ K
Sbjct  743   LACLRGGNARVDKGMQAKLAGAAGMILCNDELDGNEVIADLHVLPAAHISYADGS-AVFK  801

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI +   P+  L   K  F  KP+P MA F+S GP+   P +LKPDITAPG++++AA+S+
Sbjct  802   YINSTAKPMGYLTHSKATFDVKPAPYMAAFSSKGPNTVTPELLKPDITAPGVDVIAAYSQ  861

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A SP ++P DHR V Y + SGTSMSCPH+S +V LLK +HP WS AAI+SAIMTTA T++
Sbjct  862   AVSPTDEPSDHRRVSYMMDSGTSMSCPHISGIVGLLKTLHPTWSPAAIRSAIMTTARTRD  921

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTT  539
                  ++DA    A PF YGAGH++P++A DPGL+YD    DYL F+CS      +I T 
Sbjct  922   NTINPMEDANYAKATPFGYGAGHVRPTRAMDPGLIYDLNATDYLQFLCSIGYNKTTIETF  981

Query  538   LDPSYKCPKKASSPSNL---NYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
              + S+KC K + +  NL   NYPS+ + +L GS+ V RTV NVGS    Y   V+ P   
Sbjct  982   YNGSHKCSKSSYNKENLLNFNYPSITVPKLSGSVTVTRTVKNVGSPG-VYVARVRQPLRV  1040

Query  367   SVKISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             SV ++P  +KF +VG EK+            K  E+ FG   WSDG H V+SPIVV++
Sbjct  1041  SVTVTPKMMKFEKVGEEKKFKVTLTSKVRGGKSEEYRFGELLWSDGKHYVRSPIVVAA  1098



>ref|XP_004144624.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=758

 Score =   442 bits (1138),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 262/596 (44%), Positives = 359/596 (60%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY +  GP+N +F   S RD  GHG+HT ST GG  VA AS  G
Sbjct  172   SFHCNRKLIGARYFNKGYASVVGPLNSSF--HSPRDKEGHGSHTLSTAGGNFVAGASVFG  229

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
                 G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG
Sbjct  230   -LGKGTAKGGSPRARVAAYKVCWPPK----AGNECFDADILAAFDFAIHDGVDVLSVSLG  284

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVF  1403
               P  N    D VA+G+ HA+K  I V+ SAGN      +VTNVAPW  TVGAS++DR F
Sbjct  285   GDP--NPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQITVGASTMDRKF  342

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V+LGN   ++GES+++  +  ++  PL+ A DV +  ++      C+  TL+P K K
Sbjct  343   PSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRLANASVHEAQLCKAGTLNPMKAK  402

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G A +IL +    G+EI  +  ++ A++I N +   A
Sbjct  403   GKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVLPASHI-NFTDGSA  461

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K P A + P  T  G +P+P MA F+S+GP+   P ILKPDITAPGL+++AA
Sbjct  462   VFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAA  521

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D+R + +N +SGTSMSCPHVS +  LLK ++P WS AAIKSAIMTTA+
Sbjct  522   YTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAAIKSAIMTTAS  581

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
               +   E + +A   VA PF+YGAGH+ P+ AADPGLVYD    +YL F+C      + I
Sbjct  582   ILDNNFEPLLNASYSVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFLCALGYNKAQI  641

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 +  + C     SP+NLNYPS+ + +L  S+ + R + NVGS   TY  E++ P G 
Sbjct  642   SQFSNGPFNCSDPI-SPTNLNYPSITVPKLSRSITITRRLKNVGSPG-TYKAEIRKPAGI  699

Query  367   SVKISPTELKFMEVGEK-QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV + P +L F  +GE+     +    E       + +G   WSDG H V+SPIVV
Sbjct  700   SVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKNYVYGDLIWSDGKHHVRSPIVV  755



>ref|XP_002299064.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
 gb|EEE83869.1| hypothetical protein POPTR_0001s47300g [Populus trichocarpa]
Length=810

 Score =   444 bits (1142),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 274/597 (46%), Positives = 365/597 (61%), Gaps = 30/597 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CN+K+IGARY  KG+ A+  P     ++ ++RD  GHG+HT ST GG  V  AS  G + 
Sbjct  226   CNKKLIGARYFNKGF-ASASPTPIPTEWNTARDTEGHGSHTLSTAGGSFVPGASIFG-YG  283

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P   +A YK CW  P D+     C D D+LAAFD A+ DGV VIS+SLG   
Sbjct  284   NGTAKGGSPKAHVAAYKVCW--PSDN---GGCFDADILAAFDAAIGDGVDVISMSLGPH-  337

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY--SVTNVAPWIFTVGASSIDRVFSA  1397
             Q   F QDG+A+G+ +A+K+ I VV SAGN   P   SV + APW+FT+GAS++DR FSA
Sbjct  338   QAVEFLQDGMAIGSFNAIKKGIPVVASAGN-SGPVAGSVAHGAPWLFTIGASTLDREFSA  396

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              V LGN    KG SV    +   +  PL+ A +  +P +       C+  TL P+KV GK
Sbjct  397   TVTLGNKKFFKGSSVASKGLPAGKFYPLINAAEARLPTAPAADAQLCQNGTLDPKKVAGK  456

Query  1225  VVFCLTGGLSQTL---EVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  S+ +   E E AG   +IL +    GSEI  +  ++ A ++    G  A++
Sbjct  457   IIVCLRGINSRVVKGHEAELAGAVGMILANDEESGSEILSDPHMLPAAHLTFTDG-QAVM  515

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + KNP A++ P  T  G  P+P MA F+S GPS  EP ILKPD+TAPG++++AA++
Sbjct  516   NYIKSTKNPTASISPVHTDLGVVPNPVMAAFSSRGPSLIEPAILKPDVTAPGVDVIAAYT  575

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P E P D R   Y  +SGTSMSCPHVS +V LL+AIHPDWS AA+KSAIMTTA T 
Sbjct  576   EALGPSELPFDKRRTPYITMSGTSMSCPHVSGIVGLLRAIHPDWSPAALKSAIMTTAKTI  635

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS------IGT  542
             +   + I DA G+ A PF YGAGH+ P++AADPGLVYD+  +DYL F+C+       I  
Sbjct  636   SNSKKRILDADGQPATPFAYGAGHVNPNRAADPGLVYDTNEIDYLNFLCAHGYNSTFIIE  695

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                  YKCP+ AS  +  NYPS+ +  L G + V R V NVG A  TY+V+ KAP   SV
Sbjct  696   FSGVPYKCPENASL-AEFNYPSITVPDLNGPVTVTRRVKNVG-APGTYTVKAKAPPEVSV  753

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGI-HMVKSPIVVSSA  194
              + P+ L+F + GE++ F V+ K        ++ FG   WSD   H VKSP+VV  A
Sbjct  754   VVEPSSLEFKKAGEEKIFKVTFKPVVNGMPKDYTFGHLTWSDSNGHHVKSPLVVKHA  810



>ref|XP_007214967.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
 gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
Length=773

 Score =   443 bits (1139),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 272/596 (46%), Positives = 369/596 (62%), Gaps = 27/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             +CNRK+IGARY  KGY A  G +N +FD  S RD  GHG+HT ST GG  V  AS  G F
Sbjct  189   YCNRKLIGARYFNKGYAAVAGTLNSSFD--SPRDNVGHGSHTLSTAGGNFVTGASVFG-F  245

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +    C + D+LAAFD A+ DGV V+SVSLG  
Sbjct  246   GNGTAKGGSPKARVAAYKVCWP----PVNGRECYEADILAAFDIAIHDGVDVLSVSLGGN  301

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  DGVA+GA HA+K  I VV SAGN      +V+NVAPW  TVGAS+IDR F +
Sbjct  302   PSA--FFNDGVAIGAFHAVKHGIVVVCSAGNSGPAEGTVSNVAPWQITVGASTIDREFPS  359

Query  1396  PVLLGNNLLVKGESVTEIK--KQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGK  1226
              V LGN    +G+S++ +    +   PL+ A D +   ++      C+  TL  +KVKGK
Sbjct  360   YVTLGNWKHFRGQSLSPVALPGKRFYPLISAADAKAANASVQEALLCKAGTLDLKKVKGK  419

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  ++  + E+A   G   +IL +    G+EI  +  ++ A++I N +    + 
Sbjct  420   ILACLRGDSARVDKGEQALLAGAVGMILANDELSGNEIISDPHVLPASHI-NFTDGALVF  478

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+P A +    T  G KP+P MA F+S GP+   P+ILKPDITAPG++I+AA++
Sbjct  479   AYINSTKSPRAYIKRPTTQLGTKPAPFMAEFSSKGPNTITPDILKPDITAPGVSIIAAFT  538

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R V +N +SGTSMSCPH+S +  LLK ++P WS AAIKSAIMTTATT+
Sbjct  539   EAQGPTNQMFDKRRVLFNSLSGTSMSCPHISGICGLLKTLYPHWSPAAIKSAIMTTATTQ  598

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS------IGT  542
             +   E + +A    A PF YGAGH+ P+   DPGLVYD +  DYL F+CS+      I  
Sbjct  599   DNSREPVLNASFYRATPFSYGAGHVNPNSVMDPGLVYDLSLNDYLNFLCSNGYNKTQIEM  658

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               + +YKCPK A S +NLNYPS+ + +L GS+VV RTV NVG+   TY   ++ P G  V
Sbjct  659   VSEETYKCPKPAISGTNLNYPSITVPKLDGSLVVTRTVKNVGTPG-TYKARIQNPDGILV  717

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              + P +L+F ++GE++SF + ++V+  K    + FG   WSDG H V+SPIVV +A
Sbjct  718   SVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGKHYVRSPIVVKAA  773



>gb|KDP32632.1| hypothetical protein JCGZ_13182 [Jatropha curcas]
Length=769

 Score =   442 bits (1138),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 268/599 (45%), Positives = 373/599 (62%), Gaps = 30/599 (5%)
 Frame = -2

Query  1942  TSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             T   CNRK+IGAR+  KGY +  GP+N TF+  ++RD SGHGTHT ST GG  VA A+  
Sbjct  180   TGVRCNRKLIGARHFNKGYASFVGPLNSTFN--TARDHSGHGTHTLSTAGGGFVAGANVF  237

Query  1762  GGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSL  1583
             G   NG A GG+P  R+A YK CW  P +   +  C D D++A F+ A++DGV V+SVSL
Sbjct  238   GN-GNGTAKGGSPFARVAAYKVCWP-PVNG--SGECFDADIIAGFEAAISDGVDVLSVSL  293

Query  1582  GLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRV  1406
             G  P +  +++D +A+GA HA+ +   VV SAGN   EP +V+N APWI TVGAS+IDR 
Sbjct  294   GAEPTE--YSEDLIAIGAFHAVMKGTVVVASAGNSGPEPQTVSNTAPWIITVGASTIDRE  351

Query  1405  FSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKV  1235
             F+  V LG+   +KG S++E  +  ++  P++     + P  + +    C  + L P+KV
Sbjct  352   FTTYVALGSKRHLKGTSLSERGLPAEKFYPMITGEHAKNPNVSALEAMLCLPEALDPKKV  411

Query  1234  KGKVVFCLTGGLSQTLEVERA---GGAAVIL---GSIGSEIQVESFLITATNIFNPSGTD  1073
             KGK++ CL G + +  + ++A   G   ++L      G+EI  +  ++ A ++ N S  +
Sbjct  412   KGKILVCLRGEIGRVNKGQQALLAGAVGMVLINDEKSGNEILADPHVLPAAHV-NFSDGE  470

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+L YI + K P+A +   +T F  KP+P MA F+S GPSY +P+ILKPDITAPG++I+A
Sbjct  471   AVLAYINSTKVPMAYMTRSRTQFDTKPAPVMAAFSSRGPSYVDPSILKPDITAPGVSIIA  530

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A+S A SP E+  D R + +N  SGTSMSCPHVS +V LLK +HPDWS AAI+SA+MTTA
Sbjct  531   AFSLAVSPTEEDFDKRRIAFNTESGTSMSCPHVSGIVGLLKTLHPDWSPAAIRSALMTTA  590

Query  712   TTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------S  554
              T+    E I D +  + A PF YGAGH+ P+KA DPGL+YD T  DYL F+C      +
Sbjct  591   RTRGNNMEPIIDSSTNKEATPFDYGAGHVNPNKAMDPGLIYDLTENDYLNFLCAKGYNKT  650

Query  553   SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQL--KGSMVVKRTVTNVGSANTTYSVEVKA  380
              I       Y CP K+   ++ NYPS+ I  L   G  V +R V NVGS  + Y   VKA
Sbjct  651   QIRLFSSKPYSCP-KSFKIADFNYPSITIPSLISLGGPVTRR-VKNVGSGPSKYCANVKA  708

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             P G SV + P  L+F + GE++ F V++K     +V ++ FG   WSDG H V+SPIVV
Sbjct  709   PHGVSVLVEPKCLEFEKTGEEKIFKVALKSLVKNEVKDYVFGKLIWSDGKHYVRSPIVV  767



>gb|ACP18876.1| subtilisin-like serine protease [Carica papaya]
Length=771

 Score =   442 bits (1138),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 267/600 (45%), Positives = 367/600 (61%), Gaps = 28/600 (5%)
 Frame = -2

Query  1942  TSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             +S HCNRK+IGAR+  +GY +  G +N +F+  S RD  GHGTHT ST GG  VANAS  
Sbjct  183   SSFHCNRKLIGARFFNRGYASAVGSLNSSFE--SPRDNEGHGTHTLSTAGGNMVANASVF  240

Query  1762  GGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSL  1583
             G    G A GG+P  R+A YK CW      +    C D D+LAAFD A+ D V V+SVSL
Sbjct  241   G-LGKGTAKGGSPRARVAAYKVCWP----PVLGNECFDADILAAFDAAIHDRVDVLSVSL  295

Query  1582  GLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRV  1406
             G       F  D VA+G+ HA+K  I VV SAGN   +  SV+NVAPW  TVGAS++DR 
Sbjct  296   G--GTAGGFFNDSVAIGSFHAVKHGIVVVCSAGNSGPDDGSVSNVAPWQITVGASTMDRE  353

Query  1405  FSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKV  1235
             F + VLLGNN+  KGES+++  +      PL+ A + +   ++      C    L P+KV
Sbjct  354   FPSYVLLGNNMSFKGESLSDAVLPGTNFFPLISALNAKATNASNEEAILCEAGALDPKKV  413

Query  1234  KGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK++ CL G    + +  +   AG   +IL +    G+EI  ++ ++ A++I    G  
Sbjct  414   KGKILVCLRGLNARVDKGQQAALAGAVGMILANSELNGNEIIADAHVLPASHISFTDGL-  472

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             ++ +YI    +PVA +   KT    KP+P MA F+S GP+   P ILKPDITAPG+N++A
Sbjct  473   SVFEYINLTNSPVAYMTRPKTKLPTKPAPVMAAFSSKGPNIVTPEILKPDITAPGVNVIA  532

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++ A  P  Q  D R V++N +SGTSMSCPHVS +V LLK ++P WS AAI+SAIMT+A
Sbjct  533   AYTRAQGPTNQNFDRRRVQFNSVSGTSMSCPHVSGIVGLLKTLYPSWSPAAIRSAIMTSA  592

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +   E+I +A    A PF YGAGH+QP++A +PGLVYD    DYL F+C      + 
Sbjct  593   TTMDNINESILNASNVKATPFSYGAGHVQPNQAMNPGLVYDLNTKDYLKFLCALGYSKTL  652

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             I    +  + CP+   S ++ NYPS+ + +LKG + + R V NVGS  TTY V V+ P G
Sbjct  653   ISIFSNDKFNCPRTNISLADFNYPSITVPELKGLITLSRKVKNVGSP-TTYRVTVQKPKG  711

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSD-GIHMVKSPIVVSSA  194
              SV + P  LKF + GE++SF V++K+++     E+ FG   WSD   H V+SPIVV +A
Sbjct  712   ISVTVKPKILKFKKAGEEKSFTVTLKMKAKNPTKEYVFGELVWSDEDEHYVRSPIVVKAA  771



>ref|XP_004294696.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score =   442 bits (1138),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 269/596 (45%), Positives = 364/596 (61%), Gaps = 27/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KG+ A  G +N +F  +S RD  GHG+HT ST GG  V  AS  G +
Sbjct  187   HCNRKLIGARYFNKGFAAVVGSLNSSF--QSPRDEEGHGSHTLSTAGGNFVTGASVFG-Y  243

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +  + C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  244   GNGTAKGGSPKARVAAYKVCWP----PVNGSECFDADILAAFDMAIHDGVDVLSVSLGGD  299

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA+K  I VV SAGN     S V+NVA W  TVGAS++DR F +
Sbjct  300   PV--AFFNDSVAIGSFHAVKHGIVVVCSAGNSGPADSTVSNVAVWEITVGASTMDREFPS  357

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGK  1226
              + LGN   +KG+S++   ++ +   PL+ A D +   ++      C+  TL PEKVKGK
Sbjct  358   YITLGNWKHLKGQSLSAMALRSKRFYPLISAADAKAANASVHEALLCKAGTLDPEKVKGK  417

Query  1225  VVFCLTGGLSQTLEVER---AGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  ++  + E+   AG   +IL +    G+EI  +  ++ A +I N +    + 
Sbjct  418   ILACLRGDNARVDKGEQSLLAGAVGMILANDEVNGNEIISDPHVLPAAHI-NFTDGALVF  476

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI    +P A +    T+ G KP+P MA F+S GP+   P+ILKPDITAPG++++AA+S
Sbjct  477   AYINETTSPRAYIKRPTTMLGTKPAPFMAAFSSKGPNSITPDILKPDITAPGVSVIAAYS  536

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R + +N +SGTSMSCPH+S +V LLK ++P WS AAIKSAIMTTA T+
Sbjct  537   EAQGPTNQEFDRRRIPFNSVSGTSMSCPHISGIVGLLKTLYPHWSPAAIKSAIMTTAKTQ  596

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   E + +A    A PF YGAGH++P+ A DPGLVYD    DYL  +C      + I T
Sbjct  597   DNNREPLLNASNSEATPFSYGAGHVKPNSAMDPGLVYDLDTDDYLNVLCALGYNKTQIET  656

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                 SYKCP  A S +NLNYPS+ + +L GS+VVKRT+ NVG    TY+  +  P G  V
Sbjct  657   FSQESYKCPSPAISLTNLNYPSITVPKLSGSLVVKRTLKNVGEPG-TYTARITNPDGILV  715

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              + P  LKF +VGE++SF V ++ +       + FG   WSDG H V+SPIVV +A
Sbjct  716   SVEPKSLKFKKVGEEKSFNVVLEAKDSNAAKNYVFGKLIWSDGKHNVRSPIVVKAA  771



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   442 bits (1137),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 275/605 (45%), Positives = 371/605 (61%), Gaps = 43/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+SHCNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  178   FTASHCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  237

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G AP  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  238   LG-YASGTARGMAPRARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  288

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN     +S++NVAPWI TVGA ++DR
Sbjct  289   LGGGMSDYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDR  346

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  347   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMSGTLI  399

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  400   PEKVKGKIVMCDRGVNARVQKGDVVKAAGGLGMILANTAANGEELVADAHLLPATTVGEK  459

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ +P A++    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  460   AG-DIIRHYVTTDPHPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  518

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+
Sbjct  519   NILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSAL  578

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ + D A G+ + PF +GAGH  P+ A +PGL+YD T  DYL F+C   
Sbjct  579   MTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHASPATATNPGLIYDLTTEDYLGFLCALN  638

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                S I      +Y C P K+ S ++LNYPS A+     G+    RTVT+VG A  TYSV
Sbjct  639   YTSSQIRIVSRRNYTCDPSKSYSVADLNYPSFAVNVDGAGAYKYTRTVTSVGGAG-TYSV  697

Query  391   EVKAP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             +V +  TG  + + P  L F    EK+S+ V+  V+S K  G   FG  +WSDG H+V S
Sbjct  698   KVASETTGVKISVEPAVLDFKAANEKKSYTVTFTVDSTKGSGSNSFGSIEWSDGKHVVGS  757

Query  214   PIVVS  200
             P+ +S
Sbjct  758   PVAIS  762



>gb|KDP45154.1| hypothetical protein JCGZ_15019 [Jatropha curcas]
Length=771

 Score =   442 bits (1137),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 262/594 (44%), Positives = 370/594 (62%), Gaps = 27/594 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             +CNRK+IGARY  KGY    GP+N ++D  S RD  GHG+HT ST GG  V++AS  G F
Sbjct  186   YCNRKLIGARYFNKGYATVAGPLNSSYD--SPRDKEGHGSHTLSTAGGNFVSDASVFG-F  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               GVA GGAP  R+A YK C+      I    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  243   GEGVAKGGAPKARVAAYKVCYP----PIGGNECFDADILAAFDSAINDGVDVLSVSLG--  296

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
               +  F  D VA+G+ HA+K  I V+ SAGN      +V+N+APW  TVGAS++DR F +
Sbjct  297   ADNTAFFNDSVAIGSFHAVKNGIVVICSAGNSGPAEATVSNLAPWQITVGASTMDREFPS  356

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGK  1226
              V+LGNN+  KGES++   + K +   ++ A +     ++      C+   L P+K KGK
Sbjct  357   YVVLGNNMTYKGESLSAKALPKNKFFRIISAAEARAANASAQDALLCKAGALDPKKAKGK  416

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILGSIG---SEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  ++  + E+A   G  A++L +     +EI  +  ++ A+++   +G  AI 
Sbjct  417   ILVCLRGSNARVEKGEQAALAGAVAMVLANDKDSENEILADPHVLPASHVNYINGV-AIF  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI   K+ V  +   KT  G KP+P MA F+S GP+   P ILKPDITAPG++++AA++
Sbjct  476   NYINNTKSSVGYITRPKTQVGTKPAPIMAAFSSKGPNTIAPEILKPDITAPGVSVIAAYT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             +A  P  +  D R V++N +SGTSMSCPHVS + ALLK +HP+WS AAIKSA+MTTATT 
Sbjct  536   KAEGPTNEDFDMRRVQFNSMSGTSMSCPHVSGIAALLKTLHPNWSPAAIKSAVMTTATTL  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGT  542
             +   E I +A    A PF YGAGHI+P++A DPGL+YD +  DYL F+C+       I +
Sbjct  596   DNSKEEILNASHSKATPFSYGAGHIRPNEAMDPGLIYDLSVNDYLNFLCTLGYSEAQILS  655

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                 S+KCPKK  S +N NYPS+ I +  GS+ V R V NVG + + Y   +K P+G+S+
Sbjct  656   FSQTSFKCPKKPVSLANFNYPSITIPKFSGSITVTRKVKNVGVSPSIYQAHIKKPSGFSI  715

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSD-GIHMVKSPIVV  203
              + P  LKF ++GE++SF V++K +    + ++ FG   WSD   + V+SPIVV
Sbjct  716   SVEPKVLKFKKIGEEKSFRVTLKSKKSYAIKDYVFGELVWSDSNKYYVRSPIVV  769



>ref|XP_008229767.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=773

 Score =   442 bits (1137),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 270/596 (45%), Positives = 364/596 (61%), Gaps = 27/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             +CNRK+IGARY+ KGY A  G +N +FD  S RD  GHG+HT ST GG  V  AS  G F
Sbjct  189   YCNRKLIGARYYNKGYAAAAGTLNSSFD--SPRDNEGHGSHTLSTAGGNFVTGASVFG-F  245

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +    C + D+LAAFD A+ DGV V+SVSLG  
Sbjct  246   GNGTAKGGSPKARVAAYKVCWP----PVNGNQCFEADILAAFDIAIHDGVDVLSVSLGGD  301

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D +A+GA HA+K  I VV SAGN      +V NVAPW  TVGAS+IDR F +
Sbjct  302   PSA--FFNDSIAIGAFHAVKHGIVVVCSAGNSGPAEGTVCNVAPWQITVGASTIDREFPS  359

Query  1396  PVLLGNNLLVKGESVTEIK---KQETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEKVKGK  1226
              V LGN    +G+S++ +    K+    +  A       S      C+  TL  +KVKGK
Sbjct  360   YVTLGNWKHFRGQSLSPVALPGKRFYRLISAADAKAANASVQEALLCKAGTLDLKKVKGK  419

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  +   + E+A   G   +IL +    G+EI  +  ++ A++I N +    + 
Sbjct  420   ILACLQGDSATVDKGEQALLAGAVGMILANDELSGNEIISDPHVLPASHI-NFTDGALVF  478

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+P A +    T  G KP+P MA F+S GP+   P+ILKPDITAPG++I+AA++
Sbjct  479   AYINSTKSPRAYIKRPTTQLGTKPAPVMAAFSSKGPNTITPDILKPDITAPGVSIIAAYT  538

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R V +N +SGTSMSCPH+S +  LLK ++P WS AAIKSAIMTTATT+
Sbjct  539   EAQGPTNQMFDKRRVLFNSVSGTSMSCPHISGICGLLKTLYPHWSPAAIKSAIMTTATTQ  598

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS------IGT  542
             +   E + +A    A PF YGAGH+ P+ A DPGLVYD +  DYL F+CS+      I  
Sbjct  599   DNSREPLLNASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFLCSNGYNKTQIEM  658

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               + +Y+CPK A S +NLNYPS+ + +L GS+VV RTV NVG+   TY   ++ P G SV
Sbjct  659   VSEEAYECPKPAVSLTNLNYPSITVPKLNGSLVVTRTVKNVGTPG-TYKARIQNPDGISV  717

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              + P +L+F ++GE++SF + ++V   K    + FG   WSDG H V+SPIVV +A
Sbjct  718   SVEPNKLEFKKIGEEKSFKLLLQVIDAKAAKNYVFGKLIWSDGKHYVRSPIVVKAA  773



>ref|XP_002313670.2| hypothetical protein POPTR_0009s14680g, partial [Populus trichocarpa]
 gb|EEE87625.2| hypothetical protein POPTR_0009s14680g, partial [Populus trichocarpa]
Length=689

 Score =   439 bits (1130),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 260/600 (43%), Positives = 347/600 (58%), Gaps = 40/600 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH---TFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FTS++CNRK++GAR++ KG+EA  GP+     TF FRS+RD  GHG+HTAST+ G  V+N
Sbjct  112   FTSANCNRKVVGARFYFKGFEAENGPLEDFGGTF-FRSARDSDGHGSHTASTIAGAVVSN  170

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
              S L G A G A GGAP  RLAIYKACW           C D D+L+A D A+ DGV ++
Sbjct  171   VS-LFGMARGTARGGAPYARLAIYKACW--------FNLCNDADILSAMDDAINDGVDIL  221

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+S G  P +  + +   ++GA HA ++ I V  SAGN   P +  NVAPWI TV ASS+
Sbjct  222   SLSFGANPPEPIYFESATSVGAFHAFRKGIVVSSSAGNSFSPKTAANVAPWILTVAASSL  281

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPEK  1238
             DR F + + LGN+ ++KG S+  +K + +  L+   D  +PG T     FC+ +TL P K
Sbjct  282   DREFDSNIYLGNSQILKGFSLNPLKMETSYGLIAGSDAAVPGVTAKNASFCKDNTLDPAK  341

Query  1237  VKGKVVFCLTGGL-----SQTLEVERAGGAAVIL-GSIGSEIQVESFLITATNIFNPSGT  1076
              KGK+V C+T  L      + + V+  GG  +IL   I  EI  +S  +  + +      
Sbjct  342   TKGKIVVCITEVLIDDPRKKAVAVQLGGGVGIILIDPIVKEIGFQS--VIPSTLIGQEEA  399

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
               +  Y+   K     + P  T+   KP+P +  F+S GP+   P+I+KPDITAPGLNIL
Sbjct  400   QQLQAYMQAQK-----IAPTVTVLNTKPAPKVTVFSSQGPNIITPDIIKPDITAPGLNIL  454

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWS  S+        RSV YNIISGTSMSCPHVSAV A+LK+  P WS AAIKSAIMTT
Sbjct  455   AAWSPVST---DDAAGRSVNYNIISGTSMSCPHVSAVAAILKSYRPSWSPAAIKSAIMTT  511

Query  715   ATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS----  551
             A   +   + I +D     A PF YG+GHI P  A +PGLVYD    D + F+CS+    
Sbjct  512   AIVMDNTRKLIGRDPDDTQATPFDYGSGHINPLAALNPGLVYDFDSNDVINFLCSTGARP  571

Query  550   ---IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKA  380
                   T  P+Y CPK+     + NYPS+ ++ + GS+ V RTVT  G+  T Y  +V  
Sbjct  572   AQLKNLTGQPTY-CPKQTKPSYDFNYPSIGVSNMNGSISVYRTVTYYGTGQTVYVAKVDY  630

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
             P G  V ++P  LKF + GEK   F           G F FG   WS GIH V+SPI ++
Sbjct  631   PPGVQVTVTPATLKFTKTGEK-LSFKIDFKPLKTSDGNFVFGALTWSSGIHKVRSPIALN  689



>ref|XP_009136129.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=775

 Score =   442 bits (1136),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 268/596 (45%), Positives = 361/596 (61%), Gaps = 32/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  GP+N +FD  S RDI GHG+HT ST GG  V  A+  G  
Sbjct  191   HCNRKLIGARYFHKGYAAAVGPLNSSFD--SPRDIDGHGSHTLSTPGGAFVPRANVFGQ-  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +K   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  248   GNGTAKGGSPRARVAAYKVCWP----PVKGNECYDADVLAAFDAAIHDGADVISVSLGGE  303

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSA  1397
             P    F +D VA+G+ HA K+ I VV SAGN     S V+NVAPW  TVGAS++DR F++
Sbjct  304   PAS--FFKDSVAIGSFHAAKKGIVVVCSAGNSGPADSTVSNVAPWQITVGASTMDREFAS  361

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  + +   +  P++ A D +    T      C+  +L P+K KGK
Sbjct  362   NLILGNGKHYKGQSLAPSSLPHAKFYPIIAASDAKAKNVTASDAQLCKIGSLDPQKAKGK  421

Query  1225  VVFCL---TGGLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNI-FNPSGTDAI  1067
             ++ CL    G + +   V  AGG  ++L    + G+++  +  ++ AT I F  S +  +
Sbjct  422   ILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVLPATQISFKDSLS--L  479

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
              +YI   K P+A + P +T+ G KP+P MA F+S GPS   P ILKPDITAPG++++AA+
Sbjct  480   SRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKPDITAPGVSVIAAY  539

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             + A SP  +  D R + +N +SGTSMSCPHVS +  LLK  +P WS AAI+SAIMTTATT
Sbjct  540   TGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAAIRSAIMTTATT  599

Query  706   -KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
               ++ G  +   Y + A PF +GAGH++P+ A +PGLVYDS   DYL F+C      S I
Sbjct  600   MDDIPGPILNSTYMK-ATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQI  658

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPTG  371
                   ++ C  + +S  NLNYPS+ +  L  S V V RTV NVG   +TY+V V  P G
Sbjct  659   SVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP-STYTVRVNNPEG  717

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              SV + PT L F +VGE+++F V++     K    + FG   WSD  H V+SPIVV
Sbjct  718   VSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKHRVRSPIVV  773



>ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=771

 Score =   441 bits (1135),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 271/593 (46%), Positives = 367/593 (62%), Gaps = 26/593 (4%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  G +N TFD  S RD  GHGTHT ST GG  VA AS  G  
Sbjct  186   HCNRKLIGARYFNKGYASVVGHLNSTFD--SPRDREGHGTHTLSTAGGNFVAGASVFGL-  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK C    +  +    C D D+LAAFD A++DGV V+SVSLG  
Sbjct  243   GKGKAKGGSPKARVAAYKVC----YPPVGGNECFDADILAAFDTAISDGVDVLSVSLG--  296

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
              +      D VA+G+ HA+K  I V+ SAGN      + +N+APW  TVGAS+IDR F +
Sbjct  297   GEAAQLFNDSVAIGSFHAVKHGIVVICSAGNSGPADGTASNLAPWQITVGASTIDREFPS  356

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLV-YAGDVEIPGSTTIPGFCRQDTLSPEKVKGK  1226
              V+LGNN+  KGES+++  + K +  PL+  A       S      C+  +L  +K KGK
Sbjct  357   YVVLGNNISYKGESLSKKALPKNKFYPLMSAADARAANASVEDAKLCKAGSLDRKKAKGK  416

Query  1225  VVFCLTG---GLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G    + +  +  RAG   ++L      G+EI  +  ++ A+++   +G  AIL
Sbjct  417   ILVCLRGVNARVDKGQQAARAGAVGMVLVNDKDSGNEILADVHILPASHLNYTNGV-AIL  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K P+A +   +T  G KP+P MA F+S GP+   P ILKPDITAPG++I+AA++
Sbjct  476   NYINSTKYPIAHVTRPETHIGTKPAPFMAAFSSRGPNTITPEILKPDITAPGVSIIAAYT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             +A+ P  +  D R V +N +SGTSMSCPHVS +V LLK +HP WS AAIKSAIMTTA T+
Sbjct  536   QAAGPTNEDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKILHPTWSPAAIKSAIMTTAMTR  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   E I +A    A PF YGAGHI+P++A +PGLVYD T  DYL F+C      + I +
Sbjct  596   DNNREPILNATYSKANPFSYGAGHIRPNQAMEPGLVYDLTANDYLNFLCALGYNETQILS  655

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                  YKCP K  + +N NYPS+ + + KGS+ V R V NVGS ++TY V ++ PTG SV
Sbjct  656   FSQAPYKCPNKLVNLANFNYPSITVPKFKGSITVTRRVKNVGSPSSTYKVSIRKPTGISV  715

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              + P  L F E+GE+++F V++K +  K   E+ FG   WSD IH V+SPIVV
Sbjct  716   SVEPEILNFREIGEEKTFKVTLKGKKFKARKEYVFGELTWSDSIHRVRSPIVV  768



>ref|XP_010657502.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=620

 Score =   437 bits (1123),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 258/596 (43%), Positives = 363/596 (61%), Gaps = 28/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  +GY A  G +N +F   + RD  GHG+HT ST GG  V  AS  G F
Sbjct  37    HCNRKLIGARYFHQGYAAAVGSLNSSF--HTPRDTEGHGSHTLSTAGGNFVEGASVFG-F  93

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+S SLG L
Sbjct  94    GNGTAKGGSPKARVAAYKVCWP----PVGGNECFDADILAAFDIAIHDGVDVLSASLGGL  149

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D +++G+ HA+K  I VV SAGN      +V+N++PW FTVGAS++DR F +
Sbjct  150   PTP--FFNDSLSIGSFHAVKHGIVVVCSAGNSGPADGTVSNISPWQFTVGASTMDRQFPS  207

Query  1396  PVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGK  1226
              ++LGN   ++G S++   +   +  PL+ A D +   ++      C+  TL   KVKGK
Sbjct  208   YLVLGNKKRLEGGSLSPKALPPNKFFPLISAADAKAANASADDALLCKAGTLDHSKVKGK  267

Query  1225  VVFCLTG---GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G    + +  +   AG   ++L +    G+E+  +  ++ A++I    G  A+ 
Sbjct  268   ILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVLPASHINFTDGV-AVF  326

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              Y+ + K+P+A + P  T  G KP+P MA F+S GP+   P ILKPDITAPG++++AA++
Sbjct  327   TYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIAAYT  386

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R V +N +SGTSMSCPHVS +V LLK +HPDWS AAI+SA+MTTA T 
Sbjct  387   EAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWSPAAIRSAMMTTARTM  446

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   EAI +A    A PF YGAGH++P++A +PGLVYD    DYL F+C      + I  
Sbjct  447   DNSMEAILNASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYLNFLCALGYNQTLIKM  506

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  Y CPK  S  +N NYPS+ + +L GS+ V RT+ NVG    TY   ++ PTG SV
Sbjct  507   FSERPYTCPKPISL-TNFNYPSITVPKLHGSITVTRTLKNVGPPG-TYKARIRKPTGISV  564

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              + P  LKF ++GE+++F ++++ E      ++ FG   WSD  H V+SPIVV +A
Sbjct  565   SVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHFVRSPIVVKAA  620



>emb|CDY65487.1| BnaA03g57660D [Brassica napus]
Length=775

 Score =   441 bits (1135),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 268/596 (45%), Positives = 360/596 (60%), Gaps = 32/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  GP+N +FD  S RDI GHG+HT ST GG  V  A+  G  
Sbjct  191   HCNRKLIGARYFHKGYAAAVGPLNSSFD--SPRDIDGHGSHTLSTAGGAFVPGANVFGQ-  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +K   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  248   GNGTAKGGSPRARVAAYKVCWP----PVKGNECYDADVLAAFDAAIHDGADVISVSLGGE  303

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSA  1397
             P    F +D VA+G+ HA K+ I VV SAGN     S V+NVAPW  TVGAS+ DR F++
Sbjct  304   PAS--FFKDSVAIGSFHAAKKGIVVVCSAGNSGPADSTVSNVAPWQITVGASTTDREFAS  361

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  + +   +  P++ A D +    T      C+  +L P+K KGK
Sbjct  362   NLILGNGKHYKGQSLAPSSLPHAKFYPIIAASDAKAKNVTASDAQLCKIGSLDPQKAKGK  421

Query  1225  VVFCL---TGGLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNI-FNPSGTDAI  1067
             ++ CL    G + +   V  AGG  ++L    + G+++  +  ++ AT I F  S +  +
Sbjct  422   ILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVLPATQISFKDSLS--L  479

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
              +YI   K P+A + P +T+ G KP+P MA F+S GPS   P ILKPDITAPG++++AA+
Sbjct  480   SRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKPDITAPGVSVIAAY  539

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             + A SP  +  D R + +N +SGTSMSCPHVS +  LLK  +P WS AAI+SAIMTTATT
Sbjct  540   TGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAAIRSAIMTTATT  599

Query  706   -KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
               ++ G  +   Y + A PF +GAGH++P+ A +PGLVYDS   DYL F+C      S I
Sbjct  600   MDDIPGPILNSTYMK-ATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQI  658

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPTG  371
                   ++ C  + +S  NLNYPS+ +  L  S V V RTV NVG   +TY+V V  P G
Sbjct  659   SVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP-STYTVRVNNPEG  717

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              SV + PT L F +VGE+++F V++     K    + FG   WSD  H V+SPIVV
Sbjct  718   VSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKHRVRSPIVV  773



>ref|XP_011013808.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=749

 Score =   441 bits (1133),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 265/596 (44%), Positives = 359/596 (60%), Gaps = 32/596 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGYEA  G    + +   +RD +GHGTHT ST GGR V+ A+ LG  A
Sbjct  163   CNRKLIGARYFNKGYEAALGRRLDSSN-NPARDTNGHGTHTLSTAGGRFVSGANFLGS-A  220

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV ++S+SLG   
Sbjct  221   YGTAKGGSPNARVASYKVCWPR---------CYDADILAAFDAAIQDGVDILSLSLGRAL  271

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY---SVTNVAPWIFTVGASSIDRVFS  1400
             +  YF + G+A+G+  A+   I VV SAGN  +     + +NVAPW+ TV AS+IDR F 
Sbjct  272   EIPYF-RSGIAIGSFQAVMNGILVVCSAGNSGQVLGFGTTSNVAPWVLTVAASTIDREFP  330

Query  1399  APVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKG  1229
             + V+LGNN   KG S     +  ++  P+VY+ D +    S  +   C  ++L P+KV+G
Sbjct  331   SNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKAANASAQLAQICYPESLDPKKVRG  390

Query  1228  KVVFCLTG---GLSQTLEVERAGGAAVILGS--IGSEIQVESFLITATNIFNPSGTDAIL  1064
             K+V+CL G    + ++L V +AGG  +IL      S      F +  + +    G  ++L
Sbjct  391   KIVYCLRGMTSDVEKSLVVAQAGGVGMILAHQFADSSSSPRGFFVPTSLVSAIDGL-SVL  449

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+PVA  I G T  G   +P MAPF+S GP+   P ILKPDITAPG++ILAA++
Sbjct  450   SYIHSTKSPVA-YISGSTEIGKVVAPVMAPFSSTGPNEITPEILKPDITAPGVHILAAYT  508

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             +A   L +  D R + +NIISGTSMSCPHVS +  LLK +HPDWS AAIKSAIMTTA T 
Sbjct  509   KAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTS  568

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGT  542
             +   + I  A    A PF+YG+GH++P++A DPGLVYD T  DYL F+CS       +  
Sbjct  569   SNARQPIAKASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSI  628

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  Y CP K  S  N NYPS+ +  L G++ + RT+ NVG+    Y+V VK P G  V
Sbjct  629   FNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGTPG-LYTVRVKKPDGILV  687

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             K+ P  LKF ++ E+++F V +K +       + FG   WSDG+H VKSPIVV  A
Sbjct  688   KVEPKSLKFSKLNEEKTFKVMLKAKDDWFRRSYVFGGLTWSDGVHHVKSPIVVRKA  743



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   441 bits (1133),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 275/605 (45%), Positives = 372/605 (61%), Gaps = 43/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  171   FTASLCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  230

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G AP  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  231   LG-YASGTARGMAPRARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  281

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN      S++NVAPWI TVGA ++DR
Sbjct  282   LGGGMSDYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDR  339

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  340   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  392

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  393   PEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEK  452

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ NP A++    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  453   AG-DIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  511

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+
Sbjct  512   NILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSAL  571

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS--  554
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C+  
Sbjct  572   MTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALN  631

Query  553   ----SIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                  I +    +Y C P K+ S ++LNYPS A+     G+    RTVT+VG A  TYSV
Sbjct  632   YTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVDGVGAYKYTRTVTSVGGAG-TYSV  690

Query  391   EVKAP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             +V +  TG  + + P  L F E  EK+S+ V+  V+S K  G   FG  +WSDG H+V S
Sbjct  691   KVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGS  750

Query  214   PIVVS  200
             P+ +S
Sbjct  751   PVAIS  755



>ref|XP_009394968.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   441 bits (1134),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 265/593 (45%), Positives = 362/593 (61%), Gaps = 27/593 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
              CNRK+IG RY  KGY +  G V       + RD  GHGTHT ST  GR V  A+  G  
Sbjct  187   RCNRKLIGLRYFNKGYRSAVGAVG--LAAETPRDTDGHGTHTLSTAAGRFVPGANVFG-L  243

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GGAP  R+A YK CW      +  + C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  244   GNGTAKGGAPNARVAAYKVCWP----PVNGSECFDADILAAFDAAIHDGVHVLSVSLGGG  299

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P  NYF +DGVA+G+ HA+K  I VV SAGN   +  +V+N APWI TVGAS++DR F A
Sbjct  300   PT-NYF-KDGVAIGSFHAVKHGITVVCSAGNSGPKSGTVSNTAPWIVTVGASTMDREFPA  357

Query  1396  PVLLGNNLLVKGESVTEIKKQETL--PLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              + L +   +KG+S++ +   + +  P++ + +      S      C + +L PEKV+GK
Sbjct  358   YLSLRSKKQIKGQSLSPMALPDKMFYPIISSREATARNASQESAKLCLKRSLDPEKVRGK  417

Query  1225  VVFCLTGGLSQTLE---VERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             +V CL G  ++  +   V +AGG  ++L    S G+EI  ++ ++ AT+I    G  AIL
Sbjct  418   IVVCLRGENARVEKGDVVHQAGGIGMVLANDESTGNEIIADAHVLPATHISYDDGL-AIL  476

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              Y+ ++K+    +   KTI G KP+P MA F+S GP+   P ILKPDITAPG++I+AA+S
Sbjct  477   SYLNSSKSLFGYITSPKTIIGTKPAPVMAAFSSQGPNTVNPEILKPDITAPGVSIIAAFS  536

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA+ P     D R V +N  SGTSMSCPH++ +  LLKA+HPDWS +AIKSAIMTTA T+
Sbjct  537   EATGPTGLTFDDRRVLFNSESGTSMSCPHIAGIAGLLKALHPDWSHSAIKSAIMTTARTR  596

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   E + ++      PF YG+GH+QP++A DPGLVYD T  DYL F+C      + I T
Sbjct  597   DNMKEPMFNSSFVKTSPFSYGSGHVQPNRAMDPGLVYDLTTNDYLNFLCALGYNSTQIAT  656

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                  + CP K     +LNYPS+ I  L G+  + RT+ NVG   +TY V V+ P G SV
Sbjct  657   FSTEPFVCPSKPLKIEDLNYPSITIPNLSGASTITRTIKNVG-LPSTYKVRVEEPAGVSV  715

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              + P +LKF ++GE++ F V++K +      E+ FG   WSDG H V+SPIVV
Sbjct  716   TVKPRKLKFKKLGEEKKFTVALKDKRSNLAREYTFGGLTWSDGKHYVRSPIVV  768



>ref|XP_010252985.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
 ref|XP_010252986.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=777

 Score =   441 bits (1133),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 262/599 (44%), Positives = 369/599 (62%), Gaps = 29/599 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPV-NHTFDFRSSRDISGHGTHTASTVGGRKVANASALGG  1757
              CNRK+IGARY  KGY +  G +   +    ++RD  GHGTHT ST GG  V  A+ LG 
Sbjct  189   RCNRKLIGARYFNKGYASAAGTLLKSSLTLATARDDDGHGTHTLSTAGGNFVPGANVLG-  247

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
             F NG A GGAP  R+A Y+ CW      I  + C D D+LAAFD A+ DGV +ISVSLG 
Sbjct  248   FGNGTAKGGAPRARVAAYRVCWP----PINGSECYDADILAAFDAAIHDGVDIISVSLGG  303

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
              P D YF QDG+++GA HA+K  I VV SAGN   +  SV+NV+PW+FTVGAS+IDR F 
Sbjct  304   APSD-YF-QDGISIGAFHAVKNGIVVVTSAGNSGPDAGSVSNVSPWLFTVGASTIDREFP  361

Query  1399  APVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKG  1229
               V LGN + +KG+S++   +   +  PL+     +   ++      C+  TL PEKVKG
Sbjct  362   VYVKLGNKVQLKGQSLSASSLPAAKYYPLISGAKAKAANASAKDALLCKAGTLDPEKVKG  421

Query  1228  KVVFCL---TGGLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAI  1067
             K++ CL    G + + ++   AG   +IL +    G+EI V++ ++ A +I    G D +
Sbjct  422   KILACLRGVNGRVQKGIQAALAGAVGMILANDEINGNEIIVDTHVLPAAHIIYKDGLD-L  480

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               YI + K+P+A +    T    KP+P MA F+S GP+   P ILKPDITAPG++I+AA+
Sbjct  481   FAYINSTKSPIAYITRPVTQMAVKPAPFMASFSSRGPNTITPEILKPDITAPGVSIIAAY  540

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             ++A+ P  +  D R V++N  SGTSMSCPHV+ +  LLK +HPDWS +AI+SAIMT+A T
Sbjct  541   TQATGPTGEKSDERRVQFNSESGTSMSCPHVAGISGLLKTLHPDWSPSAIRSAIMTSART  600

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIG  545
             ++ K E + ++    A PF YGAGH++P++A DPGLVYD T  DYL F+C      + I 
Sbjct  601   RDNKREPMLNSSYVKANPFDYGAGHVRPNRAMDPGLVYDLTVKDYLNFLCALGYNETKIK  660

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
             +  +  Y+CP       + NYPS+ + +L G   + RTV NVG+   TY    + P G S
Sbjct  661   SFWEEPYECPNHVRL-LDFNYPSITVPRLSGPTTISRTVKNVGTPG-TYKARFRPPPGIS  718

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeF--GWYKWSDGIHMVKSPIVVSSA  194
             V + P  LKF ++GE++SF +++K+++ K      +  G   WSDG H V+SPIVV +A
Sbjct  719   VSVEPLTLKFDKLGEEKSFKLTLKLKAKKAPAASNYVFGRLIWSDGNHYVRSPIVVKAA  777



>ref|XP_008462020.1| PREDICTED: subtilisin-like protease isoform X2 [Cucumis melo]
Length=655

 Score =   436 bits (1121),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 260/596 (44%), Positives = 356/596 (60%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY +  GP+N +F   S RD  GHG+HT ST GG  VA AS  G
Sbjct  69    SFHCNRKLIGARYFNKGYASVVGPLNSSF--HSPRDKEGHGSHTLSTAGGNFVAGASVFG  126

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
                 G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG
Sbjct  127   -LGKGTAKGGSPRARVAAYKVCWPPK----AGNECFDADILAAFDLAIHDGVDVLSVSLG  181

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVF  1403
               P  N    D VA+G+ HA+K  I V+ SAGN      +VTNVAPW  TVGAS++DR F
Sbjct  182   GDP--NPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQITVGASTMDRKF  239

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V+LGN   ++GES+++  +  ++  PL+ A DV +  ++      C+  TL P K K
Sbjct  240   PSLVVLGNKKQIEGESLSQEALPSKKLYPLMNAADVRLANASAHEAQLCKAGTLDPMKAK  299

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G A +IL +    G+EI  +  ++ A +I N +   A
Sbjct  300   GKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVLPALHI-NYTDGSA  358

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K P A + P  T  G +P+P MA F+S+GP+   P ILKPDITAPGL+++AA
Sbjct  359   VFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAA  418

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D+R V +N +SGTSMSCPHVS +  LL+ ++P WS AAIKSAIMTTA+
Sbjct  419   YTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSPAAIKSAIMTTAS  478

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T +   E + +A   VA PF+YGAGH+ P+ A DPGLVYD    +YL F+C      + I
Sbjct  479   TLDNNFEPLLNASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYLSFLCALGYDKAQI  538

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 D  + C +  S  +NLNYPS+ + +L  S+ + R + NVGS   TY  +++ P G 
Sbjct  539   SQFSDGPFNCSEPISL-TNLNYPSITVPKLSRSITITRRLKNVGSPG-TYEAKIRKPAGI  596

Query  367   SVKISPTELKFMEVGEK-QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV + P +L F ++GE+                  + +G   WSDG H V+SPIVV
Sbjct  597   SVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKNYVYGDLIWSDGKHHVRSPIVV  652



>ref|XP_003601486.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES71737.1| subtilisin-like serine protease [Medicago truncatula]
Length=772

 Score =   440 bits (1131),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 268/598 (45%), Positives = 370/598 (62%), Gaps = 30/598 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             S HCNRK+IGARY  KGY +    P+N +F+  + RD  GHG+HT ST GG  V   S  
Sbjct  187   SFHCNRKLIGARYFNKGYASRLTVPLNSSFE--TPRDNEGHGSHTLSTAGGNMVPGVSVF  244

Query  1762  G-GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             G G+  G A GG+P  R+A YK CW      I    C D D+LAAFD A+ DGV V+SVS
Sbjct  245   GQGY--GTAKGGSPKARVASYKVCWP----PINGDECFDADILAAFDAAIHDGVDVLSVS  298

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG     N F  D VA+G+ HA K+ I VV SAGN      + +N+APW  TVGAS++DR
Sbjct  299   LGG-SASNLF-NDSVAIGSFHAAKKGIVVVCSAGNSGPNDATASNLAPWYITVGASTMDR  356

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPG-FCRQDTLSPEKV  1235
              F + V+LGNNL  KGES++  +  +   P++ A D ++  +T      C+  TL P+KV
Sbjct  357   EFPSYVVLGNNLTFKGESLSAARLADKFYPIIKATDAKLASATNEDAVLCQNGTLDPKKV  416

Query  1234  KGKVVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTD  1073
             KGK+V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I    G +
Sbjct  417   KGKIVLCLRGINARVDKGEQALLAGAVGMVLANDKTTGNEIIADPHVLPASHINFSDGVE  476

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              +  Y+ ++K+PVA +    T    KP+P MA F+S GP+   P ILKPDITAPG++++A
Sbjct  477   -VFHYVNSSKSPVAYITHPTTKLHTKPAPFMAAFSSKGPNTIIPEILKPDITAPGVSVIA  535

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++EA  P  Q  D+R +++N +SGTSMSCPH+S +V LL++++P W+ AAIKSAIMTTA
Sbjct  536   AYTEAEGPTNQEFDNRRIQFNSVSGTSMSCPHISGIVGLLRSLYPSWTPAAIKSAIMTTA  595

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT + K E I +A    A PF YGAGH+QP+ A DPGLVYD T  DY  F+C      + 
Sbjct  596   TTLDNKAEPIMNATKSQATPFSYGAGHVQPNSAMDPGLVYDITTNDYFNFLCALGYNETQ  655

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             +       YKC K  S   NLNYPS+ +  L GS+ V RT+ NVG A  TY V V++P+G
Sbjct  656   MSLFSKGPYKCHKNFSI-LNLNYPSITVPNLSGSVTVTRTLKNVG-APGTYIVHVQSPSG  713

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              ++ + P  L+F +VGE++ F V +KV+  K    + FG   WSDG H VKSP+VV +
Sbjct  714   ITISVKPNILEFKKVGEEKRFEVKLKVKKGKATKSYVFGKMIWSDGKHYVKSPLVVKA  771



>dbj|BAB09207.1| subtilisin-like protease [Arabidopsis thaliana]
Length=713

 Score =   438 bits (1126),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 265/598 (44%), Positives = 350/598 (59%), Gaps = 58/598 (10%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNH--TFDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F SSHCNR      Y+ +GYE  +GP N     DF S RD  GHG+HTAST  GR+V   
Sbjct  156   FNSSHCNR------YYARGYERYYGPFNAEANKDFLSPRDADGHGSHTASTAVGRRVDGV  209

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKAT-FCQDDDVLAAFDHAVADGVQVI  1595
             SALGG A G A+GGA L RLA+YKACW VP  +  AT  C D+D+LAAFD A+ADGV VI
Sbjct  210   SALGGIAMGTASGGASLARLAVYKACWAVPNKEKYATNTCFDEDMLAAFDDAIADGVNVI  269

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGN---YREPYSVTNVAPWIFTVGA  1424
             S+S+G +    Y  +DG+A+GALHA+KR+I V  SAGN    RE  +++N APWI TVGA
Sbjct  270   SISIGTVEPHTYL-EDGIAIGALHAVKRDIVVAASAGNDGPARE--TLSNPAPWIITVGA  326

Query  1423  SSIDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLSP  1244
             SS+DR F   + LG+  + + +S+T +K     PLVYA DV       +PG  R D +  
Sbjct  327   SSLDRFFVGRLELGDGYVFESDSLTTLKMDNYAPLVYAPDV------VVPGVSRNDAIG-  379

Query  1243  EKVKGKVVFCLTGGLSQTLEVERAGGAAVILGSI--GSEIQVESFLITATNIFNPSGTDA  1070
                     +     + + LEV+RAGG  +IL +        VES  +    +F+ S  D 
Sbjct  380   --------YGSGSTIGKGLEVKRAGGVGMILANSRDNDAFDVESHFVPTALVFS-STVDR  430

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             IL YI     PVA + P +T+              L  + PE +   PDI APGLNILAA
Sbjct  431   ILDYIYNTYEPVAFIKPAETV--------------LYRNQPEDS---PDIIAPGLNILAA  473

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             WS A S  +   D R + YN+ SGTSMSCPHV+  +ALLK++HP WS AAI+SA+MTTA+
Sbjct  474   WSGADSASKDSIDRRVLDYNLDSGTSMSCPHVAGAIALLKSMHPTWSSAAIRSALMTTAS  533

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDP  530
               N   E I+D  G  A PF  G+ H +P+KAA PGLVYD++Y  YLL+ CS   T LDP
Sbjct  534   MTNEDNEPIQDYDGSPANPFALGSRHFRPTKAASPGLVYDASYQSYLLYCCSVGLTNLDP  593

Query  529   SYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVT---NVGSANTTYSVEVKAPTGYSVK  359
             ++KCP +     NLNYPS++I  L G++ V RTVT     G++ + Y    + P G  VK
Sbjct  594   TFKCPSRIPPGYNLNYPSISIPYLSGTVTVTRTVTCVGRTGNSTSVYVFNAQPPNGVLVK  653

Query  358   ISPTELKFMEVGEKQs-----ffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               P  L F ++G+K+           +     +   + FGW+ W+DG H+V+S I VS
Sbjct  654   AEPNVLVFDKIGQKKRFNIIFTTQRYEFTGEARRDRYRFGWFSWTDGHHVVRSSIAVS  711



>dbj|BAF95887.1| subtilase [Lotus japonicus]
Length=759

 Score =   439 bits (1129),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 255/598 (43%), Positives = 354/598 (59%), Gaps = 35/598 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFD---FRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG EA  GP+ +  D   FRS RD  GHGTHTAST+ G  V+N
Sbjct  171   FTLANCNKKIIGARFYSKGLEAEIGPLENIVDSIFFRSPRDSDGHGTHTASTIAGSIVSN  230

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
              S L G A G A GGAP  RL+IYKACW          FC D DV AA D A+ DGV ++
Sbjct  231   VS-LFGMAKGTARGGAPSARLSIYKACW--------FGFCSDADVFAAMDDAIHDGVDIL  281

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + ++ +++GA HA ++ I V  SAGN   P +  NVAPWIFTV AS++
Sbjct  282   SLSLGPDPPQPLYFENAISVGAFHAFQKGILVSASAGNSVFPRTACNVAPWIFTVAASTV  341

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVY-AGDVEIPGSTTIPGFCRQDTLSPEK  1238
             DR F + + LGN+ ++KG S+  IK + +  L+Y +       +     FC++ TL P  
Sbjct  342   DREFRSDIYLGNSKVLKGLSLNPIKMEGSYGLIYGSAAAAAGDAALNASFCKEHTLDPTL  401

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C     +     + + +++ GG  +IL    +      F+I +T I    G D
Sbjct  402   IKGKIVICTVEKFTDNRREKAIIIKQGGGVGMILIDHNARDVGFQFVIPSTMI----GQD  457

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             A+ +   Y+ T KNP AT+ P  T+ G KP+P  A F+S+GP+   P+I+KPDIT PG+N
Sbjct  458   AVEELQAYMKTEKNPTATIFPTLTLVGTKPAPESAAFSSVGPNIITPDIIKPDITGPGVN  517

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  ++  E   + +SV YNIISGTSMSCPH+SA+ A++K+ HP WS AAI SAIM
Sbjct  518   ILAAWSPVAT--EATVEQKSVNYNIISGTSMSCPHISAISAIIKSHHPSWSPAAIMSAIM  575

Query  721   TTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             T+AT  +     I +D  G  A PF YG+GH+ P  + +PGLVYD +  D L F+CS+  
Sbjct  576   TSATVMDNTHSLIGRDPNGTQATPFDYGSGHVNPVASLNPGLVYDFSSQDVLNFLCSNGA  635

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  ++  N NYPS+ ++ L GS+ V RTVT  G   T Y   V+
Sbjct  636   SPAQLKNLTGELTQCQKSPTASYNFNYPSIGVSNLNGSLSVYRTVTYYGQEPTEYFASVE  695

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              P+G  V+++P +LKF + GEK   F           G F FG   W++G   V+SPI
Sbjct  696   RPSGVIVRVTPAKLKFWKAGEK-ITFRIDFTPFKNSNGNFVFGALTWNNGKQRVRSPI  752



>dbj|BAK01624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=792

 Score =   439 bits (1130),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 262/597 (44%), Positives = 371/597 (62%), Gaps = 26/597 (4%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCN K+IGARY  KGY A  G      +F + RD  GHGTHT ST GG  V  AS  G F
Sbjct  204   HCNAKLIGARYFNKGYGAE-GLDTKAPEFNTPRDNEGHGTHTLSTAGGAPVPGASVFG-F  261

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A+GG+P   +A Y+ C++     +  + C + D+LAAFD A+ DGV V+SVSLG  
Sbjct  262   GNGTASGGSPRAHVAAYRVCYK----PVNGSSCFEADILAAFDAAIHDGVHVLSVSLGND  317

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
              +   +  D +++G+ HA++R I+VV SAGN   +P S++N+APW+FTVGAS++DR F +
Sbjct  318   GEPYDYFDDAISIGSFHAVRRGISVVCSAGNSGPKPSSISNLAPWVFTVGASTMDREFPS  377

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
               L+ N   +KG+S++E  +K ++  P++ + +   PG        C Q +L PEKVKGK
Sbjct  378   -YLVFNGTKIKGQSMSETSLKTKDPYPMIDSAEAAAPGRAVDDAKICLQGSLDPEKVKGK  436

Query  1225  VVFCLTG---GLSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             +V CL G    +++ L V +AGGAA++L    + G+E+  ++ L+ AT+I +  G   + 
Sbjct  437   IVVCLRGTSARVAKGLTVLQAGGAAMVLANDAASGNEVIADAHLLPATHIRHHDGL-TLY  495

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              Y+ + K+PV  +   +T    KP+P MA F+S GP+   P ILKPDITAPG+ ++AA++
Sbjct  496   SYLKSTKSPVGYVEKPETSLETKPAPYMAAFSSQGPNPVNPEILKPDITAPGVGVIAAFT  555

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
              A +P E   D R V +  +SGTSMSCPHVS +V LLKA+HPDWS +AIKSA+MTTAT  
Sbjct  556   RAMAPTELAFDERRVAFTTMSGTSMSCPHVSGLVGLLKALHPDWSPSAIKSAMMTTATDV  615

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             + KGE+I +A    AGPF YGAGH+ PS+A +PGLVYD     YL F+C      + +  
Sbjct  616   DNKGESILNASLTPAGPFAYGAGHVWPSRAMNPGLVYDLGPDHYLDFLCALKYNATVLSM  675

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGS-MVVKRTVTNVGSANTTYSVEVKAPTGYS  365
                  YKCP+KA    +LNYPS+ +  L  S   VKRTV NVG     Y   V+ P G  
Sbjct  676   FNGEPYKCPEKAPKIQDLNYPSITVVNLTASGATVKRTVKNVGFPG-KYKAVVRQPAGVH  734

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             V +SP  ++F + GE+++F V  +++  K    + FG   WS+G+  VKSPIVV +A
Sbjct  735   VAVSPEVMEFGKKGEEKTFEVKFEIKDAKLAKNYAFGTLMWSNGVQFVKSPIVVKTA  791



>ref|XP_011088876.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=726

 Score =   437 bits (1125),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 260/600 (43%), Positives = 352/600 (59%), Gaps = 41/600 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT S+CNRKI+GAR++  G+ A +GP+   NHTF F S+RD  GHGTHT+ST+ G  VAN
Sbjct  140   FTLSNCNRKIVGARFYYGGFIADYGPLESFNHTF-FVSARDSDGHGTHTSSTIAGSVVAN  198

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
              S L G   G A GGAP  RLAIYKACW           C D D+L+A D A+ DGV VI
Sbjct  199   VS-LYGIGRGTARGGAPGARLAIYKACW--------FNLCSDADILSAIDDAINDGVDVI  249

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    +  D +++G+ HA ++ + V  SAGN   P + +NVAPWI TV AS++
Sbjct  250   SMSLGPDPPQPIYFSDAISIGSFHAFQKGVVVSASAGNSFLPKTASNVAPWILTVAASTM  309

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIP----GFCRQDTLS  1247
             DR     + LGN+ +++G SV   + +    LV       PG   IP     FC+ +TL 
Sbjct  310   DRDIQTKIYLGNSQVIQGFSVNPTEMKSFYGLVTGSAAAAPG---IPSRNASFCKSNTLD  366

Query  1246  PEKVKGKVVFC-----LTGGLSQTLEVERAGGAAVIL-GSIGSEIQVESFLITATNIFNP  1085
             P  +KGK+V C     L     +   +++ GG  +IL   + +++ ++  L  A  + + 
Sbjct  367   PALIKGKIVVCTLEAILDNRKEKATSIKQGGGVGIILVDPLATDVAIQFVLPGA--LISL  424

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
                + +  Y+ + KNPVA +   K I   KP+P MA F+S+GP+   P+++KPDITAPG+
Sbjct  425   EEAEELQAYMASQKNPVARISQTKAILATKPAPQMAMFSSMGPNIISPDVIKPDITAPGV  484

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             N+LAAWS  S+        RS+ YNI+SGTSMSCPHVSA+ A++K+ HP WS AAIKSAI
Sbjct  485   NVLAAWSPLST---DNTAGRSIDYNIVSGTSMSCPHVSAIAAIVKSSHPSWSPAAIKSAI  541

Query  724   MTTATT-KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSI  548
             MTTAT   N K    +   G    PF YG+GHI P+ A DPGLVYD    D + F+CS+ 
Sbjct  542   MTTATIHDNTKNFIRRHPNGTQTSPFDYGSGHINPAAAIDPGLVYDFDTSDIIDFLCSTG  601

Query  547   GT-------TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVE  389
              T       T +  Y C K   S  + NYPS+ ++ L+GS+ V RTVT  G     Y  E
Sbjct  602   ATPAQLKNLTGEVMY-CRKNPKSSYDFNYPSIGVSNLRGSISVHRTVTYYGEGPAVYKAE  660

Query  388   VKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             V  P G +V I+P EL+F + G+K   FV          GEF FG   W+DGIH+V+SPI
Sbjct  661   VDHPAGVNVSITPNELRFEKNGDKM-SFVIGFTPYKASNGEFVFGALTWTDGIHVVRSPI  719



>ref|NP_001267495.1| SUB1 homolog precursor [Glycine max]
 gb|AAQ23176.1| subtilisin-like protease [Glycine max]
 gb|AFV08660.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   439 bits (1128),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 274/595 (46%), Positives = 363/595 (61%), Gaps = 29/595 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  GP+N +FD  S RD  GHGTHT ST GG  VA  S  G  
Sbjct  187   HCNRKLIGARYFNKGYASVAGPLNSSFD--SPRDNEGHGTHTLSTAGGNMVARVSVFGQ-  243

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P+ R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  244   GQGTAKGGSPMARVAAYKVCWP----PVGGEECFDADILAAFDLAIHDGVDVLSVSLGGS  299

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVT--NVAPWIFTVGASSIDRVFS  1400
                  F +D VA+G+ HA KR + VV SAGN   P   T  N+APW  TV AS++DR F 
Sbjct  300   SST--FFKDSVAIGSFHAAKRGVVVVCSAGN-SGPAEATAENLAPWHVTVAASTMDRQFP  356

Query  1399  APVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
               V+LGN++  KGES++  K   +  P++ A D ++  +       C+  TL P K KGK
Sbjct  357   TYVVLGNDITFKGESLSATKLAHKFYPIIKATDAKLASARAEDAVLCQNGTLDPNKAKGK  416

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             +V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I N +   A+ 
Sbjct  417   IVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPHVLPASHI-NFTDGSAVF  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K PVA +   KT    KP+P MA F+S GP+   P ILKPDITAPG++++AA++
Sbjct  476   NYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTMVPEILKPDITAPGVSVIAAYT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R + +N +SGTSMSCPHVS +V LL+A++P WS AAIKSAIMTTATT 
Sbjct  536   EAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTWSTAAIKSAIMTTATTL  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             + + E + +A    A PF YGAGH+QP++A DPGLVYD T  DYL F+C      + I  
Sbjct  596   DNEVEPLLNATDGKATPFSYGAGHVQPNRAMDPGLVYDITIDDYLNFLCALGYNETQISV  655

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  YKC KK S   NLNYPS+ + +L GS+ V RT+ NVGS   TY   V+ P G +V
Sbjct  656   FTEGPYKCRKKFSL-LNLNYPSITVPKLSGSVTVTRTLKNVGSPG-TYIAHVQNPYGITV  713

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              + P+ LKF  VGE++SF ++ K    K    + FG   WSDG H V SPIVV +
Sbjct  714   SVKPSILKFKNVGEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKHYVTSPIVVKA  768



>gb|EYU27629.1| hypothetical protein MIMGU_mgv1a001914mg [Erythranthe guttata]
Length=740

 Score =   437 bits (1125),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 264/595 (44%), Positives = 356/595 (60%), Gaps = 27/595 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY+ KGY A  G P+N T++  + RD+ GHGTHT ST  G  VA A+  G F
Sbjct  153   CNRKLIGARYYNKGYAAYAGVPLNSTYN--TPRDVDGHGTHTLSTAAGNFVAGANVFG-F  209

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A Y+ C+  P  +  +  C D D++  FD A+ADGV V+SVSLG  
Sbjct  210   GNGTAKGGSPRARVAAYRVCY--PKMNESSGECYDADIMKGFDAAIADGVGVLSVSLGSD  267

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
               D  +  DG A+GA HA+K  I VV SAGN    P SV NVAPW  TVGAS++DR F A
Sbjct  268   SVD--YINDGTAIGAFHAVKNGIVVVASAGNSGPTPGSVENVAPWFITVGASTLDRKFQA  325

Query  1396  PVLLGNNLLVKGESVTE-IKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGKV  1223
              V L N  + +G S+++ + + +   L+ A +      S      C++ TL  +K KGK+
Sbjct  326   NVQLKNGSIFQGMSLSKPLPEDKMYTLISAAEARAADVSEEDAILCKEKTLDSKKAKGKI  385

Query  1222  VFCLTG---GLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDAILK  1061
             V CL G    L +  E  RAG A +IL    S G+E+  ++ ++ AT +    G   +  
Sbjct  386   VVCLRGENARLEKGEEALRAGAAGMILCNDESSGNELIADAHILPATQLNYTDGL-IVFS  444

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             Y+   KNP   +   K++   KP+P MA F+S GP+   P ILKPDITAPG+NI+AA+SE
Sbjct  445   YLKNTKNPQGLITEPKSVLNVKPAPFMASFSSRGPNAITPAILKPDITAPGVNIMAAYSE  504

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             ++SP E P D R+  + I SGTSM+CPHVS V  LLK +HPDWS  AI+SAIMTTA T++
Sbjct  505   STSPTEVPSDKRTTPFYIESGTSMACPHVSGVAGLLKTLHPDWSPGAIRSAIMTTARTRD  564

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
               G  +KDA  + A PF YG+GHI+P++A +PGLVYD T  DYL F+C      + +G  
Sbjct  565   NTGSPMKDADYQKATPFMYGSGHIRPNRAMNPGLVYDLTVNDYLDFLCGIGYNSTMVGQF  624

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
                 Y CP   +   N N PS+++  L  S+VV R + NVG    TY+  +++P GYSV 
Sbjct  625   AGAYYDCPNNYNI-LNFNNPSISVPDLTRSVVVTRKLKNVGKPG-TYAARIRSPPGYSVT  682

Query  358   ISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             + P  LKF ++G EK                 F+FG   WSDG H V+SPIVV+S
Sbjct  683   VKPNLLKFEKIGEEKSFKLSIKVNGRRGAKSVFQFGELLWSDGKHYVRSPIVVAS  737



>ref|XP_002523782.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF38508.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=759

 Score =   438 bits (1126),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 263/602 (44%), Positives = 356/602 (59%), Gaps = 38/602 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGP---VNHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FTS++CNRKIIGAR++ KG+EA  GP   V+ TF FRS+RD  GHG+HTAST+GG  V N
Sbjct  172   FTSANCNRKIIGARFYYKGFEAEIGPLENVDGTF-FRSARDSDGHGSHTASTIGGNMVTN  230

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS L G A G A GGAP  RLAIYKACW           C D DVL+A D A+ DGV ++
Sbjct  231   AS-LYGMARGTARGGAPNARLAIYKACW--------FNLCSDADVLSAMDDAINDGVDIL  281

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    +  + +++GA HA ++ + V  SAGN   P + TNVAPWI TV ASS+
Sbjct  282   SLSLGPDPPQPVYFGNAISVGAFHAFRKGVFVSCSAGNSFFPGTATNVAPWILTVAASSL  341

Query  1414  DRVFSAPVL-LGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPG----FCRQDTL  1250
             DR F++ V+ LGN+ ++KG S+  +K + +  L+   D    G   +P     FC+ +TL
Sbjct  342   DREFNSNVVYLGNSKVLKGFSLNPLKMETSYALIAGSDAAAAG---VPAKNASFCKNNTL  398

Query  1249  SPEKVKGKVVFCLTGGL-----SQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNP  1085
              P K+KGK+V C    +      + L +++ GG  +IL    ++     F+I  T +   
Sbjct  399   DPAKIKGKIVVCTIEVVRDSRGEKALTIQQGGGVGMILIDPSAKEVGFQFVIPGT-LIGQ  457

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
                  +L Y+ T K P+A + P  TI   KP+P MA F+S GP+   P+I+KPDITAPGL
Sbjct  458   EEAQQLLAYMKTEKYPIARIAPTITILNTKPAPKMAVFSSQGPNIISPDIIKPDITAPGL  517

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAWS  ++        R+  YNIISGTSMSCPHV+AV A+LK+    WS AAI SAI
Sbjct  518   NILAAWSPVAT---GGTGGRAANYNIISGTSMSCPHVAAVAAILKSYKNSWSPAAIMSAI  574

Query  724   MTTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS-  551
             MTTAT  +  G+ I +   G  + PF YG+GH+ P  A +PGLVYD    D   F+CS+ 
Sbjct  575   MTTATVIDNTGKVIGRYPNGTQSSPFDYGSGHLNPIAAVNPGLVYDFNSYDVTNFLCSTG  634

Query  550   -----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEV  386
                  +      S  C K    P + NYPS+ ++++ GS+ V+RTVT      T Y+ ++
Sbjct  635   ESPAQLKNLTGQSTYCQKPNMQPYDFNYPSIGVSKMHGSVSVRRTVTYYSKGPTAYTAKI  694

Query  385   KAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
               P+G  V ++P  LKF   GEK   F    V      G F FG   WS+GIH V+SPIV
Sbjct  695   DYPSGVKVTVTPATLKFTRTGEK-ISFRIDFVPFKTSNGNFVFGALTWSNGIHEVRSPIV  753

Query  205   VS  200
             ++
Sbjct  754   LN  755



>ref|XP_010942942.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=771

 Score =   437 bits (1125),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 271/598 (45%), Positives = 366/598 (61%), Gaps = 29/598 (5%)
 Frame = -2

Query  1942  TSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASAL  1763
             T  HCN+K+IGARY   GY++   P +H  D  S RD  GHGTHT ST  G KV  A+ L
Sbjct  187   TPFHCNKKLIGARYFNSGYKSVV-PFSHLVD--SPRDYVGHGTHTLSTAAGAKVPGAT-L  242

Query  1762  GGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSL  1583
              G+  G+A GGAP  R+A YK CW  PF       C D D+LA FD A+ DGV V+SVSL
Sbjct  243   FGYGTGMAKGGAPNARVAAYKVCWP-PF---LGNECFDADILAGFDSAIDDGVDVLSVSL  298

Query  1582  GLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS--VTNVAPWIFTVGASSIDR  1409
             G  P D  +  D VA+G+ HA+K  I VV SAGN   P S  V+NVAPWI TVGAS+IDR
Sbjct  299   GGDPVD--YLDDAVAIGSFHAVKHGITVVCSAGN-SGPMSGTVSNVAPWILTVGASTIDR  355

Query  1408  VFSAPVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPGF-CRQDTLSPEKV  1235
              F + V L N   +KG+S++ +  Q+   PL+ + D   P  +      C    L P KV
Sbjct  356   EFPSYVHLRNRQQIKGQSLSPVSLQQKFYPLIGSEDARNPNRSIADATQCISGALDPAKV  415

Query  1234  KGKVVFCLTGGLSQTLE---VERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTD  1073
              GK+V C+ G  S+  +   V +AGG  +IL    S G+E+  ++ ++ AT+I    G  
Sbjct  416   TGKIVICIRGTNSRVEKGETVRQAGGTGMILANDESTGNEVLADAHVLPATHISYSDGV-  474

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             ++L YI + K+P+  +   KT+    P+P MA F+S GP+   P ILKPDITAPG++I+A
Sbjct  475   SLLSYIKSAKSPLGYITDPKTMLDTFPAPFMAAFSSRGPNTVTPGILKPDITAPGVSIIA  534

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++ +  P     D R V +N  SGTSMSCPHVS +  LLKA+HPDWS +AIKSAI+T+A
Sbjct  535   AYTGSLGPTSLDFDSRRVLFNSESGTSMSCPHVSGISGLLKALHPDWSPSAIKSAIITSA  594

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------S  551
              T++   E I ++  + A PF YG+GH++P++A DPGLVYD T  DYL F+CS       
Sbjct  595   RTQDNTLEPISNSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCSLGYNSTQ  654

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             I       Y CP K     +LNYPS+AI+ L+G++ + RTV NVG+   TY V V  P G
Sbjct  655   IAGFNGEPYSCPSKPLKIEDLNYPSIAISNLRGAVSLIRTVKNVGTPG-TYKVRVMEPAG  713

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              SV + P +LKF +VGE++ F V++K +S    G++ FG   WSDG H V++PI V +
Sbjct  714   ISVSVKPRKLKFDKVGEEKKFVVTLKAKSRDVAGDYAFGKLVWSDGKHYVRTPIAVKA  771



>ref|XP_004251819.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=772

 Score =   437 bits (1124),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 260/595 (44%), Positives = 362/595 (61%), Gaps = 30/595 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
              CNRK+IGARY +KG+ A  G +  T  F + RD  GHG+HT ST GG  V  A+  G +
Sbjct  183   RCNRKLIGARYFIKGFAAEAGALV-TSKFYTPRDTLGHGSHTLSTAGGNFVEGANIFG-Y  240

Query  1753  ANGVATGGAPLTRLAIYKACWQ--VPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
              NG A GG+P  R+A YKACW   +P D      C D DVLAAFD A+ DGV V+S+S+G
Sbjct  241   GNGTAKGGSPRARVASYKACWPPIIPSDS-----CTDADVLAAFDMAIHDGVDVLSLSMG  295

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVF  1403
              LP    + QD +A+G+ HAMKR I VV S GN    P ++ N APW+ TVGAS+IDR F
Sbjct  296   GLPVP--YAQDSIAIGSFHAMKRGIVVVTSGGNSGAYPGTIANTAPWLITVGASTIDREF  353

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
             S+ ++LGNN   +G S++   + K ++ P++     ++  +T     FC + TL P+K K
Sbjct  354   SSYIVLGNNKRYRGVSLSSKALPKGKSFPIITGASAKVANATAEEANFCIEGTLDPKKAK  413

Query  1231  GKVVFCLTGG---LSQTLEVERAGGAA-VILGS--IGSEIQVESFLITATNIFNPSGTDA  1070
             G ++ C  GG    S+ ++    G    VIL S   G E+  E +L  AT I    G   
Sbjct  414   GTILVCHRGGSAAFSKCIQATSVGAVGIVILNSAFFGDEMYAEPYLCPATFISYSDGLQ-  472

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  Y+ + +   A +    T  G KP+P MA F+S+GP+   P ILKPDITAPG++ILAA
Sbjct  473   VSSYVSSTRKATAYITRPTTELGTKPAPVMASFSSIGPNRVTPEILKPDITAPGVSILAA  532

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++    P +   D+R VK+N ++GTSMSCPHV+ VV LLK++HP WS AAIKSAIMT+A 
Sbjct  533   YTGVQGPADSELDNRRVKFNTMTGTSMSCPHVAGVVGLLKSLHPTWSPAAIKSAIMTSAR  592

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T++     + ++      PF YG+GHI P++A DPGLVYD T  DY+ F+C      + I
Sbjct  593   TRDNTINPMTNSTHLKVSPFAYGSGHIWPNRAMDPGLVYDLTIDDYMNFLCAQGYNETQI  652

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                    +KCP   S  SNLN PS+ + +LKGS+VV RT+ NVG+   TY   +++P G 
Sbjct  653   SFFTQGHFKCPDPISF-SNLNLPSITVPKLKGSIVVTRTLKNVGTPG-TYKAHIRSPIGI  710

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             +V + P  L+F ++GE++SF +++KV   K   ++ FG   WSD  H V+SPIVV
Sbjct  711   TVVVEPNTLEFRKIGEEKSFKITLKVNGQKAPKDYVFGHLIWSDNKHYVRSPIVV  765



>ref|XP_010514315.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=772

 Score =   437 bits (1124),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 357/597 (60%), Gaps = 34/597 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK++GARY  KGY A  GP+N +FD  S RD+ GHG+HT ST GG  V   S  G  
Sbjct  188   HCNRKLVGARYFHKGYAAAVGPLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVSVFGQ-  244

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +K   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  245   GNGTAKGGSPRARVAAYKVCWP----PMKGNECYDADVLAAFDAAIHDGADVISVSLGSE  300

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA K+ I VV SAGN      +V+N APW  TVGAS++DR F++
Sbjct  301   PTS--FFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQITVGASTMDREFAS  358

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  T +   +  P++ +   +   GS      C+  +L P+K KGK
Sbjct  359   NLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSALDAQLCKLGSLDPKKAKGK  418

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             ++ CL G   Q   VE+      AGG  ++L +    G+++  +  ++ AT + +     
Sbjct  419   ILVCLRG---QNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPATQLTSKDSL-  474

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+ +Y+   KNP+A + P +T  G KP+P MA F+S GPS   P ILKPDITAPG++++A
Sbjct  475   AVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDITAPGVSVIA  534

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++ A SP  +  D R + YN +SGTSMSCPH+S +  LLK  +P WS AAI+SAIMTTA
Sbjct  535   AYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAIRSAIMTTA  594

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +     I++A    A PF +GAGH+QP+ A +PGLVYDS   DYL F+C      S 
Sbjct  595   TTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQ  654

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPT  374
             I      ++ C    +S  NLNYPS+ +  L  S V V RTV NVG   +TY+V V  P 
Sbjct  655   IAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP-STYTVRVTNPR  713

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             G  V ++PT L F +VGEK++F V++  +   K   + FG   WSD  H V+SPIVV
Sbjct  714   GVYVAVNPTSLNFTKVGEKKTFKVTLVKDKGNKAKGYVFGELVWSDKKHRVRSPIVV  770



>ref|XP_002266728.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
 emb|CBI28486.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   437 bits (1123),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 258/596 (43%), Positives = 363/596 (61%), Gaps = 28/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  +GY A  G +N +F   + RD  GHG+HT ST GG  V  AS  G F
Sbjct  186   HCNRKLIGARYFHQGYAAAVGSLNSSF--HTPRDTEGHGSHTLSTAGGNFVEGASVFG-F  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+S SLG L
Sbjct  243   GNGTAKGGSPKARVAAYKVCWP----PVGGNECFDADILAAFDIAIHDGVDVLSASLGGL  298

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D +++G+ HA+K  I VV SAGN      +V+N++PW FTVGAS++DR F +
Sbjct  299   PTP--FFNDSLSIGSFHAVKHGIVVVCSAGNSGPADGTVSNISPWQFTVGASTMDRQFPS  356

Query  1396  PVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGK  1226
              ++LGN   ++G S++   +   +  PL+ A D +   ++      C+  TL   KVKGK
Sbjct  357   YLVLGNKKRLEGGSLSPKALPPNKFFPLISAADAKAANASADDALLCKAGTLDHSKVKGK  416

Query  1225  VVFCLTG---GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G    + +  +   AG   ++L +    G+E+  +  ++ A++I    G  A+ 
Sbjct  417   ILVCLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVLPASHINFTDGV-AVF  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              Y+ + K+P+A + P  T  G KP+P MA F+S GP+   P ILKPDITAPG++++AA++
Sbjct  476   TYLNSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIAAYT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R V +N +SGTSMSCPHVS +V LLK +HPDWS AAI+SA+MTTA T 
Sbjct  536   EAQGPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWSPAAIRSAMMTTARTM  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   EAI +A    A PF YGAGH++P++A +PGLVYD    DYL F+C      + I  
Sbjct  596   DNSMEAILNASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYLNFLCALGYNQTLIKM  655

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  Y CPK  S  +N NYPS+ + +L GS+ V RT+ NVG    TY   ++ PTG SV
Sbjct  656   FSERPYTCPKPISL-TNFNYPSITVPKLHGSITVTRTLKNVGPPG-TYKARIRKPTGISV  713

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              + P  LKF ++GE+++F ++++ E      ++ FG   WSD  H V+SPIVV +A
Sbjct  714   SVKPDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHFVRSPIVVKAA  769



>emb|CDP06146.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   437 bits (1123),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 264/596 (44%), Positives = 366/596 (61%), Gaps = 28/596 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  G +N TF+  S RD  GHG+HT ST GG  V  A+  G +
Sbjct  185   HCNRKLIGARYFNKGYASAVGKLNSTFN--SPRDGEGHGSHTLSTAGGNFVVGANVFG-Y  241

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +    C D D+LA  D A+ DGV VISVSLG  
Sbjct  242   GNGTAKGGSPRARVAAYKVCWP----PVSNNECFDADILAGIDMAIHDGVDVISVSLGGD  297

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P   YF  D +A+G+ HA+K  I V+ SAGN    P SV+NVAPW  TV AS++DR F +
Sbjct  298   PVP-YF-NDSIAIGSFHAVKHGIVVICSAGNSGPTPASVSNVAPWQITVAASTMDRHFPS  355

Query  1396  PVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              V+LGNN+   GES+++  +  ++  P+V A  V+    S      C+  TL   K KGK
Sbjct  356   YVVLGNNMRFSGESLSQEALPDKKFFPIVAAKSVKAAYASDKDAELCKAGTLDHSKAKGK  415

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G  ++  + ++A   G   ++L +    G+EI  +  ++ A++I    G  A+ 
Sbjct  416   ILVCLRGDNARVDKGQQAAAVGAVGMVLTNDKLSGNEIIADPHVLPASHINYTDGL-AVF  474

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI ++++P A +    T  G KP+P MA F+S GP+   P +LKPDITAPG++++AA++
Sbjct  475   SYIYSSRSPKAYITHPTTELGTKPAPFMAAFSSKGPNTLTPELLKPDITAPGVSVIAAFT  534

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  +  D R V +N  SGTSMSCPHVS +V LLK +HPDWS AAI+SAIMT+A ++
Sbjct  535   EAQGPTSEGFDKRRVLFNSESGTSMSCPHVSGIVGLLKTLHPDWSPAAIRSAIMTSARSR  594

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   E I +A    A PF YGAGHI P++AADPGLVYD T  DYL F+C      S I  
Sbjct  595   DNAFEPIINASYVKASPFSYGAGHIWPNRAADPGLVYDLTANDYLTFLCSLGYNESQIAL  654

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                   KCPK  S   +LNYPS+ + +L+GS+ V RT+ NVG A  TY+ ++ +P G SV
Sbjct  655   FTQVPKKCPKPISL-LDLNYPSITVPKLRGSITVTRTLKNVG-APATYTAKIVSPPGVSV  712

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              I P  L F  +GE++SF ++++++      ++ FG   WSDG H V+SPIVV ++
Sbjct  713   DIQPKSLTFARIGEEKSFKLTLQLKKPGAARDYVFGRLAWSDGKHFVRSPIVVKAS  768



>ref|XP_009759676.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=623

 Score =   432 bits (1110),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 258/595 (43%), Positives = 357/595 (60%), Gaps = 28/595 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
              CNRK+IGARY  +GY    G +N +F+  + RD  GHG+HT ST GG  V  AS  G +
Sbjct  40    QCNRKLIGARYFNQGYATLAGSLNSSFN--TPRDTDGHGSHTLSTAGGNFVQGASVFG-Y  96

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A Y+ CW      I    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  97    GNGTAKGGSPKARVAAYRVCWP----PIMGNECFDSDILAAFDMAIHDGVDVLSVSLG--  150

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDRVFSA  1397
                  +  D VA+G+ HA+K  I VV SAGN    P +V+NVAPW+ TVGAS++DR F +
Sbjct  151   GDAGAYVNDSVAIGSFHAVKHGIVVVTSAGNSGPGPGTVSNVAPWLITVGASTMDRQFPS  210

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              ++LGN    KGES  V  + K +  P++ A   + P  ST     C+   L P+KVKG 
Sbjct  211   YIILGNKKQYKGESLSVETLPKGKLFPIINAASAKAPHASTDDAQLCKAGALDPKKVKGT  270

Query  1225  VVFCLTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL G    + +  +   AG   ++L    + G+EI  +  ++ AT I    G + + 
Sbjct  271   ILVCLRGDNARVDKGQQAALAGAVGMVLANDYASGNEIIADPHVLPATQISYTDGLE-LF  329

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              Y+ + + P A++   KT  G KP+P MA F+S+GP+   P  LKPDITAPG++++AA++
Sbjct  330   AYVNSTRTPTASITHPKTQLGTKPAPVMAAFSSIGPNTVTPEFLKPDITAPGVSVIAAYT  389

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
              A  P  Q  D R VK+N +SGTSMSCPHVS +V LLK ++P WS +AIKSAIMTTA T+
Sbjct  390   GAEGPTNQDFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLYPTWSPSAIKSAIMTTARTR  449

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +   E + +A      PF YGAGH++P++A DPGLVYD T  DYL F+C      + I T
Sbjct  450   DNAIEPMLNASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTIDDYLSFLCAQGYNETQIKT  509

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
                  +KCP+  +   N+N PS+ +  L GS+ V RT+ NVGS   TY   ++ P G S 
Sbjct  510   FTQGPFKCPEPINF-INMNLPSITVPNLNGSVTVTRTLKNVGSPG-TYKACIRRPIGISA  567

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              + P  L+F  +GEK+SF +++KV+  K   ++ FG   WS G H V+SPIVV S
Sbjct  568   VVEPNSLEFKNIGEKKSFKLTLKVKGSKGPKDYVFGQLIWSYGKHYVRSPIVVKS  622



>ref|XP_008462019.1| PREDICTED: subtilisin-like protease isoform X1 [Cucumis melo]
Length=773

 Score =   436 bits (1122),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 260/596 (44%), Positives = 356/596 (60%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S HCNRK+IGARY  KGY +  GP+N +F   S RD  GHG+HT ST GG  VA AS  G
Sbjct  187   SFHCNRKLIGARYFNKGYASVVGPLNSSF--HSPRDKEGHGSHTLSTAGGNFVAGASVFG  244

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
                 G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG
Sbjct  245   -LGKGTAKGGSPRARVAAYKVCWPPK----AGNECFDADILAAFDLAIHDGVDVLSVSLG  299

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVF  1403
               P  N    D VA+G+ HA+K  I V+ SAGN      +VTNVAPW  TVGAS++DR F
Sbjct  300   GDP--NPLFNDSVAIGSFHAIKHGIVVICSAGNSGPAAGTVTNVAPWQITVGASTMDRKF  357

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V+LGN   ++GES+++  +  ++  PL+ A DV +  ++      C+  TL P K K
Sbjct  358   PSLVVLGNKKQIEGESLSQEALPSKKLYPLMNAADVRLANASAHEAQLCKAGTLDPMKAK  417

Query  1231  GKVVFCLTGGLSQTLEVERA---GGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G  ++  + E+A   G A +IL +    G+EI  +  ++ A +I N +   A
Sbjct  418   GKILVCLRGDNARVDKGEQALLAGAAGMILANNELSGNEILADPHVLPALHI-NYTDGSA  476

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K P A + P  T  G +P+P MA F+S+GP+   P ILKPDITAPGL+++AA
Sbjct  477   VFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDITAPGLSVIAA  536

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D+R V +N +SGTSMSCPHVS +  LL+ ++P WS AAIKSAIMTTA+
Sbjct  537   YTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSPAAIKSAIMTTAS  596

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T +   E + +A   VA PF+YGAGH+ P+ A DPGLVYD    +YL F+C      + I
Sbjct  597   TLDNNFEPLLNASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYLSFLCALGYDKAQI  656

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 D  + C +  S  +NLNYPS+ + +L  S+ + R + NVGS   TY  +++ P G 
Sbjct  657   SQFSDGPFNCSEPISL-TNLNYPSITVPKLSRSITITRRLKNVGSPG-TYEAKIRKPAGI  714

Query  367   SVKISPTELKFMEVGEK-QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV + P +L F ++GE+                  + +G   WSDG H V+SPIVV
Sbjct  715   SVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKNYVYGDLIWSDGKHHVRSPIVV  770



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   436 bits (1121),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 274/605 (45%), Positives = 371/605 (61%), Gaps = 43/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  171   FTASLCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  230

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G AP  R+A+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  231   LG-YASGTARGMAPRARVAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  281

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN      S++NVAPWI TVGA ++DR
Sbjct  282   LGGGMSDYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDR  339

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  340   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  392

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  393   PEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEK  452

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ NP A++    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  453   AG-DIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  511

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLK++HP+ S AAI+SA+
Sbjct  512   NILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPECSPAAIRSAL  571

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS--  554
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C+  
Sbjct  572   MTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALN  631

Query  553   ----SIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                  I +    +Y C P K+ S ++LNYPS A+     G+    RTVT+VG A  TYSV
Sbjct  632   YTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVDGVGAYKYTRTVTSVGGAG-TYSV  690

Query  391   EVKAP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             +V +  TG  + + P  L F E  EK+S+ V+  V+S K  G   FG  +WSDG H+V S
Sbjct  691   KVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGS  750

Query  214   PIVVS  200
             P+ +S
Sbjct  751   PVAIS  755



>ref|XP_010488664.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Camelina 
sativa]
Length=772

 Score =   436 bits (1122),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 357/597 (60%), Gaps = 34/597 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  GP+N +FD  S RD+ GHG+HT ST GG  V   S  G  
Sbjct  188   HCNRKLIGARYFHKGYAAAVGPLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVSVFGQ-  244

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      IK   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  245   GNGTAKGGSPRARVAAYKVCWP----PIKGNECYDADVLAAFDAAIHDGADVISVSLGSE  300

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA K+ I VV SAGN      +V+N APW  TVGAS++DR F++
Sbjct  301   PTS--FFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQITVGASTMDREFAS  358

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  T +   +  P++ +   +   GS      C+  +L P+K KGK
Sbjct  359   NLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSALDAQLCKLGSLDPKKAKGK  418

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             ++ CL G   Q   VE+      AGG  ++L +    G+++  +  ++ AT + +     
Sbjct  419   ILVCLRG---QNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPATQLTSKDSL-  474

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+ +Y+   KNP+A + P +T  G KP+P MA F+S GPS   P ILKPDITAPG++++A
Sbjct  475   AVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDITAPGVSVIA  534

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++ A SP  +  D R + YN +SGTSMSCPH+S +  LLK  +P WS AAI+SAIMTTA
Sbjct  535   AYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAIRSAIMTTA  594

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +     I++A    A PF +GAGH+QP+ A +PGLVYDS   DYL F+C      S 
Sbjct  595   TTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQ  654

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPT  374
             I      ++ C    +S  NLNYPS+ +  L  S V V RTV NVG   ++Y+V V  P 
Sbjct  655   IAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP-SSYTVRVTKPR  713

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             G  V ++PT L F +VGE+++F V++  +   K   + FG   WSD  H V+SPIVV
Sbjct  714   GVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKHRVRSPIVV  770



>gb|AFV08661.1| subtilisin-like protease [Glycine max]
Length=773

 Score =   436 bits (1121),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 273/595 (46%), Positives = 362/595 (61%), Gaps = 29/595 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY +  GP+N +FD  S RD  GHGTHT ST GG  VA  S  G  
Sbjct  187   HCNRKLIGARYFNKGYASVAGPLNSSFD--SPRDNEGHGTHTLSTAGGNMVARVSVFGQ-  243

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P+ R+A YK CW      +    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  244   GQGTAKGGSPMARVAAYKVCWP----PVGGEECFDADILAAFDLAIHDGVDVLSVSLGGS  299

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVT--NVAPWIFTVGASSIDRVFS  1400
                  F +D VA+G+ HA KR + VV SAGN   P   T  N+APW  TV AS++DR F 
Sbjct  300   SST--FFKDSVAIGSFHAAKRGVVVVCSAGN-SGPAEATAENLAPWHVTVAASTMDRQFP  356

Query  1399  APVLLGNNLLVKGESVTEIK-KQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
               V+LGN++  KGES++  K   +  P++ A D ++  +       C+  TL P K KGK
Sbjct  357   TYVVLGNDITFKGESLSATKLAHKFYPIIKATDAKLASARAEDAVLCQNGTLDPNKAKGK  416

Query  1225  VVFCLTGGLSQTLEVERA---GGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAIL  1064
             +V CL G  ++  + E+A   G   ++L    + G+EI  +  ++ A++I N +   A+ 
Sbjct  417   IVVCLRGINARVDKGEQAFLAGAVGMVLANDKTTGNEIIADPHVLPASHI-NFTDGSAVF  475

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K PVA +   KT    KP+P MA F+S GP+   P ILKPDITAPG++++AA++
Sbjct  476   NYINSTKFPVAYITHPKTQLDTKPAPFMAAFSSKGPNTMVPEILKPDITAPGVSVIAAYT  535

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             EA  P  Q  D R + +N +SGTSMSCPHVS +V LL+A++P WS AAIKSAIMTTATT 
Sbjct  536   EAQGPTNQVFDKRRIPFNSVSGTSMSCPHVSGIVGLLRALYPTWSTAAIKSAIMTTATTL  595

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             + + E + +A    A PF YGAGH+QP++A DPGLVYD T  DYL F+C      + I  
Sbjct  596   DNEVEPLLNATDGKATPFSYGAGHVQPNRAMDPGLVYDITIDDYLNFLCALGYNETQISV  655

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  YKC KK S   NLNYP + + +L GS+ V RT+ NVGS   TY   V+ P G +V
Sbjct  656   FTEGPYKCRKKFSL-LNLNYPLITVPKLSGSVTVTRTLKNVGSPG-TYIAHVQNPYGITV  713

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              + P+ LKF  VGE++SF ++ K    K    + FG   WSDG H V SPIVV +
Sbjct  714   SVKPSILKFKNVGEEKSFKLTFKAMQGKATNNYAFGKLIWSDGKHYVTSPIVVKA  768



>ref|XP_002269259.3| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=749

 Score =   435 bits (1119),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 266/594 (45%), Positives = 359/594 (60%), Gaps = 33/594 (6%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK++GARY  KGYEA  G P++ ++  +++RD +GHGTHT ST GG  V  A+ LG  
Sbjct  168   CNRKLVGARYFNKGYEAALGKPLDSSY--QTARDTNGHGTHTLSTAGGGFVGGANLLGS-  224

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  225   GYGTAKGGSPSARVASYKVCWPS---------CYDADILAAFDAAIHDGVDVLSVSLGGP  275

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P+D +   D +A+G+  A+K+ I VV SAGN    P SV N APWI TV AS+IDR F +
Sbjct  276   PRDYFL--DSIAIGSFQAVKKGIVVVCSAGNSGPTPGSVENSAPWIITVAASTIDRDFPS  333

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              V+LGNNL  KG S     +   +  PLVY+ D   P ++      C   +L PEKVKGK
Sbjct  334   YVMLGNNLQFKGLSFYTNSLPAAKFYPLVYSVDARAPNASAREAQLCFVGSLDPEKVKGK  393

Query  1225  VVFCLTGGLSQTLE----VERAGGAAVILGS-IGSEIQVESFLITATNIFNPSGTDAILK  1061
             +V+CL G L++ ++    V +AGG  +IL + + +   +       T+  + +   AIL 
Sbjct  394   IVYCLIG-LNEIVQKSWVVAQAGGIGMILANRLSTSTLIPQAHFVPTSYVSAADGLAILL  452

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI   K PVA  I G T  G   +P MA F+S GP+   P IL PDITAPG+NILAA+ E
Sbjct  453   YIHITKYPVA-YIRGATEVGTVAAPIMASFSSQGPNTITPGILNPDITAPGVNILAAYIE  511

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P     D R V +NI+SGTSMSCP VS  V LLK IHP WS +AI+SAIMTTA T+N
Sbjct  512   AKGPTFLQSDDRRVLFNIVSGTSMSCPQVSGTVGLLKKIHPHWSPSAIRSAIMTTARTRN  571

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTT  539
                + + +   E A PF+YGAGH+ P++A DPGLVYD T +DYL F+CS       +   
Sbjct  572   NVRQPMANGTLEEANPFNYGAGHLWPNRAMDPGLVYDLTTIDYLNFLCSIGYNATQLSRF  631

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             +D  Y+ P    S  +LNYPS+ +    G + V RT+ NVG+   TY+V  + P+   VK
Sbjct  632   VDEPYESPPNPMSVLDLNYPSITVPSFSGKVTVTRTLKNVGTP-ATYAVRTEVPSELLVK  690

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             + P  LKF ++ E+++F V+++ +   +   + FG   WSDG H V+SPIVV++
Sbjct  691   VEPERLKFEKINEEKTFKVTLEAKRDGEGSGYIFGRLIWSDGEHYVRSPIVVNA  744



>gb|KDP35557.1| hypothetical protein JCGZ_08995 [Jatropha curcas]
Length=786

 Score =   436 bits (1121),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 269/601 (45%), Positives = 365/601 (61%), Gaps = 45/601 (7%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CN+K+IGARY  KG+EA  G P+N +F+  ++RD+ GHGTHT ST GGR V+ A+  G  
Sbjct  195   CNKKLIGARYFNKGFEAAIGSPLNSSFN--TARDLDGHGTHTLSTAGGRFVSGANIFGS-  251

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
             ANG   GG P  R+A YK CW           C D D+LAAFD A+ DGV +++VSLG  
Sbjct  252   ANGTIKGGLPNARVASYKVCWPS---------CFDADILAAFDAAIQDGVDILTVSLGSR  302

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P+ NYF   G+++G+ HA++  I VV SAGN   +P S +NVAPWI TV ASSIDR F +
Sbjct  303   PR-NYFGH-GISIGSFHAVRNGILVVCSAGNSGPQPASASNVAPWILTVAASSIDRNFPS  360

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGK  1226
              V+LGNN L KG S     +  +   PLVY+ D +    ST+   FC   +L P K+KGK
Sbjct  361   NVILGNNRLFKGLSFNTNSLPARNYHPLVYSVDAKNANVSTSDAQFCSPGSLDPTKIKGK  420

Query  1225  VVFCLTG-------GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGT  1076
             +V+CL          + +   V +AGG  +IL S     + I    FL   T+I + +  
Sbjct  421   IVYCLRNLDPEVEPDVEKGWVVAQAGGVGMILASQFDFQTIIPRPHFL--PTSIVSATDG  478

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
              +IL YI  +  PVA  I G+T  G   +P MA F+S GP+   P ILKPDITAPG++I+
Sbjct  479   LSILAYIYNSGFPVA-YISGETEVGEVAAPIMASFSSPGPNAITPEILKPDITAPGVHII  537

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AA+S+AS P     D R V +NIISGTSM+CPHV+ +  LLK +HPDWS AAIKSAIMTT
Sbjct  538   AAYSKASGPSSLEVDQRHVPFNIISGTSMACPHVAGIAGLLKTLHPDWSPAAIKSAIMTT  597

Query  715   ATTK-NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS-----  554
             A T+ N+K   + + + + A PF+YG+GHI P++A DPGLVYD T  DYL F+CS     
Sbjct  598   ARTRSNIKQPILTNLF-DKANPFNYGSGHIWPNRATDPGLVYDLTPKDYLNFLCSIGYNA  656

Query  553   -SIGTTLDPSYKCPKKASSPS---NLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEV  386
               I       Y CP K ++ +   + NYPS+ +  L   +++ RT+ NVG+    Y V +
Sbjct  657   TQISAFAGAPYSCPSKNTTTNFLLDFNYPSITVPNLSKKVILTRTLKNVGTPG-VYRVRI  715

Query  385   KAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
              AP G SVK+ P +L F ++ E++ F ++++ +          G   WSDGIH V+SPIV
Sbjct  716   DAPEGISVKVEPKKLGFSKMNEEKRFKLTLEAKKNGSQDYVFGGLV-WSDGIHNVRSPIV  774

Query  205   V  203
             V
Sbjct  775   V  775



>ref|XP_008229443.1| PREDICTED: cucumisin-like [Prunus mume]
Length=764

 Score =   436 bits (1120),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 255/596 (43%), Positives = 347/596 (58%), Gaps = 32/596 (5%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFD----FRSSRDISGHGTHTASTVGGRKVA  1778
             FT ++CNRKIIG+R++V+G+E   GP+  +F     FRS+RD  GHG+HT ST+ G  V 
Sbjct  177   FTLANCNRKIIGSRFYVQGFEVEKGPL-ESFAPLPFFRSARDSDGHGSHTGSTIAGSVVP  235

Query  1777  NASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQV  1598
             NAS  G  A G A GGAP TRLAIYKACW           C D DVL+A D A+ DGV +
Sbjct  236   NASFFG-MARGTARGGAPSTRLAIYKACW--------FNLCSDADVLSAMDDAIYDGVDI  286

Query  1597  ISVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASS  1418
             +S+SLG  P    + ++ +++GA HA  R I V  SAGN   P +  NVAPWI TV AS+
Sbjct  287   LSLSLGPDPPQPTYFENAISIGAFHAFHRGILVSASAGNSGFPSTACNVAPWILTVAAST  346

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPE  1241
             +DR F + V LGN+ ++KG S+  +K + +  L+ A    +P  T     FC+ +TL+  
Sbjct  347   MDREFHSNVYLGNSRILKGSSLNPLKMERSYGLIAASAAALPEVTAKNASFCKNNTLNAS  406

Query  1240  KVKGKVVFC-----LTGGLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGT  1076
              +KGK+V C         + +++ V + GG  +IL     +     F+I  T I      
Sbjct  407   LIKGKIVVCTFETFTDNRMDKSIVVRQGGGVGMILVDPFLKDVGFQFVIPGTLIGQEEAQ  466

Query  1075  DAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNIL  896
             + + +Y+ T KNPVA + P  T    KP+P MA F+S+GP+   P+I+KPD+T PG+N+L
Sbjct  467   E-LQEYMTTEKNPVAIISPTITFLKTKPAPEMAVFSSMGPNIITPDIIKPDVTGPGVNVL  525

Query  895   AAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTT  716
             AAWS  ++        RSV YNIISGTSMSCPHVSAV A+LK+  P WS AAI SAIMTT
Sbjct  526   AAWSPVATAATA---ERSVNYNIISGTSMSCPHVSAVAAILKSYQPSWSPAAIMSAIMTT  582

Query  715   ATT-KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTT  539
             AT   N +    +D  G    PF YG+GHI P+ A DPGLVYD    D + F+CS+  + 
Sbjct  583   ATVLDNSRSTIGRDPNGTPTTPFDYGSGHINPAAAIDPGLVYDFDSHDIINFLCSTGASP  642

Query  538   LDPS------YKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAP  377
             L           C K  +   N NYPS+ ++++ G + V+RTVT  G  +T Y   V  P
Sbjct  643   LQLKNLTGSLVYCQKSPTPSYNFNYPSIGVSKMNGRVSVRRTVTYYGKGSTVYVANVDYP  702

Query  376   TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
              G +V ++P++LKF + GEK   F           G F FG   WS+GI  V+SPI
Sbjct  703   AGVNVTVAPSKLKFTKTGEKM-SFRVDFAAFKNSNGSFVFGALTWSNGIQKVRSPI  757



>ref|XP_011013813.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=768

 Score =   436 bits (1120),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 262/593 (44%), Positives = 354/593 (60%), Gaps = 32/593 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGYEA  G    + +  ++RD  GHGTHT ST GGR V+ A+ LG  A
Sbjct  184   CNRKLIGARYFNKGYEAALGRALDSSN-NTARDTDGHGTHTLSTAGGRFVSGANFLGS-A  241

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV ++S+SLG   
Sbjct  242   YGTAKGGSPNARVASYKVCWPR---------CYDADILAAFDAAIQDGVDILSLSLGRAL  292

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY---SVTNVAPWIFTVGASSIDRVFS  1400
             +  YF + G+A+G+  A+   I VV SAGN  + +   + +NVAPW+ TV AS+IDR F 
Sbjct  293   EIPYF-RSGIAIGSFQAVMNGILVVCSAGNSGQGFGFGTASNVAPWVLTVAASTIDREFP  351

Query  1399  APVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKG  1229
             + V+LGNN   KG S     +  ++  P+V + D +    S  +   C  ++L P KV+G
Sbjct  352   SNVVLGNNKEFKGTSFNTNNLSARKYYPIVNSVDAKAANASAQLAQLCYPESLDPTKVRG  411

Query  1228  KVVFCLTG---GLSQTLEVERAGGAAVILGS--IGSEIQVESFLITATNIFNPSGTDAIL  1064
             K+V+CL      + Q+L V +AGG  +IL      S      F +  + +    G  ++L
Sbjct  412   KIVYCLGDMIPDVEQSLVVAQAGGVGMILAHQFADSSSSPRGFFVPTSLVSAIDGL-SVL  470

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K+PVA  I G T  G   +P MAPF+S GP+   P ILKPDITAPG++ILAA++
Sbjct  471   SYIHSTKSPVA-YISGSTEIGKVVAPVMAPFSSTGPNEITPEILKPDITAPGVHILAAYT  529

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             +A   L +  D R + +NIISGTSMSCPHVS +  LLK +HPDWS AAIKSAIMTTA T 
Sbjct  530   KAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPDWSPAAIKSAIMTTARTS  589

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGT  542
             +   + I  A    A PF+YG+GH++P++A DPGLVYD T  DYL F+CS       +  
Sbjct  590   SNARQPIPKASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTDYLNFLCSIGYNATQMSI  649

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSV  362
               +  Y CP K  S  N NYPS+ +  L G++ + R + NVG+    Y+V VK P G  V
Sbjct  650   FNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRILKNVGTPG-LYTVRVKMPDGILV  708

Query  361   KISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             K+ P  LKF ++ E+++F V +K         + FG   WSDG+H VKSPIVV
Sbjct  709   KVEPESLKFSKLNEERTFKVMLKATDDWYSSSYVFGGLTWSDGVHRVKSPIVV  761



>gb|KDP29034.1| hypothetical protein JCGZ_16423 [Jatropha curcas]
Length=782

 Score =   436 bits (1121),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 267/598 (45%), Positives = 364/598 (61%), Gaps = 31/598 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFD--FRSSRDISGHGTHTASTVGGRKVANASALGG  1757
             CNRK+IGARY  KGY   +      +D    + RDI GHGTHT ST  G  V  AS +G 
Sbjct  193   CNRKLIGARYFNKGYIEEYKLKVGRWDPSLNTPRDIEGHGTHTLSTAAGNFVPKASVVG-  251

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
               +G A GGAP  R+A YK CW    +D     C D D++  FD A+ DGV V+SVSLG 
Sbjct  252   IGSGTAKGGAPKARVAAYKVCWSA-VEDKDIDGCYDADIIEGFDAAIHDGVDVLSVSLGG  310

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
               Q +YF  DG+A+G+ HA+K+ I VV SAGN   EP +V+NVAPW+ TVGAS+IDR   
Sbjct  311   -DQTDYF-NDGIAIGSFHAVKKGIVVVVSAGNSGPEPGTVSNVAPWMITVGASTIDRKIQ  368

Query  1399  APVLLGNNLLVKGESVTEIKKQETL-PLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
               V LGN   +KG S+++   +  L PL+ +   +   ++      C   TL P KVKGK
Sbjct  369   TIVELGNGHHLKGTSISKAMPENKLYPLISSVQAKAANASVKDAELCLPGTLDPAKVKGK  428

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVIL---GSIGSEIQVESFLITATNIFNPSGTD  1073
             ++ CL G   +T  V++      AG   +IL    S G  I  ++ L+ A++I    G  
Sbjct  429   ILACLRG---ETARVDKGAQAALAGAVGMILCNDESDGDSINTDAHLLPASHITYKDGL-  484

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+  YI + ++P+  + P   IFG KP+P MA F+S+GP+   P ILKPDITAPG++I+A
Sbjct  485   ALFSYINSTRDPLGFITPTSEIFGTKPAPFMAAFSSVGPNTVTPQILKPDITAPGVDIIA  544

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             +++ +SSP     D R   +  +SGTSMSCPHV+ VVALLK +HP+WS AAIKSAIMTTA
Sbjct  545   SYTGSSSPTGLDFDKRRTPFITMSGTSMSCPHVAGVVALLKTLHPEWSPAAIKSAIMTTA  604

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
              T++   + + D     A PF+YG+GHI+P++A +PGLVYD +  DYL F+C      SS
Sbjct  605   RTRDNTPQPLLDGSSVKATPFNYGSGHIRPNRAMNPGLVYDLSVNDYLDFLCAIGYNQSS  664

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTG  371
             I       +KCPK AS   + NYPS+ I +L GS+ V R + NVGSA   Y+V +K P G
Sbjct  665   I-DAFSADHKCPKSASL-LDFNYPSITIPKLSGSVTVSRKLKNVGSAG-KYAVRIKEPYG  721

Query  370   YSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              SV + P+ L F + GE++SF  + K +       +EFG   W+DG+H V+SPIVVS+
Sbjct  722   ISVSVEPSALTFEKTGEEKSFKATFKAKWEGAAKNYEFGGLTWTDGVHYVRSPIVVST  779



>ref|XP_004243217.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=774

 Score =   436 bits (1120),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 264/598 (44%), Positives = 358/598 (60%), Gaps = 38/598 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY    G +N TF+  + RD  GHG+HT ST GG  V  +S  G +
Sbjct  191   HCNRKLIGARYFNKGYATLAGSLNSTFN--TPRDTDGHGSHTLSTAGGNFVEGSSVFG-Y  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG--  1580
              NG A GG+P  R+A YK CW      I    C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  248   GNGTAKGGSPKARVAAYKVCWT----PISGNECFDADILAAFDMAIHDGVDVLSVSLGGD  303

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVF  1403
              +P    +  D +A+G+ HA+K  I VV SAGN     S V+NVAPW+ TVGAS++DR F
Sbjct  304   AVP----YANDSIAIGSFHAVKHGIVVVTSAGNSGPAVSTVSNVAPWVITVGASTMDRQF  359

Query  1402  SAPVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVK  1232
              + V LGNN   KGES  V  + K +  P++ A   +   +TT     C+   L P+KVK
Sbjct  360   PSYVTLGNNKCYKGESLSVEALPKGKLFPIITAASAKATHATTYDAQLCKAGALDPKKVK  419

Query  1231  GKVVFCLTG---GLSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDA  1070
             G ++ CL G    + +  +   AG  A++L    + G+EI  +  ++ AT I    G D 
Sbjct  420   GTILVCLRGENARVDKGQQAALAGAVAMVLANDYASGNEIIADPHVLPATQISYTDGLD-  478

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             ++ Y+ + + P A +    T  G KP+P MA F+S+GP+   P ILKPDITAPG++I+AA
Sbjct  479   VIAYVNSTRAPTAFITHPTTQLGTKPAPVMAAFSSIGPNTVTPQILKPDITAPGVSIIAA  538

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++ A  P EQ  D R VK+N +SGTSMSCPHVS +V LLK +HP WS +AIKSAIMTTA 
Sbjct  539   FTGAQGPTEQAFDKRRVKFNSVSGTSMSCPHVSGIVGLLKTLHPTWSPSAIKSAIMTTAR  598

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSI  548
             T++   E + +A      PF YGAGH++P++A DPGLVYD T  DYL F+C      + I
Sbjct  599   TRDNSVEPMLNASYIKTSPFAYGAGHVRPNRAMDPGLVYDLTIDDYLSFLCAQGYNETQI  658

Query  547   GTTLDPSYKCPKKASSPSN---LNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAP  377
              T    S+KCP     P N   +N PS+ +  L  S+ + RT+ NVGS   TY   ++ P
Sbjct  659   KTFTLGSFKCP----DPINFIDMNLPSITVPNLNSSVTITRTLKNVGSPG-TYKARIRHP  713

Query  376   TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              G S  + P  L+F  + E++SF +++KV+  K   ++ FG   WSD  H V+SPIVV
Sbjct  714   IGISAVVEPNSLEFKNINEEKSFKLTLKVKGSKAPKDYVFGQLIWSDNKHYVRSPIVV  771



>ref|XP_004506157.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=759

 Score =   435 bits (1118),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 257/599 (43%), Positives = 360/599 (60%), Gaps = 37/599 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGP----VNHTFDFRSSRDISGHGTHTASTVGGRKVA  1778
             FT ++CN+KI+GAR++ KG+EA  GP    VN+ F FRS+RD  GHGTHTAST+ G  V 
Sbjct  171   FTLANCNKKIVGARFYSKGFEAETGPLEDIVNNIF-FRSARDSDGHGTHTASTIAGSIVV  229

Query  1777  NASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQV  1598
             NAS L G A G A GGAP  RLAIYKACW   F+      C D DVL+A D A+ DGV +
Sbjct  230   NAS-LFGIAKGTARGGAPSARLAIYKACW---FE-----LCSDADVLSAMDDAIHDGVDI  280

Query  1597  ISVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASS  1418
             +S SLG  P    + ++ +++GA HA ++ I V  SAGN   P +  NVAPWI TV AS+
Sbjct  281   LSXSLGPNPPQPIYFENALSIGAFHAFQKGILVSASAGNSVFPRTACNVAPWILTVAAST  340

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVY-AGDVEIPGSTTIPGFCRQDTLSPE  1241
             +DR FS+ + LGN+ ++KG S+  IK +++  L+Y +       S T   FC+ +TL P 
Sbjct  341   VDREFSSNIYLGNSKVLKGLSLNPIKMEDSHGLIYGSAAAASGVSATNASFCKNNTLDPN  400

Query  1240  KVKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGT  1076
              + GK+V C     +     + + + + GG  +IL    ++     F+I +T I    G 
Sbjct  401   LINGKIVICTIERFTDNRREKAIIIRQGGGVGMILIDHNAKDVGFQFVIPSTLI----GQ  456

Query  1075  DAILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             DA+ +   YI T+KNP A + P  T+ G KP+P  A F+S+GP+   P+I+KPDIT PG+
Sbjct  457   DAVEELQAYINTDKNPTAIISPTVTVVGTKPAPEAAAFSSMGPNIITPDIIKPDITGPGV  516

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAWS  ++  E   + +SV YNIISGTSMSCPH+SAV A++K+ HP W+ AAI SA+
Sbjct  517   NILAAWSPVAT--EATVEQQSVNYNIISGTSMSCPHISAVAAIIKSYHPLWTPAAIMSAV  574

Query  724   MTTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS-  551
             MTTAT  +     I +D  G    PF YG+GH+ P+ + +PGLVYD +  D L F+CS+ 
Sbjct  575   MTTATVMDNTYHLIGRDPNGTQTTPFDYGSGHVNPAASLNPGLVYDFSSQDVLDFLCSNG  634

Query  550   -----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEV  386
                  +        +C K   +  N NYPS+ ++ L GS+ V RTVT  G     Y   V
Sbjct  635   ASPSQLKNITGELTQCQKAPIASYNFNYPSIGVSNLNGSLSVYRTVTYYGHEPAVYVASV  694

Query  385   KAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             + P+G +V ++P E+KF ++GEK + F       +   G F FG   W++G   V+SPI
Sbjct  695   ENPSGVNVTVTPVEMKFWKMGEK-TTFRIDFNPFMNSNGNFVFGALTWNNGRQRVRSPI  752



>ref|XP_010488663.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Camelina 
sativa]
Length=772

 Score =   435 bits (1119),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 264/596 (44%), Positives = 356/596 (60%), Gaps = 34/596 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  GP+N +FD  S RD+ GHG+HT ST GG  V   S  G  
Sbjct  188   HCNRKLIGARYFHKGYAAAVGPLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVSVFGQ-  244

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      IK   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  245   GNGTAKGGSPRARVAAYKVCWP----PIKGNECYDADVLAAFDAAIHDGADVISVSLGSE  300

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA K+ I VV SAGN      +V+N APW  TVGAS++DR F++
Sbjct  301   PTS--FFNDSVAIGSFHAAKKRIVVVCSAGNSGPGDGTVSNAAPWQITVGASTMDREFAS  358

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  T +   +  P++ +   +   GS      C+  +L P+K KGK
Sbjct  359   NLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGSALDAQLCKLGSLDPKKAKGK  418

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             ++ CL G   Q   VE+      AGG  ++L +    G+++  +  ++ AT + +     
Sbjct  419   ILVCLRG---QNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPATQLTSKDSL-  474

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+ +Y+   KNP+A + P +T  G KP+P MA F+S GPS   P ILKPDITAPG++++A
Sbjct  475   AVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDITAPGVSVIA  534

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++ A SP  +  D R + YN +SGTSMSCPH+S +  LLK  +P WS AAI+SAIMTTA
Sbjct  535   AYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAIRSAIMTTA  594

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +     I++A    A PF +GAGH+QP+ A +PGLVYDS   DYL F+C      S 
Sbjct  595   TTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQ  654

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPT  374
             I      ++ C    +S  NLNYPS+ +  L  S V V RTV NVG   ++Y+V V  P 
Sbjct  655   IAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP-SSYTVRVTKPR  713

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
             G  V ++PT L F +VGE+++F V++  +   K   + FG   WSD  H V+SPIV
Sbjct  714   GVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKHRVRSPIV  769



>emb|CBI38462.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   435 bits (1119),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 266/594 (45%), Positives = 359/594 (60%), Gaps = 33/594 (6%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK++GARY  KGYEA  G P++ ++  +++RD +GHGTHT ST GG  V  A+ LG  
Sbjct  191   CNRKLVGARYFNKGYEAALGKPLDSSY--QTARDTNGHGTHTLSTAGGGFVGGANLLGS-  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK CW           C D D+LAAFD A+ DGV V+SVSLG  
Sbjct  248   GYGTAKGGSPSARVASYKVCWPS---------CYDADILAAFDAAIHDGVDVLSVSLGGP  298

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             P+D +   D +A+G+  A+K+ I VV SAGN    P SV N APWI TV AS+IDR F +
Sbjct  299   PRDYFL--DSIAIGSFQAVKKGIVVVCSAGNSGPTPGSVENSAPWIITVAASTIDRDFPS  356

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              V+LGNNL  KG S     +   +  PLVY+ D   P ++      C   +L PEKVKGK
Sbjct  357   YVMLGNNLQFKGLSFYTNSLPAAKFYPLVYSVDARAPNASAREAQLCFVGSLDPEKVKGK  416

Query  1225  VVFCLTGGLSQTLE----VERAGGAAVILGS-IGSEIQVESFLITATNIFNPSGTDAILK  1061
             +V+CL G L++ ++    V +AGG  +IL + + +   +       T+  + +   AIL 
Sbjct  417   IVYCLIG-LNEIVQKSWVVAQAGGIGMILANRLSTSTLIPQAHFVPTSYVSAADGLAILL  475

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI   K PVA  I G T  G   +P MA F+S GP+   P IL PDITAPG+NILAA+ E
Sbjct  476   YIHITKYPVA-YIRGATEVGTVAAPIMASFSSQGPNTITPGILNPDITAPGVNILAAYIE  534

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P     D R V +NI+SGTSMSCP VS  V LLK IHP WS +AI+SAIMTTA T+N
Sbjct  535   AKGPTFLQSDDRRVLFNIVSGTSMSCPQVSGTVGLLKKIHPHWSPSAIRSAIMTTARTRN  594

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTT  539
                + + +   E A PF+YGAGH+ P++A DPGLVYD T +DYL F+CS       +   
Sbjct  595   NVRQPMANGTLEEANPFNYGAGHLWPNRAMDPGLVYDLTTIDYLNFLCSIGYNATQLSRF  654

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
             +D  Y+ P    S  +LNYPS+ +    G + V RT+ NVG+   TY+V  + P+   VK
Sbjct  655   VDEPYESPPNPMSVLDLNYPSITVPSFSGKVTVTRTLKNVGTP-ATYAVRTEVPSELLVK  713

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
             + P  LKF ++ E+++F V+++ +   +   + FG   WSDG H V+SPIVV++
Sbjct  714   VEPERLKFEKINEEKTFKVTLEAKRDGEGSGYIFGRLIWSDGEHYVRSPIVVNA  767



>ref|XP_009112378.1| PREDICTED: subtilisin-like protease, partial [Brassica rapa]
Length=619

 Score =   430 bits (1106),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 279/603 (46%), Positives = 362/603 (60%), Gaps = 39/603 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+ V GYE   GPV+ + + RS RD  GHGTHTAST  G  V  A+ 
Sbjct  33    FTASLCNRKLIGARFFVTGYEKINGPVDESKESRSPRDDDGHGTHTASTAAGSVVEGANL  92

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FANG A G A   R+A+YK CW+          C   DVLA  D A+ D V V+S+S
Sbjct  93    LG-FANGTARGMAYRARVAVYKVCWK--------PTCFGSDVLAGIDKAIEDNVNVLSIS  143

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG   +D     + +A+GA  AM+R I V  SAGN    P+S++NVAPWI TVGA ++DR
Sbjct  144   LGRRRRD---YNNEIAIGAFSAMERGIFVSCSAGNDGPNPFSLSNVAPWITTVGAGTLDR  200

Query  1408  VFSAPVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEKV  1235
              F A V LGN     G S+   +    + LP VYAG+     + T   FC   TL PEKV
Sbjct  201   DFPALVTLGNGKYYTGVSLFKGDALSSKLLPFVYAGNAS--NNATYGNFCFPGTLIPEKV  258

Query  1234  KGKVVFCLTG---GLSQTLEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             KGK+V C  G    + +   V+ AGG  +IL +    G E    +FL+ AT +     +D
Sbjct  259   KGKIVMCEKGVNVRVEKGEVVKAAGGLGMILANTAYEGEERTANAFLLPATTV-GEKASD  317

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
              I  Y  T+ NP A+++   T+   +PSP +A F+S GP+   PNILKPD+ APG+NILA
Sbjct  318   IIRHYAFTDPNPTASIVFQGTVVNVQPSPVLAAFSSRGPNPITPNILKPDLIAPGVNILA  377

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             AW+ A  P     D R V++NIISGTSMSCPHVS + ALLK+++P+WS AAI+SA+MTTA
Sbjct  378   AWTGAVGPSGLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVYPEWSPAAIRSALMTTA  437

Query  712   TTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------S  554
                   G  I D A G  + PF +GAGH+ P+ A +PGL+YD T  DYL F+C      S
Sbjct  438   YNTYKDGNPIIDIATGIPSTPFEHGAGHVSPTTAVNPGLIYDLTTADYLGFLCALKYNSS  497

Query  553   SIGTTLDPSYKC-PKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYSVEVK  383
              I      +Y C P K  S ++LNYPS A+  + GS   K  RTVTNVG A  +YSV+V 
Sbjct  498   LIRIISRGNYTCDPSKTYSVADLNYPSFAV-NVDGSSTYKYTRTVTNVGGAG-SYSVKVT  555

Query  382   APTGYSVKIS--PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             + T  +VKIS  P  L F EV EK+S+ V+  V+S K  G   FG  +WSDG H+V SP+
Sbjct  556   SET-TAVKISVEPAILNFKEVNEKKSYEVTFTVDSSKPSGSNSFGSIEWSDGKHVVASPV  614

Query  208   VVS  200
              +S
Sbjct  615   AIS  617



>ref|XP_007015857.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY33476.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=784

 Score =   435 bits (1119),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 261/615 (42%), Positives = 356/615 (58%), Gaps = 52/615 (8%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             F  S+CNRKIIGAR++ KG+EA +GP+   N +F FRS+RD  GHGTHTAST+ G  VAN
Sbjct  179   FALSNCNRKIIGARFYFKGFEAKYGPLESLNSSF-FRSARDSDGHGTHTASTIAGSVVAN  237

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS L G A G A GGAP  RLAIYKACW           C D D+L+A D A++DGV ++
Sbjct  238   AS-LFGMARGTARGGAPGARLAIYKACW--------FNLCTDADILSAMDDAISDGVDIL  288

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+S G  P    + +D  ++GA HA +  + V  SAGN   P + TNVAPWI TV ASS+
Sbjct  289   SLSFGPDPPQPSYFEDATSIGAFHAFENGVLVSASAGNSIFPGTATNVAPWILTVAASSV  348

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGST-TIPGFCRQDTLSPEK  1238
             DRVF++ +LLGN+ ++KG S+  +K + +  L+        G T     FC+ +TL    
Sbjct  349   DRVFNSNILLGNSKVLKGFSLNPLKMETSYGLIAGSAAAAKGITPENASFCKNNTLDATL  408

Query  1237  VKGKVVFCLTGGLSQ-----TLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C    +++     ++ + + GG  +IL    ++     F++  T I     T 
Sbjct  409   IKGKIVVCTIETVTENRREKSIFIRQGGGVGMILIDPSAKEVGFQFVLPGTLIGQEEAT-  467

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSY-------------------  950
              + KY+ T KNPVA + P  T+   KP+PAMA F+S+GP+                    
Sbjct  468   MLQKYMATEKNPVARIYPTITVLNTKPAPAMAAFSSMGPNVITPDIIKFNEETIVHKTAP  527

Query  949   PEPNILKPDITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLK  770
             P+ N L+PDIT PGLNILAAWS  +    +    RSV YNIISGTSMSCPH+SAV A++K
Sbjct  528   PDANFLQPDITGPGLNILAAWSPVAI---EATAERSVNYNIISGTSMSCPHISAVAAIIK  584

Query  769   AIHPDWSGAAIKSAIMTTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVY  593
             +    WS AAIKSAIMTTAT  +     I ++  G    PF YG+GHI P+KA +PGL+Y
Sbjct  585   STQTSWSPAAIKSAIMTTATVLDNTEHLIGREPTGTKTTPFDYGSGHINPTKALEPGLIY  644

Query  592   DSTYMDYLLFVCSSIGT-------TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKR  434
             D    D + F+CS+  +       T  P+Y C   +    NLNYPS+ ++ + GS+ V R
Sbjct  645   DFDSSDIINFLCSTGASPAQLKNLTGHPTY-CQNSSIPSYNLNYPSIGVSSMNGSLSVHR  703

Query  433   TVTNVGSANTTYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFG  254
             TVT  G   T Y+  ++ P G  V ++P++L F + GEK   F           G F FG
Sbjct  704   TVTYYGKGQTVYAAYIEHPVGVRVTVTPSKLCFTKNGEKM-SFRVDFTPHKNSNGSFVFG  762

Query  253   WYKWSDGIHMVKSPI  209
                WS+ IH V+SPI
Sbjct  763   ALTWSNDIHNVRSPI  777



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score =   434 bits (1117),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 266/605 (44%), Positives = 363/605 (60%), Gaps = 44/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYEAT GPV+ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  175   FTASLCNRKLIGARFFARGYEATMGPVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  234

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FA+G A G  P  R+A+YK CW           C   D+LAA D A+ D V V+S+S
Sbjct  235   LG-FASGTARGMDPRARVAVYKVCW--------LGGCFSSDILAAIDQAIEDNVNVLSMS  285

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN    PYS++NVAPWI TVGA ++DR
Sbjct  286   LGGGMSDYY--RDGVAIGAFAAMERGIFVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDR  343

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KG+++ +    + LP +YAG+     + T    C   +L 
Sbjct  344   DFPAIAILGNGKNYSGVSLFKGDALPD----KLLPFIYAGNAS---NATNGNLCMTGSLI  396

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ ++ AT +   
Sbjct  397   PEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEK  456

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I +Y+LT+ NP A+++   T+   +PSP +A F+S GP+   PNILKPD+ APG+
Sbjct  457   AG-DIIRRYVLTDPNPTASVLIQGTVVNVQPSPVVAAFSSRGPNSITPNILKPDLIAPGV  515

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P   P D R V +NIISGTSMSCPHVS + ALLK+ HP+WS AAI+SA+
Sbjct  516   NILAAWTGAAGPTGLPSDPRRVGFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSAL  575

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ I D A G+ +  F +GAG++ P+ A +PGLVYD T +DYL F+C   
Sbjct  576   MTTAYRSYKDGKPILDIATGKPSTAFDHGAGYVSPTIATNPGLVYDLTTVDYLGFLCALN  635

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYS  395
                S I +    ++ C P K  S ++LNYPS A+  + GS   K  RTVT+VG A +   
Sbjct  636   YTSSQIRSVSRRNFTCDPSKTHSVADLNYPSFAV-NVDGSGAYKYTRTVTSVGGAGSYKV  694

Query  394   VEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
               +   T   + ++P  L F EV EK+  +         K     FG  +WSDG H+V S
Sbjct  695   KVISESTAVKISVAPAVLNFKEVNEKK-SYTVTFTVDSSKASGSSFGNIEWSDGKHVVGS  753

Query  214   PIVVS  200
             P+ ++
Sbjct  754   PVAIT  758



>ref|XP_002982080.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
 gb|EFJ16748.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
Length=752

 Score =   434 bits (1116),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 272/612 (44%), Positives = 358/612 (58%), Gaps = 44/612 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             F S+ CN+K+IGARY  +GYEA  GP+N + +F+S RD  GHGTHTAST GGR V  A  
Sbjct  150   FESTACNKKLIGARYFFRGYEAMSGPINGSTEFKSPRDSDGHGTHTASTAGGRYVYRADM  209

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FA+G A G AP  R+A+YK CW         + C D D+LAAFD AVADGV VIS+S
Sbjct  210   LG-FASGTAEGMAPKARIAVYKVCW--------TSGCFDSDILAAFDTAVADGVDVISLS  260

Query  1585  LG--LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSI  1415
             +G  ++P    +  D +ALGA  AM R + V  S GN      SVTNVAPWI T+GAS++
Sbjct  261   VGGGVMP----YRMDSIALGAFGAMTRGVFVATSGGNQGPGQLSVTNVAPWIATIGASTM  316

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIK---KQETLPLVYAGDVEI--PGSTTIPG-FCRQDT  1253
             DR F A V LGN    KG S+   K     E +PLVY+ D  +   GS +     C   +
Sbjct  317   DRAFPATVKLGNGESYKGVSLYSGKGFAAGEEIPLVYSADASVGKNGSDSYSASLCLAGS  376

Query  1252  LSPEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILG---SIGSEIQVESFLITATNIF  1091
             L P+ V+GK+V C  G  ++  +   V  AGG  +IL    + G  +  +S L+ AT + 
Sbjct  377   LDPKLVRGKIVLCDRGNNARVEKGGVVLAAGGRGMILSNSPTDGEGLIADSHLLPATAVG  436

Query  1090  NPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAP  911
             N +G+ +I  YI + K+PVA++    T+ G  P+P +A F+S GP+   P ILKPD+ AP
Sbjct  437   NAAGS-SIKNYIKSAKSPVASIKFLGTVLGTSPAPVVASFSSRGPNPETPEILKPDMIAP  495

Query  910   GLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKS  731
             G+NILAAW+ A+ P     D R V++NIISGTSM+CPHVS + ALL+  HPDWS AAIKS
Sbjct  496   GVNILAAWTGAAGPTGLASDTRKVRFNIISGTSMACPHVSGLAALLRGAHPDWSPAAIKS  555

Query  730   AIMTTAT-TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS  554
             A+MTTA+   N K     +A G V+ PF +G+G + P  A DPGLVYD    DY+ F+CS
Sbjct  556   ALMTTASLVDNTKNIMSDEATGNVSTPFDFGSGLVNPETAMDPGLVYDLGREDYIEFLCS  615

Query  553   SIGTTLD------PSYKCPKKASSPSNLNYPSLAIA---QLKGSMVV--KRTVTNVGSAN  407
                ++ D          CPK     S+LNYPS +      +KG M +  KRTVTNVGS  
Sbjct  616   LNYSSKDLRMVTRSKASCPKSVPKTSDLNYPSFSAVFDQSVKGPMKMSFKRTVTNVGSPK  675

Query  406   TTYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkv---gefeFGWYKWSD  236
               Y   V  P G    + P  L F E+ +K S+ +++       V    E  FG   WSD
Sbjct  676   AEYVASVLVPKGIEASVVPKRLLFSELNQKLSYTLTISAPRAAVVPGDIETVFGLLTWSD  735

Query  235   GIHMVKSPIVVS  200
                MV+SPI +S
Sbjct  736   SQRMVRSPIAIS  747



>ref|XP_009394691.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=784

 Score =   435 bits (1119),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 269/596 (45%), Positives = 361/596 (61%), Gaps = 29/596 (5%)
 Frame = -2

Query  1939  SSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALG  1760
             S  CNRK+IGARY  KGYEA  GP+N TF  +S RD  GHGTHT ST GG  V +A+  G
Sbjct  192   SFSCNRKLIGARYFNKGYEALVGPLNATF--KSPRDYDGHGTHTLSTAGGGFVPSANIFG  249

Query  1759  GFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLG  1580
              + NG A GG+P  R+A YK CW      +  + C D D+LAAFD A+ DG+ VISVSLG
Sbjct  250   -YGNGTAKGGSPWARVAAYKVCWP----PVNGSECFDADILAAFDAAIRDGIDVISVSLG  304

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVF  1403
               P D YF QDG+A+G+ HA+K+ I VV SAGN      +V+N++PW+FTVGAS++DR F
Sbjct  305   GDPVD-YF-QDGLAIGSFHAVKKGITVVSSAGNSGPNLATVSNLSPWMFTVGASTMDRQF  362

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVE-IPGSTTIPGFCRQDTLSPEKVK  1232
              + V++ ++  +KGES++   +  +   PL+ + + + +  S      C   +L P KVK
Sbjct  363   PS-VIVFDDKRIKGESLSPKGLPGKRLYPLISSAEAKLVNASARQARLCYLGSLDPAKVK  421

Query  1231  GKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDA  1070
             GK+V CL G  ++  +   V +AGG  ++L +    G+EI  ++ ++ AT+I    G   
Sbjct  422   GKIVVCLRGITARVEKGEAVHQAGGIGMVLANDVDNGNEIVADAHVLPATHITYSDGL-T  480

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  Y+   K+P+  +   KT  GAKP+P MA F+S GP+   P ILKPD+TAPG+++LAA
Sbjct  481   LFSYLGATKSPLGYITRPKTKLGAKPAPFMAAFSSKGPNTITPEILKPDVTAPGVSVLAA  540

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             +S A  P     D R V +N  SGTSMSCPH+S V  LLK +HPDWS AAIKSAIMTTA 
Sbjct  541   YSGAVGPTGLVFDGRRVAFNAESGTSMSCPHISGVAGLLKTLHPDWSPAAIKSAIMTTAR  600

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGTTLDP  530
             T++   E + ++    A P  YG+GH++P+ A DPGLVYD T  DYL F+CS   TT   
Sbjct  601   TRDNMKEPMLNSSFNKATPLGYGSGHVRPNHAMDPGLVYDMTTTDYLDFLCSLGYTTAQL  660

Query  529   S------YKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
             +      Y CP       +LNYPS+ I  L+ S  V R V NVG    TY V V  P G 
Sbjct  661   AMFNGEPYACPSTPLHIRDLNYPSITIPDLQSSTKVARVVKNVGPPG-TYVVRVVEPRGV  719

Query  367   SVKISPTELKFMEVG-EKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             SV +SP  L F +VG EK+    +   E     G + FG   WSDG H V+SP+VV
Sbjct  720   SVTVSPASLTFEKVGEEKRFEVTAGIKEGKTDGGGYVFGGLIWSDGKHYVRSPLVV  775



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score =   434 bits (1117),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 266/605 (44%), Positives = 363/605 (60%), Gaps = 44/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYEAT GPV+ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  175   FTASLCNRKLIGARFFARGYEATMGPVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  234

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG FA+G A G  P  R+A+YK CW           C   D+LAA D A+ D V V+S+S
Sbjct  235   LG-FASGTARGMDPRARVAVYKVCW--------LGGCFSSDILAAIDQAIEDNVNVLSMS  285

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN    PYS++NVAPWI TVGA ++DR
Sbjct  286   LGGGMSDYY--RDGVAIGAFAAMERGIFVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDR  343

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KG+++ +    + LP +YAG+     + T    C   +L 
Sbjct  344   DFPAIAILGNGKNYSGVSLFKGDALPD----KLLPFIYAGNAS---NATNGNLCMTGSLI  396

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ ++ AT +   
Sbjct  397   PEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEK  456

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I +Y+LT+ NP A+++   T+   +PSP +A F+S GP+   PNILKPD+ APG+
Sbjct  457   AG-DIIRRYVLTDPNPTASVLIQGTVVNVQPSPVVAAFSSRGPNSITPNILKPDLIAPGV  515

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P   P D R V +NIISGTSMSCPHVS + ALLK+ HP+WS AAI+SA+
Sbjct  516   NILAAWTGAAGPTGLPSDPRRVGFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSAL  575

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC---  557
             MTTA      G+ I D A G+ +  F +GAG++ P+ A +PGLVYD T +DYL F+C   
Sbjct  576   MTTAYRSYKDGKPILDIATGKPSTAFDHGAGYVSPTIATNPGLVYDLTTVDYLGFLCALN  635

Query  556   ---SSIGTTLDPSYKC-PKKASSPSNLNYPSLAIAQLKGSMVVK--RTVTNVGSANTTYS  395
                S I +    ++ C P K  S ++LNYPS A+  + GS   K  RTVT+VG A +   
Sbjct  636   YTSSQIRSVSRRNFTCDPSKTHSVADLNYPSFAV-NVDGSGAYKYTRTVTSVGGAGSYKV  694

Query  394   VEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
               +   T   + ++P  L F EV EK+  +         K     FG  +WSDG H+V S
Sbjct  695   KVISESTAVKISVAPAVLNFKEVNEKK-SYTVTFTVDSSKASGSSFGNIEWSDGKHVVGS  753

Query  214   PIVVS  200
             P+ ++
Sbjct  754   PVAIT  758



>ref|XP_008218932.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   434 bits (1117),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 275/604 (46%), Positives = 365/604 (60%), Gaps = 43/604 (7%)
 Frame = -2

Query  1936  SHCNRKIIGARYHVKGYEATFGPVNHTFDFR---SSRDISGHGTHTASTVGGRKVANASA  1766
             SHCNRK+IGARY  KGY A    VN +       ++RD  GHG+HT ST  G  V  AS 
Sbjct  185   SHCNRKLIGARYFSKGYLAYASTVNSSAAKTIQPNARDFGGHGSHTLSTAAGNFVPRASV  244

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
              G   NG A GG+P  R+A YK CW      I    C D D++AAFD A++DGV V+SVS
Sbjct  245   FGN-GNGTAKGGSPKARVAAYKVCWP----PINGNECFDADIMAAFDAAISDGVDVLSVS  299

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG   Q   F  DG+A+G+ HA+K+ I+VV SAGN    P +V+NV+PW+ TVGAS+IDR
Sbjct  300   LG--GQAAEFFSDGIAIGSFHAVKKGISVVSSAGNSGPTPGTVSNVSPWLLTVGASTIDR  357

Query  1408  VFSAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEK  1238
              FS+ V LGN   +KG S++   +  +   PL+ A D +    S++    C+  +L  +K
Sbjct  358   EFSSYVALGNKKHLKGASLSSGALPSKMFYPLISAVDGKAANASSSDAQLCKAGSLEKKK  417

Query  1237  VKGKVVFCLTGGLSQTLEVERA--GGAAVILGSIG----------SEIQVESFLITATNI  1094
             V+GK++ C+ G      E  RA  G  AV+ G++G          +EI  +  L+  +++
Sbjct  418   VEGKILVCIRG------ENARADKGQQAVLAGAVGMILVNDKLSGNEIIADPHLLPTSHV  471

Query  1093  FNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITA  914
              N S   A+  YI + K PVA L   KT  GAKP+P MA F+S GP+  E +ILKPDITA
Sbjct  472   -NYSDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPAPFMASFSSRGPNTIEQSILKPDITA  530

Query  913   PGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIK  734
             PG++I+AA++ A  P +Q  D R V +N  SGTSMSCPHVS +V LLK +HP WS AAIK
Sbjct  531   PGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSMSCPHVSGIVGLLKTLHPSWSPAAIK  590

Query  733   SAIMTTATTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS  554
             SAIMTTA  ++   EA++D+    A PF YGAGH+QP++A DPGLVYD T  DYL F+C+
Sbjct  591   SAIMTTARKRDNNKEAMQDSSKARATPFAYGAGHVQPNRAMDPGLVYDLTTDDYLNFLCA  650

Query  553   S-IGTTL-----DPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYS  395
                  TL     +  + CP KA S ++ NYPS+ +  L    V V R V NVGS   TY 
Sbjct  651   RGYNATLLKVFSNEPHTCP-KAYSLADFNYPSVTVPDLHDKPVAVTRRVKNVGSPG-TYV  708

Query  394   VEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             V +K P G SV + P+ L+F  VGE++  F  V    V+   ++ FG   WSDG H V+S
Sbjct  709   VHIKEPAGVSVSVKPSSLQFKTVGEEK-KFKVVLKPKVQGTQDYVFGELNWSDGKHNVRS  767

Query  214   PIVV  203
             PIVV
Sbjct  768   PIVV  771



>ref|XP_008224681.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   434 bits (1116),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 266/592 (45%), Positives = 366/592 (62%), Gaps = 31/592 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  KGY +  G P+  +F+  S+RD  GHG+HT ST  G  VA A+  G  
Sbjct  186   CNRKLIGARYFNKGYASYAGAPLRSSFN--SARDHEGHGSHTLSTAAGNFVAGANVFG-L  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      I  + C D D++AAFD A+ DGV V+SVSLG  
Sbjct  243   GNGTAKGGSPKARVAAYKVCWP----PINGSECFDADIMAAFDAAIHDGVDVLSVSLGGD  298

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P +  +  DG+++GA HA+K  I VV SAGN      +V+NVAPW+ TVGAS++DR F A
Sbjct  299   PSN--YLDDGLSIGAFHAVKHGIVVVCSAGNSGPAAGTVSNVAPWMITVGASTLDREFQA  356

Query  1396  PVLLGNNLLVKGESVTE-IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKV  1223
              V L N L +KG S+++ + +    PL+     +   ++      C   TL P+KVKGK+
Sbjct  357   IVQLRNGLRLKGTSLSKPLPEDRFYPLITGAQAKAANASAQDAMLCIGGTLDPQKVKGKI  416

Query  1222  VFCLTGGLSQTLEVERA---GGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G  ++  + E+A   G   +IL    + G+EI  +  ++ A+ I    G  A++ 
Sbjct  417   LACLRGDTARADKGEQAALAGAVGMILCNDKASGNEIIADPHVLPASQINYTDGI-AVVS  475

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI +  +P   + P      AKP+P MA F+S GP+   P ILKPDITAPG+NI+AA+++
Sbjct  476   YINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEILKPDITAPGVNIIAAYTQ  535

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A+SP  +  D R + +N  SGTSMSCPHVS VV LLK ++PDWS +AI+SAIMTTA T++
Sbjct  536   ATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDWSPSAIRSAIMTTARTRD  595

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT-------  542
                  +K+A    A PF YGAGHI+P++A DPGL+YD T  DYL F+C +IG        
Sbjct  596   NTANPMKNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVNDYLDFLC-AIGYNKTMMQL  654

Query  541   -TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
              +  P+YKCPK AS   + NYPS+A+ +L GS+ V R V NVGS   TY+V +  P G S
Sbjct  655   FSESPNYKCPKSASL-LDFNYPSIAVPELSGSVTVTRRVKNVGSPG-TYAVRIHKPLGVS  712

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             V + P  LKF  +GE++SF V++K + +     + FG   WSDG H V+SPI
Sbjct  713   VTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKGYVFGGLIWSDGKHYVRSPI  764



>ref|XP_002530614.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF31757.1| Cucumisin precursor, putative [Ricinus communis]
Length=771

 Score =   434 bits (1116),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 262/597 (44%), Positives = 360/597 (60%), Gaps = 33/597 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEAT-FGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGG  1757
              CN+K+IGAR   KG +A   GP N T    ++RD  GHG+HT ST GG  V  AS  G 
Sbjct  191   RCNKKLIGARVFYKGAQAAGDGPFNKTS--ITARDNEGHGSHTLSTAGGSFVPGASIFG-  247

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
             + NG A GG+P  R+A YK CW           C   D+LA FD A+ADGV VIS S+G 
Sbjct  248   YGNGTAKGGSPKARVAAYKICW--------TGGCYGADILAGFDAAMADGVDVISASIGG  299

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
              P D  FT D  A G+ +A+KR I V+ S GN    P +++NVAPWIFT+GAS++DR F 
Sbjct  300   PPVD-LFT-DPTAFGSFNAIKRGIHVIASGGNSGPTPETISNVAPWIFTIGASTMDRDFV  357

Query  1399  APVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVE-IPGSTTIPGFCRQDTLSPEKVKG  1229
             + V+LG+N  ++G S+++  +   +  PL+   D +    + +    C + +L   KV G
Sbjct  358   SSVVLGDNKSLRGISLSDKSLPAGKFYPLISGADAKSASANASDAQLCEEGSLDKAKVAG  417

Query  1228  KVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAI  1067
             K++ CL G    L++   V   G   +IL +     +E+  +   + A++I    G  A+
Sbjct  418   KIIVCLRGDSDRLAKGQVVASLGAVGMILANDQLSANELLADPHFLPASHITYTDG-QAV  476

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               YI T KNP A++ P KT  G KP+P MA F+S GP+   P +LKPD+TAPG+NILAA+
Sbjct  477   YNYIKTTKNPTASISPVKTEVGVKPAPVMASFSSRGPNAVFPGLLKPDVTAPGVNILAAY  536

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             S A SP E+  D R V + ++SGTSMSCPHVS +V LLK+IHPDWS AA+KSAIMTTA T
Sbjct  537   SGAISPSEEESDKRRVPFTVMSGTSMSCPHVSGIVGLLKSIHPDWSPAAVKSAIMTTAKT  596

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIG  545
             +   G +I D+ G+ A PF YGAGH++P+ AADPGLVYD T  DY   +C      S + 
Sbjct  597   RANNGRSILDSDGKTATPFAYGAGHVRPNLAADPGLVYDLTITDYANSLCGFGYNESVVK  656

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
             + +  SY CPK  +  ++ NYPS+ +A L  S+VV R   NVG+   TY+  VK P G S
Sbjct  657   SFIGESYTCPKNFNM-ADFNYPSITVANLNASIVVTRKAKNVGTPG-TYTAHVKVPGGIS  714

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             V + P +L F ++GE++ + V++K         + FG   WSDG H V+SP+VV  A
Sbjct  715   VTVEPAQLTFTKLGEEKEYKVNLKASVNGSPKNYVFGQLVWSDGKHKVRSPLVVKHA  771



>ref|XP_003608826.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES91023.1| subtilisin-like serine protease [Medicago truncatula]
Length=775

 Score =   434 bits (1116),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 263/600 (44%), Positives = 359/600 (60%), Gaps = 38/600 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPV-NHTFDFRSSRDISGHGTHTASTVGGRKVANASALGG  1757
             HCNRK+IGARY  KGY A   P+ N    F S+RD  GHG+HT ST GG  VANAS  G 
Sbjct  186   HCNRKLIGARYFYKGYMAVPIPIRNPNETFNSARDSVGHGSHTLSTAGGNFVANASVFG-  244

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSL-G  1580
             + NG A+GG+P  R++ YK CW           C D D+LA F+ A++DGV V+SVSL G
Sbjct  245   YGNGTASGGSPKARVSAYKVCWGS---------CYDADILAGFEAAISDGVDVLSVSLSG  295

Query  1579  LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVF  1403
               P +  F    +++G+ HA+  NI VV S GN      +V N+ PWI TV AS+IDR F
Sbjct  296   DFPVE--FHDSSISIGSFHAVANNIIVVASGGNSGPSSNTVANMEPWILTVAASTIDRDF  353

Query  1402  SAPVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVK  1232
             ++ V+LGN  ++KG S++E  +   +  PL+   +  +   S      C    L P K  
Sbjct  354   TSYVVLGNKKILKGASLSESHLPPHKLFPLISGANANVDNVSAEQALLCLNGALDPHKAH  413

Query  1231  GKVVFCLTG---GLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDA  1070
             GK++ CL G    L + +E  R G   +IL      G E+  ++ ++ A+N+ N +    
Sbjct  414   GKILVCLEGENSKLEKGIEASRVGAIGMILVIERESGGEVIADAHVLPASNV-NVTDGSY  472

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             I  Y    K PVA +   KT  G KP+P+MA F+S GPS  EP+ILKPDITAPG+NI+AA
Sbjct  473   IFNYANKTKFPVAYITGVKTQLGIKPTPSMASFSSRGPSSLEPSILKPDITAPGVNIIAA  532

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             +SE++SP +   D R + +  +SGTSMSCPHV+ +V LLK+IHPDWS AAIKSAIMTTAT
Sbjct  533   YSESTSPSQSASDKRIIPFMTMSGTSMSCPHVAGLVGLLKSIHPDWSPAAIKSAIMTTAT  592

Query  709   TK-NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------S  551
             TK NV+G A++ +  E A PF YGAGHI+P+  ADPGLVYD   +DYL F+C+       
Sbjct  593   TKDNVRGSALESSLAE-ATPFAYGAGHIRPNHVADPGLVYDLNVIDYLNFLCARGYNNKQ  651

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLK--GSMVVKRTVTNVGSANTTYSVEVKAP  377
             +       Y CP K+ +  + NYP++ I   K   S+ V RTVTNVGS  +TY V V+AP
Sbjct  652   LKLFYGRPYTCP-KSFNIIDFNYPAITIPDFKIGHSLNVTRTVTNVGSP-STYRVRVQAP  709

Query  376   TGYSVKISPTELKFMEVGEK-QsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVS  200
               + + + P  LKF + GEK +           K + ++ FG   W+DG H V++PI ++
Sbjct  710   PEFLISVEPRRLKFRQKGEKIEFKVTFTLRPQTKYIEDYVFGRLVWTDGKHSVETPIAIN  769



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   433 bits (1113),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 262/602 (44%), Positives = 351/602 (58%), Gaps = 34/602 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT--FDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F  SHCNRKIIGAR+++KGYEA FG ++ +  F+FRS RD  GHGTHTAST  G  + NA
Sbjct  141   FNRSHCNRKIIGARWYIKGYEAEFGNLSTSDGFEFRSPRDAEGHGTHTASTAAGASIENA  200

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S +G  A G+A GGAP  RLA+YK CW           C   D+LAAFD A+ DGV V+S
Sbjct  201   SFMG-LAAGLARGGAPSARLAVYKVCW-------GTGSCSSADLLAAFDDAIFDGVDVLS  252

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSI  1415
              SLG  P    + +D V++G+ HA+ + I+V+ SAGN    P +V N APWIFTV AS+I
Sbjct  253   ASLGSPPPLPSYVKDVVSIGSFHAVAKGISVICSAGNSGPYPQTVINSAPWIFTVAASTI  312

Query  1414  DRVFSAPVLLGNNLLVKGESV-TEIKKQETLPLVYAGDV-EIPGSTTIPGFCRQDTLSPE  1241
             DR F   + LGNN  V G+++ T +   +  PLVY GD+  I       G C   TL+  
Sbjct  313   DRAFPTAITLGNNQTVVGQALYTGMDTNKFYPLVYGGDIASIDADEDSAGNCDSGTLNDT  372

Query  1240  KVKGKVVFCLTG-----GLSQTLEVERAGGAAVILGSIGS-EIQVESFLITATNIFNPSG  1079
                GK++ C         ++    V +  GA +I     S ++ + S  +    +    G
Sbjct  373   LASGKMILCFQSRTQRLAITAIRTVMKVKGAGLIFAQFPSKDVSLSSGRLPCVQVDFAIG  432

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
             T  +L YI   +NP+    P KT  G + SP +A F+S GP+   P+ILKPDITAPG+NI
Sbjct  433   T-YLLTYIGATRNPLVKFNPTKTQVGQQISPEVAFFSSRGPNSLSPSILKPDITAPGVNI  491

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LA+WS A SP + P+      + I SGTSMSCPH+S +VALLKAIHP WS AAIKSA++T
Sbjct  492   LASWSPARSPSKSPD-----TFKIESGTSMSCPHISGIVALLKAIHPTWSPAAIKSALVT  546

Query  718   TATTKNVKGEAI--KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS---  554
             TA+ ++   ++I  + A  + A PF YG GH+ P+KA  PGL+YD    DY+ F+CS   
Sbjct  547   TASLEDEYAQSIVAEGAPHKQADPFDYGGGHVDPNKAISPGLIYDIESSDYIHFLCSMGY  606

Query  553   ---SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                +I         C K      NLN PS+ I +LK SM V R VTNVG  N+ Y   V+
Sbjct  607   NNTAISLVAGTKITCQKSTKFIVNLNLPSITIHELKQSMTVSRRVTNVGPVNSVYFARVQ  666

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             AP G SVK+ P+ L F     K+  F  +    ++  G F FG   W DG+H+V+ P+VV
Sbjct  667   APAGVSVKVKPSVLSFNST-VKKLEFKVIFCSLLRVQGRFTFGNLFWEDGLHVVRIPLVV  725

Query  202   SS  197
              +
Sbjct  726   RT  727



>ref|XP_009772256.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=799

 Score =   434 bits (1117),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 264/616 (43%), Positives = 359/616 (58%), Gaps = 49/616 (8%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV-NHTFDFRSSRDISGHGTHTASTVGGRKVANAS  1769
             FT ++CN+KIIGARY   GYEA  G + N + D +S+RD  GHGTHTAS   GR V +AS
Sbjct  192   FTKANCNKKIIGARYFTAGYEARIGRIMNSSTDIKSARDSDGHGTHTASIAAGRAVEDAS  251

Query  1768  ALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISV  1589
              LG FA G+A G AP  R+A YK CW+          C D D+LAAFD AV DGV VIS+
Sbjct  252   LLG-FAKGIAVGIAPKARIAAYKVCWK--------RGCMDSDILAAFDKAVDDGVNVISI  302

Query  1588  SLG--LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASS  1418
             S+G   +P    +  D +A+G+  AM++ I V  SAGN    P +VTNVAPWI TVGAS+
Sbjct  303   SIGGGAVP----YNLDPIAIGSFGAMEKGILVSASAGNEGPRPMTVTNVAPWITTVGAST  358

Query  1417  IDRVFSAPVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEI---PGSTTIPGF----C  1265
             IDR F A ++LGN   + G S+   +    + LPLVY G+V +    G+     F    C
Sbjct  359   IDRKFPADLVLGNGKRITGASLYSGDPLPDKQLPLVYGGNVSVGIRNGARHSSSFSAASC  418

Query  1264  RQDTLSPEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITA  1103
               D+L  E+V GK+V C  GG  +  +   V  AGGA VI+ ++   G  +  ++ LI  
Sbjct  419   MPDSLDKERVHGKIVVCDRGGTPRVAKGEVVNEAGGAGVIVANVAPMGEGLIADAHLIPG  478

Query  1102  TNIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPD  923
               +   +G + I  YI +N NP AT+    T  G KP+P +A F+S GP+     +LKPD
Sbjct  479   LGVTESAG-NIIRDYINSNNNPTATMAFYGTQLGVKPAPVVASFSSRGPNAESIFVLKPD  537

Query  922   ITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGA  743
             + APG+NILAAW +  +P E   D R  ++NI SGTSMSCPHVS + ALLK  HPDWS A
Sbjct  538   VIAPGVNILAAWPDGVAPTELSSDTRRTQFNIESGTSMSCPHVSGLAALLKGAHPDWSPA  597

Query  742   AIKSAIMTTATTKNVKGEAIKDAYG-EVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLL  566
              I+SA+MTTA T++ +G+ + D     V+     GAGH+ P KA DPGLVYD T  DYL 
Sbjct  598   MIRSALMTTAYTQDQQGKMLLDEKSYNVSTVLDMGAGHVDPEKAVDPGLVYDITIDDYLN  657

Query  565   FVCSS------IGTTLDPSYKCPKKASSPSNLNYPSLAI------AQLKGSMVVKRTVTN  422
             F+C+S      I       ++C  K   P + NYP++++      A   G + + RTVT+
Sbjct  658   FLCASNYSGRDIRQIARRPWRCMGKHHKPWDFNYPAISVVIDSTEAPGMGIVQLTRTVTH  717

Query  421   VGSANTTYSVEVKAPTGYSVKISPTELKFMEVGEKQs---ffvsvkvesvkkvgefeFGW  251
             +G A +TY+V V  P G +V ++PT++ F E G++QS      +  +         E G 
Sbjct  718   IGEAPSTYTVLVTNPKGATVTVTPTKIDFRERGQRQSYVVRIKAENLAVTTLSSLVEVGM  777

Query  250   YKWSDGIHMVKSPIVV  203
               W+DG H V SP+VV
Sbjct  778   LNWTDGKHQVVSPLVV  793



>ref|XP_004515893.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=767

 Score =   434 bits (1115),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 258/600 (43%), Positives = 369/600 (62%), Gaps = 38/600 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGYEA+ G         S+RD  GHG+HT ST GG  V N   + G+
Sbjct  185   HCNRKLIGARYFSKGYEASQG---KNASINSARDFDGHGSHTLSTAGGNFV-NGVNVFGY  240

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A+GG+P  R+A YK CW           C D D+LA F+ A+ DGV VIS+SLG  
Sbjct  241   GNGTASGGSPKARVAAYKVCWDG---------CYDADILAGFEAAIHDGVDVISMSLGGD  291

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
             PQ+ YF Q+G+++G+ HA+ +NI VVGS GN    P SV+N+ PW+ T  AS+IDR F++
Sbjct  292   PQE-YF-QNGISIGSFHAVSKNIVVVGSGGNSGPTPASVSNLEPWMLTTAASTIDRNFAS  349

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGK  1226
              V LGN  +  G S+  T +   +  PL+ A D ++   S      C++  + P KV GK
Sbjct  350   YVTLGNKKIYMGASLSDTALPPHKMYPLISAADAKLDNVSAEDALLCKEGAIDPHKVNGK  409

Query  1225  VVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL GG   + + ++  RAG   +IL +    G E+  +  L+ A+++ N +  + I 
Sbjct  410   ILVCLRGGSGRVDKGVQASRAGAIGMILANDEASGGEVIADPHLLPASHV-NFTIGNYIF  468

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
              YI + K PVA +   KT  G +P+P MA F+S GP+Y  P++LKPDITAPG+NI+AA+S
Sbjct  469   DYINSTKLPVAYISRVKTKLGVRPTPIMASFSSRGPNYIAPSLLKPDITAPGVNIIAAYS  528

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK  704
             +A+SP E+  D R + +  +SGTSMSCPHV+ +V LLK++HPDWS AAIKSAIMTTATTK
Sbjct  529   KATSPSEEASDKRRIPFTTMSGTSMSCPHVTGLVGLLKSLHPDWSPAAIKSAIMTTATTK  588

Query  703   NVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGT  542
             +     + D+  + A PF YGAGHI+P++AADPGLVYD    DYL F+C      S +  
Sbjct  589   DNIDSQMLDSSLDKATPFAYGAGHIRPNRAADPGLVYDLNITDYLNFLCRRGYTSSQLTL  648

Query  541   TLDPSYKCPKKASSPSNLNYPSLAIAQLK--GSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                  Y CP ++ +  + NYP++ I       S+ V R +TNVGS  + Y V ++AP+ +
Sbjct  649   FYGRPYDCP-ESFNLVDFNYPAITIPTFNVGHSLNVTRILTNVGSP-SKYRVRIQAPSEF  706

Query  367   SVKISPTELKFMEVGEKQsffvsvkve--svkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
              V + P+ L+F++ GEK+ F V+  ++    K + ++ FG   WS+G H V + I +  A
Sbjct  707   LVSVEPSRLRFVKKGEKKEFKVTFTLKPNYSKYITDYVFGKLVWSNGKHRVATRISIRYA  766



>emb|CDY15084.1| BnaC03g44450D [Brassica napus]
Length=775

 Score =   434 bits (1115),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 262/595 (44%), Positives = 358/595 (60%), Gaps = 30/595 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  GP+N +FD  S RDI GHG+HT ST GG  V  A+  G  
Sbjct  191   HCNRKLIGARYFHKGYAAAVGPLNSSFD--SPRDIDGHGSHTLSTAGGAFVPGANVFGQ-  247

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +K   C D DVLAAFD A+ DG  VISVSLG  
Sbjct  248   GNGTAKGGSPRARVAAYKVCWP----PVKGNECYDADVLAAFDAAIHDGADVISVSLGGE  303

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA ++ I VV SAGN     S V+NVAPW  TVGAS++DR F++
Sbjct  304   PAS--FFNDSVAIGSFHAAEKGIVVVCSAGNSGPADSTVSNVAPWQITVGASTMDREFAS  361

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  + +   +  P++ A + +    T      C+  +L P+K +GK
Sbjct  362   SLILGNGKHYKGQSLAPSSLPHAKFYPIIAASEAKAKNVTASDAQLCKIGSLDPQKARGK  421

Query  1225  VVFCL---TGGLSQTLEVERAGGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDAIL  1064
             ++ CL    G + +   V  AGG  ++L    + G+++  +  ++ AT I +   + A+ 
Sbjct  422   ILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVLPATQI-SFKDSLALS  480

Query  1063  KYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWS  884
             +YI   K P+A + P +T+ G K +P MA F+S GPS   P ILKPDITAPG++++AA++
Sbjct  481   RYISQTKKPIAHITPSRTVLGTKQAPVMAAFSSKGPSSVAPEILKPDITAPGVSVIAAYT  540

Query  883   EASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT-  707
              A SP  +  D R + +N +SGTSMSCPHVS +  LLK  +P WS AAI+SAIMTTATT 
Sbjct  541   GAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAAIRSAIMTTATTM  600

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIG  545
              ++ G  +   Y + A PF +GAGH++P+ A +PGLVYDS   DYL F+C      S I 
Sbjct  601   DDIPGPILNSTYMK-ATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLCSLGYNASQIS  659

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPTGY  368
                  ++ C  + +S  NLNYPS+ +  L  S V V RTV NVG   +TY+V V  P G 
Sbjct  660   VFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP-STYTVRVNNPEGV  718

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              V + PT L F +VGE+++F V++     K    + FG   WSD  H V+SPIVV
Sbjct  719   YVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKHRVRSPIVV  773



>ref|XP_006377976.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
 gb|ERP55773.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
Length=775

 Score =   434 bits (1115),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 258/595 (43%), Positives = 368/595 (62%), Gaps = 32/595 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY +  G +N +F  +++RDI GHGTHT ST  G  V  A+  G   
Sbjct  188   CNRKLIGARYFNKGYGSIGGHLNSSF--QTARDIEGHGTHTLSTAAGNFVPGANVFGN-G  244

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
              G A GG+P  R+A YK CW  P   +    C + D+LA FD A++DGV V+SVSLG   
Sbjct  245   KGTAKGGSPRARVAAYKVCW--PAVGVNEGGCYEADILAGFDVAISDGVDVLSVSLGGAI  302

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSIDRVFSAP  1394
              +  ++ D +A+G+ HA K+ I VV SAGN    P SV+NVAPW+ TVGAS++DR F+  
Sbjct  303   DE--YSDDAIAIGSFHAFKKGITVVASAGNSGPGPGSVSNVAPWLITVGASTLDRAFTIY  360

Query  1393  VLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEKVKGKV  1223
             V LGN   +KG S+++  +  ++  PL+     +    S      C+  TL  +KVKGK+
Sbjct  361   VALGNRKHLKGVSLSQKSLPARKFYPLISGARAKASNQSEEDANLCKPGTLDSKKVKGKI  420

Query  1222  VFCLTGGLSQTLEVER------AGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             + CL G       VE+      AG   +IL +    G+ I  ++ ++ A +I +  G  A
Sbjct  421   LVCLRG---VNPRVEKGHVALLAGAVGMILANDEESGNGILADAHVLPAAHIISTDG-QA  476

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  Y+ + K+P A +   +T  G KP+P MA F+S GP+  E +ILKPDITAPG++++AA
Sbjct  477   VFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILKPDITAPGVSVIAA  536

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++ A+ P +   D R + +N  SGTSMSCPHVS +V LLK++HPDWS AAI+SAIMTTAT
Sbjct  537   FTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWSPAAIRSAIMTTAT  596

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SI  548
             T++  G+ I D+    A PF YGAGH+QP++AADPGLVYD T  D+L ++CS       +
Sbjct  597   TRDNNGDPILDSSNTRATPFAYGAGHVQPNRAADPGLVYDLTVNDFLNYLCSRGYTAKDL  656

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                 D  Y CP K+ S ++ NYPS++   L  ++ V R V NVGS    Y + V+ PTG 
Sbjct  657   KLFTDKPYTCP-KSFSLTDFNYPSISAINLNDTITVTRRVKNVGSPGKYY-IHVREPTGV  714

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              V ++PT L+F ++GE+++F V+ K+    K+ ++ FG   WSDG H V+SP+VV
Sbjct  715   LVSVAPTTLEFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKHFVRSPLVV  769



>ref|XP_010689355.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   433 bits (1114),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 272/595 (46%), Positives = 358/595 (60%), Gaps = 30/595 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFD--FRSSRDISGHGTHTASTVGGRKVANASALGG  1757
             CNRK+IGARY  KGY A     N +      S RD  GHGTHT ST GG  V +AS  G 
Sbjct  181   CNRKLIGARYFNKGYLAALSTSNSSHTTTINSPRDYDGHGTHTLSTAGGSFVRDASVFG-  239

Query  1756  FANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
             F  G+A GG+P  R+A YK CW      I    C D DVLAAFD A+ADGV +IS S+G 
Sbjct  240   FGKGIAKGGSPRARVATYKVCWP----PINGDECYDADVLAAFDMAIADGVDIISASIGG  295

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY--SVTNVAPWIFTVGASSIDRVF  1403
              P   YF  D +A+G+ HA K+ I VV SAGN   P   +V NV+PWIFTVGAS++DR F
Sbjct  296   NPSP-YF-NDTLAIGSFHATKKGILVVCSAGN-SGPMDGTVVNVSPWIFTVGASTMDREF  352

Query  1402  SAPVLLGNNLLVKGESVT--EIKKQETLPLVYAGDVE-IPGSTTIPGFCRQDTLSPEKVK  1232
             S  VLLGN   +KGES+    ++  +  PLV A  V+ +  S      C+  T+ P K +
Sbjct  353   SDWVLLGNGKYIKGESLAPKSLQAGKYYPLVSAAQVKALNASVEEAKLCKSRTIDPRKAR  412

Query  1231  GKVVFCLTGG---LSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDA  1070
             GK+V C+ G    + +  +V  AGG  +IL +     +EI  +  ++ A++I N S    
Sbjct  413   GKIVVCIRGDNARVDKGQQVALAGGVGMILANDHDTANEILADPHVLPASHI-NYSNGIL  471

Query  1069  ILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAA  890
             +  YI + K P A++    T  G  P+P MA F+S GP+   P ILKPDITAPG++++AA
Sbjct  472   VSTYINSTKFPKASITRTSTRLGINPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIAA  531

Query  889   WSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTAT  710
             ++EA  P  Q  D R V++N ISGTSMSCPH+S +V LLK ++P WS AAIKSAIMTTA+
Sbjct  532   YTEAQGPTNQVFDKRRVQFNSISGTSMSCPHISGIVGLLKTLYPHWSPAAIKSAIMTTAS  591

Query  709   TKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SI  548
               +   E I +A    A PFHYGAGH+QP++A DPGLVYD T  DYL F+C+      SI
Sbjct  592   VIDNVHEPITNASNIQANPFHYGAGHVQPNRAVDPGLVYDMTTTDYLNFLCALGYNEKSI  651

Query  547   GTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGY  368
                    Y CPK  S   +LNYPS+ + +LK ++ V RTV NVGS    Y   V+ P G 
Sbjct  652   ALFHAGHYLCPKNFSI-LDLNYPSITVPRLKNTITVTRTVKNVGSPG-KYKAHVQNPRGI  709

Query  367   SVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             S+ +SP  L+F  + +++SF ++++V   K    + FG   WSDG H V SPIVV
Sbjct  710   SIFVSPPILEFTTLCQEKSFHLTLEVVKGKISKNYAFGRIIWSDGYHNVSSPIVV  764



>gb|KHN21134.1| Subtilisin-like protease [Glycine soja]
Length=629

 Score =   429 bits (1103),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 244/550 (44%), Positives = 338/550 (61%), Gaps = 35/550 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGP---VNHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG+EA  GP   VN  F FRS+RD  GHGTHTAST+ G  VAN
Sbjct  93    FTLANCNKKIIGARFYSKGFEAEVGPLEGVNKIF-FRSARDGDGHGTHTASTIAGSIVAN  151

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
             AS LG  A G A GGAP  RLAIYKACW   FD     FC D D+L+A D A+ DGV ++
Sbjct  152   ASLLG-IAKGTARGGAPSARLAIYKACW---FD-----FCGDADILSAMDDAIHDGVDIL  202

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P +  + ++ +++GA HA ++ + V  SAGN   P +  NVAPWI TV AS+I
Sbjct  203   SLSLGPDPPEPIYFENAISVGAFHAFQKGVLVSASAGNSVFPRTACNVAPWILTVAASTI  262

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVY-AGDVEIPGSTTIPGFCRQDTLSPEK  1238
             DR FS+ +LLGN+ ++KG S+  I+   +  L+Y +    +  S TI GFC+ +TL P  
Sbjct  263   DREFSSNILLGNSKVLKGSSLNPIRMDHSYGLIYGSAAAAVGVSATIAGFCKNNTLDPTL  322

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             +KGK+V C     S     + + + + GG  +IL    ++     F+I +T I    G D
Sbjct  323   IKGKIVICTIEKFSDDRRAKAIAIRQGGGVGMILIDHNAKDIGFQFVIPSTLI----GQD  378

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             A+ +   YI T+KNP A + P  T+ G KP+P MA F+S+GP+   P+I+K  +  PG+N
Sbjct  379   AVEELQAYIKTDKNPTARIYPTITVVGTKPAPEMAAFSSIGPNIITPDIIKASLLTPGVN  438

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  ++  E   + RS+ YNIISGTSMSCPH++AV A++K+ HP W  AAI S+IM
Sbjct  439   ILAAWSPVAT--EATVEQRSIDYNIISGTSMSCPHITAVAAIIKSHHPHWGPAAIMSSIM  496

Query  721   TTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTAT  +     I +D  G    PF YG+GH+ P  + +PGLVY+    D L F+CS+  
Sbjct  497   TTATVMDNTRRIIGRDPNGTQTTPFDYGSGHVNPVASLNPGLVYEFNSKDVLNFLCSNGA  556

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  ++ SN NYPS+ ++ L GS  V RTVT  G   T Y   V+
Sbjct  557   SPAQLKNLTGALTQCQKPLTASSNFNYPSIGVSNLNGSSSVYRTVTYYGQGPTVYHASVE  616

Query  382   APTGYSVKIS  353
              P+G +VK++
Sbjct  617   NPSGVNVKVT  626



>ref|XP_007213363.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
 gb|EMJ14562.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica]
Length=740

 Score =   432 bits (1112),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 266/593 (45%), Positives = 366/593 (62%), Gaps = 31/593 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  KGY +  G P+  +F+  S+RD  GHG+HT ST  G  VA A+  G  
Sbjct  158   CNRKLIGARYFNKGYASYAGAPLRSSFN--SARDHEGHGSHTLSTAAGNFVAGANVFG-L  214

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      I  + C D D++AAFD A+ DGV V+SVSLG  
Sbjct  215   GNGTAKGGSPKARVAAYKVCWP----PINGSECFDADIMAAFDAAIHDGVDVLSVSLGGD  270

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSA  1397
             P +  +  DG+++GA HA+K  I VV SAGN      +V+NVAPW+ TVGAS++DR F A
Sbjct  271   PSN--YLDDGLSIGAFHAVKNGIVVVCSAGNSGPAAGTVSNVAPWMITVGASTLDREFQA  328

Query  1396  PVLLGNNLLVKGESVTE-IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGKV  1223
              V L N L +KG S+++ + +    PL+     +   ++      C   TL P+KVKGK+
Sbjct  329   IVQLRNGLRLKGTSLSKPLPEDRFYPLITGAQAKAANASAHDAMLCIGGTLDPQKVKGKI  388

Query  1222  VFCLTGGLSQTLEVERA---GGAAVIL---GSIGSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL G  ++  + E+A   G   +IL    + G+EI  +  ++ A+ I    G  A++ 
Sbjct  389   LACLRGDTARIDKGEQAALAGAVGMILCNDKASGNEIIADPHVLPASQINYTDGI-AVVS  447

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI +  +P   + P      AKP+P MA F+S GP+   P ILKPDITAPG+NI+AA+++
Sbjct  448   YINSTIDPQGFITPPTAQLNAKPAPFMASFSSQGPNTITPEILKPDITAPGVNIIAAYTQ  507

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A+SP  +  D R + +N  SGTSMSCPHVS VV LLK ++PDWS +AI+SAIMTTA T++
Sbjct  508   ATSPTNESFDKRRIAFNTESGTSMSCPHVSGVVGLLKTLYPDWSPSAIRSAIMTTARTRD  567

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT-------  542
                  +K+A    A PF YGAGHI+P++A DPGL+YD T  DYL F+C +IG        
Sbjct  568   NTANPMKNASFIEATPFSYGAGHIRPNRAMDPGLIYDLTVNDYLDFLC-AIGYNKTMMQL  626

Query  541   -TLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
              +  P+YKCPK AS   + NYPS+ + +L GS+ V R V NVGS   TY+V    P G S
Sbjct  627   FSESPNYKCPKSASL-LDFNYPSIVVPELSGSVTVTRRVKNVGSPG-TYAVRAHKPLGVS  684

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIV  206
             V + P  LKF  +GE++SF V++K + +    ++ FG   WSDG H V+SPIV
Sbjct  685   VTVEPNILKFKNIGEEKSFKVTLKAKGLGVTKDYVFGGLIWSDGKHYVRSPIV  737



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score =   433 bits (1114),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 263/600 (44%), Positives = 354/600 (59%), Gaps = 34/600 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHT--FDFRSSRDISGHGTHTASTVGGRKVANA  1772
             F  SHCNRKIIGAR++ KGYEA FG ++ +  F++ S RD  GHGTHT+ST  G  + NA
Sbjct  176   FNRSHCNRKIIGARWYSKGYEAEFGNLSTSDEFEYLSPRDAGGHGTHTSSTAAGDSIQNA  235

Query  1771  SALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVIS  1592
             S   G A G+A GGAPL RLA+YK CW V         C   D+LAAFD A+ DGV V+S
Sbjct  236   S-YKGLAAGLARGGAPLARLAVYKVCWAVG--------CSSADLLAAFDDAIYDGVDVLS  286

Query  1591  VSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYRE-PYSVTNVAPWIFTVGASSI  1415
             VSLG  P  + + +D +A+G+ HA+ + I+VV SAGN    P +V N APWIFTV AS+I
Sbjct  287   VSLGSPPPLSSYVEDAMAIGSFHAVAKGISVVCSAGNSGPYPQTVINSAPWIFTVAASTI  346

Query  1414  DRVFSAPVLLGNNLLVKGESV-TEIKKQETLPLVYAGDV-EIPGSTTIPGFCRQDTLSPE  1241
             DR F A + LGNN  V G+++ T + + +  PLVY GD+  I       G C   TL+  
Sbjct  347   DRAFPAVITLGNNQTVVGQALYTGMDRNKYYPLVYGGDIASIDSDKDTAGSCDPGTLNET  406

Query  1240  KVKGKVVFCLTG-----GLSQTLEVERAGGAAVILGSIGS-EIQVESFLITATNIFNPSG  1079
                GKV+ C         +  T  V  A GA +I     S ++ + S       +    G
Sbjct  407   LASGKVILCFQSRSQRSSIPATTTVTSARGAGLIFAQFPSKDVSLSSGSPPCVQVDFAIG  466

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
             T+ +L YI T +NPV    P KT+ G + SP +A F+S GP+   P+ILKPDI APG+NI
Sbjct  467   TN-LLTYIGTTRNPVVKFNPSKTLVGQQISPEVAFFSSRGPNSLSPSILKPDIAAPGVNI  525

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LA+WS A S  +   D     + I SGTSM+CPH+S +VALLK+IHP WS AAIKS+++T
Sbjct  526   LASWSPAQSQNQANPD----IFKIESGTSMACPHISGIVALLKSIHPTWSPAAIKSSLVT  581

Query  718   TATTKNVKGEAI--KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS---  554
             TA+ ++  G++I  + A  + A PF YG GH+ P+KA  PGL+YD    DY+ F+CS   
Sbjct  582   TASLEDEYGQSIVAEGAPHKQANPFDYGGGHVDPNKAIAPGLIYDIESSDYIRFLCSMGY  641

Query  553   ---SIGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                +I         C K  +  +NLN PS+ I +LK S  V RTVTNVG  N+TY+  V 
Sbjct  642   NNTAISLVAGAKITCRKSTNFINNLNLPSITIHELKQSTTVSRTVTNVGPVNSTYNARVI  701

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              P G SV++ P+ L F     K+  F       ++  G F FG   W DG+H+V+ P++V
Sbjct  702   TPAGVSVRVKPSILSFNST-VKKLEFKVTFRSLLRIQGRFSFGNLFWEDGLHVVRIPLIV  760



>emb|CDP06171.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   433 bits (1113),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 263/593 (44%), Positives = 349/593 (59%), Gaps = 39/593 (7%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGAR+  KGY A  G   ++  F S RD  GHG+HT ST GG  V  AS L G  
Sbjct  185   CNRKLIGARFFNKGYFAAVGGTVNSSIFDSPRDTEGHGSHTLSTAGGNFVPGAS-LFGLG  243

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG A GG+P  R+A YK C  + F+      C D D+LA FD A++DGV VISVSLG  P
Sbjct  244   NGTAKGGSPKARVAAYKVCGPMTFEGS----CYDADILAGFDMAISDGVDVISVSLGGRP  299

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
             Q   + +D +A+G+ HA+K  I VV SAGN   +  +V+NVAPW+ TVGAS++DR  +  
Sbjct  300   QP--YEEDSIAIGSFHAVKHGIVVVCSAGNAGPDLATVSNVAPWLITVGASTMDRKLATF  357

Query  1393  VLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLSPEKVKGKVVFC  1214
             + LGNN+ +    V EI      P            ++   FC    L P K KGK+V C
Sbjct  358   LNLGNNISL----VAEIIPYLLFP------------SSCSTFCMAGCLDPIKAKGKIVVC  401

Query  1213  LTGG---LSQTLEVERAGGAAVILG---SIGSEIQVESFLITATNIFNPSGTDAILKYI-  1055
             LTG    + + +    AG   ++L    S G+EI  ++ ++ A  I    G  A+  YI 
Sbjct  402   LTGENGIVEKGINAASAGAVGMVLANDVSDGNEISSDAHVLPAVQIRYTDGA-AVFAYIN  460

Query  1054  LTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEAS  875
              T +NP A + P  T+ G KP+P MAPF+S GP+   P ILKPDITAPG++++AA+SEA 
Sbjct  461   STVRNPTAYISPPSTLLGIKPAPVMAPFSSRGPNTVTPEILKPDITAPGVDVIAAYSEAQ  520

Query  874   SPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNVK  695
              P  +  D R   Y + SGTSMSCPHVS +  LLK +HPDWS AAI+SAIMT+  T++  
Sbjct  521   GPTGESFDKRRTPYFVDSGTSMSCPHVSGIAGLLKTLHPDWSPAAIRSAIMTSGKTRDNA  580

Query  694   GEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTTLD  533
              E I D     A PF YGAGH+ PS+A DPGL+YD T  DYL F+CS      +I     
Sbjct  581   VERITDDGHIKATPFAYGAGHVHPSQAMDPGLIYDLTNQDYLTFLCSLGYNETTILLFTH  640

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKIS  353
              ++ CPK  S   NLNYPS+A+ +L GS+ V RTV NVGS+  TY+  V  P G SV + 
Sbjct  641   ETFTCPKPISL-VNLNYPSIAVPKLNGSITVTRTVKNVGSSPATYTALVVNPPGLSVDVQ  699

Query  352   PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             P  L F  +G+++SF V++         ++ FG   WSDG H V+S I V ++
Sbjct  700   PKTLAFATIGDQKSFNVTITATKAGANRDYVFGMLTWSDGKHYVRSQIAVKTS  752



>ref|XP_006350127.1| PREDICTED: subtilisin-like protease-like, partial [Solanum tuberosum]
Length=760

 Score =   433 bits (1113),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 259/594 (44%), Positives = 362/594 (61%), Gaps = 30/594 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY +KG+ A  G +  T  F + RD  GHG+HT ST GG  V  A+  G + 
Sbjct  172   CNRKLIGARYFIKGFAAEAGALV-TSKFYTPRDTLGHGSHTLSTAGGNFVEGANIFG-YG  229

Query  1750  NGVATGGAPLTRLAIYKACWQ--VPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
             NG A GG+P  R+A YKACW   +P D      C D DVLAAFD A+ DGV V+SVS+G 
Sbjct  230   NGTAKGGSPKARVAAYKACWPPIIPSDS-----CTDADVLAAFDMAIHDGVDVLSVSMGG  284

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNY-REPYSVTNVAPWIFTVGASSIDRVFS  1400
             LP    + QD +A+G+ HA+K  I VV S GN    P ++ N APW+ TVGAS+IDR FS
Sbjct  285   LPVP--YAQDSIAIGSFHAIKHGIVVVTSGGNSGAYPGTIANTAPWLITVGASTIDREFS  342

Query  1399  APVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKG  1229
             + ++LGNN   +G S++   + + ++ P++     ++  +T     FC + TL P+K KG
Sbjct  343   SYIILGNNKRYRGVSLSSKALPEGKSFPIITGASAKVANATAEEANFCIEGTLDPKKAKG  402

Query  1228  KVVFCLTGG---LSQTLEVERAGGAA-VILGS--IGSEIQVESFLITATNIFNPSGTDAI  1067
              ++ C  GG    ++  +    G    VIL S   G+E+  E +L  AT+I    G   +
Sbjct  403   TILVCHRGGSPAFNKCTQATSVGAVGIVILNSAFFGNEMYAEPYLCPATHISYSDGLQ-V  461

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               Y+ + +   A +    T  G KP+P MA F+S+GP+   P ILKPDITAPG++ILAA+
Sbjct  462   SSYVNSTRKATAYITRPTTELGTKPAPVMAAFSSIGPNRVTPEILKPDITAPGVSILAAY  521

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             +    P E   D+R VK+N ++GTSMSCPHV+ VV LLK +HP WS AAIKSAIMT+A T
Sbjct  522   TGVQGPTETDLDNRRVKFNTMTGTSMSCPHVAGVVGLLKTLHPTWSPAAIKSAIMTSART  581

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIG  545
             ++     + ++    A PF YG+GHI P++A DPGLVYD T  DY+ F+C      + I 
Sbjct  582   RDNTINPMTNSTHLKASPFAYGSGHIWPNRAMDPGLVYDLTINDYMNFLCAQGYKETQIS  641

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYS  365
                   +KCP   S  SNLN PS+ + +L GS+VV RT+ NVGS   TY   +++P G +
Sbjct  642   FFTQGHFKCPDPISF-SNLNLPSITVPKLNGSIVVTRTLKNVGSPG-TYKAHIRSPIGIT  699

Query  364   VKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             V + P  L+F ++GE++SF +++KV+  K   ++ FG   WSD  H V+SPIVV
Sbjct  700   VVVEPNTLEFKKIGEEKSFKITLKVKGHKAPKDYVFGHLIWSDNKHYVRSPIVV  753



>ref|XP_007206725.1| hypothetical protein PRUPE_ppa024702mg [Prunus persica]
 gb|EMJ07924.1| hypothetical protein PRUPE_ppa024702mg [Prunus persica]
Length=727

 Score =   432 bits (1110),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 254/597 (43%), Positives = 346/597 (58%), Gaps = 34/597 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFD----FRSSRDISGHGTHTASTVGGRKVA  1778
             FT ++CNRKIIG+R++V+G+E   GP+  +F     FRS+RD  GHG+HT ST+ G  V 
Sbjct  140   FTLANCNRKIIGSRFYVQGFEVENGPL-ESFAPLPFFRSARDSDGHGSHTGSTIAGSVVP  198

Query  1777  NASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQV  1598
             NAS  G  A G A GGAP TRLAIYKACW           C D DVL+A D A+ DGV +
Sbjct  199   NASFFG-MARGTARGGAPSTRLAIYKACW--------FNLCSDADVLSAMDDAIYDGVDI  249

Query  1597  ISVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASS  1418
             +S+SLG  P    + ++ +++GA HA  R I V  SAGN   P +  NVAPWI TV AS+
Sbjct  250   LSLSLGPDPPQPTYFENAISIGAFHAFHRGILVSASAGNSGFPSTACNVAPWILTVAAST  309

Query  1417  IDRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPGSTTI-PGFCRQDTLSPE  1241
             +DR F + V LGN+ ++KG S+  +K + +  L+ A    +P  T     FC+ +TL+  
Sbjct  310   LDREFHSNVYLGNSRILKGSSLNPLKMERSYGLIAASAAALPEVTAKNASFCKNNTLNAS  369

Query  1240  KVKGKVVFC----LTGGLSQTLEVERAGGAA--VILGSIGSEIQVESFLITATNIFNPSG  1079
              +KGK+V C     T   +    V R GG    +++     ++  + F+I  T I     
Sbjct  370   LIKGKIVVCTFETFTDNRTDKSRVVRQGGGVGMILVDPFLKDVGFQ-FVIPGTLIGQEEA  428

Query  1078  TDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNI  899
              + + +Y++T KNPVA + P  T    KP+P MA F+S+GP+   P+I+KPD+T PG+N+
Sbjct  429   QE-LQEYMMTEKNPVAIISPTITFLKTKPAPEMAVFSSMGPNIITPDIIKPDVTGPGVNV  487

Query  898   LAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMT  719
             LAAWS  ++         SV YNIISGTSMSCPHVSAV A+LK+  P WS AAI SAIMT
Sbjct  488   LAAWSPVATAATA---EMSVNYNIISGTSMSCPHVSAVAAILKSYQPSWSPAAIMSAIMT  544

Query  718   TATT-KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSSIGT  542
             TAT   N +    +D  G    PF YG+GHI P+ A DPGLVYD    D + F+CS+  +
Sbjct  545   TATVLDNSRSTIGRDPNGTPTTPFDYGSGHINPAAAIDPGLVYDFDSHDIINFLCSTGAS  604

Query  541   TLDPS------YKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKA  380
              L           C K  +   N NYPS+ ++++ G + V RTVT  G  +T Y   V  
Sbjct  605   PLQLKNLTGSLVYCQKSPTPSYNFNYPSIGVSKMNGRVSVHRTVTYYGKGSTVYVANVDY  664

Query  379   PTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPI  209
             P G +V ++P++LKF + GEK   F           G F FG   WS+GI  V+SPI
Sbjct  665   PAGVNVTVAPSKLKFTKTGEKM-SFRVDFAAFKNSNGSFVFGALTWSNGIQKVRSPI  720



>ref|XP_004515894.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   433 bits (1113),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 261/597 (44%), Positives = 366/597 (61%), Gaps = 31/597 (5%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  G + +   F S+RD+ GHG+HT ST GG  V N   + G+
Sbjct  186   HCNRKLIGARYFYKGYLAALGDIGNV-SFNSARDVEGHGSHTLSTAGGNAV-NGVNVFGY  243

Query  1753  ANGVATGGAPLTRLAIYKACW-QVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGL  1577
              NG A+GG+P  R+A YK CW +V      A  C + D+LA F+ A++DGV VISVSLG 
Sbjct  244   GNGTASGGSPKARVATYKVCWPKVE----GAGGCYEADILAGFEAAISDGVDVISVSLGG  299

Query  1576  LPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFS  1400
              P + YF Q  ++ G+ HA+ + I VV SAGN    P SV+N+ PW+ TVGAS+IDR F+
Sbjct  300   APGE-YF-QSSISTGSFHAIAKGIVVVSSAGNSGPAPSSVSNLEPWVLTVGASTIDRAFT  357

Query  1399  APVLLGNNLLVKGESVTE--IKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKG  1229
               V LG+N ++KG S++E  +  ++  PL+ +   +  G+  +    C+  +L PEKVKG
Sbjct  358   NYVTLGDNKVLKGVSLSESYLPPKKFYPLISSSQAKADGAFLLDALVCKGGSLDPEKVKG  417

Query  1228  KVVFCLTGGLSQT---LEVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAI  1067
             K+V CL G   +T    +V RAGG  +IL S     + +  +  ++ A+++    G   I
Sbjct  418   KIVVCLRGETGRTDKGEQVARAGGVGMILTSAEESDNSVLADPHVLPASHVNFKDGR-YI  476

Query  1066  LKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAW  887
               YI   K+P+A++   +T  G KP+P MA F+S GP+  +P ILKPDI APG++I+AA+
Sbjct  477   FNYINQTKSPIASISRVETELGVKPAPVMASFSSRGPNIVDPTILKPDIIAPGVDIIAAY  536

Query  886   SEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATT  707
             SE  SP + P D R   +  +SGTSMSCPHVS VV LLK++HPDWS AAIKSAIMTTAT 
Sbjct  537   SEVQSPSDLPSDKRKTSFITMSGTSMSCPHVSGVVGLLKSLHPDWSPAAIKSAIMTTATI  596

Query  706   KNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIG  545
                 G+ + D+  E A PF YGAG I+P++AADPGLVYD    DY+ ++C+       + 
Sbjct  597   TGNTGKQLMDSSLESATPFAYGAGQIRPNRAADPGLVYDLNVTDYMNYLCNHGYEGDRLS  656

Query  544   TTLDPSYKCPKKASSPSNLNYPSLAIAQLK--GSMVVKRTVTNVGSANTTYSVEVKAPTG  371
                   Y CP ++ S  + NYP++ I  LK   S+ V RT+TNVG A + Y V ++AP  
Sbjct  657   IFYGKPYTCP-ESFSLVDFNYPTITIPDLKTGSSLNVTRTLTNVG-APSIYRVHIEAPPE  714

Query  370   YSVKISPTELKFMEVGEKQsffvsvkve-svkkvgefeFGWYKWSDGIHMVKSPIVV  203
             + V + P  L F   GEK+ F V++ +    K   ++ FG   W+DG H V+S I +
Sbjct  715   FLVSVEPKILNFKNKGEKKEFRVTLSLRPLNKLTNDYVFGMLDWTDGKHHVRSSIAI  771



>gb|KEH29867.1| subtilisin-like serine endopeptidase family protein [Medicago 
truncatula]
Length=677

 Score =   430 bits (1105),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 256/601 (43%), Positives = 348/601 (58%), Gaps = 39/601 (6%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPV---NHTFDFRSSRDISGHGTHTASTVGGRKVAN  1775
             FT ++CN+KIIGAR++ KG+EA FGP+   N  F FRS+RD  GHGTH AST+ GR VAN
Sbjct  93    FTLANCNKKIIGARFYPKGFEAEFGPLEDFNKIF-FRSARDNDGHGTHIASTIAGRSVAN  151

Query  1774  ASALGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVI  1595
              S L G A G+A GGAP  RLAIYK CW          FC D D+L+A D A+ DGV ++
Sbjct  152   VS-LFGMAKGIARGGAPSARLAIYKTCW--------FGFCSDADILSAVDDAIHDGVDIL  202

Query  1594  SVSLGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYSVTNVAPWIFTVGASSI  1415
             S+SLG  P    + +D +++GA HA +  I V  SAGN   P +  NVAPWI TV AS++
Sbjct  203   SLSLGTEPPQPIYFEDAISVGAFHAFQNGILVSASAGNSVLPRTACNVAPWILTVAASTV  262

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIKKQETLPLVYAGDVEIPG-STTIPGFCRQDTLSPEK  1238
             DR FS+ + LGN+ ++KG S+  IK +    L+Y       G   T   FC+ +TL P  
Sbjct  263   DREFSSNIHLGNSKILKGYSLNPIKMEHFHGLIYGSAAAASGVPATNASFCKNNTLDPTL  322

Query  1237  VKGKVVFCLTGGLS-----QTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTD  1073
             + GK+V C     S     + + V + GG  +IL    ++     F+I +T I    G D
Sbjct  323   INGKIVICTIESFSDNRREKAITVRQGGGVGMILIDHNAKEIGFQFVIPSTLI----GQD  378

Query  1072  AILK---YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLN  902
             ++ K   YI  ++NP+A + P  T+ G KP+P  A F+S+GP+   P+I+K     PG+N
Sbjct  379   SVEKLQAYIKADRNPIAKIYPTTTVVGTKPAPEAAAFSSMGPNVVTPDIIK---ARPGVN  435

Query  901   ILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIM  722
             ILAAWS  ++  E   +HRSV YNIISGTSMSCPH+SAV A++K+ HP W+ AAI SAIM
Sbjct  436   ILAAWSPVAT--EATVEHRSVDYNIISGTSMSCPHISAVAAIIKSYHPTWTPAAIMSAIM  493

Query  721   TTATTKNVKGEAI-KDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCSS--  551
             TTA   +     I +D  G    PF YG+GH+ P  + +PGLVYD +  D L F+CS+  
Sbjct  494   TTAIVLDNTNHLIGRDPNGTQTTPFDYGSGHVNPLASLNPGLVYDFSSQDVLDFLCSNGA  553

Query  550   ----IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVK  383
                 +        +C K  +   N NYPS+ ++ L GS+ + RTVT  G     Y   V+
Sbjct  554   SPSQLKNITGELTQCQKTPTPSYNFNYPSIGVSNLNGSLSIYRTVTFYGQEPAVYVASVE  613

Query  382   APTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
              P G +V ++P  LKF + GEK   F       V   G F FG   W +G   V+SPI V
Sbjct  614   NPFGVNVTVTPVALKFWKTGEK-LTFRVDFNPFVNSNGNFVFGALTWKNGKQRVRSPIGV  672

Query  202   S  200
             +
Sbjct  673   N  673



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   432 bits (1111),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 274/605 (45%), Positives = 370/605 (61%), Gaps = 45/605 (7%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT+S CNRK+IGAR+  +GYE+T GP++ + + RS RD  GHGTHT+ST  G  V  AS 
Sbjct  162   FTASLCNRKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  221

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             LG +A+G A G   L  LA+YK CW           C   D+LAA D A+AD V V+S+S
Sbjct  222   LG-YASGTARG--MLHALAVYKVCWL--------GGCFSSDILAAIDKAIADNVNVLSMS  270

Query  1585  LGLLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDR  1409
             LG    D Y  +DGVA+GA  AM+R I V  SAGN      S++NVAPWI TVGA ++DR
Sbjct  271   LGGGMSDYY--RDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDR  328

Query  1408  VFSAPVLLGNNL------LVKGESVTEIKKQETLPLVYAGDVEIPGSTTIPGFCRQDTLS  1247
              F A  +LGN        L KGE++ +    + LP +YAG+     + T    C   TL 
Sbjct  329   DFPALAILGNGKNFTGVSLFKGEALPD----KLLPFIYAGNAS---NATNGNLCMTGTLI  381

Query  1246  PEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGSI---GSEIQVESFLITATNIFNP  1085
             PEKVKGK+V C  G  ++  +   V+ AGG  +IL +    G E+  ++ L+ AT +   
Sbjct  382   PEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEK  441

Query  1084  SGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGL  905
             +G D I  Y+ T+ NP A++    T+ G KPSP +A F+S GP+   PNILKPD+ APG+
Sbjct  442   AG-DIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGV  500

Query  904   NILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAI  725
             NILAAW+ A+ P     D R V++NIISGTSMSCPHVS + ALLK++HP+WS AAI+SA+
Sbjct  501   NILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSAL  560

Query  724   MTTATTKNVKGEAIKD-AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS--  554
             MTTA      G+ + D A G+ + PF +GAGH+ P+ A +PGL+YD T  DYL F+C+  
Sbjct  561   MTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALN  620

Query  553   ----SIGTTLDPSYKC-PKKASSPSNLNYPSLAI-AQLKGSMVVKRTVTNVGSANTTYSV  392
                  I +    +Y C P K+ S ++LNYPS A+     G+    RTVT+VG A  TYSV
Sbjct  621   YTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVDGAGAYKYTRTVTSVGGAG-TYSV  679

Query  391   EVKAP-TGYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKS  215
             +V +  TG  + + P  L F E  EK+S+ V+  V+S K  G   FG  +WSDG H+V S
Sbjct  680   KVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGS  739

Query  214   PIVVS  200
             P+ +S
Sbjct  740   PVAIS  744



>emb|CAN62337.1| hypothetical protein VITISV_004299 [Vitis vinifera]
Length=590

 Score =   427 bits (1097),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 255/593 (43%), Positives = 359/593 (61%), Gaps = 28/593 (5%)
 Frame = -2

Query  1924  RKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFANG  1745
             RK+IGARY  +GY A  G +N +F   + RD  GHG+HT ST GG  V  AS  G F NG
Sbjct  10    RKLIGARYFHQGYAAAVGSLNSSF--HTPRDTEGHGSHTLSTAGGNFVEGASVFG-FGNG  66

Query  1744  VATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLPQD  1565
              A GG+P  R+A YK CW      +    C D D+LAAFD A+ DGV V+S SLG LP  
Sbjct  67    TAKGGSPKARVAAYKVCWP----PVGGNECFDADILAAFDIAIHDGVDVLSASLGGLPTP  122

Query  1564  NYFTQDGVALGALHAMKRNIAVVGSAGNYREPY-SVTNVAPWIFTVGASSIDRVFSAPVL  1388
               F  D +++G+ HA+K  I VV SAGN      +V+N++PW FTVGAS++DR F +  +
Sbjct  123   --FFNDSLSIGSFHAVKHGIVVVCSAGNSGPADGTVSNISPWQFTVGASTMDRQFPSYXV  180

Query  1387  LGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGKVVF  1217
             LGN   ++G S++   +   +  PL+ A D +   ++      C+  TL   KVKGK++ 
Sbjct  181   LGNKKRLEGGSLSPKALPPNKFFPLISAADAKAANASADDALLCKAGTLDHSKVKGKILV  240

Query  1216  CLTG---GLSQTLEVERAGGAAVILGS---IGSEIQVESFLITATNIFNPSGTDAILKYI  1055
             CL G    + +  +   AG   ++L +    G+E+  +  ++ A++I    G  A+  Y+
Sbjct  241   CLRGENARVDKGQQAALAGAVGMVLANNELTGNEVIADPHVLPASHINFTDGV-AVFTYL  299

Query  1054  LTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEAS  875
              + K+P+A + P  T  G KP+P MA F+S GP+   P ILKPDITAPG++++AA++EA 
Sbjct  300   NSTKSPIAYITPSTTELGTKPAPFMAAFSSKGPNTITPEILKPDITAPGVSVIAAYTEAQ  359

Query  874   SPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKNVK  695
              P  Q  D R V +N +SGTSMSCPHVS +V LLK +HPDWS AAI+SA+MTTA T +  
Sbjct  360   GPTNQDFDKRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPDWSPAAIRSAMMTTARTMDNS  419

Query  694   GEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTTLD  533
              EAI +A    A PF YGAGH++P++A +PGLVYD    DYL F+C      + I    +
Sbjct  420   MEAILNASYFKATPFSYGAGHVRPNRAMNPGLVYDLNVNDYLNFLCALGYNQTLIKMFSE  479

Query  532   PSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKIS  353
               Y CPK  S  +N NYPS+ + +L GS+ V RT+ NVG    TY   ++ PTG SV + 
Sbjct  480   RPYTCPKPISL-TNFNYPSITVPKLHGSITVTRTLKNVGPPG-TYKARIRKPTGISVSVK  537

Query  352   PTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSSA  194
             P  LKF ++GE+++F ++++ E      ++ FG   WSD  H V+SPIVV +A
Sbjct  538   PDSLKFNKIGEEKTFSLTLQAERAGAARDYVFGELIWSDAKHFVRSPIVVKAA  590



>ref|XP_010063229.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70437.1| hypothetical protein EUGRSUZ_F03662 [Eucalyptus grandis]
Length=769

 Score =   432 bits (1112),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 258/592 (44%), Positives = 359/592 (61%), Gaps = 28/592 (5%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGFA  1751
             CNRK+IGARY  KGY A  G +N TF   ++RD  GHG+HT ST GG  V  AS  G + 
Sbjct  187   CNRKLIGARYFNKGYAAYAGLLNSTF--YTARDHDGHGSHTLSTAGGSLVPGASVFG-YG  243

Query  1750  NGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLLP  1571
             NG + GG+P  R+  YK CW  P +D+    C D DVLA FD A++DGV V+SVSLG  P
Sbjct  244   NGTSKGGSPKARVVAYKVCWP-PLEDVG---CFDADVLAGFDAAISDGVDVLSVSLGDEP  299

Query  1570  QDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSAP  1394
              +  F  DG+ +G+ HA +  I VV SAGN   +P +V NVAPW+ TV AS+IDR F+  
Sbjct  300   AE--FFMDGIVIGSFHAARNGIVVVSSAGNSGPQPGTVLNVAPWMITVAASTIDREFTTY  357

Query  1393  VLLGNNLLVKGESVT--EIKKQETLPLVYAGDVEIPGSTTIPGF-CRQDTLSPEKVKGKV  1223
             + LGN   +KG S++  E+   +  PL+   D +    +      C+  TL  +KVKGK+
Sbjct  358   IALGNKQHLKGSSLSANELPSNKFYPLISGADAQAANVSAAEALLCKAGTLDRKKVKGKI  417

Query  1222  VFCLTGGLSQTL---EVERAGGAAVILGSI---GSEIQVESFLITATNIFNPSGTDAILK  1061
             + CL     + +   +   AG   ++L +    G+++  ++ ++ A +I    G   +  
Sbjct  418   LACLLVDNKRIVVGQQAALAGAVGMVLANDEANGNDVVADAHVLPAAHISFVDGK-VLFA  476

Query  1060  YILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSE  881
             YI +   P+A +   KT+    P+P MA F+S GP+  EP ILKPDITAPGLNI+AA++ 
Sbjct  477   YINSTAFPMAYITRVKTMLNTTPAPFMASFSSRGPNIVEPAILKPDITAPGLNIIAAYTL  536

Query  880   ASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTKN  701
             A  P  Q  D R   ++  SGTSMSCPHV+ +V LLK ++P WS AAI+SAIMTTA T++
Sbjct  537   AVGPAGQDFDKRKTPFSAESGTSMSCPHVAGIVGLLKTLYPSWSPAAIQSAIMTTARTRD  596

Query  700   VKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SSIGTT  539
              K E + DA    A PF YGAGHI+P++A +PGLVYD T  DYL F+C      S +   
Sbjct  597   NKLEPMLDASFAKATPFSYGAGHIRPNRAMNPGLVYDLTANDYLDFLCARGYNESQLRLF  656

Query  538   LDPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVK  359
              + +++CPK   + S+LNYPS+ +  L G+MVV R + NVG+   TYS  +KAP G S+ 
Sbjct  657   TNETHRCPKHFKT-SDLNYPSITVPDLNGTMVVTRRMKNVGTPG-TYSAHIKAPAGVSLS  714

Query  358   ISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             + P  LKF + GE++ F V +K +   K  +  FG   WSDG+H V+SP+VV
Sbjct  715   VQPQNLKFEKCGEEKEFKVVLKPKVAGKPVDHVFGKLIWSDGVHYVRSPLVV  766



>ref|XP_002885743.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62002.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   432 bits (1112),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 261/597 (44%), Positives = 354/597 (59%), Gaps = 34/597 (6%)
 Frame = -2

Query  1933  HCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             HCNRK+IGARY  KGY A  GP+N +F+  S RD+ GHG+HT ST  G  V   S  G  
Sbjct  189   HCNRKLIGARYFHKGYAAAVGPLNSSFE--SPRDLDGHGSHTLSTAAGDFVPGVSIFGQ-  245

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
              NG A GG+P  R+A YK CW      +K   C D DV+AAFD A+ DG  VISVSLG  
Sbjct  246   GNGTAKGGSPRARVAAYKVCWP----PVKGNECYDADVMAAFDAAIHDGADVISVSLGGE  301

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYREPYS-VTNVAPWIFTVGASSIDRVFSA  1397
             P    F  D VA+G+ HA K+ I VV SAGN     S V+NVAPW  TVGAS++DR F++
Sbjct  302   PTS--FFNDSVAIGSFHAAKKRIVVVCSAGNSGPADSTVSNVAPWQITVGASTMDREFAS  359

Query  1396  PVLLGNNLLVKGESV--TEIKKQETLPLVYAGDVEIPGSTTIPG-FCRQDTLSPEKVKGK  1226
              ++LGN    KG+S+  T +   E  P++ + + +   ++ +    C+  +L P K KGK
Sbjct  360   NLVLGNGKHYKGQSLSSTALPHAEFYPIMASVNAKAKNASALDAQLCKLGSLDPIKAKGK  419

Query  1225  VVFCLTGGLSQTLEVER------AGGAAVILGSI---GSEIQVESFLITATNIFNPSGTD  1073
             ++ CL G   Q   VE+      AGG  ++L +    G+++  +  ++ AT + +  G  
Sbjct  420   ILVCLRG---QNPRVEKGRVVALAGGVGMVLENTNVTGNDLTADPHVLPATQLTSKDGF-  475

Query  1072  AILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILA  893
             A+ +YI   K P+A + P +T  G KP+P MA F+S GPS   P ILKPDITAPG++++A
Sbjct  476   AVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPQILKPDITAPGVSVIA  535

Query  892   AWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTA  713
             A++ A SP +Q  D R + +N ISGTSMSCPH+S +  LLK  +P WS AAI+SAIMTTA
Sbjct  536   AYTAAVSPTDQQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSPAAIRSAIMTTA  595

Query  712   TTKNVKGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVC------SS  551
             TT +     I++A    A PF +GAGH+QP+ A +PGL+YD    DYL F+C      S 
Sbjct  596   TTMDDIPGPIQNATSMKATPFSFGAGHVQPNLAVNPGLIYDLGIKDYLNFLCSLRYNASQ  655

Query  550   IGTTLDPSYKCPKKASSPSNLNYPSLAIAQLKGSMV-VKRTVTNVGSANTTYSVEVKAPT  374
             I      ++ C    +S  NLNYPS+ +  L  + V V RTV NVG   +TY+V V  P 
Sbjct  656   ISVFSGNNFTCSSHKTSLVNLNYPSITVPNLSSNKVTVSRTVKNVGRP-STYTVRVANPQ  714

Query  373   GYSVKISPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVV  203
             G  V + PT L F +VGE+++F V +          + FG   WSD  H V+SPIVV
Sbjct  715   GVYVTVKPTSLNFTKVGEQKTFKVILVKSKGNVAKGYVFGELVWSDKKHRVRSPIVV  771



>ref|XP_010647022.1| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=758

 Score =   432 bits (1110),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 266/593 (45%), Positives = 360/593 (61%), Gaps = 38/593 (6%)
 Frame = -2

Query  1930  CNRKIIGARYHVKGYEATFG-PVNHTFDFRSSRDISGHGTHTASTVGGRKVANASALGGF  1754
             CNRK+IGARY  KG EA  G P+N ++  ++ RD SGHGTHT ST GGR V  A+ LG  
Sbjct  186   CNRKLIGARYFNKGVEAELGSPLNSSY--QTVRDTSGHGTHTLSTAGGRFVGGANLLGS-  242

Query  1753  ANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVSLGLL  1574
               G A GG+P  R+A YK+CW           C D DVLAA D A+ DGV ++S+S+  +
Sbjct  243   GYGTAKGGSPSARVASYKSCWPD---------CNDVDVLAAIDAAIHDGVDILSLSIAFV  293

Query  1573  PQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSIDRVFSA  1397
              +D +   D +A+G+LHA++  I VV + GN    P SV N+APWI TV AS+IDR F +
Sbjct  294   SRDYFL--DSIAIGSLHAVQNGIVVVCAGGNEGPTPGSVKNMAPWIITVAASTIDRDFPS  351

Query  1396  PVLLGNNLLVKGES--VTEIKKQETLPLVYAGDVEIP-GSTTIPGFCRQDTLSPEKVKGK  1226
              V LGNN   KG S     +  ++  PLVY+ D      S +    C   +L P+KVKGK
Sbjct  352   NVTLGNNQQFKGRSFYTNTLPAEKFYPLVYSVDARAANASASDAQVCSVGSLDPKKVKGK  411

Query  1225  VVFCLTG---GLSQTLEVERAGGAAVILGSIGSEIQVESFLITATNIFNPSGTDAILKYI  1055
             +V+CL G    + ++  V +AGG  +IL    S     SF+I                ++
Sbjct  412   IVYCLVGVNENVEKSWVVAQAGGIGMILSDRLSTDT--SFMIXLV----LRKVFFFFFHV  465

Query  1054  LTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPDITAPGLNILAAWSEAS  875
              T + PVA  I G T  G   +P +  F+S GP+   P ILKPD+TAPG+ I+AA+S+A+
Sbjct  466   STFRYPVA-YISGATEVGTVAAPIIPSFSSQGPNPITPEILKPDLTAPGVQIVAAYSQAT  524

Query  874   SPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGAAIKSAIMTTATTK-NV  698
              P +   D R V ++IISGTSMSCPHV+  + LLK IHPDWS +A++SAIMTTA T+ NV
Sbjct  525   GPTDLQSDDRRVPFSIISGTSMSCPHVAGTIGLLKKIHPDWSPSALRSAIMTTARTRTNV  584

Query  697   KGEAIKDAYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYLLFVCS------SIGTTL  536
             +   + +  GE A PF YGAGH+ PS+A DPGLVYD T  DYL F+CS       + T +
Sbjct  585   RQPLVNETLGE-ANPFSYGAGHLWPSRAMDPGLVYDLTTTDYLNFLCSIGYNATQLSTFV  643

Query  535   DPSYKCPKKASSPSNLNYPSLAIAQLKGSMVVKRTVTNVGSANTTYSVEVKAPTGYSVKI  356
             D  Y+CP K  S  NLNYPS+ +  L G + V RT+ NVG+   TY+V  + P+G SVK+
Sbjct  644   DKGYECPSKPMSLLNLNYPSITVPSLSGKVTVTRTLKNVGTP-ATYTVRTEVPSGISVKV  702

Query  355   SPTELKFMEVGEKQsffvsvkvesvkkvgefeFGWYKWSDGIHMVKSPIVVSS  197
              P  LKF ++ E+++F V ++ +   K GE+ FG   WSDG H V+SPIVV++
Sbjct  703   EPNTLKFEKINEEKTFKVILEAKRDGKGGEYVFGRLIWSDGEHYVRSPIVVNA  755



>gb|EYU46755.1| hypothetical protein MIMGU_mgv1a001548mg [Erythranthe guttata]
Length=798

 Score =   433 bits (1113),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 270/617 (44%), Positives = 367/617 (59%), Gaps = 51/617 (8%)
 Frame = -2

Query  1945  FTSSHCNRKIIGARYHVKGYEATFGPVNHTFDFRSSRDISGHGTHTASTVGGRKVANASA  1766
             FT +HCN+K+IGARY   GYEA  G VN + +F S+RD  GHGTHTAST  GR VANAS 
Sbjct  191   FTKAHCNKKLIGARYFSAGYEARKGVVNSSEEFHSARDSDGHGTHTASTAAGRAVANAS-  249

Query  1765  LGGFANGVATGGAPLTRLAIYKACWQVPFDDIKATFCQDDDVLAAFDHAVADGVQVISVS  1586
             L G+A+GVA G AP  R+A+YK CW+          C D D+LAAFD AV DGV VIS+S
Sbjct  250   LFGYASGVAVGVAPKARIAVYKICWK--------NGCMDSDILAAFDKAVEDGVNVISIS  301

Query  1585  LG--LLPQDNYFTQDGVALGALHAMKRNIAVVGSAGNYR-EPYSVTNVAPWIFTVGASSI  1415
             +G   +P    +  D +A+GA  AM+R I V  SAGN      +VTNVAPW+ TVGAS+I
Sbjct  302   VGGGAVP----YNLDPMAIGAFGAMERGILVSASAGNEGPTKMTVTNVAPWMTTVGASTI  357

Query  1414  DRVFSAPVLLGNNLLVKGESVTEIK---KQETLPLVYAGDVE-------IPGSTTIPGFC  1265
             DR F A ++LG+  ++ G S+   K   ++  LPL+Y G+         I   +     C
Sbjct  358   DRKFVADLVLGDGRVISGASLYSGKPLPEKTYLPLIYGGNASASWGFGGIRAGSFSASTC  417

Query  1264  RQDTLSPEKVKGKVVFCLTGGLSQTLE---VERAGGAAVILGS---IGSEIQVESFLITA  1103
                +L    V+GK+V C  GG ++  +   V +AGGA V++ +   IG  +  +S LI  
Sbjct  418   IAGSLDENSVRGKIVVCDRGGNARVAKGDVVRKAGGAGVVVANVAPIGEGLVADSHLIPG  477

Query  1102  TNIFNPSGTDAILKYILTNKNPVATLIPGKTIFGAKPSPAMAPFTSLGPSYPEPNILKPD  923
               I + S    + +YI +N NP AT++   T  G KP+P +A F++ GPS   P +LKPD
Sbjct  478   LAI-SESAARTLRQYINSNPNPRATMVFRGTQVGIKPAPVVASFSARGPSVESPYVLKPD  536

Query  922   ITAPGLNILAAWSEASSPLEQPEDHRSVKYNIISGTSMSCPHVSAVVALLKAIHPDWSGA  743
             I APG+NILAAW +  +P E   D R  ++N+ SGTSMSCPHVS V ALLK  HPDWS A
Sbjct  537   IIAPGVNILAAWPDGVAPSEIASDTRRTQFNVASGTSMSCPHVSGVAALLKGAHPDWSPA  596

Query  742   AIKSAIMTTATTKNVKGEAIKD--AYGEVAGPFHYGAGHIQPSKAADPGLVYDSTYMDYL  569
              I+SA+MTTA +++ +G+ + D  +Y + +  +  GAGH+ P KA DPGLVYD T  DYL
Sbjct  597   MIRSAMMTTAYSQDSQGKPLLDEKSYNQ-STIWDMGAGHVDPEKAVDPGLVYDLTADDYL  655

Query  568   LFVCSSIGTTLD------PSYKCPKKASSPSNLNYPSLAI------AQLKGSMVVKRTVT  425
              F+C+S  T  +       S  C +K S P +LNYP+++I            +VV RTVT
Sbjct  656   NFLCASNFTRQEIRHIARRSISCSRKQSKPWDLNYPAISIDFEASETMSANEIVVSRTVT  715

Query  424   NVGSANTTYSVEVKAPTGYSVKISPTELKFMEVGEKQsffvsvkvesvkkv---gefeFG  254
              VG +  ++S  V  P G ++ ++P +L F   GEK+S+ V +K E +K        E G
Sbjct  716   YVGESAGSFSATVNNPKGVTLTVNPMKLDFTAKGEKKSYSVGIKAEKLKVTPGNTVTEVG  775

Query  253   WYKWSDGIHMVKSPIVV  203
                WSDG   V SP+VV
Sbjct  776   RIVWSDGRRKVVSPVVV  792



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5763899892528