BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25073_g10_i6 len=1716 path=[3747:0-484 16704:485-607 4232:608-885
4510:886-992 4617:993-1091 4716:1092-1190 4815:1191-1209
4834:1210-1268 40421:1269-1361 4986:1362-1715]

Length=1716
                                                                      Score     E

gb|KDP31815.1|  hypothetical protein JCGZ_12276                         532   0.0      
ref|XP_009764841.1|  PREDICTED: lysosomal amino acid transporter ...    531   0.0      
ref|XP_009621506.1|  PREDICTED: uncharacterized protein LOC104113...    531   0.0      
ref|XP_011099275.1|  PREDICTED: probable vacuolar amino acid tran...    521   4e-178   
ref|XP_002533273.1|  conserved hypothetical protein                     509   1e-173   Ricinus communis
ref|XP_004233648.1|  PREDICTED: probable vacuolar amino acid tran...    506   1e-172   
ref|XP_002274448.2|  PREDICTED: probable vacuolar amino acid tran...    504   6e-172   Vitis vinifera
ref|XP_006338274.1|  PREDICTED: seven transmembrane protein 1-like      504   1e-171   
ref|XP_010649200.1|  PREDICTED: probable vacuolar amino acid tran...    502   8e-171   
ref|XP_007047037.1|  PQ-loop repeat family protein / transmembran...    494   6e-168   
ref|XP_011025699.1|  PREDICTED: lysosomal amino acid transporter ...    489   1e-165   
ref|XP_009374215.1|  PREDICTED: probable vacuolar amino acid tran...    488   2e-165   
ref|XP_006380747.1|  PQ-loop repeat family protein                      486   1e-164   
ref|XP_010437297.1|  PREDICTED: probable vacuolar amino acid tran...    485   4e-164   
ref|XP_010432125.1|  PREDICTED: probable vacuolar amino acid tran...    484   8e-164   
ref|XP_008241616.1|  PREDICTED: probable vacuolar amino acid tran...    484   1e-163   
ref|XP_010446736.1|  PREDICTED: probable vacuolar amino acid tran...    483   2e-163   
ref|NP_568009.5|  PQ-loop repeat family protein / transmembrane f...    483   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204395.1|  hypothetical protein PRUPE_ppa007096mg             481   2e-162   
emb|CDP02413.1|  unnamed protein product                                480   2e-162   
ref|XP_010548371.1|  PREDICTED: probable vacuolar amino acid tran...    479   2e-161   
ref|XP_009379174.1|  PREDICTED: probable vacuolar amino acid tran...    477   4e-161   
ref|XP_008338172.1|  PREDICTED: lysosomal amino acid transporter ...    477   5e-161   
ref|XP_007047042.1|  PQ-loop repeat family protein / transmembran...    475   2e-160   
ref|XP_009141493.1|  PREDICTED: probable vacuolar amino acid tran...    474   6e-160   
emb|CDX75602.1|  BnaA01g01000D                                          474   9e-160   
ref|XP_004300590.1|  PREDICTED: uncharacterized protein LOC101293205    473   1e-159   
ref|XP_010029841.1|  PREDICTED: probable vacuolar amino acid tran...    473   2e-159   
ref|XP_003611897.1|  Membrane protein, putative                         472   4e-159   
ref|XP_006411956.1|  hypothetical protein EUTSA_v10025420mg             472   4e-159   
ref|XP_011025700.1|  PREDICTED: probable vacuolar amino acid tran...    471   6e-159   
gb|ACJ84546.1|  unknown                                                 470   2e-158   Medicago truncatula
gb|KFK30302.1|  hypothetical protein AALP_AA7G244100                    471   2e-158   
ref|XP_010029840.1|  PREDICTED: probable vacuolar amino acid tran...    469   8e-158   
ref|XP_006380745.1|  hypothetical protein POPTR_0007s12260g             468   9e-158   
ref|XP_007047040.1|  PQ-loop repeat family protein / transmembran...    468   1e-157   
ref|XP_006283881.1|  hypothetical protein CARUB_v10004998mg             468   3e-157   
ref|XP_003611896.1|  Membrane protein, putative                         467   4e-157   
ref|XP_003517255.1|  PREDICTED: lysosomal amino acid transporter ...    465   2e-156   
ref|XP_010437298.1|  PREDICTED: probable vacuolar amino acid tran...    464   5e-156   
ref|XP_008338915.1|  PREDICTED: lysosomal amino acid transporter ...    464   6e-156   
gb|KHN36154.1|  Protein RTC2                                            464   8e-156   
ref|XP_008457880.1|  PREDICTED: probable vacuolar amino acid tran...    462   3e-155   
ref|XP_006425752.1|  hypothetical protein CICLE_v10025820mg             460   2e-154   
ref|XP_009764843.1|  PREDICTED: lysosomal amino acid transporter ...    457   3e-154   
ref|XP_009621507.1|  PREDICTED: probable vacuolar amino acid tran...    454   4e-153   
ref|XP_010029842.1|  PREDICTED: probable vacuolar amino acid tran...    455   9e-153   
ref|XP_002866989.1|  hypothetical protein ARALYDRAFT_490949             452   2e-151   
dbj|BAH56966.1|  AT4G36850                                              451   7e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156890.1|  hypothetical protein PHAVU_002G025900g             449   3e-150   
ref|XP_009379175.1|  PREDICTED: probable vacuolar amino acid tran...    445   6e-149   
emb|CAB16817.1|  putative protein                                       442   1e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148435.1|  PREDICTED: uncharacterized membrane protein ...    435   8e-145   
ref|XP_004164469.1|  PREDICTED: uncharacterized membrane protein ...    435   1e-144   
ref|XP_006590674.1|  PREDICTED: probable vacuolar amino acid tran...    432   2e-143   
ref|XP_003547999.1|  PREDICTED: uncharacterized protein LOC100787660    428   5e-142   
gb|EYU44309.1|  hypothetical protein MIMGU_mgv1a009599mg                426   1e-141   
ref|XP_004512003.1|  PREDICTED: seven transmembrane protein 1-like      427   1e-141   
ref|XP_007047041.1|  PQ-loop repeat family protein / transmembran...    424   3e-141   
ref|XP_007156011.1|  hypothetical protein PHAVU_003G251100g             423   5e-140   
ref|XP_010099350.1|  hypothetical protein L484_009167                   422   2e-139   
ref|XP_010680925.1|  PREDICTED: uncharacterized protein LOC104895967    417   3e-137   
gb|KCW56810.1|  hypothetical protein EUGRSUZ_I02478                     412   5e-136   
gb|AET03980.2|  PQ-loop protein/transmembrane family protein            410   4e-135   
ref|XP_010254969.1|  PREDICTED: probable vacuolar amino acid tran...    409   9e-135   
ref|XP_010254970.1|  PREDICTED: probable vacuolar amino acid tran...    407   8e-134   
ref|XP_007047045.1|  PQ-loop repeat family protein / transmembran...    405   9e-134   
ref|NP_001240922.1|  uncharacterized protein LOC100789634               397   6e-130   
ref|XP_003629504.1|  Membrane protein, putative                         395   4e-129   
gb|KHN00567.1|  Putative membrane protein                               393   1e-128   
gb|EPS64909.1|  hypothetical protein M569_09870                         388   1e-126   
ref|XP_008790228.1|  PREDICTED: probable vacuolar amino acid tran...    386   2e-125   
emb|CDP07574.1|  unnamed protein product                                385   4e-125   
gb|KHN42018.1|  Putative membrane protein                               382   2e-124   
ref|XP_010254971.1|  PREDICTED: probable vacuolar amino acid tran...    380   2e-123   
ref|XP_007047039.1|  PQ-loop repeat family protein / transmembran...    376   6e-123   
ref|XP_011083744.1|  PREDICTED: probable vacuolar amino acid tran...    379   9e-123   
ref|XP_010254972.1|  PREDICTED: probable vacuolar amino acid tran...    377   2e-122   
ref|XP_007047043.1|  PQ-loop repeat family protein / transmembran...    375   2e-122   
ref|XP_007047038.1|  PQ-loop repeat family protein / transmembran...    374   4e-122   
ref|XP_010936127.1|  PREDICTED: probable vacuolar amino acid tran...    377   4e-122   
ref|XP_009396455.1|  PREDICTED: probable vacuolar amino acid tran...    375   4e-121   
ref|XP_010030885.1|  PREDICTED: probable vacuolar amino acid tran...    372   1e-120   
ref|XP_006380746.1|  hypothetical protein POPTR_0007s12260g             370   2e-120   
ref|XP_009396615.1|  PREDICTED: lysosomal amino acid transporter ...    368   2e-118   
gb|KCW56813.1|  hypothetical protein EUGRSUZ_I02478                     365   3e-118   
ref|XP_007047044.1|  PQ-loop repeat family protein / transmembran...    357   2e-115   
ref|XP_007047047.1|  PQ-loop repeat family protein / transmembran...    355   7e-115   
ref|XP_009419331.1|  PREDICTED: probable vacuolar amino acid tran...    357   5e-114   
gb|AES94854.2|  PQ-loop protein/transmembrane family protein            351   4e-113   
gb|KCW56814.1|  hypothetical protein EUGRSUZ_I02478                     351   5e-113   
ref|XP_010432126.1|  PREDICTED: uncharacterized protein LOC104716...    350   2e-112   
ref|XP_006856132.1|  hypothetical protein AMTR_s00059p00157160          335   4e-106   
gb|EPS64486.1|  hypothetical protein M569_10295                         335   5e-106   
ref|XP_006380748.1|  hypothetical protein POPTR_0007s12260g             332   7e-106   
gb|KCW56812.1|  hypothetical protein EUGRSUZ_I02478                     328   4e-104   
gb|KCW56809.1|  hypothetical protein EUGRSUZ_I02478                     319   4e-101   
gb|KDO79457.1|  hypothetical protein CISIN_1g045038mg                   308   1e-96    
ref|XP_006425753.1|  hypothetical protein CICLE_v10025820mg             308   1e-96    
ref|XP_007047046.1|  PQ-loop repeat family protein / transmembran...    306   3e-96    
ref|XP_010254973.1|  PREDICTED: probable vacuolar amino acid tran...    291   2e-89    
ref|XP_001753587.1|  predicted protein                                  278   9e-84    
ref|XP_010023553.1|  PREDICTED: lysosomal amino acid transporter ...    274   5e-82    
ref|XP_011010093.1|  PREDICTED: uncharacterized protein LOC105115030    273   2e-81    
ref|XP_010251611.1|  PREDICTED: probable vacuolar amino acid tran...    272   4e-81    
ref|XP_011041299.1|  PREDICTED: uncharacterized protein LOC105137299    271   8e-81    
ref|XP_002322574.2|  hypothetical protein POPTR_0016s02400g             270   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_010653691.1|  PREDICTED: uncharacterized protein LOC100853498    270   2e-80    
ref|XP_006836191.1|  hypothetical protein AMTR_s00101p00071870          269   4e-80    
ref|XP_010251610.1|  PREDICTED: probable vacuolar amino acid tran...    269   6e-80    
ref|XP_008443167.1|  PREDICTED: uncharacterized protein LOC103486...    269   6e-80    
ref|XP_004967745.1|  PREDICTED: lysosomal amino acid transporter ...    268   1e-79    
ref|XP_010525450.1|  PREDICTED: uncharacterized protein LOC104803245    268   1e-79    
ref|XP_006644034.1|  PREDICTED: uncharacterized protein LOC102703908    268   2e-79    
ref|XP_011040657.1|  PREDICTED: lysosomal amino acid transporter 1      267   3e-79    
ref|XP_004136760.1|  PREDICTED: uncharacterized protein LOC101209754    266   7e-79    
ref|XP_010908655.1|  PREDICTED: uncharacterized protein LOC105034983    265   2e-78    
ref|XP_004163970.1|  PREDICTED: uncharacterized protein LOC101227133    265   2e-78    
ref|XP_009142719.1|  PREDICTED: uncharacterized protein LOC103866528    264   2e-78    
ref|XP_010251612.1|  PREDICTED: probable vacuolar amino acid tran...    261   2e-77    
emb|CDY53677.1|  BnaC04g52270D                                          261   2e-77    
ref|NP_001159199.1|  hypothetical protein                               262   4e-77    Zea mays [maize]
ref|XP_003611898.1|  Membrane protein, putative                         254   5e-77    
ref|XP_009407106.1|  PREDICTED: uncharacterized protein LOC103989888    261   7e-77    
ref|XP_009419694.1|  PREDICTED: uncharacterized protein LOC103999622    260   9e-77    
ref|XP_003566800.1|  PREDICTED: uncharacterized protein LOC100836633    260   1e-76    
ref|XP_006481307.1|  PREDICTED: uncharacterized protein LOC102608...    259   2e-76    
gb|KDO64268.1|  hypothetical protein CISIN_1g015046mg                   259   3e-76    
ref|XP_010505867.1|  PREDICTED: uncharacterized protein LOC104782594    258   3e-76    
ref|XP_007028338.1|  PQ-loop repeat family protein / transmembran...    258   4e-76    
gb|EYU45103.1|  hypothetical protein MIMGU_mgv1a017749mg                254   7e-76    
ref|NP_001042681.1|  Os01g0266800                                       258   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010517585.1|  PREDICTED: uncharacterized protein LOC104793012    256   2e-75    
ref|XP_002457622.1|  hypothetical protein SORBIDRAFT_03g010545          256   6e-75    Sorghum bicolor [broomcorn]
ref|XP_002881756.1|  PQ-loop repeat family protein                      254   6e-75    
gb|AFK47806.1|  unknown                                                 254   1e-74    
ref|NP_850340.1|  PQ-loop repeat family protein / transmembrane f...    254   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007028339.1|  PQ-loop repeat family protein / transmembran...    254   2e-74    
ref|XP_008240655.1|  PREDICTED: uncharacterized protein LOC103339...    253   3e-74    
ref|XP_008240654.1|  PREDICTED: uncharacterized protein LOC103339...    253   6e-74    
ref|XP_006429714.1|  hypothetical protein CICLE_v10011933mg             252   7e-74    
ref|XP_010508772.1|  PREDICTED: uncharacterized protein LOC104785289    251   7e-74    
ref|XP_007028337.1|  PQ-loop repeat family protein / transmembran...    253   9e-74    
ref|XP_008443168.1|  PREDICTED: uncharacterized protein LOC103486...    252   2e-73    
emb|CDM82719.1|  unnamed protein product                                251   4e-73    
ref|XP_011069980.1|  PREDICTED: uncharacterized protein LOC105155744    250   4e-73    
ref|XP_007161921.1|  hypothetical protein PHAVU_001G108900g             249   9e-73    
ref|XP_010678217.1|  PREDICTED: uncharacterized protein LOC104893...    249   1e-72    
ref|XP_009365377.1|  PREDICTED: uncharacterized protein LOC103955225    249   2e-72    
ref|NP_001141539.1|  PQ loop repeat family protein                      248   6e-72    Zea mays [maize]
ref|XP_004489634.1|  PREDICTED: uncharacterized protein LOC101513...    246   1e-71    
ref|XP_003618917.1|  PQ-loop repeat-containing protein                  247   2e-71    
ref|XP_008654590.1|  PREDICTED: PQ loop repeat family protein iso...    250   4e-71    
ref|XP_009788748.1|  PREDICTED: probable vacuolar amino acid tran...    244   7e-71    
gb|ACG49102.1|  PQ loop repeat family protein                           245   9e-71    Zea mays [maize]
ref|XP_008386922.1|  PREDICTED: uncharacterized protein LOC103449379    244   1e-70    
ref|XP_003520461.1|  PREDICTED: probable vacuolar amino acid tran...    241   9e-70    
gb|KGN59379.1|  hypothetical protein Csa_3G815430                       242   4e-69    
gb|AES75135.2|  PQ-loop protein/transmembrane family protein            239   9e-69    
ref|XP_009353181.1|  PREDICTED: probable vacuolar amino acid tran...    238   2e-68    
dbj|BAJ92450.1|  predicted protein                                      236   1e-67    
dbj|BAK03368.1|  predicted protein                                      233   2e-66    
ref|XP_007028336.1|  PQ-loop repeat family protein / transmembran...    241   8e-66    
ref|XP_002984766.1|  hypothetical protein SELMODRAFT_121256             230   1e-65    
ref|XP_002985826.1|  hypothetical protein SELMODRAFT_123042             229   3e-65    
ref|XP_008806620.1|  PREDICTED: uncharacterized protein LOC103719251    229   4e-65    
ref|XP_010023561.1|  PREDICTED: seven transmembrane protein 1-like      228   1e-64    
gb|AFW79602.1|  hypothetical protein ZEAMMB73_686781                    228   1e-64    
gb|AES81064.2|  PQ-loop protein/transmembrane family protein            225   6e-64    
ref|XP_008654591.1|  PREDICTED: PQ loop repeat family protein iso...    229   2e-63    
gb|KHN10879.1|  Putative membrane protein                               223   5e-63    
ref|XP_003624846.1|  Membrane protein, putative                         220   9e-62    
ref|XP_008367312.1|  PREDICTED: uncharacterized protein LOC103430943    217   2e-60    
gb|EYU35636.1|  hypothetical protein MIMGU_mgv1a008531mg                216   2e-60    
gb|KFK36620.1|  hypothetical protein AALP_AA4G147300                    204   1e-56    
ref|XP_010111305.1|  hypothetical protein L484_027959                   205   3e-56    
ref|XP_010436471.1|  PREDICTED: probable vacuolar amino acid tran...    195   2e-53    
gb|KCW89961.1|  hypothetical protein EUGRSUZ_A02167                     196   2e-53    
gb|ABR13292.1|  putative PQ-loop repeat family protein                  184   4e-52    Prunus dulcis [sweet almond]
ref|XP_006411368.1|  hypothetical protein EUTSA_v10017959mg             184   2e-48    
gb|KCW89962.1|  hypothetical protein EUGRSUZ_A02168                     182   3e-48    
ref|XP_006294592.1|  hypothetical protein CARUB_v10023627mg             175   5e-46    
ref|XP_010678218.1|  PREDICTED: uncharacterized protein LOC104893...    173   3e-45    
emb|CBI32879.3|  unnamed protein product                                174   3e-44    
ref|XP_010531580.1|  PREDICTED: probable vacuolar amino acid tran...    161   4e-42    
gb|KHG16759.1|  Protein RTC2                                            162   1e-41    
ref|XP_010251613.1|  PREDICTED: probable vacuolar amino acid tran...    160   5e-40    
gb|AFW79603.1|  hypothetical protein ZEAMMB73_686781                    155   5e-39    
gb|ABD28651.2|  Cystinosin/ERS1p repeat                                 153   5e-38    Medicago truncatula
ref|NP_193743.1|  PQ-loop repeat family protein / transmembrane f...    149   3e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867890.1|  PQ-loop repeat family protein                      147   2e-36    
gb|EEE54293.1|  hypothetical protein OsJ_01221                          146   5e-35    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70372.1|  hypothetical protein OsI_01310                          146   7e-35    Oryza sativa Indica Group [Indian rice]
ref|XP_006282771.1|  hypothetical protein CARUB_v10006199mg             140   9e-34    
gb|EPS69988.1|  hypothetical protein M569_04776                         133   1e-33    
ref|XP_002520588.1|  conserved hypothetical protein                     130   3e-30    Ricinus communis
gb|EMS56021.1|  hypothetical protein TRIUR3_23354                       126   2e-29    
ref|XP_010451342.1|  PREDICTED: probable vacuolar amino acid tran...    127   3e-29    
gb|EYU43563.1|  hypothetical protein MIMGU_mgv11b024317mg               119   8e-29    
ref|XP_010445255.1|  PREDICTED: probable vacuolar amino acid tran...    125   1e-28    
ref|XP_008360556.1|  PREDICTED: probable vacuolar amino acid tran...    124   2e-28    
gb|KDP24049.1|  hypothetical protein JCGZ_26733                         123   4e-28    
gb|EMT15707.1|  hypothetical protein F775_07524                         121   2e-27    
ref|XP_006836190.1|  hypothetical protein AMTR_s00101p00070940          116   1e-25    
ref|XP_447583.1|  hypothetical protein                                  117   2e-25    [Candida] glabrata CBS 138
gb|EPS72867.1|  hypothetical protein M569_01891                         109   8e-25    
ref|XP_003069914.1|  PQ loop repeat family protein                      114   3e-24    
ref|XP_002989012.1|  hypothetical protein SELMODRAFT_447534             114   5e-24    
ref|XP_001242752.1|  hypothetical protein CIMG_06648                    113   7e-24    Coccidioides immitis RS
ref|XP_006380946.1|  hypothetical protein POPTR_0006s02600g             111   9e-24    
ref|XP_002983681.1|  hypothetical protein SELMODRAFT_422985             112   3e-23    
ref|XP_002547975.1|  conserved hypothetical protein                     111   3e-23    Candida tropicalis MYA-3404
ref|XP_007399607.1|  hypothetical protein PHACADRAFT_262162             107   3e-22    
ref|XP_007203296.1|  hypothetical protein PRUPE_ppa025800mg             101   3e-22    
ref|XP_009217994.1|  PQ-loop repeat-containing protein 2                107   8e-22    
ref|XP_452364.1|  hypothetical protein                                  105   1e-21    Kluyveromyces lactis NRRL Y-1140
ref|XP_002501133.1|  predicted protein                                  104   2e-21    Micromonas commoda
ref|XP_005850821.1|  hypothetical protein CHLNCDRAFT_140375             105   3e-21    
gb|EMF11695.1|  PQ-loop-domain-containing protein                       104   6e-21    
ref|XP_003015019.1|  hypothetical protein ARB_06779                     103   1e-20    
ref|XP_003306080.1|  hypothetical protein PTT_19107                     103   2e-20    
gb|EHN00330.1|  YOL092W-like protein                                    102   2e-20    
ref|XP_009497957.1|  hypothetical protein H696_05906                    102   2e-20    
gb|EME43547.1|  hypothetical protein DOTSEDRAFT_54326                   102   3e-20    
ref|XP_002489881.1|  Putative protein of unknown function               102   3e-20    Komagataella phaffii GS115
gb|EUN30194.1|  hypothetical protein COCVIDRAFT_91021                   102   3e-20    
ref|XP_007708737.1|  hypothetical protein COCCADRAFT_23411              102   4e-20    
ref|XP_007686741.1|  hypothetical protein COCMIDRAFT_91999              102   4e-20    
ref|XP_007696973.1|  hypothetical protein COCSADRAFT_136082             102   4e-20    
ref|XP_003190192.1|  PQ loop repeat protein                             102   5e-20    
ref|XP_008028557.1|  hypothetical protein SETTUDRAFT_164429             101   9e-20    
gb|EJT43218.1|  YOL092W-like protein                                  99.4    2e-19    
ref|NP_014549.1|  Ypq1p                                               99.0    2e-19    Saccharomyces cerevisiae S288C
ref|XP_001941306.1|  PQ loop repeat protein                           99.8    2e-19    Pyrenophora tritici-repentis Pt-1C-BFP
gb|EEU06474.1|  YOL092W-like protein                                  99.0    3e-19    Saccharomyces cerevisiae JAY291
emb|CCE27008.1|  uncharacterized protein CPUR_00480                   99.4    3e-19    
gb|EJT43760.1|  RTC2-like protein                                     98.6    3e-19    
gb|EDN63783.1|  conserved protein                                     98.6    3e-19    Saccharomyces cerevisiae YJM789
gb|EZF79000.1|  hypothetical protein H105_00033                       99.0    3e-19    
ref|XP_007585566.1|  putative pq loop repeat protein                  99.0    4e-19    
ref|XP_003681314.1|  hypothetical protein TDEL_0D05190                98.2    4e-19    
dbj|GAA26236.1|  K7_Yol092wp                                          98.2    5e-19    
ref|XP_001801365.1|  hypothetical protein SNOG_11116                  99.0    5e-19    Parastagonospora nodorum SN15
gb|EZF36196.1|  hypothetical protein H101_00285                       98.6    6e-19    
gb|EMG50474.1|  Vacuolar integral membrane-like protein               98.2    6e-19    
dbj|GAA88178.1|  PQ loop repeat protein                               98.6    7e-19    
gb|EZF89649.1|  hypothetical protein H110_00038                       97.8    9e-19    
gb|KEQ59079.1|  PQ-loop-domain-containing protein                     97.4    1e-18    
gb|EPS34600.1|  hypothetical protein PDE_09564                        97.8    1e-18    
ref|XP_712751.1|  hypothetical protein CaO19.6950                     97.1    1e-18    Candida albicans SC5314
gb|EKG19048.1|  hypothetical protein MPH_03738                        96.7    2e-18    
ref|XP_003230889.1|  PQ loop repeat protein                           96.7    3e-18    
ref|XP_004180924.1|  hypothetical protein TBLA_0E03510                96.3    3e-18    
ref|XP_002482048.1|  PQ loop repeat protein                           96.3    3e-18    Talaromyces stipitatus ATCC 10500
ref|XP_002548178.1|  conserved hypothetical protein                   95.9    3e-18    Candida tropicalis MYA-3404
gb|KEF61184.1|  hypothetical protein A1O9_02749                       95.9    3e-18    
ref|XP_003174134.1|  seven transmembrane protein 1                    96.3    4e-18    
ref|XP_003020250.1|  hypothetical protein TRV_05689                   95.9    4e-18    
ref|XP_003850216.1|  hypothetical protein MYCGRDRAFT_46378            96.3    4e-18    
gb|EGE04598.1|  seven transmembrane protein 1                         95.9    4e-18    
ref|XP_002504917.1|  predicted protein                                96.7    5e-18    Micromonas commoda
ref|XP_007733214.1|  hypothetical protein A1O3_04896                  96.3    6e-18    
ref|XP_002147845.1|  PQ loop repeat protein                           94.7    7e-18    Talaromyces marneffei ATCC 18224
ref|XP_002419290.1|  vacuolar integral membrane protein ydr352w h...  94.7    8e-18    Candida dubliniensis CD36
ref|XP_002848823.1|  PQ loop repeat protein                           95.1    8e-18    Microsporum canis CBS 113480
ref|XP_007726589.1|  hypothetical protein A1O1_07532                  94.7    1e-17    
gb|EGD93091.1|  PQ loop repeat protein                                94.4    1e-17    
ref|XP_006604300.1|  PREDICTED: uncharacterized protein LOC102668345  91.3    1e-17    
ref|XP_008022349.1|  hypothetical protein SETTUDRAFT_167349           95.9    2e-17    
gb|EPE03132.1|  pq loop repeat protein                                94.4    2e-17    
gb|KGO56266.1|  hypothetical protein PEX2_078730                      94.7    2e-17    
gb|KGO42224.1|  hypothetical protein PEXP_051750                      94.7    2e-17    
gb|EWG88688.1|  hypothetical protein P301_O10451                      92.8    3e-17    
dbj|GAD91993.1|  PQ loop repeat protein                               92.8    3e-17    
emb|CCK72446.1|  hypothetical protein KNAG_0K00800                    92.4    4e-17    
ref|XP_002308840.2|  hypothetical protein POPTR_0006s02590g           87.8    6e-17    Populus trichocarpa [western balsam poplar]
emb|CDM34116.1|  Cystinosin/ERS1p repeat                              93.2    7e-17    
gb|EWG93374.1|  hypothetical protein R103_O10521                      91.3    8e-17    
ref|XP_007202888.1|  hypothetical protein PRUPE_ppa015933mg           90.1    1e-16    
ref|XP_007786048.1|  hypothetical protein EPUS_04472                  90.5    2e-16    
ref|XP_007761029.1|  hypothetical protein A1O7_08850                  91.7    2e-16    
ref|XP_008717730.1|  hypothetical protein HMPREF1541_05167            90.9    2e-16    
gb|EKV06838.1|  hypothetical protein PDIP_76590                       91.7    2e-16    
ref|XP_009153576.1|  hypothetical protein HMPREF1120_01315            91.3    3e-16    
ref|XP_001748426.1|  hypothetical protein                             89.0    5e-16    
ref|XP_002149320.1|  PQ loop repeat protein                           90.5    6e-16    
ref|XP_003713677.1|  PQ-loop repeat-containing protein 2              89.7    8e-16    
gb|ABD28650.1|  Cystinosin/ERS1p repeat                               83.6    9e-16    
ref|XP_003060694.1|  predicted protein                                88.2    1e-15    
ref|XP_002484843.1|  PQ loop repeat protein                           89.0    2e-15    
emb|CCM03558.1|  predicted protein                                    85.9    2e-15    
ref|XP_008080074.1|  hypothetical protein GLAREA_06470                87.4    2e-15    
ref|XP_007749717.1|  hypothetical protein A1O5_10953                  88.6    3e-15    
ref|XP_001417502.1|  predicted protein                                86.3    3e-15    
ref|XP_004998440.1|  hypothetical protein PTSG_00968                  85.9    5e-15    
ref|XP_007582827.1|  putative pq loop repeat protein                  87.8    5e-15    
ref|XP_003868509.1|  hypothetical protein CORT_0C02290                85.5    8e-15    
ref|XP_009228113.1|  vacuolar membrane PQ loop repeat protein         85.5    1e-14    
ref|XP_007727937.1|  hypothetical protein A1O1_08889                  86.7    1e-14    
ref|XP_003078771.1|  Cystinosin/ERS1p repeat (ISS)                    84.7    1e-14    
ref|XP_008730357.1|  hypothetical protein G647_07823                  84.7    5e-14    
emb|CCE42176.1|  hypothetical protein CPAR2_807250                    82.0    1e-13    
gb|EMF15222.1|  hypothetical protein SEPMUDRAFT_147152                82.4    2e-13    
ref|XP_003868470.1|  hypothetical protein CORT_0C01900                80.9    2e-13    
ref|XP_007678850.1|  hypothetical protein BAUCODRAFT_206168           81.6    2e-13    
gb|KDB17869.1|  PQ loop repeat protein                                82.0    3e-13    
gb|ESX03022.1|  Protein RTC2                                          80.5    3e-13    
ref|XP_007779364.1|  hypothetical protein W97_03277                   81.6    4e-13    
ref|XP_003683962.1|  hypothetical protein TPHA_0A04550                80.1    5e-13    
ref|XP_505016.1|  YALI0F05060p                                        79.0    7e-13    
ref|XP_505436.1|  YALI0F14949p                                        79.0    7e-13    
emb|CAR63593.1|  putative PQ loop repeat family protein               79.3    8e-13    
ref|XP_002619384.1|  hypothetical protein CLUG_00543                  79.7    9e-13    
gb|EDK37649.2|  hypothetical protein PGUG_01747                       79.0    9e-13    
gb|EEH21188.1|  hypothetical protein PABG_03419                       80.1    1e-12    
ref|XP_010757664.1|  hypothetical protein PADG_01989                  80.1    1e-12    
ref|XP_005651295.1|  hypothetical protein COCSUDRAFT_32261            75.1    2e-12    
ref|XP_002671976.1|  PQ-loop domain-containing protein                79.3    2e-12    
ref|XP_001383137.2|  hypothetical protein PICST_41151                 78.2    2e-12    
ref|XP_007806287.1|  hypothetical protein EPUS_08512                  78.2    3e-12    
gb|EWC47474.1|  hypothetical protein DRE_00442                        79.0    3e-12    
gb|EPT05086.1|  hypothetical protein FOMPIDRAFT_1027321               77.0    3e-12    
gb|EJW83354.1|  PQ loop repeat family protein                         77.8    3e-12    
ref|XP_007866926.1|  PQ-loop-domain-containing protein                77.0    3e-12    
ref|XP_011112057.1|  hypothetical protein H072_6260                   79.7    3e-12    
emb|CDK24414.1|  unnamed protein product                              77.4    3e-12    
ref|XP_001486076.1|  hypothetical protein PGUG_01747                  77.0    4e-12    
ref|XP_004194860.1|  Piso0_005381                                     77.4    4e-12    
ref|XP_001835708.2|  hypothetical protein CC1G_07132                  76.3    5e-12    
ref|XP_004195949.1|  Piso0_005381                                     76.3    9e-12    
ref|XP_457460.2|  DEHA2B11660p                                        76.3    1e-11    
gb|EMG46046.1|  hypothetical protein G210_3722                        76.3    1e-11    
dbj|GAA96914.1|  hypothetical protein E5Q_03588                       77.4    1e-11    
emb|CDP96757.1|  Protein Bm6551, isoform b                            75.5    1e-11    
ref|XP_007028333.1|  Uncharacterized protein TCM_024076               74.3    1e-11    
ref|XP_006684069.1|  hypothetical protein CANTEDRAFT_112273           75.1    1e-11    
ref|XP_959139.1|  hypothetical protein NCU09195                       75.9    1e-11    
ref|XP_002419487.1|  uncharacterized membrane protein yol092w, pu...  75.9    2e-11    
ref|XP_009856011.1|  hypothetical protein NEUTE1DRAFT_133038          75.9    2e-11    
gb|EGE04466.1|  vacuolar membrane PQ loop repeat protein              75.1    2e-11    
ref|XP_001900199.1|  PQ loop repeat family protein                    75.5    2e-11    
emb|CDS20383.1|  PQ loop repeat containing protein 2                  75.5    2e-11    
emb|CCA67647.1|  hypothetical protein PIIN_01476                      75.1    2e-11    
ref|XP_008037941.1|  PQ-loop-domain-containing protein                74.7    2e-11    
gb|EGA76914.1|  YOL092W-like protein                                  74.3    2e-11    
ref|XP_004203634.1|  Piso0_000650                                     74.3    2e-11    
gb|EGZ77186.1|  PQ-loop-domain-containing protein                     75.1    2e-11    
gb|EGD96846.1|  vacuolar membrane PQ loop repeat protein              74.7    2e-11    
ref|XP_007319584.1|  hypothetical protein SERLADRAFT_470202           74.3    2e-11    
ref|XP_003231767.1|  vacuolar membrane PQ loop repeat protein         74.7    2e-11    
gb|EZG10258.1|  hypothetical protein H106_00760                       74.7    3e-11    
gb|KHC35340.1|  hypothetical protein MGO_03019                        75.1    3e-11    
gb|KHC37284.1|  hypothetical protein MGQ_03032                        74.7    3e-11    
ref|XP_716611.1|  hypothetical protein CaO19.7370                     74.7    3e-11    
gb|KGQ88201.1|  hypothetical protein MEO_03009                        74.7    3e-11    
dbj|GAC94194.1|  pq loop repeat                                       73.9    3e-11    
ref|XP_001753749.1|  predicted protein                                76.3    3e-11    
ref|XP_001316162.1|  PQ loop repeat family protein                    74.3    3e-11    
gb|EEQ44625.1|  conserved hypothetical protein                        74.7    3e-11    
ref|XP_003663255.1|  hypothetical protein MYCTH_2304941               75.5    3e-11    
ref|XP_762153.1|  hypothetical protein UM06006.1                      75.1    3e-11    
ref|XP_007681987.1|  hypothetical protein BAUCODRAFT_80709            74.3    4e-11    
gb|EGA56933.1|  YOL092W-like protein                                  74.3    4e-11    
emb|CCK72573.1|  hypothetical protein KNAG_0K02090                    73.9    4e-11    
ref|XP_001526212.1|  hypothetical protein LELG_02770                  75.1    4e-11    
ref|XP_007874147.1|  hypothetical protein, variant                    73.2    4e-11    
gb|ERG82280.1|  pq-loop repeat-containing protein 2                   74.3    4e-11    
ref|XP_007366297.1|  PQ-loop-domain-containing protein                73.6    5e-11    
ref|XP_011105386.1|  YOL092W                                          73.9    5e-11    
gb|EMD90857.1|  hypothetical protein COCHEDRAFT_1194598               73.9    6e-11    
gb|EGA73069.1|  YOL092W-like protein                                  74.3    6e-11    
ref|XP_003956264.1|  hypothetical protein KAFR_0C01360                73.9    6e-11    
ref|XP_004203053.1|  Piso0_000650                                     73.2    6e-11    
gb|KDD72627.1|  hypothetical protein H632_c3109p0                     70.9    7e-11    
ref|XP_007846138.1|  hypothetical protein Moror_7979                  75.1    7e-11    
emb|CDI98733.1|  PQ loop repeat containing protein 2                  73.6    7e-11    
ref|XP_449068.1|  hypothetical protein                                73.6    8e-11    
gb|ETN70566.1|  PQ loop repeat protein                                72.8    9e-11    
ref|XP_003655223.1|  hypothetical protein THITE_2118671               73.9    9e-11    
emb|CDI56571.1|  conserved hypothetical protein                       72.4    1e-10    
emb|CDH56015.1|  lysosomal amino acid transporter 1 homolog           73.2    1e-10    
gb|EHK47576.1|  putative PQ-loop G protein-coupled receptor           73.2    1e-10    
emb|CCF49114.1|  uncharacterized protein UHOR_08538                   73.2    1e-10    
ref|XP_001384561.2|  hypothetical protein PICST_45061                 72.4    1e-10    
ref|XP_006814326.1|  PREDICTED: lysosomal amino acid transporter ...  71.2    1e-10    
gb|EUB60995.1|  PQ-loop repeat-containing protein 2                   72.8    1e-10    
ref|NP_493686.2|  Protein LAAT-1                                      72.4    1e-10    
ref|XP_001229749.1|  hypothetical protein CHGG_03233                  73.9    1e-10    
ref|XP_001874892.1|  predicted protein                                73.9    1e-10    
ref|XP_007808841.1|  PQ loop repeat protein                           73.2    1e-10    
ref|XP_001934747.1|  vacuolar membrane PQ loop repeat protein         72.4    2e-10    
ref|XP_007341001.1|  PQ-loop-domain-containing protein                72.0    2e-10    
gb|EMD39517.1|  hypothetical protein CERSUDRAFT_111836                71.6    2e-10    
gb|EST07305.1|  G-protein coupled receptor - Stm1-related             72.8    2e-10    
ref|NP_001006304.1|  lysosomal amino acid transporter 1 homolog       72.0    2e-10    
ref|XP_002842106.1|  hypothetical protein                             72.0    2e-10    
emb|CBQ71276.1|  conserved hypothetical protein                       72.8    2e-10    
ref|XP_007376438.1|  hypothetical protein SPAPADRAFT_56465            72.4    2e-10    
ref|XP_001795739.1|  hypothetical protein SNOG_05332                  72.0    2e-10    
gb|EYE99443.1|  vacuolar membrane PQ loop repeat protein              72.0    2e-10    
gb|EHK17083.1|  putative PQ-loop G-protein coupled receptor protein   72.4    2e-10    
ref|XP_007304936.1|  PQ-loop-domain-containing protein                71.2    2e-10    
gb|KID73282.1|  PQ loop repeat protein                                72.4    2e-10    
gb|KGU30824.1|  hypothetical protein MGK_03044                        72.0    2e-10    
gb|KFG82068.1|  PQ loop repeat protein                                72.4    2e-10    
ref|XP_002850337.1|  vacuolar membrane PQ loop repeat protein         71.6    2e-10    
gb|KIE00912.1|  PQ loop repeat protein                                72.4    2e-10    
ref|XP_002680217.1|  predicted protein                                72.4    3e-10    
ref|XP_011119825.1|  hypothetical protein AOL_s00054g207              72.8    3e-10    
gb|KID89313.1|  PQ loop repeat protein                                72.0    3e-10    
ref|XP_007819618.1|  PQ loop repeat protein                           72.0    3e-10    
gb|KDD71797.1|  hypothetical protein H632_c4382p0                     68.9    3e-10    
emb|CDH59461.1|  hypothetical protein BATDEDRAFT_9677                 72.0    3e-10    
gb|EGT52713.1|  hypothetical protein CAEBREN_23680                    71.2    3e-10    
gb|EPZ33579.1|  hypothetical protein O9G_000354                       68.9    3e-10    
ref|XP_007512789.1|  vacuolar membrane PQ loop repeat protein         72.4    3e-10    
dbj|GAC76346.1|  predicted membrane protein                           72.0    4e-10    
gb|KGU10223.1|  hypothetical protein MEQ_02795                        70.9    4e-10    
gb|KGQ92295.1|  hypothetical protein MEU_02822                        70.9    4e-10    
ref|XP_002617056.1|  hypothetical protein CLUG_02500                  70.5    4e-10    
gb|EMG49373.1|  hypothetical protein G210_5873                        71.2    4e-10    
gb|KHC52204.1|  hypothetical protein MEW_02765                        70.9    4e-10    
gb|KFH64521.1|  hypothetical protein MVEG_09254                       72.4    4e-10    
emb|CDI98099.1|  PQ loop repeat containing protein 2                  71.2    4e-10    
gb|KHC36702.1|  hypothetical protein MGO_02798                        70.9    4e-10    
ref|XP_003139182.1|  PQ loop repeat family protein                    71.2    4e-10    
gb|ETS60429.1|  hypothetical protein PaG_05640                        71.6    4e-10    
gb|EFO24893.2|  PQ loop repeat family protein                         71.2    4e-10    
ref|XP_003097151.1|  hypothetical protein CRE_18101                   70.9    5e-10    
ref|XP_007326234.1|  hypothetical protein AGABI1DRAFT_68381           72.4    5e-10    
gb|EIE85354.1|  hypothetical protein RO3G_10064                       70.1    5e-10    
ref|XP_006458051.1|  hypothetical protein AGABI2DRAFT_190426          72.4    5e-10    
gb|ESA15442.1|  hypothetical protein GLOINDRAFT_164664                71.6    5e-10    
gb|KEQ75051.1|  PQ-loop-domain-containing protein                     71.2    5e-10    
ref|XP_010762941.1|  hypothetical protein PADG_12302                  69.3    5e-10    
ref|XP_001200817.2|  PREDICTED: PQ-loop repeat-containing protein...  71.2    5e-10    
gb|KGU27228.1|  hypothetical protein MG7_02838                        70.5    6e-10    
gb|KGR10029.1|  hypothetical protein MG5_02815                        70.5    6e-10    
gb|EEQ44418.1|  conserved hypothetical protein                        70.5    6e-10    
gb|KGQ87989.1|  hypothetical protein MEO_02792                        70.5    6e-10    
emb|CDS33454.1|  PQ loop repeat containing protein 2                  70.9    6e-10    
gb|EPB88078.1|  hypothetical protein HMPREF1544_05140                 70.9    6e-10    
ref|XP_003727883.1|  PREDICTED: PQ-loop repeat-containing protein...  71.2    6e-10    
gb|KHJ31419.1|  putative vacuolar membrane pq loop repeat protein     70.5    6e-10    
gb|EJT97269.1|  PQ-loop-domain-containing protein                     70.1    6e-10    
ref|XP_007850221.1|  ybr147w-like protein                             69.7    7e-10    
ref|XP_007764704.1|  hypothetical protein CONPUDRAFT_97826            72.4    7e-10    
ref|XP_003645309.1|  hypothetical protein Ecym_2794                   70.5    7e-10    
ref|XP_001525833.1|  conserved hypothetical protein                   70.9    7e-10    
gb|EYC38275.1|  hypothetical protein Y032_0728g1886                   70.1    8e-10    
emb|CCX32705.1|  Similar to Protein RTC2; acc. no. P38279             70.5    8e-10    
dbj|BAO37791.1|  uncharacterized membrane protein YOL092W             70.1    8e-10    
gb|EGU12201.1|  hypothetical protein RTG_01823                        72.0    8e-10    
gb|KDQ62298.1|  hypothetical protein JAAARDRAFT_30194                 69.7    8e-10    
ref|XP_003192851.1|  hypothetical protein CGB_C5240W                  69.3    9e-10    
emb|CDS06256.1|  hypothetical protein LRAMOSA08784                    70.1    9e-10    
emb|CDH55223.1|  ydr352w-like protein                                 70.1    1e-09    
gb|KDQ60972.1|  hypothetical protein JAAARDRAFT_31968                 71.2    1e-09    
ref|XP_457604.1|  DEHA2B15092p                                        69.7    1e-09    
gb|EMD92364.1|  hypothetical protein COCHEDRAFT_1193859               70.5    1e-09    
gb|KDR81691.1|  hypothetical protein GALMADRAFT_58600                 71.6    1e-09    
ref|XP_007285411.1|  pq loop repeat protein                           69.7    1e-09    
ref|NP_001091138.1|  PQ loop repeat containing 2                      69.7    1e-09    
gb|KGB77537.1|  hypothetical protein CNBG_3375                        68.9    1e-09    
emb|CCO28023.1|  Vacuolar integral membrane protein YDR352W           70.9    1e-09    
ref|XP_004345635.1|  PQ-loop repeat-containing protein 2              70.1    1e-09    
ref|XP_001907900.1|  hypothetical protein                             70.5    1e-09    
ref|XP_007374284.1|  hypothetical protein SPAPADRAFT_136546           69.3    1e-09    
ref|XP_569668.1|  hypothetical protein                                68.9    1e-09    
ref|XP_002632169.1|  Hypothetical protein CBG07028                    69.7    1e-09    
gb|EYC38273.1|  hypothetical protein Y032_0728g1886                   67.8    1e-09    
ref|XP_004254886.1|  hypothetical protein EIN_222780                  70.5    1e-09    
ref|XP_006693019.1|  hypothetical protein CTHT_0025590                70.5    1e-09    
gb|EYC38274.1|  hypothetical protein Y032_0728g1886                   68.2    1e-09    
ref|XP_002552651.1|  KLTH0C09944p                                     69.3    2e-09    
gb|EFQ24887.1|  hypothetical protein GLRG_00031                       69.7    2e-09    
gb|EPH53249.1|  hypothetical protein CAOG_08934                       69.7    2e-09    
emb|CCF43097.1|  hypothetical protein CH063_02989                     69.7    2e-09    
gb|EQB57115.1|  hypothetical protein CGLO_02791                       69.7    2e-09    
gb|KDQ33502.1|  hypothetical protein PLEOSDRAFT_1091515               70.5    2e-09    
ref|XP_007778304.1|  hypothetical protein W97_02213                   70.1    2e-09    
gb|KEQ98301.1|  hypothetical protein AUEXF2481DRAFT_26684             69.7    2e-09    
ref|XP_009851072.1|  hypothetical protein NEUTE1DRAFT_82110           70.1    2e-09    
gb|EPB89373.1|  hypothetical protein HMPREF1544_03742                 69.3    2e-09    
ref|XP_957771.1|  hypothetical protein NCU00300                       70.5    2e-09    
gb|KEY64337.1|  hypothetical protein S7711_09603                      69.7    2e-09    
ref|XP_002682050.1|  predicted protein                                69.7    2e-09    
ref|XP_009542653.1|  hypothetical protein HETIRDRAFT_100579           70.5    2e-09    
emb|CEJ04239.1|  hypothetical protein RMCBS344292_18206               68.2    2e-09    
gb|EIE79169.1|  hypothetical protein RO3G_03874                       68.6    2e-09    
ref|XP_006676539.1|  hypothetical protein BATDEDRAFT_9677             68.9    2e-09    
gb|KDN64502.1|  hypothetical protein CSUB01_00459                     69.3    2e-09    
gb|KEQ86392.1|  PQ-loop-domain-containing protein                     69.3    2e-09    
emb|CEG73521.1|  hypothetical protein RMATCC62417_08884               68.6    2e-09    
emb|CEI98914.1|  Putative Vacuolar membrane protein                   68.6    2e-09    
ref|XP_007790066.1|  putative vacuolar membrane pq loop repeat pr...  68.9    2e-09    
ref|XP_007271373.1|  PQ-loop-domain-containing protein                68.6    3e-09    
gb|EIE88404.1|  hypothetical protein RO3G_13115                       67.4    3e-09    
gb|KFA65996.1|  hypothetical protein S40285_07181                     69.3    3e-09    
ref|XP_009653486.1|  hypothetical protein VDAG_05794                  69.7    3e-09    



>gb|KDP31815.1| hypothetical protein JCGZ_12276 [Jatropha curcas]
Length=381

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/428 (64%), Positives = 311/428 (73%), Gaps = 54/428 (13%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVEKYFKDCLCN+ D+FSF  G  SLICWGVAEIPQI+TN
Sbjct  1     MSLA-----YCVKEQKPCVRWVEKYFKDCLCNLKDEFSFGFGFISLICWGVAEIPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSL+FLLTW+AGD+FNLVGCLLEPATLPTQ YTA+                 
Sbjct  56    FRTKSSHGVSLIFLLTWVAGDVFNLVGCLLEPATLPTQFYTAI-----------------  98

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +T+VLVLQ +YYD +YRWWK ++   D NQ V
Sbjct  99    ------------------------LYTTSTIVLVLQGLYYDHIYRWWKCQKI--DDNQQV  132

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             E+ KKPL++NKSG SGIPIP+ ASR A   + EYYYTSARSMAGS TPPFR  L   +SG
Sbjct  133   EDDKKPLKQNKSGDSGIPIPN-ASRTATPRR-EYYYTSARSMAGSGTPPFRGYLRAARSG  190

Query  892   PSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAA  1071
             PSA+G+DN+ SSDDE     S+ S+SQP+PIPRS GYG FL TS+++P Q+KAL   Y  
Sbjct  191   PSAMGLDNESSSDDEA-STVSVKSVSQPRPIPRSVGYGTFLATSVNLPRQSKALTYAYTG  249

Query  1072  LGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALL  1248
             +  R+LL +GSG EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL 
Sbjct  250   ITSRRLLHEGSGMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFALA  309

Query  1249  ANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             AN TYV SI+VRTT WD IK N+PWLLDAAVCV LDLFIILQYIYYRY  +      ED 
Sbjct  310   ANLTYVLSIVVRTTEWDSIKANMPWLLDAAVCVALDLFIILQYIYYRYMHQKRISHGEDY  369

Query  1429  ADYS*MSK  1452
              DY   SK
Sbjct  370   GDYMEASK  377



>ref|XP_009764841.1| PREDICTED: lysosomal amino acid transporter 1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=388

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/427 (63%), Positives = 314/427 (74%), Gaps = 52/427 (12%)
 Frame = +1

Query  166   MEASMSL-AQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIP  342
             M+A MSL  QNS  YCV EKKPC+ WV +YFKDCLCN+SD+FSF  GL SL CW VAEIP
Sbjct  1     MKALMSLRQQNSIAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLSCWAVAEIP  60

Query  343   QIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLS  522
             QI+TNFRTKSSHGVSLLFLL W+ GDIFNL GCLLEPATLPTQLYTA+            
Sbjct  61    QIITNFRTKSSHGVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAV------------  108

Query  523   T*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGD  702
                                          LYT TT++LVLQS+YYD+ YR WK ++D  D
Sbjct  109   -----------------------------LYTTTTIILVLQSLYYDYFYRCWKQRDD--D  137

Query  703   SNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL-  879
             S Q VEE KKPLR  K   SGIPIP G    A + + ++Y+TSARS+AGSATPPFRSNL 
Sbjct  138   SGQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASR-RMDFYFTSARSLAGSATPPFRSNLR  196

Query  880   -VKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
              + SGPSA+G++++ SSD++TV+AP   S+SQPKPIPRSAGYGAFL TS  +PHQTKAL+
Sbjct  197   PIASGPSAVGLNHNYSSDEDTVDAPLNISVSQPKPIPRSAGYGAFLATSSGMPHQTKALI  256

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
                   GGRKLLQ  GTEHS+ GQ LGWMMAA+YMGGR+PQIWLNIKRG+VEGLNPLMF+
Sbjct  257   ---VGFGGRKLLQEHGTEHSALGQVLGWMMAAVYMGGRLPQIWLNIKRGNVEGLNPLMFV  313

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS  1416
             FAL+AN TYVGSIL+R+T W KIK N+PWLLDA VCV LDLFIILQY+YY+Y RK S  S
Sbjct  314   FALIANVTYVGSILLRSTEWSKIKANMPWLLDAVVCVVLDLFIILQYVYYKYFRKQS--S  371

Query  1417  REDSADY  1437
               +  DY
Sbjct  372   TSNGRDY  378



>ref|XP_009621506.1| PREDICTED: uncharacterized protein LOC104113113 isoform X1 [Nicotiana 
tomentosiformis]
Length=388

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/429 (62%), Positives = 314/429 (73%), Gaps = 52/429 (12%)
 Frame = +1

Query  166   MEASMSLAQ-NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIP  342
             M+A MSL Q N   YCV EKKPC+ WV +YFKDCLCN+SD+FSF  GL SL CW VAE+P
Sbjct  1     MKAIMSLRQKNLIAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLFCWAVAEVP  60

Query  343   QIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLS  522
             QI+TNFRTKSSHGVSLLFLL W+ GDIFNL GCLLEPATLPTQLYTA+            
Sbjct  61    QIITNFRTKSSHGVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAV------------  108

Query  523   T*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGD  702
                                          LYT TT++LVLQS+YYD+ YR WK ++D  D
Sbjct  109   -----------------------------LYTTTTIILVLQSLYYDYFYRCWKHRDD--D  137

Query  703   SNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL-  879
             S Q VEE KKPLR  K   SGIPIP G    A + + ++Y+TSARS+AGSATPPFRSNL 
Sbjct  138   SGQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASR-RMDFYFTSARSLAGSATPPFRSNLR  196

Query  880   -VKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
              + SGPSA+G++++ SSD++TV+AP   S+SQPKPIPRSAGYGAFL TS  +PHQTKAL+
Sbjct  197   PIASGPSAVGLNHNYSSDEDTVDAPQNISVSQPKPIPRSAGYGAFLATSSGLPHQTKALI  256

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
                   GGRKLLQ  GTEHS+ GQ LGWMMAA+YMGGR+PQIWLNIKRG+VEGLNPLMF+
Sbjct  257   ---VGFGGRKLLQEHGTEHSAVGQVLGWMMAAVYMGGRLPQIWLNIKRGNVEGLNPLMFV  313

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS  1416
             FAL+AN +YVGSIL+R+T W KIK N+PWLLDA VCV LDLFIILQY+YY+Y RK S  S
Sbjct  314   FALIANVSYVGSILLRSTEWSKIKANMPWLLDAVVCVVLDLFIILQYVYYKYFRKQSSTS  373

Query  1417  --REDSADY  1437
               R+D   Y
Sbjct  374   NDRDDEGAY  382



>ref|XP_011099275.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Sesamum 
indicum]
Length=390

 Score =   521 bits (1342),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 266/419 (63%), Positives = 308/419 (74%), Gaps = 48/419 (11%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
             QNS  YCV E+KPC+ W +KYFKDCLCN+ D+ SF  GL SL+CWGVAEIPQI+TNFRTK
Sbjct  6     QNSLSYCVKEQKPCIGWADKYFKDCLCNVKDELSFGFGLVSLVCWGVAEIPQIITNFRTK  65

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             S HG+SLLFLLTWIAGDIFNLVGCLLEPATLPTQ YTA+                     
Sbjct  66    SGHGISLLFLLTWIAGDIFNLVGCLLEPATLPTQFYTAV---------------------  104

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAK  729
                                 LYT TTVVLVLQS+YYD++ +W   +E   +S+Q VE+ K
Sbjct  105   --------------------LYTTTTVVLVLQSIYYDYVRKWRNGEEK--ESDQEVEDLK  142

Query  730   KPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSAL  903
             KPL+  +   S IPIP+G  R   + +A YYYTSARSMAGS TPP +S L  VKSGPSA+
Sbjct  143   KPLKTPQPIDSAIPIPNGTRRATSRREA-YYYTSARSMAGSTTPPIQSYLWPVKSGPSAV  201

Query  904   GMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
             G+DN+ SSDDE    PS  S+S+PKPIPRSAGYGAFL TS+++P +TKALM  Y  L GR
Sbjct  202   GIDNNSSSDDEDNPTPSRQSVSKPKPIPRSAGYGAFLATSINMPRETKALMQAYVGLTGR  261

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             KLLQ  G+E S +GQWLGWMMAAIYMGGR+PQIWLNI+RG+VEGLNPLMFIFAL ANATY
Sbjct  262   KLLQEHGSE-SVYGQWLGWMMAAIYMGGRLPQIWLNIRRGNVEGLNPLMFIFALAANATY  320

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRED-SADY  1437
             V SILVR+TAWDKIK N+PWLLDA  CV LDLFIILQY+YYRY  K S GSR++  ADY
Sbjct  321   VASILVRSTAWDKIKANMPWLLDAMGCVLLDLFIILQYVYYRYFHKGSRGSRQEYDADY  379



>ref|XP_002533273.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29105.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score =   509 bits (1311),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/423 (61%), Positives = 303/423 (72%), Gaps = 54/423 (13%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVE+YFKDCLC++ D+ SF  G  SL+ WGVAE+PQI+TN
Sbjct  1     MSLA-----YCVKEQKPCVRWVERYFKDCLCSLKDELSFGFGFVSLVSWGVAEVPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                 
Sbjct  56    FRTKSSHGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------  98

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +T+VLVLQ +YYD++YRWWK +++  + NQ V
Sbjct  99    ------------------------LYTTSTIVLVLQGLYYDYIYRWWKGQKN--EVNQQV  132

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             E+ KKPL+  K G SGIPIP+ ++R   +   EYYYTSARSMA S TPPFR  L   KSG
Sbjct  133   EDEKKPLK-PKLGDSGIPIPNASTRSTPRR--EYYYTSARSMASSGTPPFRGYLRTAKSG  189

Query  892   PSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAA  1071
             PSA+G D++ SS D+     S  S+SQP+PIPRSAGYG FL TSL++P Q+KAL   Y  
Sbjct  190   PSAMGFDHESSSSDDEAAPVSAASVSQPRPIPRSAGYGTFLATSLNLPLQSKALTDAYIG  249

Query  1072  LGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALL  1248
             +  R+LL +GSG EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+
Sbjct  250   VTSRRLLHEGSGMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALV  309

Query  1249  ANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             AN TYV SI+VRTT W+ IK N+PWLLDAAVCV LD FIILQY+YYRY R+      ED 
Sbjct  310   ANLTYVLSIVVRTTEWESIKANMPWLLDAAVCVALDFFIILQYVYYRYFREKKMRHGEDY  369

Query  1429  ADY  1437
              DY
Sbjct  370   GDY  372



>ref|XP_004233648.1| PREDICTED: probable vacuolar amino acid transporter YPQ2 [Solanum 
lycopersicum]
Length=389

 Score =   506 bits (1304),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 259/422 (61%), Positives = 299/422 (71%), Gaps = 55/422 (13%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVV-WVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRT  366
             QNS  YCV E KPCVV WV  YFKDCLCN+ D+FSF  G  SLICW VAEIPQIVTNFRT
Sbjct  11    QNSIAYCVKENKPCVVGWVNLYFKDCLCNVRDEFSFGFGFVSLICWAVAEIPQIVTNFRT  70

Query  367   KSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVIC  546
             KSS GVSLLFLL W+ GD+FNL GCLLE ATLPTQLYTA+                    
Sbjct  71    KSSSGVSLLFLLGWVVGDVFNLTGCLLESATLPTQLYTAV--------------------  110

Query  547   ESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEA  726
                                  LYTATT++LVLQ +YYD+ Y+ WK  E+     ++ E  
Sbjct  111   ---------------------LYTATTIILVLQILYYDYFYKCWKRSENETRQLEVEEVL  149

Query  727   KKPLRRNKSGGSGIPIP-DGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPS  897
             KKPLR  K+  SGIPIP   ASRP      ++Y+ SARS+AGS+TPPFRSNL  + S PS
Sbjct  150   KKPLRPQKTTDSGIPIPCRSASRPM-----DFYFMSARSLAGSSTPPFRSNLRPIASEPS  204

Query  898   ALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALG  1077
             A+G++++ SSDD+TV+AP   S+SQPKPIPRSAGYGAFL T+  +PHQTKAL+      G
Sbjct  205   AVGLNHNYSSDDDTVDAPLSISVSQPKPIPRSAGYGAFLATASGMPHQTKALI---VGFG  261

Query  1078  GRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANA  1257
             GRKLLQ  GTEHS+ GQ LGWMMAA+YMGGRIPQIWLNIKRGSVEGLNP MF+FAL+AN 
Sbjct  262   GRKLLQEHGTEHSALGQCLGWMMAAVYMGGRIPQIWLNIKRGSVEGLNPFMFVFALIANI  321

Query  1258  TYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN--SGGSREDSA  1431
             TYVGSIL+R+T W KIK N+PWLLDA VCV LDLFIILQY+YY+Y RKN  S   RED  
Sbjct  322   TYVGSILLRSTEWSKIKANMPWLLDAVVCVVLDLFIILQYVYYKYLRKNPSSSNGREDEG  381

Query  1432  DY  1437
              Y
Sbjct  382   AY  383



>ref|XP_002274448.2| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Vitis vinifera]
 emb|CBI17580.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   504 bits (1299),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 262/413 (63%), Positives = 306/413 (74%), Gaps = 47/413 (11%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKKPCV WV+KYF DCLC++ D+FSF  GL SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  5     YCIKEKKPCVGWVDKYFGDCLCSLRDEFSFGFGLISLVCWGVAEIPQIITNFRTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTWIAGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  65    SLAFLLTWIAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLVLQS+YYD +Y WWK  +   +SNQ+VEE +KPL+ 
Sbjct  99    ---------------LYTTSTVVLVLQSVYYDDIYPWWKYGQI--NSNQVVEEERKPLK-  140

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K+GGSGIPIP+   + A     +YYYTSARS+AGS TPPFRS L   +SGPS +G+DND
Sbjct  141   PKAGGSGIPIPNTPVK-AGSTLRDYYYTSARSLAGSTTPPFRSYLRTARSGPSTVGLDND  199

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQG  1098
              SSDD+T    S  ++S+PKPIPRSAGYGA+L TS+++P Q+KA+M V     GRKLL  
Sbjct  200   SSSDDDTTHVASHKTVSKPKPIPRSAGYGAYLATSVNLPRQSKAMMEVSLGFTGRKLLHE  259

Query  1099  SGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSIL  1278
             SG E+S+FGQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYV SIL
Sbjct  260   SGMENSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANVTYVASIL  319

Query  1279  VRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             VRTT W+KIK N+PWLLDAAVCV LDLFIILQYIYY+Y RK    + ED  DY
Sbjct  320   VRTTEWEKIKANMPWLLDAAVCVMLDLFIILQYIYYKYLRKKISSAGEDLGDY  372



>ref|XP_006338274.1| PREDICTED: seven transmembrane protein 1-like [Solanum tuberosum]
Length=390

 Score =   504 bits (1298),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 297/423 (70%), Gaps = 56/423 (13%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVV-WVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRT  366
             QNS  YCV E KPCVV WV  YFKDCLCN+ D+FSF  G  SLICW VAEIPQIVTNFRT
Sbjct  11    QNSIAYCVKENKPCVVGWVNLYFKDCLCNVRDEFSFGFGFVSLICWAVAEIPQIVTNFRT  70

Query  367   KSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVIC  546
             KSSHGVSL+FLL W+ GD+FNL GCLLEPATLPTQLYTA+                    
Sbjct  71    KSSHGVSLVFLLGWVIGDVFNLTGCLLEPATLPTQLYTAV--------------------  110

Query  547   ESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEA  726
                                  LYT TT++LVLQ +YYD+ Y+ WK  E+     ++ E  
Sbjct  111   ---------------------LYTGTTIILVLQILYYDYFYKCWKRSENETGQLEVEEVL  149

Query  727   KKPLRRNKSGGSGIPIPD-GASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPS  897
             KKPLR  K+  SGIPIP   ASRP      ++Y+ SARS+AGS+TPPFRSNL  + S PS
Sbjct  150   KKPLRPQKTTDSGIPIPSRSASRPM-----DFYFMSARSLAGSSTPPFRSNLRPIASDPS  204

Query  898   ALGMDN-DCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAAL  1074
             A+ ++N D SSDD+TV+AP   S+SQPKPIPRSAGYGAF  T   +PHQTKAL+      
Sbjct  205   AVRLNNHDYSSDDDTVDAPLNISVSQPKPIPRSAGYGAFFATVSGMPHQTKALL---VGF  261

Query  1075  GGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLAN  1254
             GGRKLLQ  GTEHS+ GQ LGWMMAA+YMGGRIPQIWLNIKRGSVEGLNP MF+FAL+AN
Sbjct  262   GGRKLLQEHGTEHSALGQCLGWMMAAVYMGGRIPQIWLNIKRGSVEGLNPFMFVFALIAN  321

Query  1255  ATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS--REDS  1428
              TYVGSIL+R+T W KIK N+PWLLDA VCV LDLFIILQY+YY+Y RKN   S  RED 
Sbjct  322   VTYVGSILLRSTEWSKIKANMPWLLDAVVCVVLDLFIILQYVYYKYVRKNPSTSNGREDE  381

Query  1429  ADY  1437
               Y
Sbjct  382   GAY  384



>ref|XP_010649200.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Vitis vinifera]
Length=382

 Score =   502 bits (1292),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 263/414 (64%), Positives = 307/414 (74%), Gaps = 48/414 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKKPCV WV+KYF DCLC++ D+FSF  GL SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  5     YCIKEKKPCVGWVDKYFGDCLCSLRDEFSFGFGLISLVCWGVAEIPQIITNFRTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTWIAGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  65    SLAFLLTWIAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLVLQS+YYD +Y WWK  +   +SNQ+VEE +KPL+ 
Sbjct  99    ---------------LYTTSTVVLVLQSVYYDDIYPWWKYGQI--NSNQVVEEERKPLK-  140

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K+GGSGIPIP+   + A     +YYYTSARS+AGS TPPFRS L   +SGPS +G+DND
Sbjct  141   PKAGGSGIPIPNTPVK-AGSTLRDYYYTSARSLAGSTTPPFRSYLRTARSGPSTVGLDND  199

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL-Q  1095
              SSDD+T    S  ++S+PKPIPRSAGYGA+L TS+++P Q+KA+M V     GRKLL Q
Sbjct  200   SSSDDDTTHVASHKTVSKPKPIPRSAGYGAYLATSVNLPRQSKAMMEVSLGFTGRKLLHQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
              SG E+S+FGQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYV SI
Sbjct  260   ESGMENSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANVTYVASI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             LVRTT W+KIK N+PWLLDAAVCV LDLFIILQYIYY+Y RK    + ED  DY
Sbjct  320   LVRTTEWEKIKANMPWLLDAAVCVMLDLFIILQYIYYKYLRKKISSAGEDLGDY  373



>ref|XP_007047037.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 1 [Theobroma cacao]
 gb|EOX91194.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 1 [Theobroma cacao]
Length=381

 Score =   494 bits (1273),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 295/423 (70%), Gaps = 49/423 (12%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  99    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  138

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  139   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  195

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  196   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  255

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VEGLNPLMFIFAL+ANATYV
Sbjct  256   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIFALIANATYV  315

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*M  1446
              SILVRTT W+ IK N+PWLLDAAVCV LDLFIILQY+YY+Y RK      ED  DY   
Sbjct  316   ASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKYFRKTDNSDGEDYGDYMEA  375

Query  1447  SKQ  1455
             SK+
Sbjct  376   SKE  378



>ref|XP_011025699.1| PREDICTED: lysosomal amino acid transporter 1 isoform X1 [Populus 
euphratica]
Length=384

 Score =   489 bits (1258),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 258/430 (60%), Positives = 303/430 (70%), Gaps = 55/430 (13%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVEKYFKDCLC++ D+FSF  GL SL+CWGVAEIPQI+TN
Sbjct  1     MSLA-----YCVKERKPCVRWVEKYFKDCLCSLKDEFSFAFGLISLVCWGVAEIPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSL FLLTW+AGDIFNLVGCLLEPATLPTQ YTA+                 
Sbjct  56    FRTKSSHGVSLAFLLTWVAGDIFNLVGCLLEPATLPTQYYTAV-----------------  98

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +TVVLVLQ +YYD +YRW + ++     NQ V
Sbjct  99    ------------------------LYTTSTVVLVLQGLYYDHVYRWCRCRKT--KDNQQV  132

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             ++ + PL+   +  SGI IP  + R   +   ++YY SARS+AGS TPPFRS L   KSG
Sbjct  133   DDDQDPLKPKSADRSGISIPKASPRATSRR--DFYYMSARSLAGSNTPPFRSYLRAAKSG  190

Query  892   PSALGMDNDCSSDDETVEAPSM-NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYA  1068
             PSA+G+DN+ SSDDE     S+ N++SQP+PIPRSAGYG FL TSL++P Q+KAL   Y 
Sbjct  191   PSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPLQSKALTQAYI  250

Query  1069  ALGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL  1245
                GR+LL +G G +HS+FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL
Sbjct  251   GYTGRRLLHEGGGMDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFAL  310

Query  1246  LANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRED  1425
             +AN TYV SI+VRTT WD IKPN+PWLLDAAVCV LD FIILQYIYYRY  +     +E 
Sbjct  311   VANLTYVLSIVVRTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRYFLEKRVDHKEC  370

Query  1426  S-ADYS*MSK  1452
             S  DY   SK
Sbjct  371   SYGDYVDASK  380



>ref|XP_009374215.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Pyrus 
x bretschneideri]
Length=382

 Score =   488 bits (1257),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 253/414 (61%), Positives = 294/414 (71%), Gaps = 48/414 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPC  WV+KYFKDCLCN++DD SFV GL SL+CWGVAE+PQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCARWVQKYFKDCLCNLNDDISFVFGLISLVCWGVAEVPQIITNFHTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TW+AGD+FNL+GC LEPATLPTQLYTAL                          
Sbjct  65    SLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+T+VLVLQS+YYD++Y WWK +          EE KKPL  
Sbjct  99    ---------------LYTASTIVLVLQSVYYDYIYTWWKCRNITARQKD-EEENKKPLN-  141

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K   SGIPIP  +  P    + E+YYTSARS+AGS TPPFRS +   +SGPSA+ +D+D
Sbjct  142   PKLADSGIPIPSAS--PKATPRREFYYTSARSLAGSGTPPFRSYMRAARSGPSAMTIDSD  199

Query  919   CSSDDETVEAPS-MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  NS++QP+PIPR AGYG FL TSL++P QTK L  VY  + GRKLLQ
Sbjct  200   SSSEDESAPVTSNKNSLTQPRPIPRLAGYGTFLATSLNLPSQTKGLAQVYLGVTGRKLLQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+FGQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYVGSI
Sbjct  260   EHSVEHSTFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANVTYVGSI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             LVRTT WD IK N+PWLLDAAVCV LDLFIILQYIYY++ RK +    ED   Y
Sbjct  320   LVRTTKWDSIKANMPWLLDAAVCVALDLFIILQYIYYKHWRKGTTRGEEDYTYY  373



>ref|XP_006380747.1| PQ-loop repeat family protein [Populus trichocarpa]
 gb|ERP58544.1| PQ-loop repeat family protein [Populus trichocarpa]
Length=384

 Score =   486 bits (1251),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 252/409 (62%), Positives = 295/409 (72%), Gaps = 54/409 (13%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVEKYFKDCLC++ D+FSF  GL SL+CWGVAEIPQI+TN
Sbjct  1     MSLA-----YCVKEQKPCVRWVEKYFKDCLCSLKDEFSFTFGLISLVCWGVAEIPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSL FLLTW+AGDIFNLVGCLLEPATLPTQ YTA+                 
Sbjct  56    FRTKSSHGVSLAFLLTWVAGDIFNLVGCLLEPATLPTQYYTAV-----------------  98

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +TVVLVLQ +YYD +YRW + ++     NQ V
Sbjct  99    ------------------------LYTTSTVVLVLQGLYYDHVYRWCRCRKT--KDNQQV  132

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             ++ + PL+   +  SGI IP  + R   +   ++YY SARS+AGS TPPFRS L   KSG
Sbjct  133   DDDQDPLKPKSADRSGISIPKASPRATPRR--DFYYMSARSLAGSNTPPFRSYLRAAKSG  190

Query  892   PSALGMDNDCSSDDETVEAPSM-NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYA  1068
             PSA+G+DN+ SSDDE     S+ N++SQP+PIPRSAGYG FL TSL++P Q+KAL   Y 
Sbjct  191   PSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPLQSKALTQAYI  250

Query  1069  ALGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL  1245
                GR+LL +G GT+HS+FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL
Sbjct  251   GYTGRRLLHEGGGTDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFAL  310

Query  1246  LANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
             +AN TYV SI+ RTT WD IKPN+PWLLDAAVCV LD FIILQYIYYRY
Sbjct  311   VANLTYVLSIVARTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRY  359



>ref|XP_010437297.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Camelina sativa]
Length=390

 Score =   485 bits (1248),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 248/422 (59%), Positives = 294/422 (70%), Gaps = 49/422 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCNI+DD SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQLYTAL                          
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTAL--------------------------  101

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKD-KEDAGDSNQLVEEAKKPLR  741
                            LYT +TVVLV+Q++YYD++Y+  +  +          +E K+PL+
Sbjct  102   ---------------LYTVSTVVLVIQTIYYDYIYKLCRHGRTKICTQTDEEDEEKRPLK  146

Query  742   RNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMD  912
               K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP RS+   + KSGPSAL ++
Sbjct  147   LPKTTGSAISIPRGSYKDSPRK--EFYYTSARSLAGSGTPPLRSSYFRVAKSGPSALAIE  204

Query  913   NDCSSD-DETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             N  SSD DET+    + +I+QP+PIPR AG+G FL  S S+P Q K+L   YA    R+L
Sbjct  205   NGSSSDEDETMSTCPVITITQPRPIPRPAGFGTFLAASASLPLQAKSLAEKYAHASSRRL  264

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
             L     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRG+VEG+NPLMF+FAL+ANATYVG
Sbjct  265   LNEKIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGNVEGMNPLMFVFALVANATYVG  324

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS-ADYS*M  1446
             SILVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S  + ED   DY   
Sbjct  325   SILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRSESIKTEEDGYGDYVEA  384

Query  1447  SK  1452
             SK
Sbjct  385   SK  386



>ref|XP_010432125.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Camelina sativa]
Length=392

 Score =   484 bits (1247),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 292/424 (69%), Gaps = 51/424 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCNI+DD SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQLYTAL                          
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTAL--------------------------  101

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++YR  +            +E K+PL+ 
Sbjct  102   ---------------LYTVSTVVLVIQTIYYDYIYRLCRHGRTKICQTDEEDEEKRPLKP  146

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP RS+   + KSGPSAL ++N
Sbjct  147   PKTTGSAISIPRGSYKDSPRR--EFYYTSARSLAGSGTPPSRSSYFRVAKSGPSALAIEN  204

Query  916   DCSSDDE----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
               SSD++    T    +  +I+QP+PIPR AG+G FL  S S+P Q K+L   YA    R
Sbjct  205   GSSSDEDETMSTCPVIATKTITQPRPIPRPAGFGTFLAASASLPLQAKSLAEKYAHASSR  264

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             +LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEG+NPLMF+FAL+ANATY
Sbjct  265   RLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGMNPLMFVFALVANATY  324

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS-ADYS  1440
             VGSILVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S  + ED   DY 
Sbjct  325   VGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRSESIKTEEDGYGDYV  384

Query  1441  *MSK  1452
               SK
Sbjct  385   QASK  388



>ref|XP_008241616.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Prunus 
mume]
Length=382

 Score =   484 bits (1245),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 248/414 (60%), Positives = 296/414 (71%), Gaps = 48/414 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPC  WVEKYFKDCLCN++DD SF  GL SL+CWGVAEIPQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCDRWVEKYFKDCLCNLNDDISFAFGLVSLVCWGVAEIPQIITNFHTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNL+GCLLEPATLPTQLYTAL                          
Sbjct  65    SLAFLLTWVAGDVFNLMGCLLEPATLPTQLYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +T+VLVLQS+YYD++Y W K  +    + ++ EE K+PL  
Sbjct  99    ---------------LYTTSTIVLVLQSVYYDYIYTWCKCGKVTA-TQEVDEENKRPLN-  141

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K   SGIPIP  + +P  +   E+YYTSARS+AGS TPPFR+ +   KSGPS + + +D
Sbjct  142   PKLADSGIPIPSASPKPTPRK--EFYYTSARSLAGSGTPPFRTYMRAAKSGPSTMALYSD  199

Query  919   CSSDDETVEAPSMNSISQPKPIPRS-AGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  S++QP+PIPRS AGYG FL TSL++P QTKAL  VY  + GRKLLQ
Sbjct  200   SSSEDESAPVSSKTSVTQPRPIPRSVAGYGTFLATSLNLPSQTKALTQVYIGITGRKLLQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+FGQWLGW+MAAIYMGGR+PQIWLNIKRG+VEGLNPLMF+FAL+AN TYVGSI
Sbjct  260   EHSMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGTVEGLNPLMFVFALVANVTYVGSI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             +VRTT WD IK N+PWLLDA VCVGLDLFIILQY+YY++ RK +    E+   Y
Sbjct  320   VVRTTEWDSIKANMPWLLDAVVCVGLDLFIILQYVYYKHLRKRTTRGGENYTYY  373



>ref|XP_010446736.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Camelina 
sativa]
Length=390

 Score =   483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/422 (59%), Positives = 292/422 (69%), Gaps = 49/422 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCNI+DD SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQLYTAL                          
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTAL--------------------------  101

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++YR  +            +E K+PL+ 
Sbjct  102   ---------------LYTVSTVVLVIQTIYYDYIYRLCRHGRTKICQTDEEDEEKRPLKP  146

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP RS+   + KSGPSAL ++N
Sbjct  147   PKATGSAISIPRGSYKDSPRR--EFYYTSARSLAGSGTPPLRSSYFRVAKSGPSALAIEN  204

Query  916   DCSSD-DETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
               SSD DET+    + +I+QP+ IPR AG+G FL  S S+P Q K+L   YA    R+LL
Sbjct  205   VYSSDEDETMSTCPVITITQPRAIPRPAGFGTFLAASASLPLQAKSLAEKYAHASSRRLL  264

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
                  EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEG+NPLMF+FAL+ANATYVGS
Sbjct  265   NERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGMNPLMFVFALVANATYVGS  324

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS--ADYS*M  1446
             ILVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S  + E+    DY   
Sbjct  325   ILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRSQSIKTEEEDGYGDYVEA  384

Query  1447  SK  1452
             SK
Sbjct  385   SK  386



>ref|NP_568009.5| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
 gb|AAK76703.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86709.1| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
Length=392

 Score =   483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/426 (58%), Positives = 293/426 (69%), Gaps = 53/426 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE YF DCLCN++DD SF LG+ SL+CWGVAEIPQ++TNFRTKSS+GV
Sbjct  6     YCLKEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKSSNGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++Y+  + +          +E K+PL+ 
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYKLCRHRRTKICQKDEEDEEKRPLKP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP R++   + KSGPSAL +DN
Sbjct  145   PKTMGSAISIPGGSYKDSSRR--EFYYTSARSLAGSGTPPLRTSYFRVAKSGPSALAIDN  202

Query  916   DCSSDDE-----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGG  1080
             D SS DE     T    +  +I++P+PIPR AG+G FL  S S+P Q K+L   YA    
Sbjct  203   DGSSSDEDETMSTCPVITAKTITKPRPIPRQAGFGTFLAASASLPLQAKSLAEKYAHASS  262

Query  1081  RKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
             R+LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANAT
Sbjct  263   RRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANAT  322

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA--D  1434
             YVGSILVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S  SRE+ A  D
Sbjct  323   YVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRIKSLESREEDAYGD  382

Query  1435  YS*MSK  1452
             Y   SK
Sbjct  383   YVEASK  388



>ref|XP_007204395.1| hypothetical protein PRUPE_ppa007096mg [Prunus persica]
 gb|EMJ05594.1| hypothetical protein PRUPE_ppa007096mg [Prunus persica]
Length=382

 Score =   481 bits (1237),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/414 (60%), Positives = 295/414 (71%), Gaps = 48/414 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPC  WVEKYFKDCLCN++DD SF  GL SL+CWGVAEIPQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCDRWVEKYFKDCLCNLNDDISFAFGLVSLVCWGVAEIPQIITNFHTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNL+GCLLEPATLPTQLYTAL                          
Sbjct  65    SLAFLLTWVAGDVFNLMGCLLEPATLPTQLYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +T+VLVLQS+YYD++Y W K  +    + ++ EE K+PL  
Sbjct  99    ---------------LYTTSTIVLVLQSVYYDYIYTWCKCGK-VTSTEEVDEENKRPLN-  141

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K   SGIPIP  + +P  +   E+YYTSARS+AGS TPPFR+ +   KSGPS + + +D
Sbjct  142   PKLADSGIPIPTASPKPTPRK--EFYYTSARSLAGSGTPPFRTYMRAAKSGPSTMALYSD  199

Query  919   CSSDDETVEAPSMNSISQPKPIPRS-AGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  S++QP+PIPRS A YG FL TSL++P QTKAL  VY  + GRKLLQ
Sbjct  200   SSSEDESAPVTSKTSVTQPRPIPRSVASYGTFLATSLNLPSQTKALTQVYIGITGRKLLQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+FGQWLGW+MAAIYMGGR+PQIWLNIKRG+VEGLNPLMF+FAL+AN TYVGSI
Sbjct  260   EHSMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGTVEGLNPLMFVFALVANVTYVGSI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             +VRTT WD IK N+PWLLDA VCVGLDLFIILQYIYY++ RK +    E+   Y
Sbjct  320   VVRTTEWDSIKANMPWLLDAVVCVGLDLFIILQYIYYKHLRKRTPRGGENYTFY  373



>emb|CDP02413.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 292/421 (69%), Gaps = 65/421 (15%)
 Frame = +1

Query  184   LAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFR  363
             L Q S  YCV E+KPCV WV +YFKDCLCN  DD SF LGL SL+CWGVAEIPQIVTNFR
Sbjct  4     LVQKSISYCVKEQKPCVGWVNRYFKDCLCNFRDDLSFALGLVSLVCWGVAEIPQIVTNFR  63

Query  364   TKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVI  543
             TKSSHG+S LFL TW+AGDIFNL GCLLEPATLPTQ YTAL                   
Sbjct  64    TKSSHGISPLFLFTWVAGDIFNLFGCLLEPATLPTQFYTAL-------------------  104

Query  544   CESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV--  717
                                   LY+ TTV+LVLQS+YYD +Y WWK + ++  S ++   
Sbjct  105   ----------------------LYSTTTVLLVLQSLYYDHIYGWWKSRRNSTSSQEVPYI  142

Query  718   ----EEAKKPLR----RNKSGGSGIPIPDGASR-PARQHQAEYYYTSARSMAGSATPPFR  870
                 E+ KKPLR    R +S  SGIPIP  A++ P R+   +YYYTSARS+AGSATPP R
Sbjct  143   QLSHEDLKKPLRPHKQRQRSTDSGIPIPTAATKTPQRR---DYYYTSARSLAGSATPPIR  199

Query  871   SNL--VKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPI-PRSAGYGAFLTTSLSIPHQ  1041
             S++  V+SGPSA+G+++  SS+DE        S +  +PI PRSAGYGAF+ TS+S+P Q
Sbjct  200   SSIWPVRSGPSAIGLEDGSSSEDEA-------SPTTSRPILPRSAGYGAFVATSMSMPPQ  252

Query  1042  TKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLN  1221
             TKA+M       GRKLLQ  G   ++ GQWLGWMMAAIYMGGR+PQIWLNIKRGSVEGLN
Sbjct  253   TKAMMQASIGFSGRKLLQEHGMGSNAVGQWLGWMMAAIYMGGRLPQIWLNIKRGSVEGLN  312

Query  1222  PLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             PLMFIFAL+ANA YVGSILVR T WDKIK N+PWLLDA  CV LDLFIILQY+YY+Y R 
Sbjct  313   PLMFIFALIANAAYVGSILVRNTEWDKIKANMPWLLDAVACVLLDLFIILQYVYYKYLRN  372

Query  1402  N  1404
              
Sbjct  373   R  373



>ref|XP_010548371.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Tarenaya 
hassleriana]
Length=396

 Score =   479 bits (1232),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 287/432 (66%), Gaps = 53/432 (12%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
              N   YCV EKK CV WVEKYF DCLC ++DD SF LG+ SL+CW VAEIPQI TNFRTK
Sbjct  5     NNREGYCVKEKKRCVEWVEKYFGDCLCTLNDDVSFSLGIVSLVCWAVAEIPQIFTNFRTK  64

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             SSHGVSL FLL W+AGDIFNL+GCLLEPATLPTQ YTAL                     
Sbjct  65    SSHGVSLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTAL---------------------  103

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAK  729
                                 LYT +TVVLVLQS+YYD +YR  K +        + ++  
Sbjct  104   --------------------LYTVSTVVLVLQSIYYDHIYRLCKRRRTKVLPKDVGDDED  143

Query  730   KPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL---VKSGPSA  900
             KPL+   +  +GIPIP G+ + +   + EYY+TSARS+AGS TPPFRS+     KSGPSA
Sbjct  144   KPLKPQNTTDAGIPIPRGSHKAS--PRTEYYFTSARSLAGSGTPPFRSSYFRAAKSGPSA  201

Query  901   LGMDNDCSSDDE------TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPV  1062
             + +D+  SSDDE      T+   +  SI+QP+PIPR AGYG FL  S+++P Q K LM  
Sbjct  202   MAIDSGSSSDDEEDTARNTINVVTTKSITQPRPIPRPAGYGTFLAASVNLPFQAKGLMDA  261

Query  1063  YAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             Y     R+LLQ    EHS  GQ LGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FA
Sbjct  262   YTTTSARRLLQERVMEHSVVGQCLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFA  321

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             L+AN TYVGSILVRTT WD IK NLPWLLDA VCV LDLFIILQYIYYR+ RK      +
Sbjct  322   LIANVTYVGSILVRTTKWDSIKANLPWLLDAVVCVALDLFIILQYIYYRHLRKKDQRLDQ  381

Query  1423  DS-ADYS*MSKQ  1455
             D+  DY   SK+
Sbjct  382   DNYGDYVEASKE  393



>ref|XP_009379174.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Pyrus x bretschneideri]
Length=376

 Score =   477 bits (1227),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 251/410 (61%), Positives = 288/410 (70%), Gaps = 48/410 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPCV WV+KYFKDCLCN+SDD SF LGL SL+CWGVAEIPQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCVRWVQKYFKDCLCNLSDDISFALGLISLVCWGVAEIPQIITNFHTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TW+AGD+FNL+GC LEPATLPTQLYTAL                          
Sbjct  65    SLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD++Y WWK +          EE  KPL  
Sbjct  99    ---------------LYTASTVVLVLQSVYYDYIYAWWKCQNFKARQKD-EEENIKPLN-  141

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K    GIPIP  +  P    + E+YYTSARSMAGS TPPFR+ +   +SGPSA+ MD+D
Sbjct  142   PKLADLGIPIPTAS--PKATPKREFYYTSARSMAGSGTPPFRTYMRAARSGPSAMIMDSD  199

Query  919   CSSDDETVEAPS-MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  NS++QP+PIPRS GYG FL TS ++P QTK L  VY  + GRKLLQ
Sbjct  200   SSSEDESALVTSNKNSVTQPRPIPRSVGYGTFLATSFNLPSQTKGLAQVYLGVTGRKLLQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+ GQWLGW+MA IYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYVGSI
Sbjct  260   EHSVEHSALGQWLGWLMAGIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANVTYVGSI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRED  1425
             LVRTT WD IK N+ WLLDAAVCV LDLFIILQYIYY++ RK +    ED
Sbjct  320   LVRTTEWDNIKANMSWLLDAAVCVVLDLFIILQYIYYKHWRKGTTRGEED  369



>ref|XP_008338172.1| PREDICTED: lysosomal amino acid transporter 1-like [Malus domestica]
Length=382

 Score =   477 bits (1227),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 248/414 (60%), Positives = 292/414 (71%), Gaps = 48/414 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPC  W++KYFKDCLCN++DD SFV GL SL+CWGVAE+PQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCSRWIQKYFKDCLCNLNDDISFVFGLISLVCWGVAEVPQIITNFXTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TW+AGD+FNL+GC LEPATLPTQLYTAL                          
Sbjct  65    SLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD++Y WWK +          EE KKPL  
Sbjct  99    ---------------LYTASTVVLVLQSVYYDYIYTWWKCRNITARQKD-EEENKKPLN-  141

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K   SGIPIP  + +   +   E+YYTSARS+AGS TPPFR+ +   +SGPSA+ +D+D
Sbjct  142   PKLADSGIPIPSXSXKATPKR--EFYYTSARSLAGSGTPPFRTYMRAARSGPSAMTIDSD  199

Query  919   CSSDDETVEAPS-MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  NS++QP+PIPR AGYG FL TSL++P QTK L  VY  + GRKLLQ
Sbjct  200   SSSEDESAPVTSNKNSVTQPRPIPRLAGYGTFLATSLNLPSQTKGLAQVYLGVTGRKLLQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+FGQ LGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYVGSI
Sbjct  260   EHSVEHSTFGQGLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANVTYVGSI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             LVR T WD I+ N+PWLLDAAVCV LDLFIILQYIYY++ RK +    ED   Y
Sbjct  320   LVRXTKWDSIQANMPWLLDAAVCVALDLFIILQYIYYKHWRKGTTRGEEDYTYY  373



>ref|XP_007047042.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 6 [Theobroma cacao]
 gb|EOX91199.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 6 [Theobroma cacao]
Length=372

 Score =   475 bits (1223),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 287/423 (68%), Gaps = 58/423 (14%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPAT                                
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPAT--------------------------------  89

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  90    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  129

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  130   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  186

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  187   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  246

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VEGLNPLMFIFAL+ANATYV
Sbjct  247   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIFALIANATYV  306

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*M  1446
              SILVRTT W+ IK N+PWLLDAAVCV LDLFIILQY+YY+Y RK      ED  DY   
Sbjct  307   ASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKYFRKTDNSDGEDYGDYMEA  366

Query  1447  SKQ  1455
             SK+
Sbjct  367   SKE  369



>ref|XP_009141493.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Brassica 
rapa]
Length=393

 Score =   474 bits (1221),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 285/415 (69%), Gaps = 50/415 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCN++D+ SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCLKEKKTCVRWVERYFDDCLCNLNDEVSFALGIVSLICWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNL+GCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++YR               +E KKPL  
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYRLCTHGRTKICQKDEEDEEKKPLNP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G S  A   + E+YYTSARS+AGS TPP R++   + KSGPSA+ +D+
Sbjct  145   PKTMGSAISIP-GESYKASPRK-EFYYTSARSLAGSGTPPLRTSYFRVAKSGPSAMTIDS  202

Query  916   DCSSDDE----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
               SSD++    T+   +  +I+QP+PIPR AG+G FL  S+S+P Q K+L   YA    R
Sbjct  203   GSSSDEDETMSTLPVVTAKTITQPRPIPRQAGFGTFLAASVSLPLQAKSLAEKYAHASSR  262

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             +LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANATY
Sbjct  263   RLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANATY  322

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             VGSILVRT  WD IK NLPWLLDA VCV LDLFIILQYIYY+YCR NS    E++
Sbjct  323   VGSILVRTIEWDSIKANLPWLLDAIVCVLLDLFIILQYIYYKYCRTNSSKGEEEA  377



>emb|CDX75602.1| BnaA01g01000D [Brassica napus]
Length=393

 Score =   474 bits (1220),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 285/415 (69%), Gaps = 50/415 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCN++D+ SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCLKEKKTCVRWVERYFDDCLCNLNDEVSFALGIVSLICWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNL+GCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++YR               +E KKPL  
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYRLCTHGRTKICQKDEEDEEKKPLNP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G S  A   + E+YYTSARS+AGS TPP R++   + KSGPSA+ +D+
Sbjct  145   PKTMGSAISIP-GESYKASPRK-EFYYTSARSLAGSGTPPLRTSYFRVAKSGPSAMTIDS  202

Query  916   DCSSDDE----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
               SSD++    T+   +  +I+QP+PIPR AG+G FL  S+S+P Q K+L   YA    R
Sbjct  203   GSSSDEDETMSTLPVVTAKTITQPRPIPRQAGFGTFLAASVSLPLQAKSLAEKYAHASSR  262

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             +LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANATY
Sbjct  263   RLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANATY  322

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             VGSILVRT  WD IK NLPWLLDA VCV LDLFIILQYIYY+YCR NS    E++
Sbjct  323   VGSILVRTIEWDSIKANLPWLLDAIVCVLLDLFIILQYIYYKYCRTNSSKGEEEA  377



>ref|XP_004300590.1| PREDICTED: uncharacterized protein LOC101293205 [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   473 bits (1218),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 252/419 (60%), Positives = 297/419 (71%), Gaps = 52/419 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE+KPCV WVEKYFKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSSHGV
Sbjct  5     YCVAERKPCVRWVEKYFKDCLCNLGDDFSFGFGLVSLVCWGVAEIPQIITNFQTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTA+                          
Sbjct  65    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAV--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWK-DKEDAGDSNQLVEEA-KKPL  738
                            LYT +T+VLVLQ++YYD  Y WWK  K     + Q  EE  +KPL
Sbjct  99    ---------------LYTISTIVLVLQTIYYDHFYTWWKCGKVSVNQATQDEEEDYRKPL  143

Query  739   RRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGMD  912
                KS  SGIPIP  + + A +   E+YYTSARSMAGS TPPFR+   + KSGPS + ++
Sbjct  144   N-PKSIDSGIPIPTASIKAAPRR--EFYYTSARSMAGSGTPPFRTYMRVAKSGPSTMEVE  200

Query  913   NDCSSDDETVEAPSMNSI--SQPKPIPRSAGYGAFLTTSLSIPHQTKALMPV-YAALGGR  1083
             +D SS+DE+    S  S+  SQP+PIPRS GYGAFL TSL++P ++K +  V Y  + GR
Sbjct  201   SDSSSEDESAPVTSKKSVRTSQPRPIPRSVGYGAFLATSLNLPFRSKGMTQVLYMGITGR  260

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             KLLQ    EHS FGQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TY
Sbjct  261   KLLQEHSVEHSVFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALVANVTY  320

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN-SGGSREDSADY  1437
             V SILVRT  WD IK N+PWLLDAAVCV LDLFIILQY+YYR+ R++ + G  ED+  Y
Sbjct  321   VASILVRTIEWDSIKANMPWLLDAAVCVALDLFIILQYMYYRHWRESATSGDEEDNIYY  379



>ref|XP_010029841.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Eucalyptus grandis]
 gb|KCW56811.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=387

 Score =   473 bits (1217),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 245/417 (59%), Positives = 285/417 (68%), Gaps = 48/417 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
             LQ  G EHS FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+AN TYVG
Sbjct  263   LQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANVTYVG  322

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS  1440
             SILVRT  W+ I+ N+PWLLDA VCV LDLFIILQYIYYRY R++    +E    Y 
Sbjct  323   SILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIYYRYFRRSENSDKEGLGHYE  379



>ref|XP_003611897.1| Membrane protein, putative [Medicago truncatula]
 gb|AES94855.1| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=380

 Score =   472 bits (1214),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 239/407 (59%), Positives = 279/407 (69%), Gaps = 51/407 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WV+ YF DCLCN++D+ SF  G  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             S++FLLTW+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  65    SIVFLLTWVAGDIFNLVGCLLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLV+QS YYD++Y+W K ++   +  +  EE KKPL+ 
Sbjct  99    ---------------LYTITTIVLVVQSFYYDYIYKWCKRRQKI-NIEETYEEEKKPLKP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGMDND  918
              +    GIPI  G  R   +   EYYY SARS+AG+ TPP R+   + KSGPSA+G++ D
Sbjct  143   KERFELGIPIRSGRHRAIPK--PEYYYGSARSLAGNVTPPSRTYMRVAKSGPSAMGLNED  200

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SSDDE    P+    +QP+ IPRSAG YG FL  S+++PHQ+ AL   Y AL GRKLL 
Sbjct  201   SSSDDEAHSVPA----TQPRQIPRSAGSYGTFLAASINLPHQSNALKVGYIALSGRKLLS  256

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                  HS+ GQWLGW+MAAIY GGRIPQIWLNIKRGSVEGLNP MFIFAL+ANATYVGSI
Sbjct  257   QEHVTHSALGQWLGWLMAAIYTGGRIPQIWLNIKRGSVEGLNPFMFIFALIANATYVGSI  316

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS  1416
             LVRTT W+ IK N+PWLLDA VCV LDLFIILQYI YRY RK +  S
Sbjct  317   LVRTTEWESIKANMPWLLDAIVCVALDLFIILQYINYRYHRKTTTSS  363



>ref|XP_006411956.1| hypothetical protein EUTSA_v10025420mg [Eutrema salsugineum]
 gb|ESQ53409.1| hypothetical protein EUTSA_v10025420mg [Eutrema salsugineum]
Length=391

 Score =   472 bits (1215),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 240/413 (58%), Positives = 286/413 (69%), Gaps = 50/413 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCN++DD SF LG+ SLICW VAEIPQI+TNFRTKSSHGV
Sbjct  6     YCLKEKKTCVRWVERYFDDCLCNLNDDVSFALGIASLICWAVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNL+GCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLIGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++YR            +  +E K+PL+ 
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYRLCTHGRSKICPKEEEDEEKRPLKP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G S  A   + E+YYTSARS+AGS TPP R++   + KSGPSA+ +D+
Sbjct  145   PKTMGSAISIP-GESYKASPRK-EFYYTSARSLAGSGTPPLRTSYFRVAKSGPSAMTIDS  202

Query  916   DCSSDDE----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
               SSD++    T+ A +  +I+QP+PIPR AG+G FL  S+S+P Q K+L   YA    R
Sbjct  203   GSSSDEDETMSTLPAVTAKAITQPRPIPRQAGFGTFLAASVSLPLQAKSLAEKYAHASSR  262

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             +LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANATY
Sbjct  263   RLLNERRVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANATY  322

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             VGSILVRTT W+ IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  +    E
Sbjct  323   VGSILVRTTEWENIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRTKNVKMEE  375



>ref|XP_011025700.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 isoform 
X2 [Populus euphratica]
Length=375

 Score =   471 bits (1213),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 251/430 (58%), Positives = 295/430 (69%), Gaps = 64/430 (15%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVEKYFKDCLC++ D+FSF  GL SL+CWGVAEIPQI+TN
Sbjct  1     MSLA-----YCVKERKPCVRWVEKYFKDCLCSLKDEFSFAFGLISLVCWGVAEIPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSL FLLTW+AGDIFNLVGCLLEPAT                          
Sbjct  56    FRTKSSHGVSLAFLLTWVAGDIFNLVGCLLEPAT--------------------------  89

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +TVVLVLQ +YYD +YRW + ++     NQ V
Sbjct  90    ------------------------LYTTSTVVLVLQGLYYDHVYRWCRCRKT--KDNQQV  123

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             ++ + PL+   +  SGI IP  + R   +   ++YY SARS+AGS TPPFRS L   KSG
Sbjct  124   DDDQDPLKPKSADRSGISIPKASPRATSRR--DFYYMSARSLAGSNTPPFRSYLRAAKSG  181

Query  892   PSALGMDNDCSSDDETVEAPSM-NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYA  1068
             PSA+G+DN+ SSDDE     S+ N++SQP+PIPRSAGYG FL TSL++P Q+KAL   Y 
Sbjct  182   PSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPLQSKALTQAYI  241

Query  1069  ALGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL  1245
                GR+LL +G G +HS+FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL
Sbjct  242   GYTGRRLLHEGGGMDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFAL  301

Query  1246  LANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRED  1425
             +AN TYV SI+VRTT WD IKPN+PWLLDAAVCV LD FIILQYIYYRY  +     +E 
Sbjct  302   VANLTYVLSIVVRTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRYFLEKRVDHKEC  361

Query  1426  S-ADYS*MSK  1452
             S  DY   SK
Sbjct  362   SYGDYVDASK  371



>gb|ACJ84546.1| unknown [Medicago truncatula]
 gb|AFK47718.1| unknown [Medicago truncatula]
Length=380

 Score =   470 bits (1210),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 279/407 (69%), Gaps = 51/407 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WV+ YF DCLCN++D+ SF  G  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             S++FLLTW+AGDIFNLVGCLLEPA LPTQ YTAL                          
Sbjct  65    SIVFLLTWVAGDIFNLVGCLLEPAMLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLV+QS+YYD++Y+W K ++   +  +  EE KKPL+ 
Sbjct  99    ---------------LYTITTIVLVVQSLYYDYIYKWCKRRQKI-NIEETYEEEKKPLKP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGMDND  918
              +    GIPI  G  R   +   EYYY SARS+AG+ TPP R+   + KSGPSA+G++ D
Sbjct  143   KERFELGIPIRSGRHRAIPK--PEYYYGSARSLAGNVTPPSRTYMRVAKSGPSAMGLNED  200

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SSDDE    P+    +QP+ IPRSAG YG FL  S+++PHQ+ AL   Y AL GRKLL 
Sbjct  201   SSSDDEAHSVPA----TQPRQIPRSAGSYGTFLAASINLPHQSNALKVGYIALSGRKLLS  256

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                  HS+ GQWLGW+MAAIY GGRIPQIWLNIKRGSVEGLNP MFIFAL+ANATYVGSI
Sbjct  257   QEHVTHSALGQWLGWLMAAIYTGGRIPQIWLNIKRGSVEGLNPFMFIFALIANATYVGSI  316

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS  1416
             LVRTT W+ IK N+PWLLDA VCV LDLFIILQYI YRY RK +  S
Sbjct  317   LVRTTEWESIKANMPWLLDAIVCVALDLFIILQYINYRYHRKTTTSS  363



>gb|KFK30302.1| hypothetical protein AALP_AA7G244100 [Arabis alpina]
Length=390

 Score =   471 bits (1211),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/424 (56%), Positives = 290/424 (68%), Gaps = 51/424 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ E KPCV WVE+YF DCLCN++DD SF LG+  +ICW VAE+PQI+TNFRTKSSHGV
Sbjct  6     YCLKENKPCVRWVERYFDDCLCNLNDDVSFALGIAGIICWTVAEVPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNL+GC+LEPATLPTQ YTAL                          
Sbjct  66    SLYFLLAWVAGDIFNLIGCILEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD+ Y+ ++         +  +E K+PL+ 
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYFYKLYRHGRTKVSQKEEEDEKKRPLQP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP  + + +  H+ E+YYTSARS+AGS+TPP RS+   + KSGPSA+ +  
Sbjct  145   PKTMGSAISIPGESYKSS--HRKEFYYTSARSLAGSSTPPLRSSYFRVAKSGPSAMAIYG  202

Query  916   DCSSDDETVEAP---SMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
               S +DET+ +    ++ +I+QP+PIPR AG+G FL TS+++P Q K+L   YA    R+
Sbjct  203   SSSDEDETMSSQPVVTVKTITQPRPIPRQAGFGTFLATSVTLPLQAKSLAEKYANASSRR  262

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LL     EHS+ GQ LGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV
Sbjct  263   LLNERIIEHSALGQRLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  322

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS--ADYS  1440
             GSILVRTT WD IKPNLPWLLD+ VCV LDLFIILQYIYY+Y R  S    E+    DY 
Sbjct  323   GSILVRTTEWDNIKPNLPWLLDSIVCVVLDLFIILQYIYYKYGRTKSLEREEEDGYGDYV  382

Query  1441  *MSK  1452
               SK
Sbjct  383   EASK  386



>ref|XP_010029840.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Eucalyptus grandis]
Length=388

 Score =   469 bits (1206),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 245/418 (59%), Positives = 285/418 (68%), Gaps = 49/418 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSG-TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LQ  G  EHS FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+AN TYV
Sbjct  263   LQQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANVTYV  322

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS  1440
             GSILVRT  W+ I+ N+PWLLDA VCV LDLFIILQYIYYRY R++    +E    Y 
Sbjct  323   GSILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIYYRYFRRSENSDKEGLGHYE  380



>ref|XP_006380745.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
 gb|ERP58542.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
Length=375

 Score =   468 bits (1205),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 245/409 (60%), Positives = 287/409 (70%), Gaps = 63/409 (15%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVEKYFKDCLC++ D+FSF  GL SL+CWGVAEIPQI+TN
Sbjct  1     MSLA-----YCVKEQKPCVRWVEKYFKDCLCSLKDEFSFTFGLISLVCWGVAEIPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSL FLLTW+AGDIFNLVGCLLEPAT                          
Sbjct  56    FRTKSSHGVSLAFLLTWVAGDIFNLVGCLLEPAT--------------------------  89

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +TVVLVLQ +YYD +YRW + ++     NQ V
Sbjct  90    ------------------------LYTTSTVVLVLQGLYYDHVYRWCRCRKT--KDNQQV  123

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             ++ + PL+   +  SGI IP  + R   +   ++YY SARS+AGS TPPFRS L   KSG
Sbjct  124   DDDQDPLKPKSADRSGISIPKASPRATPRR--DFYYMSARSLAGSNTPPFRSYLRAAKSG  181

Query  892   PSALGMDNDCSSDDETVEAPSM-NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYA  1068
             PSA+G+DN+ SSDDE     S+ N++SQP+PIPRSAGYG FL TSL++P Q+KAL   Y 
Sbjct  182   PSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPLQSKALTQAYI  241

Query  1069  ALGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL  1245
                GR+LL +G GT+HS+FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL
Sbjct  242   GYTGRRLLHEGGGTDHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFAL  301

Query  1246  LANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
             +AN TYV SI+ RTT WD IKPN+PWLLDAAVCV LD FIILQYIYYRY
Sbjct  302   VANLTYVLSIVARTTEWDSIKPNMPWLLDAAVCVALDFFIILQYIYYRY  350



>ref|XP_007047040.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 4 [Theobroma cacao]
 gb|EOX91197.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 4 [Theobroma cacao]
Length=369

 Score =   468 bits (1204),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/423 (57%), Positives = 283/423 (67%), Gaps = 61/423 (14%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ                            
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQF---------------------------  94

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                                YTA T+       YYD +YRWWK +    D+  +VE+ KKP
Sbjct  95    -------------------YTALTI-------YYDNVYRWWKCRRIKTDN--MVEDEKKP  126

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  127   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  183

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  184   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  243

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VEGLNPLMFIFAL+ANATYV
Sbjct  244   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIFALIANATYV  303

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*M  1446
              SILVRTT W+ IK N+PWLLDAAVCV LDLFIILQY+YY+Y RK      ED  DY   
Sbjct  304   ASILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKYFRKTDNSDGEDYGDYMEA  363

Query  1447  SKQ  1455
             SK+
Sbjct  364   SKE  366



>ref|XP_006283881.1| hypothetical protein CARUB_v10004998mg [Capsella rubella]
 gb|EOA16779.1| hypothetical protein CARUB_v10004998mg [Capsella rubella]
Length=392

 Score =   468 bits (1203),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/426 (57%), Positives = 287/426 (67%), Gaps = 53/426 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKKPCV WVE+YF DCLCN++DD SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCLKEKKPCVRWVERYFDDCLCNLNDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQLYTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++Y+  +            ++ K+PL  
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYKLCRHGRTKICQQDEEDDEKRPLNP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP R +   + KSGPSA+ + +
Sbjct  145   PKTMGSAISIPRGSFKDSPRR--EFYYTSARSLAGSGTPPLRPSYFRVAKSGPSAMAIID  202

Query  916   DCSSDDE-----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGG  1080
             + SS DE     T  A +  +I+QP+ IPR AG+G FL  S S+P Q K+L   YA    
Sbjct  203   NGSSSDEDETMSTCPAITAKTITQPRAIPRQAGFGTFLAASASLPLQAKSLAEKYAHSSS  262

Query  1081  RKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
             R+LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL+AN T
Sbjct  263   RRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFALVANVT  322

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS--AD  1434
             YVGSILVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+Y R  S  + E     D
Sbjct  323   YVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYRRTESIKTEEKDGYGD  382

Query  1435  YS*MSK  1452
             Y   SK
Sbjct  383   YEEASK  388



>ref|XP_003611896.1| Membrane protein, putative [Medicago truncatula]
Length=382

 Score =   467 bits (1201),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 239/409 (58%), Positives = 279/409 (68%), Gaps = 53/409 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WV+ YF DCLCN++D+ SF  G  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             S++FLLTW+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  65    SIVFLLTWVAGDIFNLVGCLLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLV+QS YYD++Y+W K ++   +  +  EE KKPL+ 
Sbjct  99    ---------------LYTITTIVLVVQSFYYDYIYKWCKRRQKI-NIEETYEEEKKPLKP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGMDND  918
              +    GIPI  G  R     + EYYY SARS+AG+ TPP R+   + KSGPSA+G++ D
Sbjct  143   KERFELGIPIRSGRHRAI--PKPEYYYGSARSLAGNVTPPSRTYMRVAKSGPSAMGLNED  200

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SSDDE    P+    +QP+ IPRSAG YG FL  S+++PHQ+ AL   Y AL GRKLL 
Sbjct  201   SSSDDEAHSVPA----TQPRQIPRSAGSYGTFLAASINLPHQSNALKVGYIALSGRKLLS  256

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLN--IKRGSVEGLNPLMFIFALLANATYVG  1269
                  HS+ GQWLGW+MAAIY GGRIPQIWLN  IKRGSVEGLNP MFIFAL+ANATYVG
Sbjct  257   QEHVTHSALGQWLGWLMAAIYTGGRIPQIWLNVRIKRGSVEGLNPFMFIFALIANATYVG  316

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS  1416
             SILVRTT W+ IK N+PWLLDA VCV LDLFIILQYI YRY RK +  S
Sbjct  317   SILVRTTEWESIKANMPWLLDAIVCVALDLFIILQYINYRYHRKTTTSS  365



>ref|XP_003517255.1| PREDICTED: lysosomal amino acid transporter 1-like [Glycine max]
Length=385

 Score =   465 bits (1197),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/420 (57%), Positives = 271/420 (65%), Gaps = 47/420 (11%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WVEKY  DCLCN+ D  SF  G  SL+CWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKESKPCVGWVEKYLDDCLCNLKDKISFGFGFISLVCWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDIFNL+GC LEPATLPTQ YTAL                          
Sbjct  65    SLAFLLTWVAGDIFNLLGCHLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLVLQS YYD++Y+W K            EE KKPLR+
Sbjct  99    ---------------LYTITTIVLVLQSFYYDYIYKWGKPLRKINIDEAHEEEEKKPLRQ  143

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
                  SGIPI +    P    + +YYY SARS+A + TPPF + L   KS PSA+ M+ND
Sbjct  144   KPGRDSGIPIQNDG--PKETPRRDYYYRSARSLAANDTPPFGTYLRAAKSVPSAMEMNND  201

Query  919   CSSDDETVEAPSMNSISQPKPIPRS--AGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
              SSDDE     S   ++QP+PIPRS  A YG FL  S+++P Q  ALM  Y    GRKLL
Sbjct  202   SSSDDEAPPLSSTKPVTQPRPIPRSVPASYGTFLAASMNLPRQGNALMEGYKRFNGRKLL  261

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
                   HS+ GQWLGW+MA IYMGGR+PQIWLNIKRGSVEGLNPLMFIFAL+ANATYVGS
Sbjct  262   SQEHNMHSALGQWLGWLMAVIYMGGRLPQIWLNIKRGSVEGLNPLMFIFALIANATYVGS  321

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*MSK  1452
             ILVRT  W+ I+ N+PWLLDA VCV LDLFIILQY  YRY RK +G    D  DY   SK
Sbjct  322   ILVRTIEWESIRANMPWLLDAIVCVALDLFIILQYANYRYVRKKTGSDDADYGDYKEASK  381



>ref|XP_010437298.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Camelina sativa]
Length=381

 Score =   464 bits (1194),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 239/422 (57%), Positives = 285/422 (68%), Gaps = 58/422 (14%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCNI+DD SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPAT                                   
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPAT-----------------------------------  92

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKD-KEDAGDSNQLVEEAKKPLR  741
                            LYT +TVVLV+Q++YYD++Y+  +  +          +E K+PL+
Sbjct  93    ---------------LYTVSTVVLVIQTIYYDYIYKLCRHGRTKICTQTDEEDEEKRPLK  137

Query  742   RNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMD  912
               K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP RS+   + KSGPSAL ++
Sbjct  138   LPKTTGSAISIPRGSYKDSPRK--EFYYTSARSLAGSGTPPLRSSYFRVAKSGPSALAIE  195

Query  913   NDCSSD-DETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             N  SSD DET+    + +I+QP+PIPR AG+G FL  S S+P Q K+L   YA    R+L
Sbjct  196   NGSSSDEDETMSTCPVITITQPRPIPRPAGFGTFLAASASLPLQAKSLAEKYAHASSRRL  255

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
             L     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRG+VEG+NPLMF+FAL+ANATYVG
Sbjct  256   LNEKIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGNVEGMNPLMFVFALVANATYVG  315

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS-ADYS*M  1446
             SILVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S  + ED   DY   
Sbjct  316   SILVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRSESIKTEEDGYGDYVEA  375

Query  1447  SK  1452
             SK
Sbjct  376   SK  377



>ref|XP_008338915.1| PREDICTED: lysosomal amino acid transporter 1-like [Malus domestica]
Length=376

 Score =   464 bits (1193),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 245/410 (60%), Positives = 287/410 (70%), Gaps = 48/410 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPCV WV+KYFKDCLCN++DD SF  GL SL+CWGVAEIPQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCVRWVQKYFKDCLCNLNDDISFASGLISLVCWGVAEIPQIITNFHTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TW+AGD+FNL+GC LEPATLPTQLYTAL                          
Sbjct  65    SLAFLCTWVAGDVFNLLGCFLEPATLPTQLYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+T+VLVLQS+YYD++Y WWK + +     +  EE KKPL  
Sbjct  99    ---------------LYTASTIVLVLQSVYYDYIYAWWKCR-NITPRQKDEEENKKPLNP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K   S IPIP  +  P    + E+YYTSARSMAGS TPPFR+ +   +SGPSA+ +D+D
Sbjct  143   -KLADSSIPIPTAS--PKATPKREFYYTSARSMAGSGTPPFRTYMRAARSGPSAMTIDSD  199

Query  919   CSSDDETVEAPS-MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  NS++Q + IPR  GYG FL TSL++P QTK L  VY  + GRKLLQ
Sbjct  200   SSSEDESAPVTSNKNSVTQSRSIPRLVGYGTFLATSLNLPSQTKGLAQVYLGVTGRKLLQ  259

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+ GQWLGW+MAAIYMGGR+PQI LNIKRGSVEGLNPLMF+FAL+AN TYVGSI
Sbjct  260   EHSVEHSALGQWLGWLMAAIYMGGRLPQICLNIKRGSVEGLNPLMFVFALIANVTYVGSI  319

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRED  1425
             LVRTT WD I  N+ WLLDAAVCV LDLFIILQYIYY++ RK +    ED
Sbjct  320   LVRTTDWDNITANMSWLLDAAVCVVLDLFIILQYIYYKHWRKGTTRGEED  369



>gb|KHN36154.1| Protein RTC2 [Glycine soja]
Length=385

 Score =   464 bits (1193),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 238/420 (57%), Positives = 270/420 (64%), Gaps = 47/420 (11%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WVEKY  DCLCN+ D  SF  G  SL+CWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKESKPCVGWVEKYLDDCLCNLKDKISFGFGFISLVCWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDIFNL+GC LEPATLPTQ YTAL                          
Sbjct  65    SLAFLLTWVAGDIFNLLGCHLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLVLQS YYD++Y+W K            EE KKPLR+
Sbjct  99    ---------------LYTITTIVLVLQSFYYDYIYKWGKPLRKINIDEAHEEEEKKPLRQ  143

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
                  SGIPI +    P    + +YYY SARS+A + TPPF + L   KS PSA+ M+ND
Sbjct  144   KPGRDSGIPIQNDG--PKETPRRDYYYRSARSLAANDTPPFGTYLRAAKSVPSAMEMNND  201

Query  919   CSSDDETVEAPSMNSISQPKPIPRS--AGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
              SSDDE     S   ++QP+PIPRS    YG FL  S+++P Q  ALM  Y    GRKLL
Sbjct  202   SSSDDEAPPLSSTKPVTQPRPIPRSVPTSYGTFLAASMNLPRQGNALMEGYKRFNGRKLL  261

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
                   HS+ GQWLGW+MA IYMGGR+PQIWLNIKRGSVEGLNPLMFIFAL+ANATYVGS
Sbjct  262   SQEHNMHSALGQWLGWLMAVIYMGGRLPQIWLNIKRGSVEGLNPLMFIFALIANATYVGS  321

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*MSK  1452
             ILVRT  W+ I+ N+PWLLDA VCV LDLFIILQY  YRY RK +G    D  DY   SK
Sbjct  322   ILVRTIEWESIRANMPWLLDAIVCVALDLFIILQYANYRYVRKKTGSDDADYGDYKEASK  381



>ref|XP_008457880.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Cucumis 
melo]
 ref|XP_008457881.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Cucumis 
melo]
Length=381

 Score =   462 bits (1188),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 245/425 (58%), Positives = 291/425 (68%), Gaps = 54/425 (13%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
              G YCV E+K CV WVE YFKDCLCN+ DD SF  GL SL+CWG+AEIPQIVTNFRTKSS
Sbjct  2     EGWYCVKEQKRCVGWVETYFKDCLCNLRDDMSFGFGLVSLLCWGLAEIPQIVTNFRTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQLYTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQLYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT  T+VLVLQS+YYD++ +W  D++   D  Q VEE K P
Sbjct  99    ------------------LYTVNTIVLVLQSVYYDYVTKWCIDRKSKSD--QTVEEEKTP  138

Query  736   LRRNKSGG-SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALG  906
             L+ NK  G +GIPIP  + +P  +   E+YYTSARS+AGS TPPFR+   L KSGPSALG
Sbjct  139   LKGNKGVGYAGIPIPKASPKPTPRR--EFYYTSARSLAGSDTPPFRAFLRLPKSGPSALG  196

Query  907   -MDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
                +    + +T    S ++++QP+PIPRS GYG FL  S ++P Q+K     ++   GR
Sbjct  197   NDSSSSDEESDTAAVFSHSAVTQPRPIPRSVGYGTFLAASANLPFQSKGFSDGFS---GR  253

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             KLLQ   + HS FGQ LGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+ANATY
Sbjct  254   KLLQ-EHSSHSGFGQLLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANATY  312

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYY-RYCRKNSGGSREDSADYS  1440
             V SI+VR+T W+ IK N+PWLLDA VCV LDLFIILQYIYY R+ RK   G R+   DY 
Sbjct  313   VASIVVRSTEWENIKANMPWLLDAVVCVLLDLFIILQYIYYRRFRRKRQSGGRDQFKDYE  372

Query  1441  *MSKQ  1455
               +K 
Sbjct  373   EATKH  377



>ref|XP_006425752.1| hypothetical protein CICLE_v10025820mg [Citrus clementina]
 ref|XP_006466709.1| PREDICTED: probable vacuolar amino acid transporter YPQ1-like 
[Citrus sinensis]
 gb|ESR38992.1| hypothetical protein CICLE_v10025820mg [Citrus clementina]
Length=388

 Score =   460 bits (1184),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 247/410 (60%), Positives = 288/410 (70%), Gaps = 55/410 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E+K CV W+E+YFKDCLCN+ D+FSF  GL SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCVKERKGCVGWIERYFKDCLCNVKDEFSFGFGLSSLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SLLFLLTW+AGDIFNL GCLLEPATLPTQ YTAL                          
Sbjct  66    SLLFLLTWVAGDIFNLTGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLVLQ +YYD +++  K +       +  EE KKPL  
Sbjct  100   ---------------LYTISTVVLVLQGVYYDHIFKRLKGRHTKATRRE--EEEKKPLA-  141

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              KSG + IPIP  + + + +   EYYYTSARS+A S TPPFR+ L   +SGPSALG+DND
Sbjct  142   PKSGDAAIPIPKASVKSSPRR--EYYYTSARSLASSGTPPFRTFLRAAQSGPSALGLDND  199

Query  919   CSSDDETVEA-PSMNS-----ISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAA-LG  1077
              SSDDE   A P+++S      SQP+PIPRSAGYG FL  S+++P Q+ AL    AA   
Sbjct  200   SSSDDEAAAAAPTLSSSGNPPTSQPRPIPRSAGYGTFLAASVNLPFQSNALAGAMAAGFH  259

Query  1078  GRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANA  1257
              R LL G+  EHS+FGQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN 
Sbjct  260   SRTLLNGNNMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALVANV  319

Query  1258  TYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNS  1407
             TYV SI+VRTT W+ IK N+PWLLDA VCV LDLFIILQYIYYRY RK S
Sbjct  320   TYVLSIVVRTTEWESIKANMPWLLDAIVCVLLDLFIILQYIYYRYFRKKS  369



>ref|XP_009764843.1| PREDICTED: lysosomal amino acid transporter 1 homolog isoform 
X2 [Nicotiana sylvestris]
Length=325

 Score =   457 bits (1176),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/371 (63%), Positives = 271/371 (73%), Gaps = 50/371 (13%)
 Frame = +1

Query  166   MEASMSL-AQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIP  342
             M+A MSL  QNS  YCV EKKPC+ WV +YFKDCLCN+SD+FSF  GL SL CW VAEIP
Sbjct  1     MKALMSLRQQNSIAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLSCWAVAEIP  60

Query  343   QIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLS  522
             QI+TNFRTKSSHGVSLLFLL W+ GDIFNL GCLLEPATLPTQLYTA+            
Sbjct  61    QIITNFRTKSSHGVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAV------------  108

Query  523   T*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGD  702
                                          LYT TT++LVLQS+YYD+ YR WK ++D  D
Sbjct  109   -----------------------------LYTTTTIILVLQSLYYDYFYRCWKQRDD--D  137

Query  703   SNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL-  879
             S Q VEE KKPLR  K   SGIPIP G    A + + ++Y+TSARS+AGSATPPFRSNL 
Sbjct  138   SGQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASR-RMDFYFTSARSLAGSATPPFRSNLR  196

Query  880   -VKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
              + SGPSA+G++++ SSD++TV+AP   S+SQPKPIPRSAGYGAFL TS  +PHQTKAL+
Sbjct  197   PIASGPSAVGLNHNYSSDEDTVDAPLNISVSQPKPIPRSAGYGAFLATSSGMPHQTKALI  256

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
                   GGRKLLQ  GTEHS+ GQ LGWMMAA+YMGGR+PQIWLNIKRG+VEGLNPLMF+
Sbjct  257   ---VGFGGRKLLQEHGTEHSALGQVLGWMMAAVYMGGRLPQIWLNIKRGNVEGLNPLMFV  313

Query  1237  FALLANATYVG  1269
             FAL+AN TYVG
Sbjct  314   FALIANVTYVG  324



>ref|XP_009621507.1| PREDICTED: probable vacuolar amino acid transporter YPQ2 isoform 
X2 [Nicotiana tomentosiformis]
Length=325

 Score =   454 bits (1169),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 230/371 (62%), Positives = 270/371 (73%), Gaps = 50/371 (13%)
 Frame = +1

Query  166   MEASMSLAQ-NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIP  342
             M+A MSL Q N   YCV EKKPC+ WV +YFKDCLCN+SD+FSF  GL SL CW VAE+P
Sbjct  1     MKAIMSLRQKNLIAYCVKEKKPCIGWVNRYFKDCLCNLSDEFSFAFGLVSLFCWAVAEVP  60

Query  343   QIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLS  522
             QI+TNFRTKSSHGVSLLFLL W+ GDIFNL GCLLEPATLPTQLYTA+            
Sbjct  61    QIITNFRTKSSHGVSLLFLLGWVGGDIFNLAGCLLEPATLPTQLYTAV------------  108

Query  523   T*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGD  702
                                          LYT TT++LVLQS+YYD+ YR WK ++D  D
Sbjct  109   -----------------------------LYTTTTIILVLQSLYYDYFYRCWKHRDD--D  137

Query  703   SNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL-  879
             S Q VEE KKPLR  K   SGIPIP G    A + + ++Y+TSARS+AGSATPPFRSNL 
Sbjct  138   SGQEVEEVKKPLRPQKPTDSGIPIPKGIGVSASR-RMDFYFTSARSLAGSATPPFRSNLR  196

Query  880   -VKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
              + SGPSA+G++++ SSD++TV+AP   S+SQPKPIPRSAGYGAFL TS  +PHQTKAL+
Sbjct  197   PIASGPSAVGLNHNYSSDEDTVDAPQNISVSQPKPIPRSAGYGAFLATSSGLPHQTKALI  256

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
                   GGRKLLQ  GTEHS+ GQ LGWMMAA+YMGGR+PQIWLNIKRG+VEGLNPLMF+
Sbjct  257   ---VGFGGRKLLQEHGTEHSAVGQVLGWMMAAVYMGGRLPQIWLNIKRGNVEGLNPLMFV  313

Query  1237  FALLANATYVG  1269
             FAL+AN +YVG
Sbjct  314   FALIANVSYVG  324



>ref|XP_010029842.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X3 [Eucalyptus grandis]
Length=361

 Score =   455 bits (1170),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 276/399 (69%), Gaps = 49/399 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSG-TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LQ  G  EHS FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+AN TYV
Sbjct  263   LQQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANVTYV  322

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIY  1383
             GSILVRT  W+ I+ N+PWLLDA VCV LDLFIILQYIY
Sbjct  323   GSILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIY  361



>ref|XP_002866989.1| hypothetical protein ARALYDRAFT_490949 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43248.1| hypothetical protein ARALYDRAFT_490949 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   452 bits (1163),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/421 (57%), Positives = 282/421 (67%), Gaps = 60/421 (14%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCN++DD SF LG+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCLKEKKTCVRWVERYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++Y+  +         +  +E K+PL+ 
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYKLCRHGRTKICPKEEEDEEKRPLKP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP R++   + KSGPSAL +DN
Sbjct  145   PKTMGSAISIPGGSYKDSPRR--EFYYTSARSLAGSGTPPLRTSYFRVAKSGPSALAIDN  202

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
               SS+++  EA S             AG+G FL  S S+P Q K+L   Y     R+LL 
Sbjct  203   GSSSEED--EAMSTCP----------AGFGTFLAASASLPLQAKSLAENYWHASSRRLLN  250

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANATYVGSI
Sbjct  251   ERRVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANATYVGSI  310

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA--DYS*MS  1449
             LVRTT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S   +E+    DY   S
Sbjct  311   LVRTTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRMQSLERKEEDVYGDYVEAS  370

Query  1450  K  1452
             K
Sbjct  371   K  371



>dbj|BAH56966.1| AT4G36850 [Arabidopsis thaliana]
Length=376

 Score =   451 bits (1159),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 228/395 (58%), Positives = 272/395 (69%), Gaps = 51/395 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE YF DCLCN++DD SF LG+ SL+CWGVAEIPQ++TNFRTKSS+GV
Sbjct  6     YCLKEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKSSNGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++Y+  + +           E K+PL+ 
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYKLCRHRRTKICQKDEEGEEKRPLKP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP R++   + KSGPSAL +DN
Sbjct  145   PKTMGSAISIPGGSYKDSSRR--EFYYTSARSLAGSGTPPLRTSYFRVAKSGPSALAIDN  202

Query  916   DCSSDDE-----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGG  1080
             D SS DE     T    +  +I++P+PIPR AG+G FL  S S+P QTK+L   YA    
Sbjct  203   DGSSSDEDETMSTCPVITAKTITKPRPIPRQAGFGTFLAASASLPLQTKSLAEKYAHASS  262

Query  1081  RKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
             R+LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANAT
Sbjct  263   RRLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANAT  322

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFI  1365
             YVGSILVRTT WD IKPNLPWLLDA VCV LDLF+
Sbjct  323   YVGSILVRTTEWDNIKPNLPWLLDAIVCVVLDLFV  357



>ref|XP_007156890.1| hypothetical protein PHAVU_002G025900g [Phaseolus vulgaris]
 gb|ESW28884.1| hypothetical protein PHAVU_002G025900g [Phaseolus vulgaris]
Length=383

 Score =   449 bits (1155),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 234/415 (56%), Positives = 274/415 (66%), Gaps = 52/415 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WV+ YF+DCLC++ D+ SF LG  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKETKPCVGWVQHYFQDCLCDLKDEISFALGFTSLICWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDIFNLVGC++EPATLPTQ YTAL                          
Sbjct  65    SLAFLLTWVAGDIFNLVGCVMEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLVLQ++YYD++Y+W K      + ++  EE KKPLR 
Sbjct  99    ---------------LYTITTIVLVLQTLYYDYIYKWGKHHRKT-NMDEAQEEEKKPLRP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
                  SGI IP+    P    + EYYY SARS+A + TPPF + L   KS PSA+ M+ND
Sbjct  143   KPGPQSGIAIPN--DEPKATPRREYYYRSARSLAAN-TPPFGTYLRAAKSVPSAMEMNND  199

Query  919   CSSDDETVEAPSMNSISQPKPIPRS--AGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
              SSDDE  +  S   ++QP+PIPRS  A YG FL  S+++  Q  AL   Y    GRKLL
Sbjct  200   SSSDDEPPQLSSTKPVTQPRPIPRSVPASYGTFLAASMNLLRQGNALKEGYIRFNGRKLL  259

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
                   HS+ GQWLGW MA IYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+ANATYVGS
Sbjct  260   VQEQNMHSALGQWLGWFMAVIYMGGRLPQIWLNIKRGSVEGLNPLMFLFALIANATYVGS  319

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             ILVRTT W+ I+ N+PWLLDA  CV LDLFIILQY  YRY RK    +R D  DY
Sbjct  320   ILVRTTEWESIRANMPWLLDAVGCVALDLFIILQYANYRYIRKK---ARSDDGDY  371



>ref|XP_009379175.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Pyrus x bretschneideri]
Length=364

 Score =   445 bits (1145),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 239/410 (58%), Positives = 275/410 (67%), Gaps = 60/410 (15%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCVAE KPCV WV+KYFKDCLCN+SDD SF LGL SL+CWGVAEIPQI+TNF TKSSHGV
Sbjct  5     YCVAENKPCVRWVQKYFKDCLCNLSDDISFALGLISLVCWGVAEIPQIITNFHTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TW+AGD+FNL+GC LEPATLPTQ                               
Sbjct  65    SLAFLCTWVAGDVFNLLGCFLEPATLPTQ-------------------------------  93

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA +V       YYD++Y WWK +          EE  KPL  
Sbjct  94    ---------------LYTALSV-------YYDYIYAWWKCQNFKARQKD-EEENIKPLN-  129

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
              K    GIPIP  +  P    + E+YYTSARSMAGS TPPFR+ +   +SGPSA+ MD+D
Sbjct  130   PKLADLGIPIPTAS--PKATPKREFYYTSARSMAGSGTPPFRTYMRAARSGPSAMIMDSD  187

Query  919   CSSDDETVEAPS-MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SS+DE+    S  NS++QP+PIPRS GYG FL TS ++P QTK L  VY  + GRKLLQ
Sbjct  188   SSSEDESALVTSNKNSVTQPRPIPRSVGYGTFLATSFNLPSQTKGLAQVYLGVTGRKLLQ  247

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                 EHS+ GQWLGW+MA IYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYVGSI
Sbjct  248   EHSVEHSALGQWLGWLMAGIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANVTYVGSI  307

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRED  1425
             LVRTT WD IK N+ WLLDAAVCV LDLFIILQYIYY++ RK +    ED
Sbjct  308   LVRTTEWDNIKANMSWLLDAAVCVVLDLFIILQYIYYKHWRKGTTRGEED  357



>emb|CAB16817.1| putative protein [Arabidopsis thaliana]
 emb|CAB80351.1| putative protein [Arabidopsis thaliana]
Length=374

 Score =   442 bits (1138),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 274/418 (66%), Gaps = 55/418 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE YF DCLCN++DD SF LG+ SL+CWGVAEIPQ++TNFRTKSS+GV
Sbjct  6     YCLKEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKSSNGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLSFLLAWVAGDIFNLVGCLLEPATLPTQFYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++Y+  + +          +E K+PL+ 
Sbjct  100   ---------------LYTVSTVVLVIQTIYYDYIYKLCRHRRTKICQKDEEDEEKRPLKP  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCS  924
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP R++  +   S L +     
Sbjct  145   PKTMGSAISIPGGSYKDSSRR--EFYYTSARSLAGSGTPPLRTSYFRVAKSGLRLWQS--  200

Query  925   SDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSG  1104
                 T+       + Q     R AG+G FL  S S+P Q K+L   YA    R+LL    
Sbjct  201   ----TMMVRHRTKMRQC----RRAGFGTFLAASASLPLQAKSLAEKYAHASSRRLLNERI  252

Query  1105  TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR  1284
              EHS+ GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+ANATYVGSILVR
Sbjct  253   VEHSALGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANATYVGSILVR  312

Query  1285  TTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA--DYS*MSK  1452
             TT WD IKPNLPWLLDA VCV LDLFIILQYIYY+YCR  S  SRE+ A  DY   SK
Sbjct  313   TTEWDNIKPNLPWLLDAIVCVVLDLFIILQYIYYKYCRIKSLESREEDAYGDYVEASK  370



>ref|XP_004148435.1| PREDICTED: uncharacterized membrane protein YOL092W-like [Cucumis 
sativus]
 gb|KGN62067.1| hypothetical protein Csa_2G295430 [Cucumis sativus]
Length=381

 Score =   435 bits (1119),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 238/425 (56%), Positives = 284/425 (67%), Gaps = 55/425 (13%)
 Frame = +1

Query  199   GPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSH  378
             G YCV E+K CV WVE YFKDCLCN+ DD SF  GL SL+CWG+AEIPQIVTNFRTKSSH
Sbjct  3     GWYCVKEQKRCVGWVETYFKDCLCNLRDDMSFGFGLVSLLCWGLAEIPQIVTNFRTKSSH  62

Query  379   GVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLR  558
             GVSLLFLLTW+AGD+FNLVGCLLEPATLPTQLYTAL                        
Sbjct  63    GVSLLFLLTWVAGDVFNLVGCLLEPATLPTQLYTAL------------------------  98

Query  559   DNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPL  738
                              LYT  T+VLVLQS+YYD++ +   D++   D     EE K PL
Sbjct  99    -----------------LYTVNTIVLVLQSVYYDYVTKCCIDRKAKSDHTG--EEEKTPL  139

Query  739   RRNKSGG-SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALG-  906
             + NK  G  GIPIP  + +P  +   E+YYTSARS+AGS TPPFR+   L KSGPSALG 
Sbjct  140   KGNKGVGYVGIPIPKASPKPTPRR--EFYYTSARSLAGSDTPPFRAFLRLPKSGPSALGN  197

Query  907   MDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
               +    + +T    S ++++QP+PIPRS GYG FL  S ++P QTK     ++   GRK
Sbjct  198   DSSSSDDESDTAAVFSHSAVTQPRPIPRSVGYGTFLAASANLPFQTKGFSDGFS---GRK  254

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LLQ   + HS FGQ LGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+ANATYV
Sbjct  255   LLQ-EHSSHSGFGQLLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANATYV  313

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIIL--QYIYYRYCRKNSGGSREDSADYS  1440
              SI+VR+T W+ IK N+PWLLDA VCV LDLFIIL   Y      ++ SGG R++  DY 
Sbjct  314   ASIVVRSTEWESIKANMPWLLDAVVCVLLDLFIILQYIYYRRFRRQRQSGGGRDEFKDYE  373

Query  1441  *MSKQ  1455
               +K 
Sbjct  374   EATKH  378



>ref|XP_004164469.1| PREDICTED: uncharacterized membrane protein YOL092W-like [Cucumis 
sativus]
Length=381

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 238/425 (56%), Positives = 283/425 (67%), Gaps = 55/425 (13%)
 Frame = +1

Query  199   GPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSH  378
             G YCV E+K CV WVE YFKDCLCN+ DD SF  GL SL+CWG+AEIPQIVTNFRTKSSH
Sbjct  3     GWYCVKEQKRCVGWVETYFKDCLCNLRDDMSFGFGLVSLLCWGLAEIPQIVTNFRTKSSH  62

Query  379   GVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLR  558
             GVSLLFLLTW+AGD+FNLVGCLLEPATLPTQLYTAL                        
Sbjct  63    GVSLLFLLTWVAGDVFNLVGCLLEPATLPTQLYTAL------------------------  98

Query  559   DNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPL  738
                              LYT  T+VLVLQS+YYD++ +   D++   D     EE K PL
Sbjct  99    -----------------LYTVNTIVLVLQSVYYDYVTKCCIDRKAKSDHTG--EEEKTPL  139

Query  739   RRNKSGG-SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALG-  906
             + NK  G  GIPIP    +P  +   E+YYTSARS+AGS TPPFR+   L KSGPSALG 
Sbjct  140   KGNKGVGYVGIPIPKATPKPTPRR--EFYYTSARSLAGSDTPPFRAFLRLPKSGPSALGN  197

Query  907   MDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
               +    + +T    S ++++QP+PIPRS GYG FL  S ++P QTK     ++   GRK
Sbjct  198   DSSSSDDESDTAAVFSHSAVTQPRPIPRSVGYGTFLAASANLPFQTKGFSDGFS---GRK  254

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
             LLQ   + HS FGQ LGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+ANATYV
Sbjct  255   LLQ-EHSSHSGFGQLLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALIANATYV  313

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIIL--QYIYYRYCRKNSGGSREDSADYS  1440
              SI+VR+T W+ IK N+PWLLDA VCV LDLFIIL   Y      ++ SGG R++  DY 
Sbjct  314   ASIVVRSTEWESIKANMPWLLDAVVCVLLDLFIILQYIYYRRFRRQRQSGGGRDEFKDYE  373

Query  1441  *MSKQ  1455
               +K 
Sbjct  374   EATKH  378



>ref|XP_006590674.1| PREDICTED: probable vacuolar amino acid transporter YPQ2-like 
[Glycine max]
Length=381

 Score =   432 bits (1111),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 236/418 (56%), Positives = 270/418 (65%), Gaps = 50/418 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WVEKY  DCLCN+ D+ SF  G  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  7     YCVKESKPCVGWVEKYLGDCLCNLKDEISFGFGFISLICWGVAEIPQIITNFRAKSSHGV  66

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDIFNLVGC LEPATLPTQ YTAL                          
Sbjct  67    SLAFLLTWVAGDIFNLVGCHLEPATLPTQYYTAL--------------------------  100

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLR-  741
                            LYT TT+VLVLQS YYD++Y+W K            EE KKPLR 
Sbjct  101   ---------------LYTITTIVLVLQSFYYDYIYKWGKRHGKINTDEAYKEEEKKPLRP  145

Query  742   RNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDN  915
             +     SGIPI +    P    + +YYY SARS+A + TPPF + L   KS PSA+ M++
Sbjct  146   KPGRDHSGIPIQNDG--PKETPRRDYYYRSARSLAANDTPPFGTYLRAAKSVPSAIVMND  203

Query  916   DCSSDD-ETVEAPSMNSISQPKPIPRS--AGYGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D SSDD E     S   ++QP+PIPRS  A YG FL  S++ P Q  ALM  Y    GRK
Sbjct  204   DSSSDDDEAHPLSSKKPVTQPRPIPRSVPATYGTFLVASMNFPRQGNALMEGYNRFNGRK  263

Query  1087  LL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             LL Q   + H++ GQWLGW+MA IYMGGR+PQIWLNIKRG VEGLNPLMF+FAL+ANATY
Sbjct  264   LLLQEHNSMHTALGQWLGWLMAVIYMGGRLPQIWLNIKRGGVEGLNPLMFVFALIANATY  323

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             VGSILVRTT W+ I+ N+PWLLDA VCV LDLFIILQY  YRY  K +G    D  DY
Sbjct  324   VGSILVRTTEWESIRANMPWLLDAIVCVALDLFIILQYANYRYLGKKTGSDDADYGDY  381



>ref|XP_003547999.1| PREDICTED: uncharacterized protein LOC100787660 [Glycine max]
 gb|KHN44508.1| Putative membrane protein [Glycine soja]
Length=379

 Score =   428 bits (1100),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 224/414 (54%), Positives = 273/414 (66%), Gaps = 50/414 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E+KPCV WVEKYFKDCLCN+ D+ SF  GL SL+ WGVAEIPQI+T FRTK SHGV
Sbjct  5     YCVKERKPCVRWVEKYFKDCLCNLKDEISFSFGLTSLVFWGVAEIPQIITIFRTKKSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL+FLLTW+AGDI NL GC+LEPATLPTQ YTAL                          
Sbjct  65    SLVFLLTWVAGDICNLTGCILEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VL+L  +YYD++ RW+K ++         EE K     
Sbjct  99    ---------------LYTITTIVLLLLIVYYDYISRWYKHRQKVNLKRDHEEEKKPLKPP  143

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
               +  SGIPIP+G  + A +   E+YY SARS+AGS TPP+ + +   KSGP+A+   ND
Sbjct  144   KPTSKSGIPIPNGTPKAAPRQ--EHYYMSARSLAGSGTPPWGTYMGAAKSGPAAMESIND  201

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG--YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
              SSD+E   A S NS +Q  PIPRS    YG FL  ++++P +  AL   Y   GGRKLL
Sbjct  202   SSSDNEAPPASSNNSATQAMPIPRSVAGSYGTFLAAAVNLPLRGNALREGYIGFGGRKLL  261

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
             Q   T HS+FGQWLGW+MAAIY+ GR+PQIWLNIKRGSVEGLNP MF+FAL+AN TYVGS
Sbjct  262   QEYET-HSTFGQWLGWLMAAIYISGRVPQIWLNIKRGSVEGLNPFMFVFALVANVTYVGS  320

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             ILVRTT W++IK N+PWLLDA +CV LD FII QYIYYR  ++    +R+D  +
Sbjct  321   ILVRTTEWERIKANMPWLLDAVICVALDFFIISQYIYYRCFQRRE--ARDDHKE  372



>gb|EYU44309.1| hypothetical protein MIMGU_mgv1a009599mg [Erythranthe guttata]
Length=337

 Score =   426 bits (1094),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 221/364 (61%), Positives = 256/364 (70%), Gaps = 47/364 (13%)
 Frame = +1

Query  187   AQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRT  366
             A NS  YC  E+K C+ W +KYFKDCLCN  D+ SF  GL SL+CWGVAEIPQIVTNFRT
Sbjct  6     AGNSLSYCAKERKACINWADKYFKDCLCNTRDELSFGFGLISLVCWGVAEIPQIVTNFRT  65

Query  367   KSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVIC  546
             KS HG+SL FLLTWIAGDIFNLVGCLLEPATLPTQLYTA+                    
Sbjct  66    KSGHGISLAFLLTWIAGDIFNLVGCLLEPATLPTQLYTAV--------------------  105

Query  547   ESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEA  726
                                  LYT +TVVLV+QS+YYD+    W++      SNQ VE+ 
Sbjct  106   ---------------------LYTTSTVVLVIQSIYYDYFRNKWRNIHHK-HSNQEVEDM  143

Query  727   KKPLRRNKSG-GSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPS  897
             K+PL R ++   S I IP+GA R     +A YYYTSARSMAGS TPP RS L  VKSGPS
Sbjct  144   KRPLMRPQNPIDSAIAIPNGAQRATSTREA-YYYTSARSMAGSTTPPMRSYLWPVKSGPS  202

Query  898   ALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALG  1077
             A+G+DN+ SSDDE+   P  NSIS+PKPIP+S GYGAFL TS+++P +++AL+ VY  L 
Sbjct  203   AIGLDNNSSSDDESNPIPPRNSISRPKPIPKSVGYGAFLATSMNMPRESRALVQVYVGLT  262

Query  1078  GRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANA  1257
             GRKLLQ  G+E S +GQWLGWMMAAIYMGGR+PQIWLNIKRG VEGLNPLMFIFALLANA
Sbjct  263   GRKLLQEHGSE-SVYGQWLGWMMAAIYMGGRLPQIWLNIKRGGVEGLNPLMFIFALLANA  321

Query  1258  TYVG  1269
             TYV 
Sbjct  322   TYVA  325



>ref|XP_004512003.1| PREDICTED: seven transmembrane protein 1-like [Cicer arietinum]
Length=382

 Score =   427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 229/415 (55%), Positives = 267/415 (64%), Gaps = 50/415 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WV KYF DCLCN  DD SF  G  SLICWGVAEIPQI TNFR KSSHGV
Sbjct  5     YCVKENKPCVGWVLKYFSDCLCNSKDDISFFFGFISLICWGVAEIPQIFTNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             S+LFLLTW+AGDIFNL+GCLLEPATLPTQ YTAL                          
Sbjct  65    SILFLLTWVAGDIFNLIGCLLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLVLQS YYD++Y+    ++   +  + +EE KKPL+ 
Sbjct  99    ---------------LYTITTIVLVLQSFYYDYIYKCCNRRQKI-NIEEALEEEKKPLKP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              ++  SGIPI    +R     +AEYYY SARS+AG+ TPP   +   + KSGPSA+ ++ 
Sbjct  143   KQASESGIPIRSAKNRVI--PRAEYYYGSARSLAGNVTPPSSRSYMRVAKSGPSAMRLNQ  200

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
             D SS  +    P  +S  QP+ IPRS G YG FL  SL++P Q  AL      L G KLL
Sbjct  201   DDSSSSDDEAHPPPSS--QPRQIPRSTGSYGTFLAASLNLPMQGNALKLGILTLSGTKLL  258

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
                   HS  GQWLGW+MAAIY GGRIPQIWLNIKRGSVEGLNP MFIFAL+AN+ YVGS
Sbjct  259   SQEQVTHSVLGQWLGWLMAAIYTGGRIPQIWLNIKRGSVEGLNPFMFIFALIANSAYVGS  318

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             I+VRTT W+ IK N+PWLLDA VCV LDLFII QYI YRY +K +     D  +Y
Sbjct  319   IVVRTTEWESIKANMPWLLDAIVCVALDLFIISQYINYRYRQKTTASENGDYEEY  373



>ref|XP_007047041.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 5 [Theobroma cacao]
 gb|EOX91198.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 5 [Theobroma cacao]
Length=331

 Score =   424 bits (1091),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/421 (53%), Positives = 261/421 (62%), Gaps = 95/421 (23%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  99    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  138

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDN  915
             L+  K+  SGIPIP                                   K  P A     
Sbjct  139   LKPGKAD-SGIPIP-----------------------------------KPSPKA-----  157

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
                        P   S +QP+PIPR+A  YG FL  S+++P  +KA M        R+LL
Sbjct  158   ----------NPRGESGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRRLL  207

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
             Q    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VEGLNPLMFIFAL+ANATYV S
Sbjct  208   QEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIFALIANATYVAS  267

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*MSK  1452
             ILVRTT W+ IK N+PWLLDAAVCV LDLFIILQY+YY+Y RK      ED  DY   SK
Sbjct  268   ILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKYFRKTDNSDGEDYGDYMEASK  327

Query  1453  Q  1455
             +
Sbjct  328   E  328



>ref|XP_007156011.1| hypothetical protein PHAVU_003G251100g [Phaseolus vulgaris]
 gb|ESW28005.1| hypothetical protein PHAVU_003G251100g [Phaseolus vulgaris]
Length=380

 Score =   423 bits (1088),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 229/419 (55%), Positives = 275/419 (66%), Gaps = 54/419 (13%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             +G YCV E+K CV WVEKYFKDCLCN+ D+ SF LGL SL+ WGVAEIPQI+T FRTK S
Sbjct  2     AGSYCVEERKACVRWVEKYFKDCLCNMKDEISFSLGLISLVFWGVAEIPQIITIFRTKKS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGDI NL GCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDICNLTGCLLEPATLPTQYYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT TT+VL+L  +YYD++  W+K ++         EE K+ 
Sbjct  99    ------------------LYTITTIVLLLLIIYYDYISNWYKLRQKVNHKRDEEEERKQL  140

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGM  909
                  +  SGIPIP+G  +   +   EY+Y SARS+AGS TPP+ + +   KSGPSA+  
Sbjct  141   KPPKPTYESGIPIPNGTLKAVPRQ--EYFYMSARSLAGSGTPPWGTYMRAAKSGPSAMES  198

Query  910   DNDCSS-DDETVEAPSMNSISQPKPIPRSA--GYGAFLTTSLSIPHQTKALMPVYAALGG  1080
              +D SS DDET  A S N  ++ +PIPR A   YG FL  ++++P +  AL   Y   GG
Sbjct  199   IHDSSSEDDETYPAFSKNPPTKARPIPRPAVGSYGTFLAAAVNLPLKANALREGYIRFGG  258

Query  1081  RKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
             RKLLQ   T HS+FGQ LGW+MAAIY+ GRIPQIWLNIKRGSVEGL+P MFIFAL+AN T
Sbjct  259   RKLLQEYET-HSTFGQGLGWLMAAIYISGRIPQIWLNIKRGSVEGLSPFMFIFALVANVT  317

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             YVGSILVRTT ++ IK N+PWLLDA +CV LDLFIILQYIYYRY  +     RE+  DY
Sbjct  318   YVGSILVRTTEFESIKANMPWLLDAVLCVALDLFIILQYIYYRYLPR-----REERGDY  371



>ref|XP_010099350.1| hypothetical protein L484_009167 [Morus notabilis]
 gb|EXB77871.1| hypothetical protein L484_009167 [Morus notabilis]
Length=408

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 222/406 (55%), Positives = 277/406 (68%), Gaps = 46/406 (11%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E K CV WVEKYF+DCLCN+ D+FSF  GL SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  5     YCVEENKACVGWVEKYFQDCLCNLKDEFSFAFGLISLVCWGVAEIPQIITNFRTKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPAT+   ++                    V+ +  RD 
Sbjct  65    SLAFLLTWVAGDVFNLVGCLLEPATVSIAIF--------------------VVQKMTRDY  104

Query  565   IF----YHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKK  732
              F      YY  L      LYT +TVVLVLQS+YYD +YRW K ++     +   E+ +K
Sbjct  105   WFALLPTQYYTAL------LYTTSTVVLVLQSIYYDHIYRWCKRRKTTTKQST-EEDQRK  157

Query  733   PLRRNK-SGGSGIPIPDGASRPAR-QHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSA  900
             PL  +K +  SGIPIP  +++ +    + E+YYTSARS+AGS TPPFR+ L   +SGPSA
Sbjct  158   PLNNSKPADESGIPIPRPSTKASSGTPRREFYYTSARSLAGSGTPPFRTYLRAARSGPSA  217

Query  901   LGMDNDCSSDDE-TVEAPSMNSISQPKPIPRSAGY-GAFLTTSLSIPHQTKALMPVYAAL  1074
             + +++D SSDDE TV   S  S +QP+PIP+SAGY G FL  S+++P ++ +L  VY  +
Sbjct  218   MAIESDSSSDDEATVPLRSNKSTTQPRPIPKSAGYYGTFLAASVNLPLKSNSLTQVYMGV  277

Query  1075  GGRKLL--QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALL  1248
               RKLL  Q  G  H+ +GQWLGWMMAAIYMGGR+PQIWLN       GLNPLMFIFAL+
Sbjct  278   AARKLLLQQSGGENHTVYGQWLGWMMAAIYMGGRLPQIWLN-------GLNPLMFIFALI  330

Query  1249  ANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYY  1386
             AN TYVGSILVR+T W++ K N+PWLLDA VCV LD F    Y+ +
Sbjct  331   ANVTYVGSILVRSTEWERTKANMPWLLDAVVCVALDSFAECGYVRF  376



>ref|XP_010680925.1| PREDICTED: uncharacterized protein LOC104895967 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score =   417 bits (1071),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 229/421 (54%), Positives = 273/421 (65%), Gaps = 59/421 (14%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
             QN   YC  EKKPC  W  KYFKDCLCN+ D FSF  G+ SL+ WGVAE+PQI+TNFRTK
Sbjct  11    QNKVSYCWREKKPCAWWANKYFKDCLCNLRDHFSFAFGIVSLLAWGVAEVPQIITNFRTK  70

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             SSHGVSLLFLL W  GDIFNLVGCLLEPATLPTQLYTA                      
Sbjct  71    SSHGVSLLFLLGWFFGDIFNLVGCLLEPATLPTQLYTAF---------------------  109

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAK  729
                                 LYT +T+VLVLQS+YYD+ Y+W K + +    ++ VEE K
Sbjct  110   --------------------LYTTSTIVLVLQSVYYDYFYQWLKCRHNG--VHEEVEEEK  147

Query  730   KPLRRNKSGGSGIPIPDGASR-PARQHQAEYYYTSARSMAGSATPPFRSNLV---KSGPS  897
             KPL    +  +GIPIP    R P R+     YYTSARS+AGS TPPFRS L    +SGPS
Sbjct  148   KPLNPKPTDQTGIPIPSAPVRAPIRR-----YYTSARSLAGSGTPPFRSYLTTGPRSGPS  202

Query  898   ALGMDNDCSSDDET---VEAPSMN-SISQPKPIPRSAGYGAFLT-TSLSIPHQTKALMPV  1062
             AL      SSDDE    +  P+   + S P+ IPR A  GA +   S+++P    AL+  
Sbjct  203   ALVRGYHSSSDDEETNPIPIPAKRGTASLPRQIPRPAARGAMVAAVSVNLPIGGNALLEA  262

Query  1063  YAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             Y    GR++L   G+EHS+ GQWLGW+MAAIYMGGRIPQI  NIKRGSVEGLNPLMFIFA
Sbjct  263   YKGFTGRRMLSEHGSEHSAVGQWLGWLMAAIYMGGRIPQIIWNIKRGSVEGLNPLMFIFA  322

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             L+AN  YVGSI+VR T   +IK N+PWLLDA VCV LDLFII+QY+YY++ RK +  +RE
Sbjct  323   LIANVAYVGSIVVRRTELAEIKANMPWLLDAVVCVVLDLFIIMQYVYYKHMRKRN--TRE  380

Query  1423  D  1425
             +
Sbjct  381   E  381



>gb|KCW56810.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=367

 Score =   412 bits (1059),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 262/417 (63%), Gaps = 68/417 (16%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
             LQ  G EHS FGQWLGW+MAAIYMGGRIPQIWLN+  G                      
Sbjct  263   LQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNVLYGYC--------------------  302

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS  1440
             SILVRT  W+ I+ N+PWLLDA VCV LDLFIILQYIYYRY R++    +E    Y 
Sbjct  303   SILVRTVEWESIEANMPWLLDAIVCVALDLFIILQYIYYRYFRRSENSDKEGLGHYE  359



>gb|AET03980.2| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=374

 Score =   410 bits (1055),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 225/415 (54%), Positives = 268/415 (65%), Gaps = 55/415 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E K CV WVE YFKDCLCN+ DD SF LGL SL+ WGVAEIPQI+T FR KSSHG+
Sbjct  5     YCVKENKECVKWVETYFKDCLCNLRDDISFSLGLMSLVSWGVAEIPQIITIFRNKSSHGI  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDI NLVGCLLEPATLPTQ YTAL                          
Sbjct  65    SLAFLLTWVAGDICNLVGCLLEPATLPTQFYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LY +TT++L+LQ +YYD + RW K +++   S    EE K+PL  
Sbjct  99    ---------------LYASTTIILLLQIVYYDHILRWCKHRQNV-KSKLDNEEEKRPLNP  142

Query  745   NKSGG-SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDN  915
               S   SGI IP+G  + A +   EYYY SARS+AGSATPP  ++L   KSGPSAL   +
Sbjct  143   KPSQVYSGIAIPNGTQKEAAR--GEYYYMSARSLAGSATPPSFTHLRAAKSGPSALEFIH  200

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAG--YGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D S DDE  +  S  S ++P  IPRS    YG FL T++++P +  ++   Y    G KL
Sbjct  201   DSSDDDEASQVTSNISTTKPWSIPRSVDGRYGTFLATAINLPLKGNSMRYGYIGFTGIKL  260

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
             L+ +   HS++GQ+LGW+MAAIY   RIPQIWLNIKRGSVEGLNP MF+FAL+AN +YVG
Sbjct  261   LKENEV-HSTYGQYLGWIMAAIYTCSRIPQIWLNIKRGSVEGLNPFMFVFALIANTSYVG  319

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             SILVRTT ++ IK NLPWLLDA VCV LD FII QYIYYRY R     S E S D
Sbjct  320   SILVRTTEFESIKANLPWLLDATVCVALDFFIISQYIYYRYFR-----SSESSDD  369



>ref|XP_010254969.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Nelumbo nucifera]
Length=380

 Score =   409 bits (1052),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 220/411 (54%), Positives = 267/411 (65%), Gaps = 49/411 (12%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YC  +KKPCV WVE YFKDCLCN+SD+ SF  G FSLICWGVAEIPQI+TNF TKS 
Sbjct  6     SHAYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSG  65

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
              GVSL FLLTW+ GD+FNLVGCLLEPATLPTQ YTA+                       
Sbjct  66    QGVSLAFLLTWVVGDVFNLVGCLLEPATLPTQFYTAV-----------------------  102

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT TTVVLVLQ +YYD +  WWK K     S  +V+E  KP
Sbjct  103   ------------------LYTVTTVVLVLQCLYYDRICLWWKSK--GKQSYVMVDEETKP  142

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGM  909
             L  +K   + +PIP    + A   + + YYTSARS+A S+TP   S L   +SGPSA+  
Sbjct  143   LN-SKLLDTSVPIPSSGPQEASPSR-DLYYTSARSLASSSTPTLGSYLGISRSGPSAVEE  200

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              +D SS+DE        S SQPK  P S GYGAFL  S ++P ++ ALM  Y A  GR+L
Sbjct  201   QSD-SSEDEAFPVYDKKSSSQPKRTPPSVGYGAFLGASANLPFRSMALMEGYLASTGRRL  259

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
              + +   ++ +G  LGW+MAAIYMGGR+PQI+LNI+RGSVEGLNPLMFIFAL+AN TYVG
Sbjct  260   HE-TEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLNPLMFIFALIANVTYVG  318

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             SILVR+T W +IK N+PWL DA VCV LDLFII+QY+YY+  +K    S++
Sbjct  319   SILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQKRRASSQQ  369



>ref|XP_010254970.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Nelumbo nucifera]
Length=378

 Score =   407 bits (1046),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 219/411 (53%), Positives = 265/411 (64%), Gaps = 51/411 (12%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YC  +KKPCV WVE YFKDCLCN+SD+ SF  G FSLICWGVAEIPQI+TNF TKS 
Sbjct  6     SHAYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSG  65

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
              GVSL FLLTW+ GD+FNLVGCLLEPATLPTQ YTA+                       
Sbjct  66    QGVSLAFLLTWVVGDVFNLVGCLLEPATLPTQFYTAV-----------------------  102

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT TTVVLVLQ +YYD +  WWK K         V+E  KP
Sbjct  103   ------------------LYTVTTVVLVLQCLYYDRICLWWKSK----GKQSYVDEETKP  140

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGM  909
             L  +K   + +PIP    + A   + + YYTSARS+A S+TP   S L   +SGPSA+  
Sbjct  141   LN-SKLLDTSVPIPSSGPQEASPSR-DLYYTSARSLASSSTPTLGSYLGISRSGPSAVEE  198

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              +D SS+DE        S SQPK  P S GYGAFL  S ++P ++ ALM  Y A  GR+L
Sbjct  199   QSD-SSEDEAFPVYDKKSSSQPKRTPPSVGYGAFLGASANLPFRSMALMEGYLASTGRRL  257

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
              + +   ++ +G  LGW+MAAIYMGGR+PQI+LNI+RGSVEGLNPLMFIFAL+AN TYVG
Sbjct  258   HE-TEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLNPLMFIFALIANVTYVG  316

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             SILVR+T W +IK N+PWL DA VCV LDLFII+QY+YY+  +K    S++
Sbjct  317   SILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQKRRASSQQ  367



>ref|XP_007047045.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 9 [Theobroma cacao]
 gb|EOX91202.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 9 [Theobroma cacao]
Length=322

 Score =   405 bits (1040),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 217/421 (52%), Positives = 253/421 (60%), Gaps = 104/421 (25%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPAT                                
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPAT--------------------------------  89

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  90    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  129

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDN  915
             L+  K+  SGIPIP                                   K  P A     
Sbjct  130   LKPGKAD-SGIPIP-----------------------------------KPSPKA-----  148

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
                        P   S +QP+PIPR+A  YG FL  S+++P  +KA M        R+LL
Sbjct  149   ----------NPRGESGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRRLL  198

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
             Q    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VEGLNPLMFIFAL+ANATYV S
Sbjct  199   QEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEGLNPLMFIFALIANATYVAS  258

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS*MSK  1452
             ILVRTT W+ IK N+PWLLDAAVCV LDLFIILQY+YY+Y RK      ED  DY   SK
Sbjct  259   ILVRTTEWESIKANMPWLLDAAVCVALDLFIILQYVYYKYFRKTDNSDGEDYGDYMEASK  318

Query  1453  Q  1455
             +
Sbjct  319   E  319



>ref|NP_001240922.1| uncharacterized protein LOC100789634 [Glycine max]
 gb|ACU24122.1| unknown [Glycine max]
Length=379

 Score =   397 bits (1020),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 218/394 (55%), Positives = 260/394 (66%), Gaps = 48/394 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E+KPCV WVEKYFKDCLCN+ D+ SF  GL SL+ WGVAEIPQI+T FRTK SHGV
Sbjct  5     YCVNERKPCVRWVEKYFKDCLCNLKDEISFSFGLTSLVFWGVAEIPQIITIFRTKKSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL+FLLTW+AGDI NL GC+LEPATLPTQ YTAL                          
Sbjct  65    SLVFLLTWVAGDICNLTGCILEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VL+L  +YYD++ RW+K ++         EE K     
Sbjct  99    ---------------LYTITTIVLLLLIVYYDYISRWYKHRQKVNLVRDHEEEKKPLKPP  143

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
               +  SGIPIP+G+ + A +   EYYY SARS+AGS TPP+   +   KSGPSA+   +D
Sbjct  144   KPTNKSGIPIPNGSPKAAPRQ--EYYYMSARSLAGSGTPPWGIYMRAAKSGPSAIESIDD  201

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG--YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
              SSDDE   A S NS SQ  PIPRS    YG FL  ++++P +  AL   Y   GGRKLL
Sbjct  202   SSSDDEAPPASSNNSASQAMPIPRSVAGSYGTFLAAAVNLPLKGNALRQGYIGYGGRKLL  261

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
             Q    +HS+FGQWLGW+MAAIY+ GR+PQIWLNIKR SVEGLNP MF+FAL+AN TYVGS
Sbjct  262   Q-EYEKHSTFGQWLGWLMAAIYISGRVPQIWLNIKRSSVEGLNPFMFVFALVANVTYVGS  320

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQ  1374
             ILVRTT W+ IK N+PWLLDA +CV LD+FII Q
Sbjct  321   ILVRTTEWESIKANMPWLLDAVICVALDIFIISQ  354



>ref|XP_003629504.1| Membrane protein, putative [Medicago truncatula]
Length=372

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 215/403 (53%), Positives = 260/403 (65%), Gaps = 52/403 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E K CV WVE YFKDCLCN+ DD SF LGL SL+ WGVAEIPQI+T FR KSSHG+
Sbjct  5     YCVKENKECVKWVETYFKDCLCNLRDDISFSLGLMSLVSWGVAEIPQIITIFRNKSSHGI  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDI NLVGCLLEPAT                           + ES  + 
Sbjct  65    SLAFLLTWVAGDICNLVGCLLEPAT---------------------------VSESEPN-  96

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LY +TT++L+LQ +YYD + RW K +++   S    EE K+PL  
Sbjct  97    ---------------LYASTTIILLLQIVYYDHILRWCKHRQNV-KSKLDNEEEKRPLNP  140

Query  745   NKSGG-SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDN  915
               S   SGI IP+G  + A +   EYYY SARS+AGSATPP  ++L   KSGPSAL   +
Sbjct  141   KPSQVYSGIAIPNGTQKEAAR--GEYYYMSARSLAGSATPPSFTHLRAAKSGPSALEFIH  198

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAG--YGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D S DDE  +  S  S ++P  IPRS    YG FL T++++P +  ++   Y    G KL
Sbjct  199   DSSDDDEASQVTSNISTTKPWSIPRSVDGRYGTFLATAINLPLKGNSMRYGYIGFTGIKL  258

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
             L+ +   HS++GQ+LGW+MAAIY   RIPQIWLNIKRGSVEGLNP MF+FAL+AN +YVG
Sbjct  259   LKENEV-HSTYGQYLGWIMAAIYTCSRIPQIWLNIKRGSVEGLNPFMFVFALIANTSYVG  317

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
             SILVRTT ++ IK NLPWLLDA VCV LD FII QYIYYRY R
Sbjct  318   SILVRTTEFESIKANLPWLLDATVCVALDFFIISQYIYYRYFR  360



>gb|KHN00567.1| Putative membrane protein [Glycine soja]
Length=357

 Score =   393 bits (1009),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 258/391 (66%), Gaps = 48/391 (12%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E+KPCV WVEKYFKDCLCN+ D+ SF  GL SL+ WGVAEIPQI+T FRTK SHGV
Sbjct  5     YCVNERKPCVRWVEKYFKDCLCNLKDEISFSFGLTSLVFWGVAEIPQIITIFRTKKSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL+FLLTW+AGDI NL GC+LEPATLPTQ YTAL                          
Sbjct  65    SLVFLLTWVAGDICNLTGCILEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VL+L  +YYD++ RW+K ++         EE K     
Sbjct  99    ---------------LYTITTIVLLLLIVYYDYISRWYKHRQKVNLVRDHEEEKKPLKPP  143

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDND  918
               +  SGIPIP+G+ + A +   EYYY SARS+AGS TPP+   +   KSGPSA+   +D
Sbjct  144   KPTNKSGIPIPNGSPKAAPRQ--EYYYMSARSLAGSGTPPWGIYMRAAKSGPSAIESIDD  201

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG--YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
              SSDDE   A S NS SQ  PIPRS    YG FL  ++++P +  AL   Y   GGRKLL
Sbjct  202   SSSDDEAPPASSNNSASQAMPIPRSVAGSYGTFLAAAVNLPLKGNALRQGYIGYGGRKLL  261

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
             Q    +HS+FGQWLGW+MAAIY+ GR+PQIWLNIKR SVEGLNP MF+FAL+AN TYVGS
Sbjct  262   Q-EYEKHSTFGQWLGWLMAAIYISGRVPQIWLNIKRSSVEGLNPFMFVFALVANVTYVGS  320

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFI  1365
             ILVRTT W+ IK N+PWLLDA +CV LD+F+
Sbjct  321   ILVRTTEWESIKANMPWLLDAVICVALDIFV  351



>gb|EPS64909.1| hypothetical protein M569_09870, partial [Genlisea aurea]
Length=361

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 275/413 (67%), Gaps = 67/413 (16%)
 Frame = +1

Query  196   SGPYCVAEKKPCVV-WVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             S  YCV E KPC++ WV+ YFKDCLCN  D+ SF LG+ SL+ WGVAEIPQI++NF+ +S
Sbjct  2     SSSYCVREMKPCIIGWVDTYFKDCLCNGRDEASFGLGILSLLLWGVAEIPQILSNFKAES  61

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             SHG+SL FL+ W+ GD+FNL+GC+LEPATLPTQLYTA+                      
Sbjct  62    SHGISLAFLIAWVLGDVFNLLGCILEPATLPTQLYTAV----------------------  99

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKK  732
                                LYT TT +LV+QS+YYD+  + +  +E    S Q VEE K+
Sbjct  100   -------------------LYTTTTSILVMQSLYYDYFRKLFPIREQE--SQQEVEELKR  138

Query  733   PLRRNK-SGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSAL  903
             PL+ +K +  S I IP          +  YYY SARSMAGS TPPFRS L  V+SGPS +
Sbjct  139   PLKSHKPAADSAIEIP---------RKEAYYYASARSMAGSFTPPFRSYLWPVRSGPSTV  189

Query  904   GMDNDCSSDD-------ETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPV  1062
             G+ ND SSDD         VE PS  + S+PKPIPRSA  GAF+ +S+S+P +TKALM  
Sbjct  190   GLRNDSSSDDDDDGGDDRAVEIPSRATASRPKPIPRSAAMGAFVGSSMSMPGKTKALM--  247

Query  1063  YAA-LGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIF  1239
             YA     RKLLQ  G+  S  GQWLGWMMA IYMGGR+PQI+LNIKRG+VEGLNPLMFIF
Sbjct  248   YAVGFTTRKLLQEHGSS-SVTGQWLGWMMAVIYMGGRLPQIYLNIKRGNVEGLNPLMFIF  306

Query  1240  ALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
             A+ AN+TYV SI+VRT  W+KIK NLPWLLDA VCV LDL II QY+YY++ R
Sbjct  307   AVSANSTYVASIVVRTIDWEKIKANLPWLLDAVVCVLLDLSIITQYVYYKHIR  359



>ref|XP_008790228.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Phoenix 
dactylifera]
 ref|XP_008790229.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Phoenix 
dactylifera]
Length=393

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 212/419 (51%), Positives = 261/419 (62%), Gaps = 54/419 (13%)
 Frame = +1

Query  208   CVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVS  387
             C  EKK CV W+EKYFKDC+C++S + SF LGL SLICWG+AEIPQIVTNF+TKS HGVS
Sbjct  10    CAEEKKACVGWIEKYFKDCVCSLSGEISFGLGLISLICWGIAEIPQIVTNFQTKSCHGVS  69

Query  388   LLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNI  567
             L  +LTW+ GDIFNL GCLLEP TLPTQ YTAL                           
Sbjct  70    LGLILTWVIGDIFNLAGCLLEPVTLPTQFYTAL---------------------------  102

Query  568   FYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRN  747
                           LYTATTVVL+LQ++YYD+  RWWK K     S   VEE +KPL   
Sbjct  103   --------------LYTATTVVLLLQTLYYDYWLRWWKSKVVE--SIVEVEEERKPLNPK  146

Query  748   KSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLV---KSGPSALGMDND  918
                 S  PIP  AS  A   + + YY SARS+A S TPP+ S+ +   +SGPS   + +D
Sbjct  147   LDDDSSRPIPTTASDRA-SPRIDLYYRSARSLASSGTPPYGSSYLGTARSGPSGSAL-HD  204

Query  919   CSSDDETVEAPSMNSISQPKP---IPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              SS+DE   A         KP   + RS GYGA +  S   P Q++A+M  Y  L GR++
Sbjct  205   SSSEDEASPAHDSRHRVAAKPKQIVSRSVGYGAIIIGSTGFPFQSRAMMEKYMGLAGRRM  264

Query  1090  LQGSGT---EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
             LQ       + S +G  LGW+MAA+YMGGR+PQI+LNIKRGSVEGLNPLMF+FAL+ANAT
Sbjct  265   LQEERVKTLDGSPYGLLLGWIMAAVYMGGRLPQIYLNIKRGSVEGLNPLMFMFALIANAT  324

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             YVGSILVR+  W++IK N PWLLDA +CV LDLFI++Q+ YY+   +      +   DY
Sbjct  325   YVGSILVRSVEWERIKANAPWLLDAIICVLLDLFIMIQFTYYKCMHRRESHEEDGCGDY  383



>emb|CDP07574.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   385 bits (988),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 211/415 (51%), Positives = 262/415 (63%), Gaps = 52/415 (13%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC   +KPCV WVEKYFKDCLCN+ D+ SF  G+ SL+CW VAEIPQI+TNF++KS+ GV
Sbjct  8     YCSVGQKPCVRWVEKYFKDCLCNLKDEISFAFGIASLVCWAVAEIPQIITNFKSKSADGV  67

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL F+ TWI GD+FNLVGC+LEPATLPTQ YTA+                          
Sbjct  68    SLAFISTWIVGDVFNLVGCILEPATLPTQFYTAV--------------------------  101

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LY ATT+VL LQ +YYD + R WK ++   + +     A K    
Sbjct  102   ---------------LYAATTLVLALQCIYYDHIIRLWKGRKTKVNKDYNERSALKQNLH  146

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLV-KSGPSALGMDNDC  921
             ++S       P    RP  +   ++++ SARS+AGS TPP +S +  KSGP AL   ++ 
Sbjct  147   DRSSRDRRNAPIEVPRPRWR---DFHFRSARSLAGSDTPPIQSYIKPKSGPPALEHQSES  203

Query  922   SSDDETVEAPSM--NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
             SS+DE    P      +SQP+ IP   GYG FL  S  IP  +KA    +    GR+LL+
Sbjct  204   SSEDEEAIPPEFYQRPVSQPRLIPGPVGYGTFLAVSAYIPRGSKASQLYFV---GRRLLE  260

Query  1096  GSGTEH-SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
                  H  ++GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL+ANA YVGS
Sbjct  261   EKYELHGRAYGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFLFALIANAAYVGS  320

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYC-RKNSGGSREDSAD  1434
             ILVR++ W+KI+PN+PWLLDA VCV LDLFIILQYI+YR+  RK S  S E   D
Sbjct  321   ILVRSSEWEKIQPNMPWLLDAVVCVALDLFIILQYIFYRFIKRKKSQRSEEHYED  375



>gb|KHN42018.1| Putative membrane protein [Glycine soja]
Length=359

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 252/418 (60%), Gaps = 70/418 (17%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WVEKY  DCLCN+ D+ SF  G  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKESKPCVGWVEKYLGDCLCNLKDEISFGFGFISLICWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGDIFNLVGC LEPAT                                   
Sbjct  65    SLAFLLTWVAGDIFNLVGCHLEPAT-----------------------------------  89

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLR-  741
                            LYT TT+VLVLQS YYD++Y+W K            EE KKPLR 
Sbjct  90    ---------------LYTITTIVLVLQSFYYDYIYKWGKRHGKINTDEAYKEEEKKPLRP  134

Query  742   RNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDN  915
             +     SGIPI +    P    + +YYY SARS+A + TPPF + L   KS PSA+ M++
Sbjct  135   KAGRDHSGIPIQNDG--PKETPRRDYYYRSARSLAANDTPPFGTYLRAAKSVPSAIVMND  192

Query  916   DCSSDD-ETVEAPSMNSISQPKPIPRS--AGYGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D SSDD E     S   ++QP+PIPRS  A YG FL  S++ P Q  ALM  Y    GRK
Sbjct  193   DSSSDDDEAHPLSSKKPVTQPRPIPRSVPATYGTFLVASMNFPRQGNALMEGYNRFNGRK  252

Query  1087  LL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
             LL Q   + H++ GQWLGW+MA IYMGGR+PQIWLN       GLNPLMF+FAL+ANATY
Sbjct  253   LLLQEHNSMHTALGQWLGWLMAVIYMGGRLPQIWLN-------GLNPLMFVFALIANATY  305

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             VGSILVRTT W+ I+ N+PWLLDA VCV LDLF    Y  YRY  K +G    D  DY
Sbjct  306   VGSILVRTTEWESIRANMPWLLDAIVCVALDLF----YANYRYLGKKTGSDDADYGDY  359



>ref|XP_010254971.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X3 [Nelumbo nucifera]
Length=368

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 209/411 (51%), Positives = 255/411 (62%), Gaps = 61/411 (15%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YC  +KKPCV WVE YFKDCLCN+SD+ SF  G FSLICWGVAEIPQI+TNF TKS 
Sbjct  6     SHAYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSG  65

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
              GVSL FLLTW+ GD+FNLVGCLLEPATLPTQ                            
Sbjct  66    QGVSLAFLLTWVVGDVFNLVGCLLEPATLPTQF---------------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                                YTA         +YYD +  WWK K     S  +V+E  KP
Sbjct  99    -------------------YTAVC-------LYYDRICLWWKSK--GKQSYVMVDEETKP  130

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGM  909
             L  +K   + +PIP    + A   + + YYTSARS+A S+TP   S L   +SGPSA+  
Sbjct  131   LN-SKLLDTSVPIPSSGPQEASPSR-DLYYTSARSLASSSTPTLGSYLGISRSGPSAVEE  188

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              +D SS+DE        S SQPK  P S GYGAFL  S ++P ++ ALM  Y A  GR+L
Sbjct  189   QSD-SSEDEAFPVYDKKSSSQPKRTPPSVGYGAFLGASANLPFRSMALMEGYLASTGRRL  247

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
              + +   ++ +G  LGW+MAAIYMGGR+PQI+LNI+RGSVEGLNPLMFIFAL+AN TYVG
Sbjct  248   HE-TEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLNPLMFIFALIANVTYVG  306

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             SILVR+T W +IK N+PWL DA VCV LDLFII+QY+YY+  +K    S++
Sbjct  307   SILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQKRRASSQQ  357



>ref|XP_007047039.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 3 [Theobroma cacao]
 gb|EOX91196.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 3 [Theobroma cacao]
Length=307

 Score =   376 bits (966),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 232/344 (67%), Gaps = 49/344 (14%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  99    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  138

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  139   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  195

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  196   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  255

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGL  1218
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VE L
Sbjct  256   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEAL  299



>ref|XP_011083744.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Sesamum 
indicum]
Length=381

 Score =   379 bits (973),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 254/405 (63%), Gaps = 57/405 (14%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  E+KPC+ W+E+ FKDCLCN++D  SF LG+ SL+CW VAEIPQI+TNF +KS+ GV
Sbjct  9     YCRVERKPCMRWIEEVFKDCLCNLNDQISFALGIASLVCWSVAEIPQIITNFTSKSATGV  68

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TWI GD+FNLVGC+LEPATLPTQ YTAL                          
Sbjct  69    SLAFLSTWIIGDVFNLVGCILEPATLPTQFYTAL--------------------------  102

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT  T++L LQ +YY+   +WWK  +   +   +V+E  +PL+R
Sbjct  103   ---------------LYTTVTIILALQCVYYNHFRQWWKRSQKEAN---MVKEETEPLQR  144

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL-VKSGPSALGMDNDC  921
                 G           P R+   ++Y+ SARS+AGS TPP +  +  +SGP AL   +  
Sbjct  145   KLHHGGTASTNAPIEVPRRR---DFYFMSARSLAGSDTPPTQCYIKARSGPPALDHHSHS  201

Query  922   SSDDETVEA------PSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
             SSD++          PS  + +QP+ IPR   YG F+  + ++P  ++AL     AL  +
Sbjct  202   SSDEDDDNESIFPPPPSNKTATQPRQIPRQVKYGTFVAATANLPRLSEALR---RALVAQ  258

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
              LLQ      +++GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL+ANATY
Sbjct  259   PLLQEHEFSENAYGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFALVANATY  318

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
              GSILVR   W  IK N+PWLLDA VCVGLDLFIILQYI+Y+Y +
Sbjct  319   TGSILVRNAEWRMIKANMPWLLDAIVCVGLDLFIILQYIFYKYVK  363



>ref|XP_010254972.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X4 [Nelumbo nucifera]
Length=366

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/411 (51%), Positives = 253/411 (62%), Gaps = 63/411 (15%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YC  +KKPCV WVE YFKDCLCN+SD+ SF  G FSLICWGVAEIPQI+TNF TKS 
Sbjct  6     SHAYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSG  65

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
              GVSL FLLTW+ GD+FNLVGCLLEPATLPTQ                            
Sbjct  66    QGVSLAFLLTWVVGDVFNLVGCLLEPATLPTQF---------------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                                YTA         +YYD +  WWK K         V+E  KP
Sbjct  99    -------------------YTAVC-------LYYDRICLWWKSK----GKQSYVDEETKP  128

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGM  909
             L  +K   + +PIP    + A   + + YYTSARS+A S+TP   S L   +SGPSA+  
Sbjct  129   LN-SKLLDTSVPIPSSGPQEASPSR-DLYYTSARSLASSSTPTLGSYLGISRSGPSAVEE  186

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              +D SS+DE        S SQPK  P S GYGAFL  S ++P ++ ALM  Y A  GR+L
Sbjct  187   QSD-SSEDEAFPVYDKKSSSQPKRTPPSVGYGAFLGASANLPFRSMALMEGYLASTGRRL  245

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
              + +   ++ +G  LGW+MAAIYMGGR+PQI+LNI+RGSVEGLNPLMFIFAL+AN TYVG
Sbjct  246   HE-TEVANNVYGLLLGWLMAAIYMGGRLPQIFLNIRRGSVEGLNPLMFIFALIANVTYVG  304

Query  1270  SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             SILVR+T W +IK N+PWL DA VCV LDLFII+QY+YY+  +K    S++
Sbjct  305   SILVRSTEWTRIKANMPWLFDAIVCVALDLFIIVQYMYYKSGQKRRASSQQ  355



>ref|XP_007047043.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 7 [Theobroma cacao]
 gb|EOX91200.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 7 [Theobroma cacao]
Length=303

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 231/342 (68%), Gaps = 49/342 (14%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  99    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  138

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  139   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  195

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  196   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  255

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VE
Sbjct  256   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  297



>ref|XP_007047038.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 2 [Theobroma cacao]
 gb|EOX91195.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 2 [Theobroma cacao]
Length=306

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 231/342 (68%), Gaps = 49/342 (14%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  99    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  138

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  139   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  195

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  196   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  255

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VE
Sbjct  256   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  297



>ref|XP_010936127.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Elaeis 
guineensis]
 ref|XP_010936129.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Elaeis 
guineensis]
Length=393

 Score =   377 bits (969),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 209/420 (50%), Positives = 262/420 (62%), Gaps = 54/420 (13%)
 Frame = +1

Query  208   CVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVS  387
             C   KK CV W+EKYFKDC+C++S + SF LGL SLICWG+AEIPQI+TNF+TKS HGVS
Sbjct  10    CAEAKKACVGWIEKYFKDCVCSLSGEVSFGLGLISLICWGIAEIPQIITNFQTKSGHGVS  69

Query  388   LLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNI  567
             L  +LTW+ GDIFNLVGCLLEP TLPTQ YTAL                           
Sbjct  70    LGLILTWVIGDIFNLVGCLLEPVTLPTQFYTAL---------------------------  102

Query  568   FYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRN  747
                           LYTATTVVL+LQ++YYD+  RW K K+    S   VEE +KPL   
Sbjct  103   --------------LYTATTVVLLLQTLYYDYWLRWRKSKDVE--STVEVEEERKPLNPT  146

Query  748   KSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLV---KSGPSALGMDND  918
                    PIP  AS  A   + + YY SARS+A S TPP+ S+ +   +SGPS   + +D
Sbjct  147   LDDDPSRPIPTTASVLA-SPRIDLYYMSARSLASSGTPPYGSSYLGTARSGPSGSPL-HD  204

Query  919   CSSDDETVEAPSMNSISQPKP---IPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              SS+DE          +  KP   + RS GYG  +  S  +P Q++A+M  + +L GR++
Sbjct  205   SSSEDEASPTQDQRHRAAAKPKRMVSRSIGYGTVILGSTGLPFQSRAMMEKHFSLAGRRI  264

Query  1090  LQGSGTEH---SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
             LQ    +    SS+G  LGW+MAAIYMGGR+PQI+LNIKRGSVEGLNPLMF+FAL+ANAT
Sbjct  265   LQEERMKTFDGSSYGLLLGWIMAAIYMGGRLPQIYLNIKRGSVEGLNPLMFMFALIANAT  324

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS  1440
             YVGSILVR+  W++I+ N PWLLDA VCV LDLFI+ Q+ YY+Y  +      E    Y+
Sbjct  325   YVGSILVRSVEWERIRANAPWLLDAIVCVLLDLFIVTQFTYYKYMHRRESREEEGCGGYT  384



>ref|XP_009396455.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Musa 
acuminata subsp. malaccensis]
Length=395

 Score =   375 bits (963),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 208/438 (47%), Positives = 264/438 (60%), Gaps = 63/438 (14%)
 Frame = +1

Query  166   MEASMSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQ  345
             ME S++ A      C  E+K CV W+++YF DC+C+ S   SF LG+ SL+CWG+AEIPQ
Sbjct  1     MEKSLAWAS-----CGEEEKACVGWIKRYFNDCVCSPSGVLSFGLGMISLLCWGIAEIPQ  55

Query  346   IVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST  525
             I+TNF +KS HGVS  FLLTW+ GDIFNLVGCLLEP TLPTQLYTAL             
Sbjct  56    IITNFHSKSGHGVSFAFLLTWVIGDIFNLVGCLLEPVTLPTQLYTAL-------------  102

Query  526   *AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDS  705
                                         LYTATTVVLVLQ++YYD+  RWWK +    ++
Sbjct  103   ----------------------------LYTATTVVLVLQTLYYDYWVRWWKKR--GLEA  132

Query  706   NQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLV-  882
                VEE        K+     P+P   +      + + YYTSARS+A S TPP RS+ + 
Sbjct  133   PLEVEEGSCKRLNPKNEDLSRPLPTLTASRRTSSRVDVYYTSARSLASSGTPPCRSSYLG  192

Query  883   ----KSGPSALGMDNDCSSDDETVEAPSMNS----ISQPKPI-PRSAGYGAFLTTSLSIP  1035
                 +SGPSA G      SD+E   +P   S    +S PK +  RS  YG F   + S+P
Sbjct  193   VVPARSGPSASGYMESSGSDEEG--SPRHQSRSSGVSNPKKVVSRSVSYGTFAAGAASLP  250

Query  1036  HQTKALMPVYAALGGRKLLQGSGT---EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGS  1206
              QTKALM V   L   + +Q  G    E +++G  LGW+MAAIY GGR+PQI+LNIKRGS
Sbjct  251   FQTKALMEVQTGLAVGRTVQEGGIRSLEGNTYGLLLGWIMAAIYTGGRLPQIYLNIKRGS  310

Query  1207  VEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYY  1386
             VEGLNPLMF+FAL+ANATYVGSIL R+  W++IK N PWLLDA VCV LDLFII+Q++YY
Sbjct  311   VEGLNPLMFLFALIANATYVGSILSRSVEWERIKANAPWLLDAIVCVLLDLFIIIQFVYY  370

Query  1387  RYCRKNSGGSREDSADYS  1440
             +   K    + +D   ++
Sbjct  371   KLVHKRMANNEDDYEGFT  388



>ref|XP_010030885.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Eucalyptus 
grandis]
Length=350

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 210/420 (50%), Positives = 244/420 (58%), Gaps = 84/420 (20%)
 Frame = +1

Query  193   NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             +S  Y   EKK CV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKS
Sbjct  2     SSITYRAREKKRCVRWVEKYFKDCLCNAKDEVSFGFGMISLVCWGVAEIPQIITNFRTKS  61

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             SHGVSL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                      
Sbjct  62    SHGVSLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL----------------------  99

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKK  732
                                LYTA+TVVLVLQS+ YD +Y  WK +       Q   E K 
Sbjct  100   -------------------LYTASTVVLVLQSLDYDHVYSLWKGRHIKKPDPQ--AEEKG  138

Query  733   PLRRNKSGGSGIPIPDGASR--PARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALG  906
              L+   +  SGIPIP  A++  P +    E+ +TSARS+AGS                  
Sbjct  139   SLKPKATHQSGIPIPGAAAKATPVKASSKEFNFTSARSLAGS------------------  180

Query  907   MDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
                D SS DE    PS  S+S+P PI R   +  FLT +       K+    +  L  RK
Sbjct  181   ---DSSSGDEAARVPSAKSVSRPNPIARLVAF--FLTLN-------KSFTEAHVVLSTRK  228

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLN--------IKRGSVEGLNPLMFIFA  1242
             LL G   +H+  GQ LGW+MAA YMGGRI +I LN        IK+GSVEGLN LM IF 
Sbjct  229   LLHGR-MKHNVIGQRLGWLMAATYMGGRISKICLNLIVFVIAQIKQGSVEGLNLLMLIFE  287

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             L+AN TY GSILVRT  W+ IK N+PWLLDA VCV LDLFIILQYIYYRY RK+     E
Sbjct  288   LVANVTYAGSILVRTVEWESIKANMPWLLDAIVCVALDLFIILQYIYYRYFRKSENSDEE  347



>ref|XP_006380746.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
 gb|ERP58543.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
Length=299

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 236/343 (69%), Gaps = 54/343 (16%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSLA     YCV E+KPCV WVEKYFKDCLC++ D+FSF  GL SL+CWGVAEIPQI+TN
Sbjct  1     MSLA-----YCVKEQKPCVRWVEKYFKDCLCSLKDEFSFTFGLISLVCWGVAEIPQIITN  55

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             FRTKSSHGVSL FLLTW+AGDIFNLVGCLLEPATLPTQ YTA+                 
Sbjct  56    FRTKSSHGVSLAFLLTWVAGDIFNLVGCLLEPATLPTQYYTAV-----------------  98

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                     LYT +TVVLVLQ +YYD +YRW + ++     NQ V
Sbjct  99    ------------------------LYTTSTVVLVLQGLYYDHVYRWCRCRKT--KDNQQV  132

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSG  891
             ++ + PL+   +  SGI IP  + R   +   ++YY SARS+AGS TPPFRS L   KSG
Sbjct  133   DDDQDPLKPKSADRSGISIPKASPRATPRR--DFYYMSARSLAGSNTPPFRSYLRAAKSG  190

Query  892   PSALGMDNDCSSDDETVEAPSM-NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYA  1068
             PSA+G+DN+ SSDDE     S+ N++SQP+PIPRSAGYG FL TSL++P Q+KAL   Y 
Sbjct  191   PSAVGLDNESSSDDEAAAPVSVSNTVSQPRPIPRSAGYGTFLATSLNLPLQSKALTQAYI  250

Query  1069  ALGGRKLL-QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNI  1194
                GR+LL +G GT+HS+FGQWLGW+MAAIYMGGRIPQIWLN+
Sbjct  251   GYTGRRLLHEGGGTDHSAFGQWLGWLMAAIYMGGRIPQIWLNV  293



>ref|XP_009396615.1| PREDICTED: lysosomal amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=394

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 209/422 (50%), Positives = 260/422 (62%), Gaps = 58/422 (14%)
 Frame = +1

Query  208   CVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVS  387
             C  E++ CV W+E+YF DC+C++  + SF LG+ SL CWG+AE+PQI+TNF  K+ HG+S
Sbjct  10    CGEEERACVGWIERYFNDCVCSVRGELSFGLGMISLFCWGIAEVPQIITNFHNKTGHGIS  69

Query  388   LLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNI  567
             L FLLTW+ GDIFNLVGCLLEP TLPTQ YTAL                           
Sbjct  70    LAFLLTWVVGDIFNLVGCLLEPVTLPTQFYTAL---------------------------  102

Query  568   FYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV--EEAKKPLR  741
                           LYTA TVVLVLQ +YYD    W    E  G + QL   E++ KPL 
Sbjct  103   --------------LYTAVTVVLVLQILYYDC---WLSCCESRGFAAQLEVEEDSCKPLN  145

Query  742   RNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLV---KSGPSALGMD  912
              N  G S  P+P   + P    +A+  YTSARS+A S TPP+RS+ +   +SGPSA G  
Sbjct  146   PNSEGHSH-PLPTLTAPPTASPRADVCYTSARSLASSGTPPYRSSYLGPARSGPSASGYL  204

Query  913   NDCSSDDE-TVEAPSMNS-ISQP-KPIPRSAGYGAFLTTSLSIPHQTKALMPVY-AALGG  1080
                 SDDE +    S +S +S+P + + R  GYG F   S+++P QTKA M V       
Sbjct  205   ESSGSDDERSARHRSWHSGMSKPIRILSRPVGYGTFAAASVTLPFQTKASMEVNNIGFDS  264

Query  1081  RKLLQGSGT---EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLA  1251
             RK LQ  G    E + +G  LGW+MAAIYMGGR+PQI+ NIKRGSVEGLNPLMF+FAL A
Sbjct  265   RKNLQEGGIKSLEENPYGLLLGWVMAAIYMGGRLPQIYKNIKRGSVEGLNPLMFMFALAA  324

Query  1252  NATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA  1431
             NATYVGSILVR+  W++IK N PWLLDA VCV LDLFIILQ+ YY++  K    S ED  
Sbjct  325   NATYVGSILVRSIEWERIKANSPWLLDAIVCVLLDLFIILQFAYYKFMHKRM-TSNEDEH  383

Query  1432  DY  1437
             ++
Sbjct  384   EH  385



>gb|KCW56813.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=325

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 198/359 (55%), Positives = 233/359 (65%), Gaps = 50/359 (14%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE--GLNPLMFIFALLANAT  1260
             LQ  G EHS FGQWLGW+MAAIYMGGRIPQIWLNIKRGSVE    +P      LL N+T
Sbjct  263   LQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEVITFHPFSKFCFLLMNST  321



>ref|XP_007047044.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 8 [Theobroma cacao]
 gb|EOX91201.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 8 [Theobroma cacao]
Length=298

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 224/344 (65%), Gaps = 58/344 (17%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPAT                                
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPAT--------------------------------  89

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  90    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  129

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  130   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  186

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  187   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  246

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGL  1218
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VE L
Sbjct  247   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVEAL  290



>ref|XP_007047047.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 11 [Theobroma cacao]
 gb|EOX91204.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 11 [Theobroma cacao]
Length=294

 Score =   355 bits (911),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 183/342 (54%), Positives = 223/342 (65%), Gaps = 58/342 (17%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPAT                                
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPAT--------------------------------  89

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  90    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  129

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
             L+  K+  SGIPIP  +  P    + E+YYTSARS+AGS T PFR+   + KSGPSA+ +
Sbjct  130   LKPGKAD-SGIPIPKPS--PKANPRGEFYYTSARSLAGSGTSPFRTYMRVAKSGPSAMEL  186

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRK  1086
             D+D SS+DE        S +QP+PIPR+A  YG FL  S+++P  +KA M        R+
Sbjct  187   DSDSSSEDEAAPVSFKKSGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRR  246

Query  1087  LLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
             LLQ    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VE
Sbjct  247   LLQEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  288



>ref|XP_009419331.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Musa 
acuminata subsp. malaccensis]
Length=390

 Score =   357 bits (915),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 254/427 (59%), Gaps = 70/427 (16%)
 Frame = +1

Query  208   CVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVS  387
             C  ++K CV W+ KYF DC+CN+S + SF LG+ SL CWG+AEIPQ++TNF+TKS HGVS
Sbjct  10    CSEKQKACVGWINKYFDDCVCNLSGEISFGLGMISLFCWGMAEIPQLITNFQTKSGHGVS  69

Query  388   LLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNI  567
             L  LLTW+ GD+FNLVGCLLEP TLPTQ YTAL                           
Sbjct  70    LALLLTWVIGDVFNLVGCLLEPVTLPTQFYTAL---------------------------  102

Query  568   FYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWK--------DKEDAGDS-NQLVE  720
                           LYT+TTVVLVLQ++YYD+  RWWK        ++ED G   N  VE
Sbjct  103   --------------LYTSTTVVLVLQTLYYDYGLRWWKSICFDAPLEEEDNGQPLNPKVE  148

Query  721   EAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL---VKSG  891
             +  +P            IP  A   A + + + YYTSARS+A S TP         V+SG
Sbjct  149   DLSRP------------IPTTAVANASR-RTDVYYTSARSLASSGTPSCGGTSYLGVRSG  195

Query  892   PSALGMDNDCSSDDETVEAPSMNSISQPKP-IPRSAGYGAFLTTSLSIPHQTKALMPVYA  1068
             PS     +D SS+DE   A    + ++ K    RS  YG F+   + +P+QTKA   +  
Sbjct  196   PSEGLAFHDSSSEDEGSPAHHHGAAARKKTTFSRSVSYGTFVAGFIGLPYQTKAFREMTI  255

Query  1069  ALGGRKLLQGSGT---EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIF  1239
                 R+ LQ S     E + +G  LGW+MAAIYMGGR+PQI+LN+KRGSVEGLNPLMF+F
Sbjct  256   ISSERRTLQDSEVKSLEGNFYGLLLGWIMAAIYMGGRLPQIYLNMKRGSVEGLNPLMFMF  315

Query  1240  ALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSR  1419
             AL ANATYVGSILVR+  W+K+ PN PWLLDA VC+ LDL I+LQ+ YY++ R     + 
Sbjct  316   ALAANATYVGSILVRSVEWEKVGPNAPWLLDAIVCILLDLLIMLQFAYYKFLRGRDACTE  375

Query  1420  EDSADYS  1440
             ++   ++
Sbjct  376   DEHEGFT  382



>gb|AES94854.2| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=298

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 217/334 (65%), Gaps = 51/334 (15%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YCV E KPCV WV+ YF DCLCN++D+ SF  G  SLICWGVAEIPQI+TNFR KSSHGV
Sbjct  5     YCVKENKPCVGWVQNYFSDCLCNVNDNISFTFGFISLICWGVAEIPQIITNFRAKSSHGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             S++FLLTW+AGDIFNLVGCLLEPATLPTQ YTAL                          
Sbjct  65    SIVFLLTWVAGDIFNLVGCLLEPATLPTQYYTAL--------------------------  98

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT TT+VLV+QS YYD++Y+W K ++   +  +  EE KKPL+ 
Sbjct  99    ---------------LYTITTIVLVVQSFYYDYIYKWCKRRQKI-NIEETYEEEKKPLKP  142

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGMDND  918
              +    GIPI  G  R   +   EYYY SARS+AG+ TPP R+   + KSGPSA+G++ D
Sbjct  143   KERFELGIPIRSGRHRAIPK--PEYYYGSARSLAGNVTPPSRTYMRVAKSGPSAMGLNED  200

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ  1095
              SSDDE    P+    +QP+ IPRSAG YG FL  S+++PHQ+ AL   Y AL GRKLL 
Sbjct  201   SSSDDEAHSVPA----TQPRQIPRSAGSYGTFLAASINLPHQSNALKVGYIALSGRKLLS  256

Query  1096  GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIK  1197
                  HS+ GQWLGW+MAAIY GGRIPQIWLN++
Sbjct  257   QEHVTHSALGQWLGWLMAAIYTGGRIPQIWLNVR  290



>gb|KCW56814.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=303

 Score =   351 bits (900),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 220/335 (66%), Gaps = 48/335 (14%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNI  1194
             LQ  G EHS FGQWLGW+MAAIYMGGRIPQIWLN+
Sbjct  263   LQEGGIEHSVFGQWLGWLMAAIYMGGRIPQIWLNV  297



>ref|XP_010432126.1| PREDICTED: uncharacterized protein LOC104716448 isoform X2 [Camelina 
sativa]
Length=315

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 219/336 (65%), Gaps = 50/336 (15%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC+ EKK CV WVE+YF DCLCNI+DD SF LG+ SLICWGVAEIPQI+TNFRTKSSHGV
Sbjct  8     YCLKEKKACVRWVERYFDDCLCNINDDVSFALGIASLICWGVAEIPQIITNFRTKSSHGV  67

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLL W+AGDIFNLVGCLLEPATLPTQLYTAL                          
Sbjct  68    SLSFLLAWVAGDIFNLVGCLLEPATLPTQLYTAL--------------------------  101

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT +TVVLV+Q++YYD++YR  +            +E K+PL+ 
Sbjct  102   ---------------LYTVSTVVLVIQTIYYDYIYRLCRHGRTKICQTDEEDEEKRPLKP  146

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN---LVKSGPSALGMDN  915
              K+ GS I IP G+ + + +   E+YYTSARS+AGS TPP RS+   + KSGPSAL ++N
Sbjct  147   PKTTGSAISIPRGSYKDSPRR--EFYYTSARSLAGSGTPPSRSSYFRVAKSGPSALAIEN  204

Query  916   DCSSDDE----TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGR  1083
               SSD++    T    +  +I+QP+PIPR AG+G FL  S S+P Q K+L   YA    R
Sbjct  205   GSSSDEDETMSTCPVIATKTITQPRPIPRPAGFGTFLAASASLPLQAKSLAEKYAHASSR  264

Query  1084  KLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLN  1191
             +LL     EHS+ GQWLGW+MAAIYMGGRIPQIWLN
Sbjct  265   RLLNERIVEHSALGQWLGWLMAAIYMGGRIPQIWLN  300



>ref|XP_006856132.1| hypothetical protein AMTR_s00059p00157160 [Amborella trichopoda]
 gb|ERN17599.1| hypothetical protein AMTR_s00059p00157160 [Amborella trichopoda]
Length=371

 Score =   335 bits (860),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 192/412 (47%), Positives = 240/412 (58%), Gaps = 61/412 (15%)
 Frame = +1

Query  220   KKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFL  399
             +K CV WV KYF DCLCN  D  SF  GL SL+CWGVAE+PQIVTN  TK++ GVSL FL
Sbjct  14    QKECVSWVLKYFGDCLCNSRDSISFAFGLVSLVCWGVAEVPQIVTNCSTKATDGVSLAFL  73

Query  400   LTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHY  579
             LTW+ GD+FNLVGCLLEPATLPTQ YTAL                               
Sbjct  74    LTWVVGDVFNLVGCLLEPATLPTQFYTAL-------------------------------  102

Query  580   YFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGG  759
                       LYTATT+VLVLQ++YY++  +W K  +        VE    PL  +K   
Sbjct  103   ----------LYTATTIVLVLQTIYYEYFLKWLKHHKIEHHVPSEVE----PLN-SKGNP  147

Query  760   SGIPIPDGASR--PARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSA--LGMDNDCSS  927
                PIP   +R      H    Y  SARS+A + TPP   + ++   S   +      SS
Sbjct  148   PSTPIPMAGARMHDTTSHGMNLYIFSARSLAFTRTPPPHDSFLRVTKSVPPVAPSYSSSS  207

Query  928   DDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGT  1107
             +D+  E       S PK +  + GYG F+ + L++P +  A+ P+      R+LLQ  G 
Sbjct  208   EDDDHERAHAKPASAPKRMLNAVGYGTFIASGLTLPIKGDAV-PI-----PRRLLQEHGE  261

Query  1108  EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRT  1287
                 +G WLGWMMAAIYMGGR+PQI+LN+KRGSVEGLNPLMF+FAL+ANATYVG    R+
Sbjct  262   SRKVYGMWLGWMMAAIYMGGRLPQIYLNMKRGSVEGLNPLMFVFALIANATYVG----RS  317

Query  1288  TAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYC-RKNSGGSREDSADYS  1440
             T WD IK N+PWLLDA VCV LDLFII+Q++YY++  R+       D   YS
Sbjct  318   TEWDMIKANMPWLLDAIVCVALDLFIIMQFVYYKFTSRRRIHHEEGDFGAYS  369



>gb|EPS64486.1| hypothetical protein M569_10295, partial [Genlisea aurea]
Length=358

 Score =   335 bits (858),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 190/413 (46%), Positives = 236/413 (57%), Gaps = 63/413 (15%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  E+KPCV +VE+ F DCLCN+ D+ SF  GLF L+ W VAEIPQIVTNF  KS+ GV
Sbjct  5     YCSTERKPCVRFVERVFGDCLCNVRDEISFGFGLFGLVLWAVAEIPQIVTNFFNKSADGV  64

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FL TWI GD+FN+VGC+LEPATLPTQ YTA                           
Sbjct  65    SLAFLSTWIIGDVFNIVGCILEPATLPTQYYTA---------------------------  97

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYT  + VL LQ +YY+   +WW+     G +N  V+E + PLR 
Sbjct  98    --------------WLYTIVSSVLALQCVYYNHFVKWWRFSSTVGKNN--VDETE-PLRP  140

Query  745   NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLV-KSGPSALGMDNDC  921
                 G           P   H+ E+Y+ SARS+ GS TPP +  +  +SGP  L    D 
Sbjct  141   KFDLGVAHSKRALMDVP---HRREFYFMSARSLVGSNTPPKQYYVRPRSGPPTLEHLADS  197

Query  922   SSDDETVEAP---SMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
             S +++   +P   + NS S+P PIPR   YG     + ++P   +A+        G  L 
Sbjct  198   SEEEDDGISPRPVAGNSFSRPLPIPRPVKYGTLAAAAANLPRLGQAV-------SGETLE  250

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
             + S T     GQWLGW+MA  YMGGRIPQIWLN+KRGSVEGLNPLMF+ AL+AN TYV S
Sbjct  251   KRSVT-----GQWLGWLMAVTYMGGRIPQIWLNMKRGSVEGLNPLMFLLALMANVTYVLS  305

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA  1431
             ILVR   W+ I+ NLPWLLDA VCV LDLFII+Q I+Y Y +       ED A
Sbjct  306   ILVRNCKWEVIQNNLPWLLDAVVCVLLDLFIIIQCIFYNYVKGKRRDEEEDVA  358



>ref|XP_006380748.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
 gb|ERP58545.1| hypothetical protein POPTR_0007s12260g [Populus trichocarpa]
Length=297

 Score =   332 bits (852),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 171/266 (64%), Positives = 206/266 (77%), Gaps = 8/266 (3%)
 Frame = +1

Query  607   QLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGA  786
             QLYT +TVVLVLQ +YYD +YRW + ++     NQ V++ + PL+   +  SGI IP  +
Sbjct  11    QLYTTSTVVLVLQGLYYDHVYRWCRCRKT--KDNQQVDDDQDPLKPKSADRSGISIPKAS  68

Query  787   SRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDNDCSSDDETVEAPSM-  957
              R   +   ++YY SARS+AGS TPPFRS L   KSGPSA+G+DN+ SSDDE     S+ 
Sbjct  69    PRATPRR--DFYYMSARSLAGSNTPPFRSYLRAAKSGPSAVGLDNESSSDDEAAAPVSVS  126

Query  958   NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL-QGSGTEHSSFGQWL  1134
             N++SQP+PIPRSAGYG FL TSL++P Q+KAL   Y    GR+LL +G GT+HS+FGQWL
Sbjct  127   NTVSQPRPIPRSAGYGTFLATSLNLPLQSKALTQAYIGYTGRRLLHEGGGTDHSAFGQWL  186

Query  1135  GWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPN  1314
             GW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMF+FAL+AN TYV SI+ RTT WD IKPN
Sbjct  187   GWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFVFALVANLTYVLSIVARTTEWDSIKPN  246

Query  1315  LPWLLDAAVCVGLDLFIILQYIYYRY  1392
             +PWLLDAAVCV LD FIILQYIYYRY
Sbjct  247   MPWLLDAAVCVALDFFIILQYIYYRY  272



>gb|KCW56812.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=311

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 205/285 (72%), Gaps = 7/285 (2%)
 Frame = +1

Query  598   IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIP  777
             ++ QLYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+   +   GI IP
Sbjct  20    VLEQLYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKPKATHQMGIAIP  77

Query  778   DGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGMDNDCSSDDETV  942
               A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +D+D SSDDE  
Sbjct  78    GAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHLDSDSSSDDEAA  137

Query  943   EAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSF  1122
               PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKLLQ  G EHS F
Sbjct  138   RVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKLLQEGGIEHSVF  197

Query  1123  GQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDK  1302
             GQWLGW+MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFAL+AN TYVGSILVRT  W+ 
Sbjct  198   GQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALVANVTYVGSILVRTVEWES  257

Query  1303  IKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADY  1437
             I+ N+PWLLDA VCV LDLFIILQYIYYRY R++    +E    Y
Sbjct  258   IEANMPWLLDAIVCVALDLFIILQYIYYRYFRRSENSDKEGLGHY  302



>gb|KCW56809.1| hypothetical protein EUGRSUZ_I02478 [Eucalyptus grandis]
Length=284

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 206/322 (64%), Gaps = 48/322 (15%)
 Frame = +1

Query  205   YCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGV  384
             YC  EKKPCV WVEKYFKDCLCN  D+ SF  G+ SL+CWGVAEIPQI+TNFRTKSSHGV
Sbjct  6     YCAREKKPCVRWVEKYFKDCLCNARDEASFGFGMISLVCWGVAEIPQIITNFRTKSSHGV  65

Query  385   SLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDN  564
             SL FLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                          
Sbjct  66    SLAFLLTWVAGDVFNLVGCLLEPATLPTQYYTAL--------------------------  99

Query  565   IFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR  744
                            LYTA+TVVLVLQS+YYD +Y  WK +       Q   E K+PL+ 
Sbjct  100   ---------------LYTASTVVLVLQSLYYDHVYSLWKGRHIKKPDPQ--AEEKEPLKP  142

Query  745   NKSGGSGIPIPDGASR--PARQH-QAEYYYTSARSMAGSATPPFRS--NLVKSGPSALGM  909
               +   GI IP  A++  P +   + E++YTSARS+AGS TPPFR+   + KSGPS + +
Sbjct  143   KATHQMGIAIPGAAAKATPVKASPRKEFFYTSARSLAGSGTPPFRTYIRVAKSGPSTVHL  202

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
             D+D SSDDE    PS  S+S+PK IPRS GYG FL +SL++P Q K+    +  L  RKL
Sbjct  203   DSDSSSDDEAARVPSTKSVSKPKQIPRSVGYGTFLASSLTLPLQNKSFTEAHVVLSTRKL  262

Query  1090  LQGSGTEHSSFGQWLGWMMAAI  1155
             LQ  G EHS+ GQW GW+MAAI
Sbjct  263   LQEGGMEHSAIGQWFGWLMAAI  284



>gb|KDO79457.1| hypothetical protein CISIN_1g045038mg, partial [Citrus sinensis]
Length=289

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/276 (62%), Positives = 203/276 (74%), Gaps = 14/276 (5%)
 Frame = +1

Query  610   LYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGAS  789
             LYT +TVVLVLQ +YYD +++  K +       +  EE KKPL   KSG + IPIP  + 
Sbjct  1     LYTISTVVLVLQGVYYDHIFKRLKGRHTKATRRE--EEEKKPLA-PKSGDAAIPIPKASV  57

Query  790   RPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDNDCSSDDETVEA-PSMN  960
             + + +   EYYYTSARS+A S TPPFR+ L   +SGPSALG+DND SSDDE   A P+++
Sbjct  58    KSSPRR--EYYYTSARSLASSGTPPFRTFLRAAQSGPSALGLDNDSSSDDEAAAAAPTLS  115

Query  961   S-----ISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAA-LGGRKLLQGSGTEHSSF  1122
             S      SQP+PIPRSAGYG FL  S+++P Q+ AL    AA    R LL G+  EHS+F
Sbjct  116   SSGNPPTSQPRPIPRSAGYGTFLAASVNLPFQSNALAGAMAAGFHSRTLLNGNNMEHSAF  175

Query  1123  GQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDK  1302
             GQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYV SI+VRTT W+ 
Sbjct  176   GQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALVANVTYVLSIVVRTTEWES  235

Query  1303  IKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSG  1410
             IK N+PWLLDA VCV LDLFIILQYIYYRY RK S 
Sbjct  236   IKANMPWLLDAIVCVLLDLFIILQYIYYRYFRKKSA  271



>ref|XP_006425753.1| hypothetical protein CICLE_v10025820mg [Citrus clementina]
 gb|ESR38993.1| hypothetical protein CICLE_v10025820mg [Citrus clementina]
Length=300

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 203/277 (73%), Gaps = 18/277 (6%)
 Frame = +1

Query  610   LYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGA-  786
             LYT +TVVLVLQ +YYD +++  K +       +  EE KKPL   KSG + IPIP  + 
Sbjct  12    LYTISTVVLVLQGVYYDHIFKRLKGRHTKATRRE--EEEKKPLA-PKSGDAAIPIPKASV  68

Query  787   -SRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGMDNDCSSDDETVEA-PS  954
              S P R    EYYYTSARS+A S TPPFR+ L   +SGPSALG+DND SSDDE   A P+
Sbjct  69    KSSPRR----EYYYTSARSLASSGTPPFRTFLRAAQSGPSALGLDNDSSSDDEAAAAAPT  124

Query  955   MNS-----ISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAA-LGGRKLLQGSGTEHS  1116
             ++S      SQP+PIPRSAGYG FL  S+++P Q+ AL    AA    R LL G+  EHS
Sbjct  125   LSSSGNPPTSQPRPIPRSAGYGTFLAASVNLPFQSNALAGAMAAGFHSRTLLNGNNMEHS  184

Query  1117  SFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAW  1296
             +FGQWLGW+MAAIYMGGR+PQIWLNIKRGSVEGLNPLMF+FAL+AN TYV SI+VRTT W
Sbjct  185   AFGQWLGWLMAAIYMGGRLPQIWLNIKRGSVEGLNPLMFVFALVANVTYVLSIVVRTTEW  244

Query  1297  DKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNS  1407
             + IK N+PWLLDA VCV LDLFIILQYIYYRY RK S
Sbjct  245   ESIKANMPWLLDAIVCVLLDLFIILQYIYYRYFRKKS  281



>ref|XP_007047046.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 10 [Theobroma cacao]
 gb|EOX91203.1| PQ-loop repeat family protein / transmembrane family protein 
isoform 10 [Theobroma cacao]
Length=253

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/340 (49%), Positives = 197/340 (58%), Gaps = 95/340 (28%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YCV E KPCV WVE++FKDCLCN+ DDFSF  GL SL+CWGVAEIPQI+TNF+TKSS
Sbjct  2     SHAYCVKENKPCVRWVERHFKDCLCNLKDDFSFAFGLVSLVCWGVAEIPQIITNFKTKSS  61

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
             HGVSLLFLLTW+AGD+FNLVGCLLEPATLPTQ YTAL                       
Sbjct  62    HGVSLLFLLTWVAGDVFNLVGCLLEPATLPTQFYTAL-----------------------  98

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT +T+VLVLQ++YYD +YRWWK +    D+  +VE+ KKP
Sbjct  99    ------------------LYTTSTLVLVLQTIYYDNVYRWWKCRRIKTDN--MVEDEKKP  138

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDN  915
             L+  K+  SGIPIP                                   K  P A     
Sbjct  139   LKPGKA-DSGIPIP-----------------------------------KPSPKA-----  157

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
                        P   S +QP+PIPR+A  YG FL  S+++P  +KA M        R+LL
Sbjct  158   ----------NPRGESGTQPRPIPRAAASYGTFLAASVNLPLGSKAWMEARTGFTSRRLL  207

Query  1093  QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
             Q    EHS+FGQWLGW+MAAIYMGGRIPQIWLNIKRG+VE
Sbjct  208   QEQSMEHSAFGQWLGWLMAAIYMGGRIPQIWLNIKRGTVE  247



>ref|XP_010254973.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 isoform 
X5 [Nelumbo nucifera]
Length=316

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 203/334 (61%), Gaps = 49/334 (15%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S  YC  +KKPCV WVE YFKDCLCN+SD+ SF  G FSLICWGVAEIPQI+TNF TKS 
Sbjct  6     SHAYCSKQKKPCVGWVEIYFKDCLCNLSDEISFAFGFFSLICWGVAEIPQIITNFNTKSG  65

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
              GVSL FLLTW+ GD+FNLVGCLLEPATLPTQ YTA+                       
Sbjct  66    QGVSLAFLLTWVVGDVFNLVGCLLEPATLPTQFYTAV-----------------------  102

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                               LYT TTVVLVLQ +YYD +  WWK K     S  +V+E  KP
Sbjct  103   ------------------LYTVTTVVLVLQCLYYDRICLWWKSK--GKQSYVMVDEETKP  142

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNL--VKSGPSALGM  909
             L  +K   + +PIP    + A   + + YYTSARS+A S+TP   S L   +SGPSA+  
Sbjct  143   L-NSKLLDTSVPIPSSGPQEASPSR-DLYYTSARSLASSSTPTLGSYLGISRSGPSAVEE  200

Query  910   DNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKL  1089
              +D SS+DE        S SQPK  P S GYGAFL  S ++P ++ ALM  Y A  GR+L
Sbjct  201   QSD-SSEDEAFPVYDKKSSSQPKRTPPSVGYGAFLGASANLPFRSMALMEGYLASTGRRL  259

Query  1090  LQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLN  1191
              + +   ++ +G  LGW+MAAIYMGGR+PQI+LN
Sbjct  260   HE-TEVANNVYGLLLGWLMAAIYMGGRLPQIFLN  292



>ref|XP_001753587.1| predicted protein [Physcomitrella patens]
 gb|EDQ81810.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   278 bits (711),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 173/429 (40%), Positives = 221/429 (52%), Gaps = 95/429 (22%)
 Frame = +1

Query  202   PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
             P C A+K PC+ WV+ Y  DC+C+  D FS   GL S+I WG+AE+PQI+TNFR KS+ G
Sbjct  2     PQCPADK-PCLRWVQVYLLDCVCSTRDRFSLAQGLMSVISWGIAEVPQILTNFREKSTEG  60

Query  382   VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
             +SLLFL+TW+ GD+FNL+GC LEPATLPTQ Y A+                         
Sbjct  61    LSLLFLMTWVVGDVFNLMGCYLEPATLPTQFYMAI-------------------------  95

Query  562   NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFL-YRWWKDKEDAGDSNQLVE----EA  726
                             LYT TT +LVLQ++YYD L  RW  D+    D    ++    EA
Sbjct  96    ----------------LYTMTTTILVLQTVYYDHLRVRWSGDRVAVKDMFPEIQKTDMEA  139

Query  727   KKPL-------RRNKSGGSGIPIPD---------------GASRPARQHQAEYYYTSARS  840
             +K +         N++GG GIP                  G S  +R H    YY SARS
Sbjct  140   QKQIPIPEAADDANETGG-GIPTSSQPTSIRVPHHVHHPHGNSAGSRDH---LYYQSARS  195

Query  841   MAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTT  1020
             +A S   P  S               C    +T E  S+N                 +  
Sbjct  196   LASSYAQPVGSY-------------SCILHHQTAE--SLNLTICLNFCVTQITTSVLMVG  240

Query  1021  SLSIPHQTKALMPVYAALGGRKLLQGSGTEH-------SSFGQWLGWMMAAIYMGGRIPQ  1179
             SL +   T  +      LG   + +     H       S  G+  GW+MA IYMGGR+PQ
Sbjct  241   SLGLSMYTSPIRTGGNTLGTTHIGRSHTLAHLFAQQEASPLGEVFGWIMAGIYMGGRLPQ  300

Query  1180  IWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDL  1359
             IWLN+KRGS+EGLNPLMF+FALL NATYVGSILVR+  W ++KPNL WL+DA VCV LD+
Sbjct  301   IWLNMKRGSMEGLNPLMFVFALLGNATYVGSILVRSLDWAQLKPNLAWLVDAGVCVVLDI  360

Query  1360  FIILQYIYY  1386
             FI+ Q+ YY
Sbjct  361   FILCQFAYY  369



>ref|XP_010023553.1| PREDICTED: lysosomal amino acid transporter 1 homolog [Eucalyptus 
grandis]
Length=417

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 176/447 (39%), Positives = 234/447 (52%), Gaps = 94/447 (21%)
 Frame = +1

Query  193   NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             N  P C A +  C  W  KY + CLC+  D  S  LG+ S+I WGVAEIPQIVTN++ KS
Sbjct  6     NDMPQCPASRH-CTRWARKYMQYCLCSTRDGVSLSLGVVSVISWGVAEIPQIVTNYKQKS  64

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             + G+S+ FL+TW+ GD+FNL GC+LEPATLPTQ Y A+                      
Sbjct  65    AEGLSIAFLMTWVVGDVFNLFGCMLEPATLPTQYYMAV----------------------  102

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK------------EDA  696
                                LYT TT+VL  Q++YY  +  W K +            E A
Sbjct  103   -------------------LYTVTTMVLTGQAVYYGHVCPWLKYRRPFCKGPKPIQIESA  143

Query  697   GD--------------SNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSA  834
             G+              S++ ++     + R     S IP+P  AS          YY SA
Sbjct  144   GNDSKSNCKVSMKEANSSERLQNGSDTIDRQSVLSSPIPLP--ASPTNASPGNGLYYVSA  201

Query  835   RSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAP----SMNSISQPKPIPRS---  993
             RS++ S TP   S         L M  + + ++ T+E P     ++  S P P  ++   
Sbjct  202   RSLSSSHTPTAGSYF------PLRMSPNNADNEGTIEEPLLAGDLSEQSAPSPKTKNMLC  255

Query  994   --AGYGAFLTTSLSIPHQTKALMPVYAALG-----GRKLLQ---GSG-TEHSSFGQWLGW  1140
               +    F T +L  P + +A        G     GRKLLQ   G+G + H   G +LGW
Sbjct  256   LVSAVTFFGTFNLPNPLKVRASSVSRKQSGRVIQVGRKLLQVDEGNGFSGHVGVGSFLGW  315

Query  1141  MMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLP  1320
              MAAIYMGGR+PQI LNI+RG+VEGLNPLMF+FAL+ N TYV SILVR+  W KI+PNLP
Sbjct  316   AMAAIYMGGRLPQICLNIRRGNVEGLNPLMFLFALIGNITYVASILVRSLDWSKIRPNLP  375

Query  1321  WLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             WL+DAA CV LD+ I++Q+IY+ Y RK
Sbjct  376   WLVDAAGCVLLDILILIQFIYFSYWRK  402



>ref|XP_011010093.1| PREDICTED: uncharacterized protein LOC105115030 [Populus euphratica]
 ref|XP_011010094.1| PREDICTED: uncharacterized protein LOC105115030 [Populus euphratica]
 ref|XP_011010095.1| PREDICTED: uncharacterized protein LOC105115030 [Populus euphratica]
Length=416

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 177/459 (39%), Positives = 233/459 (51%), Gaps = 107/459 (23%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L +++ P C    + C  W   Y K CLC++ D  S  LG+ S++ WGVAEIPQI+TN
Sbjct  1     MELFKSTMPTC---PQYCSQWARIYMKYCLCSMKDGVSLTLGVISVLSWGVAEIPQIITN  57

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KS+ G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y A+                 
Sbjct  58    YKEKSTEGLSLAFLLTWIVGDLFNVFGCMLEPATLPTQYYMAV-----------------  100

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK----------  687
                                     LYT TT +L  Q++YY  +Y   K            
Sbjct  101   ------------------------LYTITTSILTAQTIYYGHIYHRLKRNRRCIKAPISS  136

Query  688   --EDAG-------DSNQLVEEAKKPLRRNKSG------GSGIPIP----DGASRPARQHQ  810
               E+AG       D    V  A K  +RN++       GS +PIP       S P R   
Sbjct  137   QIEEAGRIRQGNSDDGAQVNNAGK--QRNETASPDGTNGSSLPIPFPTLFQKSSPGR---  191

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPS-ALGMDNDCSS-----DDETVEAPSMNSISQ  972
              E YY SARS++ S TP   S L +   S +  M N         D  T  AP++N+ + 
Sbjct  192   -ELYYMSARSLSSSHTPAVGSFLAQRMASPSFSMRNSIEEPLLGGDATTQSAPNLNTKTM  250

Query  973   PKPIPRSAGYGAF---------LTTSLSIPHQTKALMPVYAALGGRKLLQGSG-------  1104
                +      G           L  +    HQ       +    GRK+LQ S        
Sbjct  251   LCVVSVFTLLGTLNLHQSANNRLARAFENKHQG------FVIQVGRKILQASSRMSHENY  304

Query  1105  TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR  1284
             ++ S  G +LGW MAAIYMGGR+PQI+LNIKRG+VEGLNPLMF+FAL+ N TYV SILV 
Sbjct  305   SDGSGIGTFLGWSMAAIYMGGRLPQIFLNIKRGNVEGLNPLMFVFALIGNITYVASILVD  364

Query  1285  TTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             + AW KI+ NLPWL+DA  CV LD  I+LQ++Y+R+ R+
Sbjct  365   SVAWSKIRANLPWLVDAGGCVLLDTCILLQFVYFRHRRR  403



>ref|XP_010251611.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X2 [Nelumbo nucifera]
Length=418

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 179/455 (39%), Positives = 234/455 (51%), Gaps = 93/455 (20%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L + S P C      C  W   Y K CLC+  D  S  LGL S+I WGVAE+PQI+TN
Sbjct  1     MGLFKGSYPVC-PRNLHCSEWARTYMKYCLCSAKDGASLTLGLISVISWGVAEVPQIITN  59

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KS+  +S+ FL+TWI GD+FNL GCLLEPATLPTQ Y A+                 
Sbjct  60    YKKKSTESLSIAFLITWIIGDLFNLFGCLLEPATLPTQYYMAM-----------------  102

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE---------  690
                                     LYT TT++L LQ++YY  +Y   K            
Sbjct  103   ------------------------LYTLTTLILALQTIYYSRIYHLLKSHRHGHKSPILP  138

Query  691   --DAGDSNQLVEEAKKPLRRNKSGGSGI----PIPDGASRPARQHQA--EYYYTSARSMA  846
               DA D         K  +++  G  G+    PIP      +R      E YY SARS++
Sbjct  139   EIDAVDKEHYTNNFGK--KQSALGDRGVLPSSPIPVSVPSHSRDGSCGRELYYMSARSLS  196

Query  847   GSATPPFRSNLVK----SGPSALGMDNDCSSDDETV--------EAPSMNSISQPKPIPR  990
              S TP   S+L       G +++  D+DC S +E +          P MN+ +    +  
Sbjct  197   RSHTPTAGSHLACPCGYEGTNSIS-DHDCRSIEEPLLSRVGSMQSTPPMNTKNM---LCV  252

Query  991   SAGYGAFLTT-SLSIPHQTKALMPVYAALGG------RKLLQGS--------GTEHSSFG  1125
              +    FL+T  L +   ++  M +    GG      R+LLQ S        G   SS G
Sbjct  253   VSALTFFLSTFRLQLSANSRFSMYLENQPGGHVIRIGRRLLQKSSGPLLENHGEGSSSVG  312

Query  1126  QWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKI  1305
              +LGW MAAIYMGGR+PQIWLNI+RG V GLNPLMF+FAL+ NATYV SILV +    KI
Sbjct  313   TFLGWAMAAIYMGGRLPQIWLNIRRGHVGGLNPLMFVFALVGNATYVASILVSSLNLSKI  372

Query  1306  KPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSG  1410
             +PNLPWL+DA  C+ LD FII+Q+I++RY RK  G
Sbjct  373   RPNLPWLVDAGGCILLDCFIIIQFIHFRY-RKPKG  406



>ref|XP_011041299.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
 ref|XP_011041300.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
 ref|XP_011041301.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
 ref|XP_011041302.1| PREDICTED: uncharacterized protein LOC105137299 [Populus euphratica]
Length=416

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 177/459 (39%), Positives = 232/459 (51%), Gaps = 107/459 (23%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L +++ P C    + C  W   Y K CLC++ D  S  LG+ S++ WGVAEIPQI+TN
Sbjct  1     MELFKSTMPTC---PQYCSQWARIYMKYCLCSMKDGVSLTLGVISVLSWGVAEIPQIITN  57

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KS+ G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y A+                 
Sbjct  58    YKEKSTEGLSLAFLLTWIVGDLFNVFGCMLEPATLPTQYYMAV-----------------  100

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK----------  687
                                     LYT TT +L  Q++YY  +Y   K            
Sbjct  101   ------------------------LYTITTSILTAQTIYYGHIYHRLKRNRRCIKAPISS  136

Query  688   --EDAG-------DSNQLVEEAKKPLRRNKSG------GSGIPIPD----GASRPARQHQ  810
               E+AG       D    V  A K  +RN++       GS +PIP       S P R   
Sbjct  137   QIEEAGRIRQGNSDDGAQVNNAGK--QRNETASPDGTNGSSLPIPFPTLFQKSSPGR---  191

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPS-ALGMDNDCSS-----DDETVEAPSMNSISQ  972
              E YY SARS++ S TP   S L +   S +  M N         D  T  AP++N+ + 
Sbjct  192   -ELYYMSARSLSSSHTPAVGSFLAQRMASPSFSMRNSIEEPLLGGDATTQSAPNLNTKTM  250

Query  973   PKPIPRSAGYGAF---------LTTSLSIPHQTKALMPVYAALGGRKLLQGSG-------  1104
                +      G           L  +    HQ       +    GRK+LQ S        
Sbjct  251   LCVVSVFTLLGTLNLHQSANNRLARAFENKHQG------FVIQVGRKILQASSRMSQENY  304

Query  1105  TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR  1284
             ++ S  G +LGW MAAIYMGGR+PQI+LNIKRG+VEGLNPLMF+FAL+ N TYV SILV 
Sbjct  305   SDGSGIGTFLGWSMAAIYMGGRLPQIFLNIKRGNVEGLNPLMFVFALIGNITYVASILVD  364

Query  1285  TTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             + AW KI+ NLPWL+DA  CV LD  I+LQ+ Y+R+ R+
Sbjct  365   SVAWSKIRANLPWLVDAGGCVLLDTCILLQFAYFRHRRR  403



>ref|XP_002322574.2| hypothetical protein POPTR_0016s02400g [Populus trichocarpa]
 gb|EEF04335.2| hypothetical protein POPTR_0016s02400g [Populus trichocarpa]
Length=403

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 175/436 (40%), Positives = 222/436 (51%), Gaps = 98/436 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W   Y K CLC++ D  S  LG+ S++ WGVAEIPQI+TN++ KS+ G+SL FLLTW
Sbjct  8     CSQWARIYVKYCLCSMKDGVSLTLGVISVLSWGVAEIPQIITNYKEKSTEGLSLAFLLTW  67

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FN+ GC+LEPATLPTQ Y A+                                  
Sbjct  68    IIGDLFNVFGCMLEPATLPTQYYMAV----------------------------------  93

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWK------DKEDAG-------DSNQLVEEAK  729
                    LYT TT VL  Q++YY  +Y   K        E+AG       D+   V  A 
Sbjct  94    -------LYTITTSVLTAQTIYYGHIYHRLKRNRRCIKTEEAGRIRQGNSDAGAQVNNAG  146

Query  730   KPLRRNKSG------GSGIPIPD----GASRPARQHQAEYYYTSARSMAGSATPPFRSNL  879
             K  +RN++       GS  PIP       S P R    E YY SARS++ S TP   S L
Sbjct  147   K--QRNETASPDGTNGSSSPIPFPTLFQKSSPGR----ELYYMSARSLSSSHTPAVGSFL  200

Query  880   VKSGPS-ALGMDNDCSS-----DDETVEAPSMNSISQPKPIPRSAGYGAF---------L  1014
              +   S +  M N         D  T  AP++N+ +    +      G           L
Sbjct  201   AQRVASPSFSMRNSIEDPLLGGDATTQSAPNLNTKTMLCVVSVVTLLGTLNLHQSANNRL  260

Query  1015  TTSLSIPHQTKALMPVYAALGGRKLLQGSG-------TEHSSFGQWLGWMMAAIYMGGRI  1173
                    HQ       +    GRK+LQ S        +E S  G +LGW MAAIYMGGR+
Sbjct  261   ARDFENKHQG------FVIQVGRKILQASSRMSHENYSEGSGIGTFLGWSMAAIYMGGRL  314

Query  1174  PQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGL  1353
             PQI+LNIKRG+VEGLNPLMF+FAL+ N TYV SILV + AW KI  NLPWL+DA  CV L
Sbjct  315   PQIFLNIKRGNVEGLNPLMFVFALIGNITYVASILVDSVAWSKISANLPWLVDAGGCVLL  374

Query  1354  DLFIILQYIYYRYCRK  1401
             D  I+LQ+ Y+R+ R+
Sbjct  375   DTCILLQFAYFRHRRR  390



>ref|XP_010653691.1| PREDICTED: uncharacterized protein LOC100853498 [Vitis vinifera]
Length=414

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 171/447 (38%), Positives = 232/447 (52%), Gaps = 93/447 (21%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L ++S P C    + C +W  ++ K CLC++ D+ S  LG+ S+I W +AEIPQI+TN
Sbjct  1     MELFESSLPLC-PRHQHCSLWAWRFMKFCLCSVKDEISLTLGVISVISWAIAEIPQIITN  59

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KSS G+S+ FL+TWI GD+FN++GC LEPATLPTQ Y A+                 
Sbjct  60    YKEKSSEGLSIAFLMTWIVGDLFNVLGCFLEPATLPTQFYMAV-----------------  102

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLY------RWWKDK---E  690
                                     LYT TT++L  QS+YY  +Y      RW+  +    
Sbjct  103   ------------------------LYTITTLILTAQSIYYGHIYHRLKSGRWYHKEIKPN  138

Query  691   DAGDSNQLVEEAKKPLRRNKSGG--------------SGIPIPDGASRPARQHQAEYYYT  828
               G  N+  E+      R  S G              S IP+   AS        E YY 
Sbjct  139   QTGTINKNREDNNSAGGRQVSDGLKNESNVFGEVPLSSPIPVNLPASPRNISPSRELYYM  198

Query  829   SARSMAGSATPPFRSNLV--KSGPSALGMDNDCSSDDETVEAPSMNSI--SQPKPIPRSA  996
             SARS++ S  P   S L   K+ PS          D  ++E P ++S+  SQ  P   + 
Sbjct  199   SARSLSKSHAPAMGSFLAQRKTSPSV--------HDSNSLEEPLLSSVVLSQSAPASTTK  250

Query  997   GYGAFLTTSLS-------IPHQTK-----ALMPVYAALG---GRKLLQGS-GTEHSSFGQ  1128
                + L+ ++        +P +       A  P    +    GR LLQ S G  +S  G 
Sbjct  251   SMLSMLSATMFFLGCFNFLPSENNRDGIAAEKPNQGGIALKVGRTLLQLSEGGGNSGIGT  310

Query  1129  WLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIK  1308
             +LGW MAAIY+GGR+PQI LNI+RG++EGLNPLMF+FAL  NATYVGSILV +  W KIK
Sbjct  311   FLGWSMAAIYLGGRLPQIILNIRRGTIEGLNPLMFLFALTGNATYVGSILVSSLDWSKIK  370

Query  1309  PNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             PNLPWL+DA  CV LD FI+ Q+I++ 
Sbjct  371   PNLPWLVDAGGCVLLDAFILTQFIHFH  397



>ref|XP_006836191.1| hypothetical protein AMTR_s00101p00071870 [Amborella trichopoda]
 gb|ERM99044.1| hypothetical protein AMTR_s00101p00071870 [Amborella trichopoda]
Length=394

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 175/462 (38%), Positives = 224/462 (48%), Gaps = 122/462 (26%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L   S P C   K  C  W   Y K C+C++ D  S +LGL S+I WGVAEIPQI++N
Sbjct  1     MELINESLPACPINKH-CWEWARVYMKYCICDVKDWLSLILGLISVISWGVAEIPQIISN  59

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ K+S  +S+ FLLTW+ GD FNL GCLLEPATLPTQ YTA+                 
Sbjct  60    YKEKTSESLSMAFLLTWVLGDFFNLFGCLLEPATLPTQFYTAV-----------------  102

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWK----------DK  687
                                     LY  TT++L LQS+YY  +Y   K           K
Sbjct  103   ------------------------LYAVTTLILTLQSIYYCHIYPRVKASGPYLSPNKSK  138

Query  688   EDAGDSNQLVEE------AKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAG  849
              DA    +   E      ++  +  +    S IP+ D           + Y+TSARS+A 
Sbjct  139   RDATSEKKTKREYIQTYDSRPSMDDHYVSTSPIPVADTVLPRFSSTGRDLYFTSARSLAS  198

Query  850   SATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLS  1029
             SATP   S L  S  S + +         +VE P +               GAF++T  +
Sbjct  199   SATPTAGSYLAHSRASPITL-----LQQHSVEEPLL---------------GAFVSTQSA  238

Query  1030  IPHQTKALMPVYAA----LG---------------------------GRKLLQGSGTE--  1110
              P  TK ++  ++A    LG                           GRKLLQ  G    
Sbjct  239   PPLNTKNMLCSFSAIILFLGSFNLHRSANSQYNEAMHETSQGVVIQLGRKLLQNVGESSS  298

Query  1111  ----HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSIL  1278
                 HS  G ++GW M AIYMGGR+PQI LN+KRGSVEGLNPLMFIFAL+ N+TYVGSIL
Sbjct  299   LGEGHSMVGNFMGWAMTAIYMGGRLPQICLNMKRGSVEGLNPLMFIFALIGNSTYVGSIL  358

Query  1279  VRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN  1404
             VR+  W KI PNLPWL+DA  CV LD F+        +C +N
Sbjct  359   VRSIEWSKIHPNLPWLVDAGACVLLDSFV-------SFCFQN  393



>ref|XP_010251610.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X1 [Nelumbo nucifera]
Length=424

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 174/438 (40%), Positives = 228/438 (52%), Gaps = 92/438 (21%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W   Y K CLC+  D  S  LGL S+I WGVAE+PQI+TN++ KS+  +S+ FL+TW
Sbjct  23    CSEWARTYMKYCLCSAKDGASLTLGLISVISWGVAEVPQIITNYKKKSTESLSIAFLITW  82

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GCLLEPATLPTQ Y A+                                  
Sbjct  83    IIGDLFNLFGCLLEPATLPTQYYMAM----------------------------------  108

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE-----------DAGDSNQLVEEAKKP  735
                    LYT TT++L LQ++YY  +Y   K              DA D         K 
Sbjct  109   -------LYTLTTLILALQTIYYSRIYHLLKSHRHGHKSPILPEIDAVDKEHYTNNFGK-  160

Query  736   LRRNKSGGSGI----PIPDGASRPARQHQA--EYYYTSARSMAGSATPPFRSNLVK----  885
              +++  G  G+    PIP      +R      E YY SARS++ S TP   S+L      
Sbjct  161   -KQSALGDRGVLPSSPIPVSVPSHSRDGSCGRELYYMSARSLSRSHTPTAGSHLACPCGY  219

Query  886   SGPSALGMDNDCSSDDETV--------EAPSMNSISQPKPIPRSAGYGAFLTT-SLSIPH  1038
              G +++  D+DC S +E +          P MN+ +    +   +    FL+T  L +  
Sbjct  220   EGTNSIS-DHDCRSIEEPLLSRVGSMQSTPPMNTKNMLCVV---SALTFFLSTFRLQLSA  275

Query  1039  QTKALMPVYAALGG------RKLLQGS--------GTEHSSFGQWLGWMMAAIYMGGRIP  1176
              ++  M +    GG      R+LLQ S        G   SS G +LGW MAAIYMGGR+P
Sbjct  276   NSRFSMYLENQPGGHVIRIGRRLLQKSSGPLLENHGEGSSSVGTFLGWAMAAIYMGGRLP  335

Query  1177  QIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLD  1356
             QIWLNI+RG V GLNPLMF+FAL+ NATYV SILV +    KI+PNLPWL+DA  C+ LD
Sbjct  336   QIWLNIRRGHVGGLNPLMFVFALVGNATYVASILVSSLNLSKIRPNLPWLVDAGGCILLD  395

Query  1357  LFIILQYIYYRYCRKNSG  1410
              FII+Q+I++RY RK  G
Sbjct  396   CFIIIQFIHFRY-RKPKG  412



>ref|XP_008443167.1| PREDICTED: uncharacterized protein LOC103486835 isoform X1 [Cucumis 
melo]
Length=420

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 173/446 (39%), Positives = 225/446 (50%), Gaps = 91/446 (20%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
             Q+S P C + K  C  WV+   K CLC + D  S  LG+ S+I WGVAEIPQI+TN+R K
Sbjct  5     QSSKPICPSSKH-CSEWVKNNMKYCLCGVKDGVSLTLGMISVISWGVAEIPQIITNYREK  63

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             SS G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y AL                     
Sbjct  64    SSDGLSLAFLLTWILGDLFNVFGCILEPATLPTQYYMAL---------------------  102

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA------GDSNQ  711
                                 LYT TT +L  Q++YY  +Y   K +          ++N 
Sbjct  103   --------------------LYTITTGILFTQTIYYGHIYPQMKYRRRQCKGLVHSEANS  142

Query  712   LVEEAKKPLRRN---------------------KSGGSGIPIPDGASRPARQHQAEYYYT  828
              ++   K  + N                     +   S  PIP    R       E ++ 
Sbjct  143   QIDARDKAQQSNGSVNVNQVNNDDDTSKFNTSKRESASTSPIPLPVLRQNSSTGRELFFM  202

Query  829   SARSMAGSATPPFRSNLV-KSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYG  1005
             SARS++ S TP   S L  K  P  +      S  +  ++    +S ++P  +       
Sbjct  203   SARSLSRSHTPTAGSFLTQKMTPPNI----HNSMQEPLLDGNEPSSAARPPNVKNMLCLV  258

Query  1006  AFLTTSLSIPHQTKALMPVYAALG----------GRKLLQ------GSGTEHSS-FGQWL  1134
             + LT   ++ H   A     +  G          GRKLLQ       +G E S   G +L
Sbjct  259   SMLTFFSTLNHHQSAESRFQSVSGNSNKGFVIPVGRKLLQVADVLQNNGNEISGGIGTYL  318

Query  1135  GWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPN  1314
             GW MA IYMGGR+PQI LNIKRG VEGL+PLMFIFAL+ N+TYV SILV +T+W KIKPN
Sbjct  319   GWAMALIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVASILVSSTSWSKIKPN  378

Query  1315  LPWLLDAAVCVGLDLFIILQYIYYRY  1392
             LPWL+DA  CV LD FI++Q+IY+RY
Sbjct  379   LPWLVDAFGCVLLDTFILIQFIYFRY  404



>ref|XP_004967745.1| PREDICTED: lysosomal amino acid transporter 1-like [Setaria italica]
Length=419

 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 178/471 (38%), Positives = 237/471 (50%), Gaps = 106/471 (23%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M +   + P C + +  C  W   Y K CLC+  D  +  LGL S+I WGVAE+PQI+TN
Sbjct  1     MGVFSGTPPSCPSSRH-CAEWARTYLKYCLCSQKDSAALALGLISVISWGVAEVPQIITN  59

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             +R KS+ G+S+ FL+TWI GD+FNL+GC LEPATLPTQ Y AL                 
Sbjct  60    YRQKSTEGLSVAFLMTWIVGDMFNLIGCFLEPATLPTQFYMAL-----------------  102

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSN-QL  714
                                     LYT TTV+L  Q++YY  +Y   K K+    S  Q 
Sbjct  103   ------------------------LYTITTVILTGQTVYYSHIYHRLKAKKSRATSKPQK  138

Query  715   VEEAKKPLRRN----KSGGSG---------IPIPDGA----SRPARQHQA------EYYY  825
              +     LR      K GG+          IPIP       +    Q+ A      +YYY
Sbjct  139   HQRGDTSLREKLLGAKDGGASGNNHQSDATIPIPSSPIPVNTEFTEQYHAPSSPTSDYYY  198

Query  826   TSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYG  1005
              SARS++ S  P   + L   G S L       ++ +    P +  ++  +  P S    
Sbjct  199   VSARSLSRSPVPTAGTWL---GNSRLSSRTPPQTNGQ--REPLIGEVTTAQSAPPSRTKN  253

Query  1006  AF---------LTTSL----------SIPHQTKALMPVYAALGGRKLL-----QG-SGTE  1110
             AF         L T L           +P  T  ++PV     GR+LL     QG S   
Sbjct  254   AFSVVPWMGLLLGTCLLHFLVGNTHREVPSGT--VIPV-----GRRLLLFTDVQGHSSLS  306

Query  1111  H---SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV  1281
             H   S  G +LGW MA IYMGGR+PQI+LN++RG VEGLNPLMF FA++ N+TYVGSILV
Sbjct  307   HGIGSEIGSFLGWAMAIIYMGGRLPQIFLNMQRGHVEGLNPLMFTFAIVGNSTYVGSILV  366

Query  1282  RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
              +  W K++PNLPWL+DA  CV LD FIILQ++Y+ Y +++      D+AD
Sbjct  367   NSLEWSKLRPNLPWLVDAGGCVILDSFIILQFLYFHYRKQSEPSDEHDNAD  417



>ref|XP_010525450.1| PREDICTED: uncharacterized protein LOC104803245 [Tarenaya hassleriana]
 ref|XP_010525451.1| PREDICTED: uncharacterized protein LOC104803245 [Tarenaya hassleriana]
Length=412

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 171/440 (39%), Positives = 225/440 (51%), Gaps = 94/440 (21%)
 Frame = +1

Query  196   SGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSS  375
             S P C    + C  W  +  K CLC++ D  S  LG  S+I WGVAEIPQI+TN+R KS+
Sbjct  8     SSPSC---PRHCSRWARESMKYCLCSVRDGLSLSLGFISVISWGVAEIPQIITNYREKST  64

Query  376   HGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL  555
              G+S+ FL TW+ GD+FN+ GCL+EPATLPTQ YTAL                       
Sbjct  65    EGLSIAFLTTWMLGDLFNVFGCLMEPATLPTQFYTAL-----------------------  101

Query  556   RDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKED-----------AGD  702
                               LYT TT VL  Q++YY  +Y   K+++D           A  
Sbjct  102   ------------------LYTVTTAVLFAQAIYYGHIYPGLKNRKDQVVSHQKQMGAARK  143

Query  703   SNQLVEEAKKPLR-----RNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPF  867
             S+    E K   R      +  G    PIP   +R       E YYTSARS++ S TPP 
Sbjct  144   SDTGSNEGKIAERWRIGVDSPCGSPSSPIPFPRARRNNSAGRELYYTSARSLSSSHTPPA  203

Query  868   RSNLVK--SGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSL-----  1026
              S L +  + P+  G          ++E P + + + P P    A        S+     
Sbjct  204   GSFLTQRMTPPTRHG---------SSLEEPLLRAQTSPLPASPPATKMMLCLVSVFMFIG  254

Query  1027  --SIP---HQTKALMP-----VYAALGGRKLLQGS----GTEHSS----FGQWLGWMMAA  1152
               S+P    +++ +       V+   G RKLLQ S    G  HS      G  +GW MAA
Sbjct  255   TVSLPGLLDESRNMTSGERNRVFVVRGMRKLLQISSSSLGENHSGESGGIGMLMGWAMAA  314

Query  1153  IYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLD  1332
              YMGGR+PQI LN++RG+VEGLNPLMF+FAL+ N+TYV SILV +  W KI PNLPWL+D
Sbjct  315   TYMGGRLPQICLNMRRGNVEGLNPLMFLFALVGNSTYVASILVNSMEWSKIGPNLPWLVD  374

Query  1333  AAVCVGLDLFIILQYIYYRY  1392
             A  CV LD  I+LQ+IY++Y
Sbjct  375   AGGCVILDTLILLQFIYFQY  394



>ref|XP_006644034.1| PREDICTED: uncharacterized protein LOC102703908 [Oryza brachyantha]
Length=418

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 224/445 (50%), Gaps = 89/445 (20%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W + Y K CLC+  D  +  LGL S+I WGVAE+PQI+TN++ KS+ G+SL FL+TW
Sbjct  18    CAEWAQAYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKQKSTEGLSLAFLMTW  77

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL+GC LEP TLPTQ Y AL                                  
Sbjct  78    IVGDLFNLIGCFLEPETLPTQFYMAL----------------------------------  103

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSN---------QLVEEAKKP--  735
                    LYT TTV+L  Q++YY  +Y   K K+    S           L E+   P  
Sbjct  104   -------LYTITTVILTGQTIYYSHIYHRLKAKKARSTSKPQRHQRADASLREKLLAPKV  156

Query  736   ---LRRNKSGGSGIPI---PDGASRPARQHQ-------AEYYYTSARSMAGSATPPFRSN  876
                +R N   G+ +P+   P   +    +H+        +YYYTSARS++ S  P   + 
Sbjct  157   IGEIRNNSHSGATVPVSSSPITVNTEIIRHRHGPSSLGIDYYYTSARSLSSSPVPMAGTW  216

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAF-----LTTSLSIPH-  1038
                  P+    ++   +DD      S  + +Q  P P +    +      L   +S+ H 
Sbjct  217   SANHHPT----NSPPETDDHKESLVSEFTPAQYAPSPLTKNSLSVVPWMALLLGMSLLHF  272

Query  1039  ---QTKALMP--VYAALGGRKLLQGSGTEHSSF--------GQWLGWMMAAIYMGGRIPQ  1179
                 T   +P  V   +G R LL       SS         G  LGW MA IYMGGR+PQ
Sbjct  273   LVGTTHQEVPNGVVIPVGRRLLLLADDHADSSLRDASGSGIGNILGWAMAVIYMGGRLPQ  332

Query  1180  IWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDL  1359
             I LN+KRG+ EGLNPLMF FAL+ N TYVGSILV++  W K+KPNLPWL+DA  CV LD 
Sbjct  333   ILLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSLDWSKLKPNLPWLVDAGGCVLLDT  392

Query  1360  FIILQYIYYRYCRKNSGGSREDSAD  1434
             FIILQ+IY+ Y +K       D+AD
Sbjct  393   FIILQFIYFHY-QKRHEPDEPDNAD  416



>ref|XP_011040657.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
 ref|XP_011040658.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
 ref|XP_011040659.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
 ref|XP_011040660.1| PREDICTED: lysosomal amino acid transporter 1 [Populus euphratica]
Length=416

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 175/463 (38%), Positives = 234/463 (51%), Gaps = 93/463 (20%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M   +++ P C    + C  W   Y + CLCN+ D  S  LG+ S++ WGVAEIPQIVTN
Sbjct  1     MDFFKSTMPIC---PQHCSRWARVYMEYCLCNMKDGVSLSLGMISVLSWGVAEIPQIVTN  57

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KS+ G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y A+                 
Sbjct  58    YKEKSTEGLSLAFLLTWIIGDLFNVFGCMLEPATLPTQYYMAV-----------------  100

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK----------  687
                                     LYT T+ +L  Q++YY  +Y   K            
Sbjct  101   ------------------------LYTMTSTLLTAQTVYYGHIYHRLKSNRRRPKGPVSS  136

Query  688   --EDAG-------DSNQLVEEAKK----PLRRNKSGGSGIPIPDGASRPARQHQAEYYYT  828
               E+AG       D++  V  A K    P   + + G   PIP          + + YY 
Sbjct  137   HSEEAGRIKQGNSDASAQVNSADKQRNEPAAPDGTNGLSSPIPFRTLPQKSSPERDLYYA  196

Query  829   SARSMAGSATPPFRSNLV-KSGPSALGMDNDCSS-----DDETVEAPSMNSISQPKPIPR  990
             SARS++ S TP   S L  ++ P +  + N         D +T  AP++N+    K +  
Sbjct  197   SARSLSSSHTPTVGSFLAQRTTPPSFSIGNSIEEPLLGEDVDTQSAPNLNT----KTMLC  252

Query  991   SAGYGAFLTTSLSIPHQTKA-LMPVYAALG-------GRKLLQGSGT-------EHSSFG  1125
                   FL T L++ H   + L  V+           GRK+LQ S         + +  G
Sbjct  253   VVSVVTFLGT-LNLHHSANSRLDRVFENKNQGIFIQVGRKILQTSSIMSHENDIDGNVIG  311

Query  1126  QWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKI  1305
              +LGW MAAIYMGGR+PQI LNIKRG VEGLNPLMF+FAL  N TYV SILV + AW KI
Sbjct  312   TFLGWSMAAIYMGGRLPQICLNIKRGKVEGLNPLMFVFALAGNITYVASILVDSLAWSKI  371

Query  1306  KPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             + NLPWL+DA  CV LD  I+LQ+IY+RY R      +  S++
Sbjct  372   RANLPWLVDAGGCVLLDTCILLQFIYFRYRRHQVEEDKLQSSN  414



>ref|XP_004136760.1| PREDICTED: uncharacterized protein LOC101209754 [Cucumis sativus]
Length=420

 Score =   266 bits (680),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 178/448 (40%), Positives = 221/448 (49%), Gaps = 95/448 (21%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
             Q+S P C + K  C  WV+   K CLC   D  S  LG+ S+I WGVAEIPQIVTN+R K
Sbjct  5     QSSKPICPSNKH-CSEWVKNNMKYCLCGTKDGVSLTLGMISVISWGVAEIPQIVTNYREK  63

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             SS G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y AL                     
Sbjct  64    SSDGLSLAFLLTWILGDLFNVFGCILEPATLPTQYYMAL---------------------  102

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE-------------  690
                                 LYT TT +L  Q++YY  +Y   K +              
Sbjct  103   --------------------LYTITTGILFTQAIYYGHIYPQMKYRRRQCKGLVHSEANA  142

Query  691   --DAGDS----------NQLVEEAKKPLRRNK-SGGSGIPIPDGASRPARQHQAEYYYTS  831
               DA D           NQ+  +       +K    S  PIP    R       E YY S
Sbjct  143   QIDARDKAQQSYGSVNVNQVNNDDMSKFNTSKRESASTSPIPLPMLRQNSSTGRELYYMS  202

Query  832   ARSMAGSATPPFRSNL-VKSGPSALG--MDNDCSSDDETVEAPSMNSISQPKPIPRSAGY  1002
             ARS++ S TP   S L  K  P  +   M       +E   AP      +P  +      
Sbjct  203   ARSLSRSHTPTSGSFLRQKMTPPYIHNPMQEPLLDGNEPSSAP------RPPNVKTMLCL  256

Query  1003  GAFLTTSLSIPHQTKALMPVYAALG----------GRKLLQGSGTEHSSFGQ--------  1128
                LT   ++ H   A    Y+             GRKLLQ +G   ++  +        
Sbjct  257   VFMLTFFSTLNHHHSAESRFYSVSDNSNKGFVIPVGRKLLQVAGVLQNNVNEGGGGGIGT  316

Query  1129  WLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIK  1308
             +LGW MA IYMGGR+PQI LNIKRG VEGL+PLMFIFAL+ N+TYV SILV +T+W KIK
Sbjct  317   YLGWAMAVIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVASILVSSTSWSKIK  376

Query  1309  PNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
             PNLPWL+DA  CV LD FI++Q+IY+RY
Sbjct  377   PNLPWLVDAFGCVLLDTFILIQFIYFRY  404



>ref|XP_010908655.1| PREDICTED: uncharacterized protein LOC105034983 [Elaeis guineensis]
 ref|XP_010908656.1| PREDICTED: uncharacterized protein LOC105034983 [Elaeis guineensis]
Length=426

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 171/466 (37%), Positives = 227/466 (49%), Gaps = 90/466 (19%)
 Frame = +1

Query  184   LAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFR  363
             L++   P C   +  C  W   Y   CL ++ +  +  LGL S++ WGVAE+PQI+TN++
Sbjct  4     LSETLHPACSLNQH-CWQWARTYLNYCLYSVKEGMALALGLLSVVSWGVAEVPQIITNYK  62

Query  364   TKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVI  543
              KS+ G+S+ FL+TWI GD+FNL+GCLLEPATLPTQ Y AL                   
Sbjct  63    EKSTEGLSIAFLMTWIIGDLFNLIGCLLEPATLPTQFYMAL-------------------  103

Query  544   CESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKED----AGDSNQ  711
                                   LY  TT +L  Q++YY  +Y   K   D        + 
Sbjct  104   ----------------------LYMTTTAILTAQTVYYGHIYHRLKANNDRICHKSHRHH  141

Query  712   LVEEAKK------------------------PLRRNKSGGSGIPIPDGASRPAR--QHQA  813
             L +E+ K                        P+R      S  PIP  A    R   +  
Sbjct  142   LEDESTKERLLGYNMDDKEPRASNYQANGSNPIREGMHMTSS-PIPVAAPVIGRYGSYGR  200

Query  814   EYYYTSARSMAGSATPPFRSNLVKSGPSA---LGMDNDCSSDDETVE------APSMNSI  966
             + YY SARS++ S  P   S L  S  S+   L  D   S +   V       AP MN+ 
Sbjct  201   DLYYMSARSLSKSPIPTAGSWLAHSRDSSRTPLNHDQHLSHEPLVVRLIPPQSAPPMNTK  260

Query  967   SQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGS--------GTEHSSF  1122
             +    +P +A +    +  L +             L GRKLLQ          G   S  
Sbjct  261   NMLSVVPSAAFFLGVYSVHLFMNRAFSTSSHPAVILVGRKLLQDQVFESQVRHGDGSSGI  320

Query  1123  GQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDK  1302
             G  LGW MAAIYMGGR+PQI LNI+RG+VEGL+PLMFIFAL+ NATYVGSI+V +  W +
Sbjct  321   GSLLGWAMAAIYMGGRLPQICLNIRRGNVEGLSPLMFIFALIGNATYVGSIVVNSLDWSR  380

Query  1303  IKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSADYS  1440
             IKPNLPWL+DA  CV LD FI+LQ++Y+   +  +  SR +  D S
Sbjct  381   IKPNLPWLVDAGGCVLLDAFILLQFLYFHLQKPINVASRNNHFDSS  426



>ref|XP_004163970.1| PREDICTED: uncharacterized protein LOC101227133 [Cucumis sativus]
Length=420

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 175/446 (39%), Positives = 222/446 (50%), Gaps = 91/446 (20%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
             Q+S P C + K  C  WV+   K CLC   D  S  LG+ S+I WGVAEIPQIVTN+R K
Sbjct  5     QSSKPICPSNKH-CSEWVKNNMKYCLCGTKDGVSLTLGMISVISWGVAEIPQIVTNYREK  63

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             SS G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y AL                     
Sbjct  64    SSDGLSLAFLLTWILGDLFNVFGCILEPATLPTQYYMAL---------------------  102

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE-------------  690
                                 LYT TT +L  Q++YY  +Y   K +              
Sbjct  103   --------------------LYTITTGILFTQAIYYGHIYPQMKYRRRQCKGLVHSEANA  142

Query  691   --DAGDS----------NQLVEEAKKPLRRNK-SGGSGIPIPDGASRPARQHQAEYYYTS  831
               DA D           NQ+  +       +K    S  PIP    R       E YY S
Sbjct  143   QIDARDKAQQSYGSVNVNQVNNDDMSKFNTSKRESASTSPIPLPMLRQNSSTGRELYYMS  202

Query  832   ARSMAGSATPPFRSNL-VKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGA  1008
             ARS++ S TP   S L  K  P  +         +  ++    +S ++P  +        
Sbjct  203   ARSLSRSHTPTSGSFLRQKMTPPYI----HNPMQEPLLDGNEPSSAARPPNVKTMLCLVF  258

Query  1009  FLTTSLSIPHQTKALMPVYAALG----------GRKLLQGSGTEHSSFGQ--------WL  1134
              LT   ++ H   A    Y+             GRKLLQ +G   ++  +        +L
Sbjct  259   MLTFFSTLNHHHSAESRFYSVSDNSNKGFVIPVGRKLLQVAGVLQNNVNEGGGGGIGTYL  318

Query  1135  GWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPN  1314
             GW MA IYMGGR+PQI LNIKRG VEGL+PLMFIFAL+ N+TYV SILV +T+W KIKPN
Sbjct  319   GWAMAVIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVASILVSSTSWSKIKPN  378

Query  1315  LPWLLDAAVCVGLDLFIILQYIYYRY  1392
             LPWL+DA  CV LD FI++Q+IY+RY
Sbjct  379   LPWLVDAFGCVLLDTFILIQFIYFRY  404



>ref|XP_009142719.1| PREDICTED: uncharacterized protein LOC103866528 [Brassica rapa]
 ref|XP_009142720.1| PREDICTED: uncharacterized protein LOC103866528 [Brassica rapa]
 emb|CDX79960.1| BnaA05g01960D [Brassica napus]
Length=382

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 221/413 (54%), Gaps = 73/413 (18%)
 Frame = +1

Query  271   NISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLE  450
             ++    S  LG+ S+I WGVAEIPQI+TN+  KS+ G+S+ FL TWI GDIFNL+GCL+E
Sbjct  7     SVRHGLSLSLGVISVISWGVAEIPQIMTNYCEKSTEGLSIAFLTTWIIGDIFNLLGCLME  66

Query  451   PATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTV  630
             PATLPTQ Y AL                                         LYT TT 
Sbjct  67    PATLPTQFYMAL-----------------------------------------LYTVTTS  85

Query  631   VLVLQSMYYDFLYRWWKDKE----DAGDSNQLVEEAKKPLR-RNKSGGSGIP--------  771
             VL +QS+YY  +Y   K+K     +A   + +  +AK P R RN    +  P        
Sbjct  86    VLFVQSIYYGHIYPRLKNKRNQMVEAERISNICSDAKIPSRWRNSCSDATTPCGVQTTPI  145

Query  772   --IPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKS---GPSALGMDNDCSSDDE  936
               IP G+ R +   + E +YTSARS++ S TPP  S L +    G S   ++     DD 
Sbjct  146   TMIP-GSHRTSFTGR-ELFYTSARSLSSSHTPPAGSVLAQRMARGQSEPTLEEPLLPDDA  203

Query  937   TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMP---VYAALGGRKLLQ----  1095
             T  +   ++ S    +      G F  +SL    +T AL     V+     RKLLQ    
Sbjct  204   TFPSMPPSTKSLLCVVSVFMFLGTFNISSLLSEPRTMALGESDRVFVVRAARKLLQVTSG  263

Query  1096  ----GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATY  1263
                  SG E+S  G WLGW MA IYMGGR+PQI LN++RG VEGLNPLMF FAL+ N TY
Sbjct  264   NLAEHSGGENSKIGMWLGWAMAFIYMGGRLPQICLNMRRGHVEGLNPLMFFFALVGNMTY  323

Query  1264  VGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             VGSILV +  W KI PNLPWL+DA  CV LD  I+LQ+ ++R CRK++   ++
Sbjct  324   VGSILVASVEWSKIAPNLPWLVDAGGCVILDFLILLQFFHFR-CRKDTDSEKK  375



>ref|XP_010251612.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X3 [Nelumbo nucifera]
Length=394

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 171/430 (40%), Positives = 225/430 (52%), Gaps = 92/430 (21%)
 Frame = +1

Query  253   FKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNL  432
              K CLC+  D  S  LGL S+I WGVAE+PQI+TN++ KS+  +S+ FL+TWI GD+FNL
Sbjct  1     MKYCLCSAKDGASLTLGLISVISWGVAEVPQIITNYKKKSTESLSIAFLITWIIGDLFNL  60

Query  433   VGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQL  612
              GCLLEPATLPTQ Y A+                                         L
Sbjct  61    FGCLLEPATLPTQYYMAM-----------------------------------------L  79

Query  613   YTATTVVLVLQSMYYDFLYRWWKDKE-----------DAGDSNQLVEEAKKPLRRNKSGG  759
             YT TT++L LQ++YY  +Y   K              DA D         K  +++  G 
Sbjct  80    YTLTTLILALQTIYYSRIYHLLKSHRHGHKSPILPEIDAVDKEHYTNNFGK--KQSALGD  137

Query  760   SGI----PIPDGASRPARQHQA--EYYYTSARSMAGSATPPFRSNLVK----SGPSALGM  909
              G+    PIP      +R      E YY SARS++ S TP   S+L       G +++  
Sbjct  138   RGVLPSSPIPVSVPSHSRDGSCGRELYYMSARSLSRSHTPTAGSHLACPCGYEGTNSIS-  196

Query  910   DNDCSSDDETV--------EAPSMNSISQPKPIPRSAGYGAFLTT-SLSIPHQTKALMPV  1062
             D+DC S +E +          P MN+ +    +   +    FL+T  L +   ++  M +
Sbjct  197   DHDCRSIEEPLLSRVGSMQSTPPMNTKNM---LCVVSALTFFLSTFRLQLSANSRFSMYL  253

Query  1063  YAALGG------RKLLQGS--------GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKR  1200
                 GG      R+LLQ S        G   SS G +LGW MAAIYMGGR+PQIWLNI+R
Sbjct  254   ENQPGGHVIRIGRRLLQKSSGPLLENHGEGSSSVGTFLGWAMAAIYMGGRLPQIWLNIRR  313

Query  1201  GSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYI  1380
             G V GLNPLMF+FAL+ NATYV SILV +    KI+PNLPWL+DA  C+ LD FII+Q+I
Sbjct  314   GHVGGLNPLMFVFALVGNATYVASILVSSLNLSKIRPNLPWLVDAGGCILLDCFIIIQFI  373

Query  1381  YYRYCRKNSG  1410
             ++RY RK  G
Sbjct  374   HFRY-RKPKG  382



>emb|CDY53677.1| BnaC04g52270D [Brassica napus]
Length=382

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 171/415 (41%), Positives = 223/415 (54%), Gaps = 77/415 (19%)
 Frame = +1

Query  271   NISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLE  450
             ++    S  LG+ S+I WGVAEIPQI+TN+  KS+ G+S+ FL TWI GDIFNL+GCL+E
Sbjct  7     SVRHGLSLSLGVISVISWGVAEIPQIMTNYCEKSTEGLSIAFLTTWIIGDIFNLLGCLME  66

Query  451   PATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTV  630
             PATLPTQ Y AL                                         LYT TT 
Sbjct  67    PATLPTQFYMAL-----------------------------------------LYTVTTS  85

Query  631   VLVLQSMYYDFLYRWWKDKE----DAGDSNQLVEEAKKPLR-RNKSGGSGIP--------  771
             VL +QS+YY  +Y   K++     +A   + +  +AK P R RN    +  P        
Sbjct  86    VLFVQSIYYGHIYPRLKNRRNQMVEAERISNICNDAKIPSRWRNSCSDAATPCGVQTTPI  145

Query  772   --IPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKS---GPSALGMDNDCSSDDE  936
               IP G+ R +   + E +YTSARS++ S TPP  S L +    G S   ++     DD 
Sbjct  146   TMIP-GSHRTSFTGR-ELFYTSARSLSSSHTPPAGSVLAQRMARGQSEPTLEEPLLPDDA  203

Query  937   TVEAPSM--NSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMP---VYAALGGRKLLQ--  1095
             T   PSM  ++ S    +      G F  +SL    +T AL     V+     RKLLQ  
Sbjct  204   T--PPSMPPSTKSLLCVVSVFMFLGTFNLSSLLSEPRTMALGESDRVFVVQAARKLLQVT  261

Query  1096  ------GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANA  1257
                    +G E+S  G WLGW MA IYMGGR+PQI LN++RG VEGLNPLMF FAL+ N 
Sbjct  262   SGNLAEHNGGENSKIGMWLGWAMAFIYMGGRLPQICLNMRRGHVEGLNPLMFFFALVGNM  321

Query  1258  TYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             TYVGSILV +  W KI PNLPWL+DA  CV LD  I+LQ+ ++R CRK++   ++
Sbjct  322   TYVGSILVASVEWSKIAPNLPWLVDAGGCVVLDFLILLQFFHFR-CRKDTDSDKK  375



>ref|NP_001159199.1| hypothetical protein [Zea mays]
 ref|XP_008673042.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25379.1| unknown [Zea mays]
 tpg|DAA54054.1| TPA: hypothetical protein ZEAMMB73_248271 [Zea mays]
 tpg|DAA54055.1| TPA: hypothetical protein ZEAMMB73_248271 [Zea mays]
Length=418

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 165/452 (37%), Positives = 220/452 (49%), Gaps = 85/452 (19%)
 Frame = +1

Query  202   PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
             P      + C  W   Y + CLC+  +  +  LGL S+I WG AE+PQI+TN+R KS+ G
Sbjct  9     PASCPATRHCAEWARIYLRYCLCSQKEGAALALGLISVISWGFAEVPQIMTNYRQKSTEG  68

Query  382   VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
             +S+ FL+TWI GD+FNLVGC LEPATLPTQ+Y AL                         
Sbjct  69    LSVAFLMTWIVGDLFNLVGCFLEPATLPTQMYMAL-------------------------  103

Query  562   NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE-------------DAGD  702
                             LYT TT++L +Q++YY  +Y   + K+             DA  
Sbjct  104   ----------------LYTITTLILTVQTIYYSHIYHRLEAKKSRAASKAQKHQRADASL  147

Query  703   SNQLVEEAKKPLRRNKSGGSGI-----PIPDGASRPARQH----QAEYYYTSARSMAGSA  855
               +L+      L RN    + +     PIP       + H      +YYY SARS++ S 
Sbjct  148   RERLLGAKDGVLSRNNGSDATVLIPSSPIPVNVKLVDQYHGSSPNTDYYYMSARSLSRSP  207

Query  856   TPPFRSNLVKSGPSALG----MDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTS  1023
              P   + L  +  S +      D   S   E   A S  S      +  +   G  L T 
Sbjct  208   VPTAGTWLGSNRQSLMTPPQTNDQRGSLIGEIAPAHSAPSTVTKNALSVAPWMGLLLGTC  267

Query  1024  L----------SIPHQT-----KALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIY  1158
             L           +P  T     + L+      G   L  G+G+E    G++LGW MA IY
Sbjct  268   LLHILIGNTHREMPSGTVIPVGRRLLVFVEGHGNSSLSHGNGSE---IGRYLGWAMAIIY  324

Query  1159  MGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAA  1338
             MGGR+PQI LN++RG  EGLNPLMF FALL N+TYVGSILV +  W K+ PNLPWL+DA 
Sbjct  325   MGGRLPQILLNMQRGHAEGLNPLMFTFALLGNSTYVGSILVNSLDWSKVGPNLPWLVDAG  384

Query  1339  VCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
              CV LD FIILQ++Y+ Y ++       D AD
Sbjct  385   GCVLLDSFIILQFLYFHYRKQRELSDEHDKAD  416



>ref|XP_003611898.1| Membrane protein, putative [Medicago truncatula]
Length=196

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 140/181 (77%), Gaps = 5/181 (3%)
 Frame = +1

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG-YGAFLTTSLSIPHQTKAL  1053
             + KSGPSA+G++ D SSDDE    P+    +QP+ IPRSAG YG FL  S+++PHQ+ AL
Sbjct  3     VAKSGPSAMGLNEDSSSDDEAHSVPA----TQPRQIPRSAGSYGTFLAASINLPHQSNAL  58

Query  1054  MPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMF  1233
                Y AL GRKLL      HS+ GQWLGW+MAAIY GGRIPQIWLNIKRGSVEGLNP MF
Sbjct  59    KVGYIALSGRKLLSQEHVTHSALGQWLGWLMAAIYTGGRIPQIWLNIKRGSVEGLNPFMF  118

Query  1234  IFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGG  1413
             IFAL+ANATYVGSILVRTT W+ IK N+PWLLDA VCV LDLFIILQYI YRY RK +  
Sbjct  119   IFALIANATYVGSILVRTTEWESIKANMPWLLDAIVCVALDLFIILQYINYRYHRKTTTS  178

Query  1414  S  1416
             S
Sbjct  179   S  179



>ref|XP_009407106.1| PREDICTED: uncharacterized protein LOC103989888 [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 168/459 (37%), Positives = 222/459 (48%), Gaps = 98/459 (21%)
 Frame = +1

Query  202   PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
             P C++ +  C  W   Y K CLC++ D  +  LG  S+I WG+AE+PQI+TN+R KS+ G
Sbjct  10    PVCLSSRH-CSHWARIYLKYCLCSVKDGMALFLGTISIISWGIAEVPQIITNYRQKSTEG  68

Query  382   VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
             +S+ FLLTW+ GD+FN +GCLLEPATLPTQ Y AL                         
Sbjct  69    LSIAFLLTWVVGDLFNFIGCLLEPATLPTQYYVAL-------------------------  103

Query  562   NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK------------------  687
                             LYTATT++L  Q++YY  +Y  +K                    
Sbjct  104   ----------------LYTATTLILTGQTIYYGHIYHRFKANCGVPGRIEIIKKIGIGTY  147

Query  688   -----------------EDAGDSNQLVEEAKKPLRRNKSGGSGI-------PIPDGASRP  795
                              EDA +   L+ +AKK       G           PIP      
Sbjct  148   GSNSYISNEIYHFGYVLEDASERESLLGDAKKTRVVGDRGHDAKEGNLPSSPIPVAGQVF  207

Query  796   ARQHQAEYYYTSARSMAGSATPPF-----RSNLVKSGPSALGMDNDCSSDDETVEAPSMN  960
                   ++YY SARS+  S  P F      S+     P   G      S    ++  +M 
Sbjct  208   HDSCGKDFYYMSARSLKKSPVPTFGFWSVHSHDDGRAPPIDGNQQSPQSAPSNLDTKNMF  267

Query  961   SISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPV-YAALGGRKLLQGSGTEHSS--FGQW  1131
             SI     +P  A +         I +   A  P     L GRKLLQ    +  S   G  
Sbjct  268   SI-----VPSVAFFFGICVIRSYISNMHTASSPGGMVILVGRKLLQDKVQDDGSSGVGTL  322

Query  1132  LGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKP  1311
             LGW MAAIYMGGR+PQI LNI+RG+V+GLNPLMFIFAL  NATYVGSILV +  W K++P
Sbjct  323   LGWAMAAIYMGGRLPQICLNIRRGNVKGLNPLMFIFALTGNATYVGSILVNSLEWSKLRP  382

Query  1312  NLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             NLPWL+DA  CV LD FI++Q+ Y+ + R+++    ED+
Sbjct  383   NLPWLVDAGGCVILDAFILIQFAYF-HIRESNKRESEDN  420



>ref|XP_009419694.1| PREDICTED: uncharacterized protein LOC103999622 [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   260 bits (665),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 163/454 (36%), Positives = 231/454 (51%), Gaps = 78/454 (17%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MS  + + P      + C  W + Y K CLC+  D  S  LG  S+I W +AEIPQI+TN
Sbjct  1     MSFLKTAPPPDCFLNQHCSRWAQMYLKYCLCSTKDGISLFLGAASIISWVIAEIPQIMTN  60

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             +  KS+ G+S+ FL+TWI GD+FNL+GCLLEPATLPTQ Y AL                 
Sbjct  61    YCEKSTEGLSIAFLMTWIVGDLFNLIGCLLEPATLPTQYYVAL-----------------  103

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWK------------  681
                                     LYTA+TV+L  Q+MYY ++Y   +            
Sbjct  104   ------------------------LYTASTVILTGQTMYYGYIYHRLEPNKHGIHVKSQK  139

Query  682   -DKEDAGDSNQLVEEAKKP-LRRNKSGGSG----IPIPDG---ASRPARQHQAEYYYTSA  834
               +ED      L+ ++KK  +   +S G+     + IP            + +++YYTSA
Sbjct  140   HHQEDGSAEECLLGDSKKTRVHGYQSNGTSPSKEVNIPSSPIPVEVLCDSYGSDFYYTSA  199

Query  835   RSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFL  1014
             RS++ S  P F + L  S  +  G      +     + P ++ I  P+  P +      L
Sbjct  200   RSLSKSPVPAFGAWLAHSCDNG-GSPPRSGNQQSVAKEPLIDRIIFPQSAPPNLSTKNML  258

Query  1015  TT--------SLSIPHQTKALMPVYAALG-----GRKLLQGSGTEHSSFG--QWLGWMMA  1149
                        + + H     +   +  G     GRKLLQ    +  S G    LGW MA
Sbjct  259   AVVPSAVFFFGMCVLHLCTNDVHTASPNGMVIRVGRKLLQDHVQDDGSIGVGNLLGWAMA  318

Query  1150  AIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLL  1329
             AIYMG R+PQI+LNI+RG+V+GLNPLMF+FA+  NATYVGSILV +  W KI+PNLPWL 
Sbjct  319   AIYMGARLPQIYLNIRRGNVQGLNPLMFVFAVSGNATYVGSILVESLDWHKIRPNLPWLA  378

Query  1330  DAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA  1431
             DA  C+ LD+FI++Q+ Y+ Y ++    S+++ A
Sbjct  379   DAGGCILLDVFILIQFFYFHYRKQQRSESKDNPA  412



>ref|XP_003566800.1| PREDICTED: uncharacterized protein LOC100836633 [Brachypodium 
distachyon]
Length=418

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 172/451 (38%), Positives = 231/451 (51%), Gaps = 101/451 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W + Y K CLC+  D  +  LGL S+I WGVAE+PQI+TN++ KS+ G+S+ FL+TW
Sbjct  18    CAQWAQTYLKYCLCSTKDGVALGLGLASVISWGVAEVPQIITNYKQKSTEGLSIAFLMTW  77

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GC LEPATLPTQ Y AL                                  
Sbjct  78    IVGDLFNLAGCFLEPATLPTQFYMAL----------------------------------  103

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKD-------------KEDAGDSNQLV--EE  723
                    LYT TTV+L  Q++YY  +Y   K              + DA   ++L+   +
Sbjct  104   -------LYTITTVILTGQTLYYSHIYHHVKATKTRATGKPQKHLRRDASLRDKLLGHRD  156

Query  724   AKKPLRRNKSGGSGIPIPDG----ASRPARQHQ------AEYYYTSARSMAGSATP---P  864
              + P R N   G  IPIP      ++   RQ        ++YYY SARS++ S  P    
Sbjct  157   DEAP-RNNSQSGVTIPIPSSPIQVSTEVFRQRHGSISPSSDYYYVSARSLSRSPVPIGGA  215

Query  865   FRSNLVKSGPSALGMDNDCSSDDETVEAPSM------NSISQPKPIPRSAGYGAFLTTSL  1026
             +  N  ++  +    D + S   E   A S       NS+S    I    G    L   +
Sbjct  216   WLGNNRQTTKTPQTNDQNESLVGEFAPAQSAPATITKNSLSVVPWISVLLGM-CVLHILV  274

Query  1027  SIPHQTKA---LMPVYAALGGRKLL------------QGSGTEHSSFGQWLGWMMAAIYM  1161
                H+  +   ++PV     GRKLL             GSG+E    G +LGW MA IYM
Sbjct  275   GTAHKEVSNGIIIPV-----GRKLLALADDHADSSLRHGSGSE---IGSFLGWAMAIIYM  326

Query  1162  GGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAV  1341
             GGR+PQI+LN++RG  EGL+PLMF FAL+ N+TYVGSILV +  W +++PNLPWL+DA  
Sbjct  327   GGRLPQIFLNMQRGHAEGLSPLMFTFALVGNSTYVGSILVNSMDWSRLRPNLPWLVDAGG  386

Query  1342  CVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             CV LD FIILQ++Y+ Y RK S  +  D+ D
Sbjct  387   CVLLDSFIILQFLYFHY-RKQSEPAELDNVD  416



>ref|XP_006481307.1| PREDICTED: uncharacterized protein LOC102608727 isoform X1 [Citrus 
sinensis]
 ref|XP_006481308.1| PREDICTED: uncharacterized protein LOC102608727 isoform X2 [Citrus 
sinensis]
 ref|XP_006481309.1| PREDICTED: uncharacterized protein LOC102608727 isoform X3 [Citrus 
sinensis]
 ref|XP_006481310.1| PREDICTED: uncharacterized protein LOC102608727 isoform X4 [Citrus 
sinensis]
Length=414

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 172/433 (40%), Positives = 219/433 (51%), Gaps = 94/433 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W   Y + CLC++ D  S  LGL S+I WGVAE+PQI+TN+  KS+ G+S+ FL TW
Sbjct  17    CAEWARIYMEYCLCSVRDGVSLGLGLASVISWGVAEVPQIITNYEEKSTEGLSIAFLTTW  76

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FN+ GCLLEPATLPTQ Y A+                                  
Sbjct  77    ILGDLFNVFGCLLEPATLPTQYYMAM----------------------------------  102

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE--DAGDSNQLVEEAKKPLRRNKSGGS  762
                    LYT TTV+L  Q+MYY  +Y   K  +    G      E A+K   R  S G 
Sbjct  103   -------LYTLTTVILTAQTMYYSHIYPRLKHNKRPQTGLMPNQPEAAEK--TRPSSNGV  153

Query  763   G----------------------IPIP------DGASRPARQHQAEYYYTSARSMAGSAT  858
             G                      IPIP      +G+  P R    E YYTSARS++ S T
Sbjct  154   GEQVNSSGKWKIDSDTSDTENFSIPIPLPPFPRNGS--PGR----ELYYTSARSLSSSHT  207

Query  859   PPFRSNLVK----SGPSALGMDNDCSSDDETVEAP-SMNSISQPKPIPRSAGYGAFLTTS  1023
             P   S + +    S  S + ++        + ++P S N+ +    +P       F    
Sbjct  208   PTAGSFIAQRMSPSHHSRISIEEPLLGGHISTQSPPSTNTKTMLCLVPIMIFLTTFNFHY  267

Query  1024  LSIPHQTKALMPV--YAALGGRKLLQGSGT--------EHSSFGQWLGWMMAAIYMGGRI  1173
              +  H T    P   +     RKLLQ SG           S  G +LGW MAAIYMGGR+
Sbjct  268   SNTEHDTVFEKPNKGFVIQVRRKLLQVSGGLLQESVTGGSSGIGSYLGWAMAAIYMGGRL  327

Query  1174  PQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGL  1353
             PQI LNI+RG VEGLNPLMF+FAL+ NATYV SILV +  W +I+PNLPWL+DA  CV L
Sbjct  328   PQICLNIRRGHVEGLNPLMFVFALVGNATYVASILVNSVDWSRIRPNLPWLVDAGGCVLL  387

Query  1354  DLFIILQYIYYRY  1392
             D FI++Q+IYYRY
Sbjct  388   DSFILIQFIYYRY  400



>gb|KDO64268.1| hypothetical protein CISIN_1g015046mg [Citrus sinensis]
Length=414

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 172/433 (40%), Positives = 219/433 (51%), Gaps = 94/433 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W   Y + CLC++ D  S  LGL S+I WGVAE+PQI+TN++ KS+ G+S+ FL TW
Sbjct  17    CAEWARIYMEYCLCSVRDGVSLGLGLASVISWGVAEVPQIITNYKEKSTEGLSIAFLTTW  76

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FN+ GCLLEPATLPTQ Y A+                                  
Sbjct  77    ILGDLFNVFGCLLEPATLPTQYYMAM----------------------------------  102

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE--DAGDSNQLVEEAKKPLRRNKSGGS  762
                    LYT TTV+L  Q+MYY  +Y   K  +    G      E A+K   R  S G 
Sbjct  103   -------LYTLTTVILTAQTMYYSHIYPRLKHNKRPQTGLMPNQPEAAEK--TRPSSNGV  153

Query  763   G----------------------IPIP------DGASRPARQHQAEYYYTSARSMAGSAT  858
             G                      IPIP      +G+  P R    E YYTSARS++ S T
Sbjct  154   GEQVNSSGKWKIDSDTSDTENFSIPIPLPPFPRNGS--PGR----ELYYTSARSLSSSHT  207

Query  859   PPFRSNLVK----SGPSALGMDNDCSSDDETVEAP-SMNSISQPKPIPRSAGYGAFLTTS  1023
             P   S + +    S  S + ++        + ++P S N+ +    +P       F    
Sbjct  208   PTAGSFIAQRMSPSHHSRISIEEPLLGGHISTQSPPSTNTKTMLCLVPIMIFLTTFNFHY  267

Query  1024  LSIPHQTKALMPV--YAALGGRKLLQGSGT--------EHSSFGQWLGWMMAAIYMGGRI  1173
              +  H T    P   +     RKLLQ SG           S  G +LGW MAAIYMGGR+
Sbjct  268   SNTEHDTVFEKPNKGFVIQVRRKLLQVSGGLLQESVTGGSSGIGSYLGWAMAAIYMGGRL  327

Query  1174  PQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGL  1353
             PQI LNI+RG VEGLNPLMF+FAL+ NATYV SILV +  W +I+PNLPWL DA  CV L
Sbjct  328   PQICLNIRRGHVEGLNPLMFVFALVGNATYVASILVNSVDWSRIRPNLPWLADAGGCVLL  387

Query  1354  DLFIILQYIYYRY  1392
             D FI++Q+IYYRY
Sbjct  388   DSFILIQFIYYRY  400



>ref|XP_010505867.1| PREDICTED: uncharacterized protein LOC104782594 [Camelina sativa]
 ref|XP_010505868.1| PREDICTED: uncharacterized protein LOC104782594 [Camelina sativa]
Length=374

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 171/422 (41%), Positives = 218/422 (52%), Gaps = 95/422 (23%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S  LG+ S+I WGVAEIPQI+TN+  KS+ G+S+ FL TWI GDIFNL+GCL+EPAT
Sbjct  9     EGLSLSLGVISVISWGVAEIPQIMTNYSEKSTEGLSIAFLTTWIIGDIFNLLGCLMEPAT  68

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPTQ Y AL                                         LYT TT VL 
Sbjct  69    LPTQFYMAL-----------------------------------------LYTVTTSVLF  87

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVE---------EAKKPLR-RNKS-----GGSGIPI  774
              QS+YY  +Y   K++      NQ+VE         + K P R RN S     GG   PI
Sbjct  88    FQSLYYGHVYPRLKNRR-----NQMVEAERIANISSDVKIPGRWRNSSNTAPCGGHTTPI  142

Query  775   P--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEA  948
                 G+ R +   + E +YTSARS++ S TPP          S L         + T+E 
Sbjct  143   TMIPGSHRNSFTGR-ELFYTSARSLSSSHTPP--------AGSVLAQRMARGHSEPTLEE  193

Query  949   PSMNSISQPKPIPRSAG-----------YGAFLTTSLSIPHQTKALMP---VYAALGGRK  1086
             P +   + P  +P S              G F   +L    +T AL     V+     RK
Sbjct  194   PLLPEDASPPSLPPSTKSLLCVVSAFMFLGTFNLPNLLSESRTAALGERDRVFVVQAARK  253

Query  1087  LLQGS--------GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             LLQ S        G E S  G +LGW M AIY+GGR+PQI LN++RG VEGLNPLMF+FA
Sbjct  254   LLQVSSGNLVEHGGGESSRTGMFLGWAMTAIYLGGRLPQICLNMRRGHVEGLNPLMFLFA  313

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             L+ N TYVGSILV +  W KI PNLPWL+DA  CV LD  I+LQ+ ++R CRK+    +E
Sbjct  314   LIGNMTYVGSILVNSVEWLKIAPNLPWLVDAGGCVVLDFLILLQFFHFR-CRKDKDTDKE  372

Query  1423  DS  1428
             ++
Sbjct  373   EA  374



>ref|XP_007028338.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOY08840.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 2 [Theobroma cacao]
Length=388

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 167/432 (39%), Positives = 230/432 (53%), Gaps = 74/432 (17%)
 Frame = +1

Query  217   EKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLF  396
              ++ C  W   Y   C+C+  D+ SF LGL S+I W VAEIPQI+TN++ KS  G+SL F
Sbjct  7     RRRECWEWARVYINYCICSARDEGSFALGLISVISWSVAEIPQIITNYKEKSIEGLSLGF  66

Query  397   LLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYH  576
             L+TWI GD+FNL GC+LEPATLPTQ Y A+                              
Sbjct  67    LITWIVGDLFNLFGCILEPATLPTQFYMAV------------------------------  96

Query  577   YYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAG-DSNQLVEEAKKPLRRNKS  753
                        LYT TT +L  Q++YY  +Y   K K     DS +   EA + +     
Sbjct  97    -----------LYTMTTSILAAQTVYYGHIYPRLKYKRVCHKDSKEHQPEAVEKVIDADR  145

Query  754   GGSGIPIP--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVK--SGPSALGMDNDC  921
               S IP+P  +  S P R    E YY SARS++ S TP   S LV+  + PS     +  
Sbjct  146   LSSPIPLPAINVKSSPGR----ELYYMSARSLSRSHTPTAGSFLVQRMTPPS-----HTR  196

Query  922   SSDDETVEAPSMNSISQPKPIPRS-----------AGYGAFLTTSLSIPHQTKALMPVYA  1068
             SS +E + +  +++ S   P  +S           A + + L+    +  + K +   + 
Sbjct  197   SSVEEPLLSAHVSAQSASPPSSKSLLCLVSVLMFIATFNSQLSAFNKLHIEHKIVNQGFV  256

Query  1069  ALGGRKLLQGSGTEH--------SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNP  1224
                GRKLLQ +            S  G +LGW MA IYMGGR+PQI LNI+RG+VEGLNP
Sbjct  257   IQIGRKLLQVNAASLGESGIGGGSRVGTFLGWAMATIYMGGRLPQICLNIRRGNVEGLNP  316

Query  1225  LMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN  1404
              MF+FAL+ N+TYV SILV +T W +I+PNLPWL+DAA CV LD FI++Q+IY+ Y    
Sbjct  317   FMFMFALVGNSTYVASILVESTDWSRIRPNLPWLVDAAGCVLLDTFILIQFIYFCYWAPQ  376

Query  1405  SGGSREDSADYS  1440
                ++ ++ + S
Sbjct  377   DAENKHENLNAS  388



>gb|EYU45103.1| hypothetical protein MIMGU_mgv1a017749mg, partial [Erythranthe 
guttata]
Length=307

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/364 (43%), Positives = 206/364 (57%), Gaps = 73/364 (20%)
 Frame = +1

Query  205   YCVAEKKPCVV-WVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
             YC  E+K C+  W+  +FKDCLCN+ D+ SFV G+F L  W VAEIPQI+TNF  KS+  
Sbjct  8     YCTVERKACINGWINDWFKDCLCNLKDEISFVFGVFGLFFWAVAEIPQIITNFNNKSASA  67

Query  382   VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
             VSL FL TWI GDIFNLVGC+LEPAT                                  
Sbjct  68    VSLAFLSTWIIGDIFNLVGCILEPAT----------------------------------  93

Query  562   NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKD-----KEDAGDSNQLVEEA  726
                             LYT  T++L LQ +YY+   +WWK      K    + + L    
Sbjct  94    --------------AMLYTTVTIILALQCVYYNHFLQWWKSSHKEAKTVKDEVDSLEPGL  139

Query  727   KKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVK--SGPSA  900
             + PL    +  + +P+             ++Y+ SARS+AGS TPP R + +K  SGP A
Sbjct  140   QDPLITTTTMTTNVPV-------EVPRTTDFYFMSARSLAGSETPP-RQHYIKARSGPPA  191

Query  901   LGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAA-LG  1077
             L  D+  SS ++  + P    I+QP+ IPR+  YG F++ S ++P  ++AL  V++    
Sbjct  192   LEHDSSDSSSEQ--DEPL---ITQPRAIPRTVRYGLFVSASANLPQLSRALRRVHSVEFP  246

Query  1078  GRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANA  1257
             G +L Q      +++GQWLGW+MA IYMGGRIPQIWLNIKRG+VEGLNPLMF+FALLANA
Sbjct  247   GSRLSQ---EYENAYGQWLGWLMAVIYMGGRIPQIWLNIKRGNVEGLNPLMFVFALLANA  303

Query  1258  TYVG  1269
             TYVG
Sbjct  304   TYVG  307



>ref|NP_001042681.1| Os01g0266800 [Oryza sativa Japonica Group]
 dbj|BAD81134.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04595.1| Os01g0266800 [Oryza sativa Japonica Group]
 dbj|BAG91453.1| unnamed protein product [Oryza sativa Japonica Group]
Length=420

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 177/448 (40%), Positives = 227/448 (51%), Gaps = 95/448 (21%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W + Y K CLC+  D  +  LGL S+I WGVAE+PQI+TN++ KS+ G+SL FL+TW
Sbjct  20    CAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTW  79

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD FNL+GC LEP TLPTQ Y AL                                  
Sbjct  80    IVGDFFNLIGCFLEPETLPTQFYMAL----------------------------------  105

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSN---------QLVEEAKKP--  735
                    LYT TTV+L  Q++YY  +Y   K K+    S           L E+   P  
Sbjct  106   -------LYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASLREKLLGPKV  158

Query  736   ---LRRNKSGGSGIPIPDGA-----SRPARQHQ-----AEYYYTSARSMAG-----SATP  861
                +R N   G+ +PIP  +     +   RQ       +EYYYTSARS++      S T 
Sbjct  159   IGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSSSPVPMSGTW  218

Query  862   PFRSNLVKSGPSALGMDNDCSSD---DETVEAPSM-NSISQPKPIPRSAGYGA--FL--T  1017
                 +   S P          S+    +   +P + NS+S    +    G     FL  T
Sbjct  219   SANYHQTNSPPEIDDQKESLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGMSVLHFLVGT  278

Query  1018  TSLSIPHQTKALMPVYAALGGRKLL---------QGSGTEHSSFGQWLGWMMAAIYMGGR  1170
             T   +P+    ++PV     GR+LL           S    S  G +LGW MA IYMGGR
Sbjct  279   THQEVPNGI--VIPV-----GRRLLLLADDHADSSVSNGSGSGIGSFLGWAMAVIYMGGR  331

Query  1171  IPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVG  1350
             +PQIWLN+KRG+ EGLNPLMF FAL+ N TYVGSILV++  W K+KPNLPWL+DA  CV 
Sbjct  332   LPQIWLNMKRGNAEGLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNLPWLVDAGGCVL  391

Query  1351  LDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             LD FIILQ++Y+ Y RK       DSAD
Sbjct  392   LDTFIILQFLYFHY-RKRHVPDEPDSAD  418



>ref|XP_010517585.1| PREDICTED: uncharacterized protein LOC104793012 [Camelina sativa]
Length=374

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 170/422 (40%), Positives = 218/422 (52%), Gaps = 95/422 (23%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S  LG+ S+I WGVAEIPQI+TN+  KS+ G+S+ FL TWI GDIFNL+GCL+EPAT
Sbjct  9     EGLSLSLGVISVISWGVAEIPQIMTNYSEKSTEGLSIAFLTTWIIGDIFNLLGCLMEPAT  68

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPTQ Y AL                                         LYT TT VL 
Sbjct  69    LPTQFYMAL-----------------------------------------LYTVTTSVLF  87

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAK-------KPLR---RNKS-----GGSGIPI  774
             LQS+YY  +Y   +++      NQ+VE  +         +R   RN S     G    PI
Sbjct  88    LQSIYYGHIYPRLRNRR-----NQMVEAERIANISSDVKIRGRWRNSSDTAPCGVHTTPI  142

Query  775   P--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEA  948
                 G+ R +   + E +YTSARS++ S TPP          S L         + T+E 
Sbjct  143   TMIPGSHRNSFTGR-ELFYTSARSLSSSHTPP--------AGSVLAQRMARGHSEPTLEE  193

Query  949   PSMNSISQPKPIPRSAG-----------YGAFLTTSLSIPHQTKALMP---VYAALGGRK  1086
             P +   + P  +P S              G F   +L    +T AL     V+     RK
Sbjct  194   PLLPEDASPPSLPPSTKSLLCVVSAFMFLGTFNLPNLLSESRTAALGERDRVFVVQAARK  253

Query  1087  LLQGS--------GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             LLQ S        G E S  G +LGW MAAIY+GGR+PQI LN++RG VEGLNPLMF+FA
Sbjct  254   LLQVSSGNLVEHGGGESSRTGMFLGWAMAAIYLGGRLPQICLNMRRGHVEGLNPLMFLFA  313

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
             L+ N TYVGSILV +  W KI PNLPWL+DA  CV LD  I+LQ+ ++R CRK+    +E
Sbjct  314   LIGNMTYVGSILVNSVEWLKIAPNLPWLVDAGGCVVLDFLILLQFFHFR-CRKDKDTDKE  372

Query  1423  DS  1428
             D+
Sbjct  373   DA  374



>ref|XP_002457622.1| hypothetical protein SORBIDRAFT_03g010545 [Sorghum bicolor]
 gb|EES02742.1| hypothetical protein SORBIDRAFT_03g010545 [Sorghum bicolor]
Length=419

 Score =   256 bits (654),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 164/453 (36%), Positives = 215/453 (47%), Gaps = 86/453 (19%)
 Frame = +1

Query  202   PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
             P      + C  W   Y K CLC+  +  +  LGL S+I WG+AE+PQI+TN+R KS+ G
Sbjct  9     PASCPATRHCAEWARIYLKYCLCSQKEGAALALGLISVISWGLAEVPQIITNYRQKSTEG  68

Query  382   VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
             +S+ FL+TWI GD+FNLVGC LEPATLPTQ Y AL                         
Sbjct  69    LSVAFLMTWIVGDLFNLVGCFLEPATLPTQFYMAL-------------------------  103

Query  562   NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE-------------DAGD  702
                             LYT TT++L  Q++YY  +Y   K K+             DA  
Sbjct  104   ----------------LYTMTTLILTGQTLYYSHIYHRLKAKKSRAASKPQKHHRGDASL  147

Query  703   SNQLVEEAKKPLRRNKSGGSGI------PIPDGASRPARQH----QAEYYYTSARSMAGS  852
               +L+        RN +           PIP       + H      +YYY SARS++ S
Sbjct  148   REKLLGAKDGAASRNNNESDATVLIPSSPIPVNMKFVDQCHGSSPSTDYYYMSARSLSSS  207

Query  853   ATPP----FRSNLVKSGPSALGMDNDCSSDDETV---EAPSMNSISQPKPIPRSAGYGAF  1011
               P       SN   S       D   S   E      APS  + +     P        
Sbjct  208   PVPTAGTWLGSNRQSSRTPPQTNDQRGSLVGEIAPAHSAPSTVTKNALSVAPWMGLLLGM  267

Query  1012  LTTSLSIPHQTKALMPVYAALGGRKLL------------QGSGTEHSSFGQWLGWMMAAI  1155
                 + + +  + +        GR+LL             GSG+E    G +LGW MA I
Sbjct  268   CLLHILVGNTHREMPSGTVIPVGRRLLLFVDDHGNSSLSHGSGSE---IGSFLGWAMAII  324

Query  1156  YMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDA  1335
             YMGGR+PQI LN++RG VEGLNPLMF FAL+ N+TYVGSILV +  W K++PNLPWL+DA
Sbjct  325   YMGGRLPQILLNMQRGHVEGLNPLMFAFALVGNSTYVGSILVNSMDWSKLRPNLPWLVDA  384

Query  1336  AVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
               CV LD FIILQ++Y+ Y ++       D AD
Sbjct  385   GGCVLLDSFIILQFLYFHYRKQREPSDEHDDAD  417



>ref|XP_002881756.1| PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58015.1| PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=380

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 170/412 (41%), Positives = 212/412 (51%), Gaps = 95/412 (23%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S  LG+ S+I WGVAEIPQI+TN+  KS+ G+S+ FL TW+ GDIFNL+GCL+EPAT
Sbjct  9     DGLSLSLGVISVISWGVAEIPQIMTNYTEKSTEGLSIAFLTTWMIGDIFNLLGCLMEPAT  68

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPTQ Y AL                                         LYT TT VL 
Sbjct  69    LPTQFYMAL-----------------------------------------LYTVTTSVLY  87

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVE---------EAKKPLR-RNKS-----GGSGIPI  774
             +QS+YY  +Y   K++      NQ+VE         + K P R RN S     GG   PI
Sbjct  88    VQSIYYGHIYPRLKNRR-----NQMVEAERISSISSDVKIPGRWRNSSDTTTCGGQTTPI  142

Query  775   P--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEA  948
                 G+ R +   + E +YTSARS++ S TPP          S L         + T+E 
Sbjct  143   TMIPGSHRTSFTGR-ELFYTSARSLSSSHTPP--------AGSVLAQRMARGHSEPTLEE  193

Query  949   PSMNSISQPKPIPRSAG-----------YGAFLTTSLSIPHQTKALMP---VYAALGGRK  1086
             P +   S P  +P S              G F   ++    +T AL     V+     RK
Sbjct  194   PLLPGDSTPPSLPPSTKSMLCVVSVFLFLGTFNLPNMLSESRTMALGERDRVFVVRAARK  253

Query  1087  LLQ--------GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             LLQ         SG E S  G +LGW MAAIYMGGR+PQI LN++RG VEGLNPLMF FA
Sbjct  254   LLQVTSSNVGEHSGGESSRIGMFLGWAMAAIYMGGRLPQICLNMRRGHVEGLNPLMFFFA  313

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
             L+ N TYV SILV +  W KI PNLPWL+DA  CV LD  I+LQ+ ++R CR
Sbjct  314   LVGNMTYVASILVNSVEWLKIAPNLPWLVDAGGCVVLDFLILLQFFHFR-CR  364



>gb|AFK47806.1| unknown [Medicago truncatula]
Length=394

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 169/427 (40%), Positives = 228/427 (53%), Gaps = 82/427 (19%)
 Frame = +1

Query  193   NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             NS   C+  +  C+  V+   +    + +   S  LG+ S+I W +AEIPQ++TN+R KS
Sbjct  7     NSTSLCLGNQH-CLQLVQMVMR----SDAKTASITLGVISVIVWMIAEIPQLITNYREKS  61

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             SHG+S+ FLLTWI GD+FNL GCLLEPATLPTQLYTA+                      
Sbjct  62    SHGLSVTFLLTWIIGDLFNLFGCLLEPATLPTQLYTAV----------------------  99

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE--------DAGDSN  708
                                LYT  T+ L LQ+ YY  +Y   K K         D G+SN
Sbjct  100   -------------------LYTLITLTLCLQATYYGHIYPRLKHKRQFKIDPPIDDGESN  140

Query  709   QLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKS  888
               VE      +R   G S  PIP  A +   + Q+  YY SAR ++ S  P  +S L + 
Sbjct  141   NGVENGNAADQRTAIGLSS-PIPFPAQKSHVETQS--YYQSARYLSKSHIP--KSELAQR  195

Query  889   GPSALGMDNDCSSDDETVEAPSMNSISQPK-PIPRSAGYGAFLTT--SLSIPH--QTKAL  1053
              PS+L +D      +E +  PS+ + S P   I  +    + LT   +L++ H   T+  
Sbjct  196   MPSSLILD----PIEEPLLVPSVFTKSAPSLKIKNTLCLVSTLTFLGALNLLHSPDTRIH  251

Query  1054  MPV------YAALGGRKLLQGSGTEHS--------SFGQWLGWMMAAIYMGGRIPQIWLN  1191
               V      +    GRKLLQ SG + S        S G +LGW MA IYMGGR+PQI LN
Sbjct  252   SDVAKPRKEFVIYVGRKLLQVSGHKLSDQGVEAYHSIGTYLGWAMAVIYMGGRLPQICLN  311

Query  1192  IKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIIL  1371
             I+RG+ EG+NPLMF+FAL+ N TYV SILV +  W K+ PNLPWL+++  C  LD FI++
Sbjct  312   IRRGNFEGVNPLMFLFALIGNTTYVASILVSSMDWSKLGPNLPWLVESGGCSILDSFILM  371

Query  1372  QYIYYRY  1392
             Q++YYRY
Sbjct  372   QFLYYRY  378



>ref|NP_850340.1| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
 gb|AAL86295.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91683.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09919.1| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
Length=376

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 168/399 (42%), Positives = 214/399 (54%), Gaps = 73/399 (18%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S  LG+ S+I WGVAEIPQI+TN+  KS+ G+S+ FL TW+ GDIFNL+GCL+EPAT
Sbjct  9     DGLSLSLGIISVISWGVAEIPQIMTNYSEKSTEGLSITFLTTWMIGDIFNLLGCLMEPAT  68

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPTQ Y AL                                         LYT TT VL 
Sbjct  69    LPTQFYMAL-----------------------------------------LYTVTTSVLY  87

Query  640   LQSMYYDFLYRWWKDKED----AGDSNQLVEEAKKPLR-RNKS-----GGSGIPIP--DG  783
             +QS+YY  +Y   K++ D    A   + ++ + K P R RN S     GG   PI    G
Sbjct  88    VQSIYYGHIYPRLKNRRDQMVEAERISNIISDVKIPGRWRNSSDTTTCGGQTTPITMIPG  147

Query  784   ASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKS---GPSALGMDNDCSSDDETVEAPS  954
             + R +   + E +YTSARS++ S TPP  S L +    G S   ++     +D  V  PS
Sbjct  148   SQRTSFTGR-ELFYTSARSLSSSHTPPAGSVLAQRMARGYSEPTLEEPLLPED--VTHPS  204

Query  955   MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMP---VYAALGGRKLLQ--------GS  1101
               S+     +      G F   +L    +T AL     V+     RKLLQ         S
Sbjct  205   TKSLLCVVSV--FLFLGTFNLPNLLSESRTMALGEGDRVFVVRAARKLLQVTSSNVAEHS  262

Query  1102  GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV  1281
             G E S  G +LGW MAAIYMGGR+PQI LN++RG VEGLNPLMF FAL+ N TYV SILV
Sbjct  263   GGESSRIGMFLGWAMAAIYMGGRLPQICLNMRRGHVEGLNPLMFFFALVGNMTYVASILV  322

Query  1282  RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
              +  W K+ PNLPWL+DA  CV LD  I+LQ+ ++R CR
Sbjct  323   NSVEWLKLAPNLPWLVDAGGCVVLDFLILLQFFHFR-CR  360



>ref|XP_007028339.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 3 [Theobroma cacao]
 gb|EOY08841.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 3 [Theobroma cacao]
Length=389

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 167/433 (39%), Positives = 230/433 (53%), Gaps = 75/433 (17%)
 Frame = +1

Query  217   EKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLF  396
              ++ C  W   Y   C+C+  D+ SF LGL S+I W VAEIPQI+TN++ KS  G+SL F
Sbjct  7     RRRECWEWARVYINYCICSARDEGSFALGLISVISWSVAEIPQIITNYKEKSIEGLSLGF  66

Query  397   LLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYH  576
             L+TWI GD+FNL GC+LEPATLPTQ Y A+                              
Sbjct  67    LITWIVGDLFNLFGCILEPATLPTQFYMAV------------------------------  96

Query  577   YYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAG-DSNQLVEEAKKPLRRNKS  753
                        LYT TT +L  Q++YY  +Y   K K     DS +   EA + +     
Sbjct  97    -----------LYTMTTSILAAQTVYYGHIYPRLKYKRVCHKDSKEHQPEAVEKVIDADR  145

Query  754   GGSGIPIP--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVK--SGPSALGMDNDC  921
               S IP+P  +  S P R    E YY SARS++ S TP   S LV+  + PS     +  
Sbjct  146   LSSPIPLPAINVKSSPGR----ELYYMSARSLSRSHTPTAGSFLVQRMTPPS-----HTR  196

Query  922   SSDDETVEAPSMNSISQPKPIPRS-----------AGYGAFLTTSLSIPHQTKALMPVYA  1068
             SS +E + +  +++ S   P  +S           A + + L+    +  + K +   + 
Sbjct  197   SSVEEPLLSAHVSAQSASPPSSKSLLCLVSVLMFIATFNSQLSAFNKLHIEHKIVNQGFV  256

Query  1069  ALGGRKLLQGSGTEH--------SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNP  1224
                GRKLLQ +            S  G +LGW MA IYMGGR+PQI LNI+RG+VEGLNP
Sbjct  257   IQIGRKLLQVNAASLGESGIGGGSRVGTFLGWAMATIYMGGRLPQICLNIRRGNVEGLNP  316

Query  1225  LMFIFALLANATYVG-SILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
              MF+FAL+ N+TYV  SILV +T W +I+PNLPWL+DAA CV LD FI++Q+IY+ Y   
Sbjct  317   FMFMFALVGNSTYVASSILVESTDWSRIRPNLPWLVDAAGCVLLDTFILIQFIYFCYWAP  376

Query  1402  NSGGSREDSADYS  1440
                 ++ ++ + S
Sbjct  377   QDAENKHENLNAS  389



>ref|XP_008240655.1| PREDICTED: uncharacterized protein LOC103339143 isoform X2 [Prunus 
mume]
Length=395

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 161/411 (39%), Positives = 222/411 (54%), Gaps = 68/411 (17%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W  KY +  LC++ D  S  LGL S++ WGVAEIPQ++TN++ KS+ G+SL FL+TW
Sbjct  20    CWEWGRKYMEYELCSVKDGVSLTLGLISVVSWGVAEIPQVITNYKNKSTDGLSLAFLMTW  79

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GC+LEPATLPTQ Y A+                                  
Sbjct  80    ILGDLFNLFGCMLEPATLPTQYYMAM----------------------------------  105

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGI  768
                    LYT TT VL +Q++YY  +Y   K        N    + +       S G+ +
Sbjct  106   -------LYTITTAVLAVQTIYYGCIYPRLKHNLRQKKVNH---DGRSIGFDTPSAGNVL  155

Query  769   --PIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDE--  936
               PIP     P+     E YY SARS++ S TP  RS L ++  +A   ++  +S++E  
Sbjct  156   SSPIPLPGICPSISPGRESYYISARSLSRSHTPTERSYLAQT--TAPTFNHIRNSNEEPL  213

Query  937   ------TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMP---VYAALGGR--  1083
                   T  APS N  +    +     +G F   S+          P   V   +G R  
Sbjct  214   LGALASTHSAPSNNIKTVLSVVSLMTLFGTFNHRSVDNKLDLIVENPSRGVVMRVGRRLL  273

Query  1084  ----KLLQGSGTEHSS-FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALL  1248
                 +LLQ  GT+ SS  G  LGW MAAIY+GGR+PQI+LNI++G+VEGLNPLMF+FA+L
Sbjct  274   QVSSELLQAKGTKDSSRIGNLLGWGMAAIYIGGRLPQIFLNIRKGNVEGLNPLMFVFAVL  333

Query  1249  ANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
              NATYV SI+V +  W +I+PNLPWL+D+  C+ LD+FI++Q  ++RY R 
Sbjct  334   GNATYVTSIIVNSLDWSEIRPNLPWLVDSGGCMLLDIFILIQ--FFRYWRH  382



>ref|XP_008240654.1| PREDICTED: uncharacterized protein LOC103339143 isoform X1 [Prunus 
mume]
Length=415

 Score =   253 bits (646),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 164/428 (38%), Positives = 226/428 (53%), Gaps = 82/428 (19%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W  KY +  LC++ D  S  LGL S++ WGVAEIPQ++TN++ KS+ G+SL FL+TW
Sbjct  20    CWEWGRKYMEYELCSVKDGVSLTLGLISVVSWGVAEIPQVITNYKNKSTDGLSLAFLMTW  79

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GC+LEPATLPTQ Y A+                                  
Sbjct  80    ILGDLFNLFGCMLEPATLPTQYYMAM----------------------------------  105

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKD--KEDAGDSNQLVEEAKKPL-----RRN  747
                    LYT TT VL +Q++YY  +Y   K   ++  G  + L E  +        + N
Sbjct  106   -------LYTITTAVLAVQTIYYGCIYPRLKHNLRQKKGSKSNLTEVRRSNTDFVGKQVN  158

Query  748   KSGGS------------GIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSG  891
               G S              PIP     P+     E YY SARS++ S TP  RS L ++ 
Sbjct  159   HDGRSIGFDTPSAGNVLSSPIPLPGICPSISPGRESYYISARSLSRSHTPTERSYLAQT-  217

Query  892   PSALGMDNDCSSDDE--------TVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTK  1047
              +A   ++  +S++E        T  APS N  +    +     +G F   S+       
Sbjct  218   -TAPTFNHIRNSNEEPLLGALASTHSAPSNNIKTVLSVVSLMTLFGTFNHRSVDNKLDLI  276

Query  1048  ALMP---VYAALGGR------KLLQGSGTEHSS-FGQWLGWMMAAIYMGGRIPQIWLNIK  1197
                P   V   +G R      +LLQ  GT+ SS  G  LGW MAAIY+GGR+PQI+LNI+
Sbjct  277   VENPSRGVVMRVGRRLLQVSSELLQAKGTKDSSRIGNLLGWGMAAIYIGGRLPQIFLNIR  336

Query  1198  RGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQY  1377
             +G+VEGLNPLMF+FA+L NATYV SI+V +  W +I+PNLPWL+D+  C+ LD+FI++Q 
Sbjct  337   KGNVEGLNPLMFVFAVLGNATYVTSIIVNSLDWSEIRPNLPWLVDSGGCMLLDIFILIQ-  395

Query  1378  IYYRYCRK  1401
              ++RY R 
Sbjct  396   -FFRYWRH  402



>ref|XP_006429714.1| hypothetical protein CICLE_v10011933mg [Citrus clementina]
 gb|ESR42954.1| hypothetical protein CICLE_v10011933mg [Citrus clementina]
Length=390

 Score =   252 bits (644),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 169/422 (40%), Positives = 215/422 (51%), Gaps = 94/422 (22%)
 Frame = +1

Query  262   CLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGC  441
             CLC++ D  S  LGL S+I WGVAE+PQI+TN+  KS+ G+S+ FL TWI GD+FN+ GC
Sbjct  4     CLCSVRDGVSLGLGLASVISWGVAEVPQIITNYEEKSTEGLSIAFLTTWILGDLFNVFGC  63

Query  442   LLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTA  621
             LLEPATLPTQ Y A+                                         LYT 
Sbjct  64    LLEPATLPTQYYMAM-----------------------------------------LYTL  82

Query  622   TTVVLVLQSMYYDFLYRWWKDKE--DAGDSNQLVEEAKKPLRRNKSGGSG----------  765
             TTV+L  Q+MYY  +Y   K  +    G      E A+K   R  S G G          
Sbjct  83    TTVILTAQTMYYSHIYPRLKHNKRPQTGLMPNQPEAAEK--TRPSSNGVGEQVNSSGKWK  140

Query  766   ------------IPIP------DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVK--  885
                         IPIP      +G+  P R    E YYTSARS++ S TP   S + +  
Sbjct  141   IDSDTSDTENFSIPIPLPPFPRNGS--PGR----ELYYTSARSLSSSHTPTAGSFIAQRM  194

Query  886   --SGPSALGMDNDCSSDDETVEAP-SMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
               S  S + ++        + ++P S N+ +    +P       F     +  H T    
Sbjct  195   SPSHHSRISIEEPLLGGHISTQSPPSTNTKTMLCLVPIMIFLTTFNFHYSNTEHDTVFEK  254

Query  1057  PV--YAALGGRKLLQGSGT--------EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGS  1206
             P   +     RKLLQ SG           S  G +LGW MAAIYMGGR+PQI LNI+RG 
Sbjct  255   PNKGFVIQVRRKLLQVSGGLLQESVTGGSSGIGSYLGWAMAAIYMGGRLPQICLNIRRGH  314

Query  1207  VEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYY  1386
             VEGLNPLMF+FAL+ NATYV SILV +  W +I+PNLPWL+DA  CV LD FI++Q+IYY
Sbjct  315   VEGLNPLMFVFALVGNATYVASILVNSVDWSRIRPNLPWLVDAGGCVLLDSFILIQFIYY  374

Query  1387  RY  1392
             RY
Sbjct  375   RY  376



>ref|XP_010508772.1| PREDICTED: uncharacterized protein LOC104785289 [Camelina sativa]
Length=372

 Score =   251 bits (642),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 165/410 (40%), Positives = 216/410 (53%), Gaps = 85/410 (21%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S  LG+ S+I WGVAEIPQI+TN+  KS+ G+SL FL TWI GDIFNL+GCL+EPAT
Sbjct  9     EGLSLSLGVISVISWGVAEIPQIMTNYSEKSTEGLSLAFLTTWIIGDIFNLLGCLMEPAT  68

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPTQ Y AL                                         LYT TT  L 
Sbjct  69    LPTQFYMAL-----------------------------------------LYTVTTSALF  87

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLR-----RNKS-----GGSGIPIP--DG  783
              QS+YY  +Y   K++ +     + +      +R     RN S     GG   PI    G
Sbjct  88    FQSLYYGHVYPRLKNRRNQRVEAERIANISIDVRIPGRWRNSSDTASCGGHTTPITMIPG  147

Query  784   ASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNS  963
             + R +   + E +YTSARS++ S TPP          S L         + T+E P +  
Sbjct  148   SHRNSFTGR-ELFYTSARSLSSSHTPP--------AGSVLAQRMARGHSEPTLEEPLLPE  198

Query  964   ISQPKPIPRSAG-----YGAFLTT-SLSIPH-----QTKALMP---VYAALGGRKLLQ--  1095
              + P  +P S         AF+   +L++P+     +T AL     V+     RKLLQ  
Sbjct  199   DASPPSLPPSTKSLLCVVSAFMFLGTLNLPNLLSESRTAALGERDRVFVVQAARKLLQVS  258

Query  1096  -GSGTEH-----SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANA  1257
              G+  EH     S  G +LGW M AIY+GGR+PQI LN++RG VEGLNPLMF+FAL+ N 
Sbjct  259   SGNLVEHGDGESSRTGMFLGWAMTAIYLGGRLPQICLNMRRGHVEGLNPLMFLFALIGNM  318

Query  1258  TYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNS  1407
             TYVGSILV +  W KI PNLPWL+DA  CV LD  I+LQ+ ++R CRK++
Sbjct  319   TYVGSILVHSVEWLKIAPNLPWLVDAGGCVVLDFLILLQFFHFR-CRKDT  367



>ref|XP_007028337.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY08839.1| PQ-loop repeat family protein / transmembrane family protein, 
putative isoform 1 [Theobroma cacao]
Length=413

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 169/433 (39%), Positives = 237/433 (55%), Gaps = 51/433 (12%)
 Frame = +1

Query  217   EKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLF  396
              ++ C  W   Y   C+C+  D+ SF LGL S+I W VAEIPQI+TN++ KS  G+SL F
Sbjct  7     RRRECWEWARVYINYCICSARDEGSFALGLISVISWSVAEIPQIITNYKEKSIEGLSLGF  66

Query  397   LLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFY-  573
             L+TWI GD+FNL GC+LEPAT+  +                +T   +V  E+  D I Y 
Sbjct  67    LITWIVGDLFNLFGCILEPATMMDE----------------NTFNCLVYAEA-SDTILYG  109

Query  574   HYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA-GDSNQLVEEAKKPLRRNK  750
                 +L     QLYT TT +L  Q++YY  +Y   K K     DS +   EA + +    
Sbjct  110   SSKNMLNPKCSQLYTMTTSILAAQTVYYGHIYPRLKYKRVCHKDSKEHQPEAVEKVIDAD  169

Query  751   SGGSGIPIP--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVK--SGPSALGMDND  918
                S IP+P  +  S P R    E YY SARS++ S TP   S LV+  + PS     + 
Sbjct  170   RLSSPIPLPAINVKSSPGR----ELYYMSARSLSRSHTPTAGSFLVQRMTPPS-----HT  220

Query  919   CSSDDETVEAPSMNSISQPKPIPRS-----------AGYGAFLTTSLSIPHQTKALMPVY  1065
              SS +E + +  +++ S   P  +S           A + + L+    +  + K +   +
Sbjct  221   RSSVEEPLLSAHVSAQSASPPSSKSLLCLVSVLMFIATFNSQLSAFNKLHIEHKIVNQGF  280

Query  1066  AALGGRKLLQGSGTE--------HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLN  1221
                 GRKLLQ +            S  G +LGW MA IYMGGR+PQI LNI+RG+VEGLN
Sbjct  281   VIQIGRKLLQVNAASLGESGIGGGSRVGTFLGWAMATIYMGGRLPQICLNIRRGNVEGLN  340

Query  1222  PLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             P MF+FAL+ N+TYV SILV +T W +I+PNLPWL+DAA CV LD FI++Q+IY+ Y   
Sbjct  341   PFMFMFALVGNSTYVASILVESTDWSRIRPNLPWLVDAAGCVLLDTFILIQFIYFCYWAP  400

Query  1402  NSGGSREDSADYS  1440
                 ++ ++ + S
Sbjct  401   QDAENKHENLNAS  413



>ref|XP_008443168.1| PREDICTED: uncharacterized protein LOC103486835 isoform X2 [Cucumis 
melo]
Length=409

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 168/444 (38%), Positives = 218/444 (49%), Gaps = 91/444 (20%)
 Frame = +1

Query  190   QNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTK  369
             Q+S P C + K  C  WV+   K CLC + D  S  LG+ S+I WGVAEIPQI+TN+R K
Sbjct  5     QSSKPICPSSKH-CSEWVKNNMKYCLCGVKDGVSLTLGMISVISWGVAEIPQIITNYREK  63

Query  370   SSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICE  549
             SS G+SL FLLTWI GD+FN+ GC+LEPATLPTQ Y AL                     
Sbjct  64    SSDGLSLAFLLTWILGDLFNVFGCILEPATLPTQYYMAL---------------------  102

Query  550   SLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA------GDSNQ  711
                                 LYT TT +L  Q++YY  +Y   K +          ++N 
Sbjct  103   --------------------LYTITTGILFTQTIYYGHIYPQMKYRRRQCKGLVHSEANS  142

Query  712   LVEEAKKPLRRN---------------------KSGGSGIPIPDGASRPARQHQAEYYYT  828
              ++   K  + N                     +   S  PIP    R       E ++ 
Sbjct  143   QIDARDKAQQSNGSVNVNQVNNDDDTSKFNTSKRESASTSPIPLPVLRQNSSTGRELFFM  202

Query  829   SARSMAGSATPPFRSNLV-KSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYG  1005
             SARS++ S TP   S L  K  P  +      S  +  ++    +S ++P  +       
Sbjct  203   SARSLSRSHTPTAGSFLTQKMTPPNI----HNSMQEPLLDGNEPSSAARPPNVKNMLCLV  258

Query  1006  AFLTTSLSIPHQTKALMPVYAALG----------GRKLLQ------GSGTEHSS-FGQWL  1134
             + LT   ++ H   A     +  G          GRKLLQ       +G E S   G +L
Sbjct  259   SMLTFFSTLNHHQSAESRFQSVSGNSNKGFVIPVGRKLLQVADVLQNNGNEISGGIGTYL  318

Query  1135  GWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPN  1314
             GW MA IYMGGR+PQI LNIKRG VEGL+PLMFIFAL+ N+TYV SILV +T+W KIKPN
Sbjct  319   GWAMALIYMGGRLPQICLNIKRGHVEGLSPLMFIFALIGNSTYVASILVSSTSWSKIKPN  378

Query  1315  LPWLLDAAVCVGLDLFIILQYIYY  1386
             LPWL+DA  CV L  F+    IY+
Sbjct  379   LPWLVDAFGCVLLRTFVSSLSIYH  402



>emb|CDM82719.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   251 bits (641),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 223/445 (50%), Gaps = 91/445 (20%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W + Y K CLC+  D  +  LGL S++ WG+AE+PQI+TN++ KS+ G+S+ FL+TW
Sbjct  18    CAEWAKVYLKYCLCSTKDGVALGLGLASVLSWGIAEVPQIITNYKQKSTEGLSIAFLMTW  77

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNLVGC LEPATLPTQ Y AL                                  
Sbjct  78    IVGDLFNLVGCFLEPATLPTQFYMAL----------------------------------  103

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE------------DAGDSNQLVEEAKK  732
                    LYT TTV+L  Q++YY  +Y     K             DA    +L+    +
Sbjct  104   -------LYTITTVILTGQTIYYSHIYHLKVKKTGTTAKSQKHQRGDASLREKLLGHRDE  156

Query  733   PLRRNKSGGSGIPIPDGA----SRPARQHQ------AEYYYTSARSMAGSATPP---FRS  873
               + N   G  IPIP       +   RQ        ++YYY SARS++ S  P      +
Sbjct  157   AFKNNIQSGPIIPIPSSPIQVNTEVFRQRHGSVSPGSDYYYASARSLSRSPVPTGTWLGN  216

Query  874   NLVKSGPSALGMDNDCSSDDETVEAPSM------NSISQPKPIPRSAGYGAFLTTSLSIP  1035
             N   +       D   S   E V A S       NS+S    I    G    L   +   
Sbjct  217   NRQTTKVPPQMNDEGASLFGEFVPAQSAPAAITKNSLSVVPWISVVLGM-CVLHILVGTA  275

Query  1036  HQ---TKALMPVYAALGGRKLL------QGSGTEHSS---FGQWLGWMMAAIYMGGRIPQ  1179
             H+    + ++PV     GRKLL       GS   H S    G +LGW MA IYMGGR+PQ
Sbjct  276   HRDASNEIIIPV-----GRKLLVVADDHAGSSLSHGSRSGIGSFLGWAMAVIYMGGRLPQ  330

Query  1180  IWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDL  1359
             I+LN++RG  EGL+PLMF FAL+ N TYVGSILV +  W +++PNLPWL+DA  CV LD 
Sbjct  331   IFLNMQRGHAEGLSPLMFTFALVGNTTYVGSILVNSLDWARLRPNLPWLVDAGGCVLLDS  390

Query  1360  FIILQYIYYRYCRKNSGGSREDSAD  1434
             FIILQ++Y+ Y RK SG    D+ D
Sbjct  391   FIILQFLYFHY-RKQSGRDELDNLD  414



>ref|XP_011069980.1| PREDICTED: uncharacterized protein LOC105155744 [Sesamum indicum]
Length=400

 Score =   250 bits (639),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 160/425 (38%), Positives = 211/425 (50%), Gaps = 84/425 (20%)
 Frame = +1

Query  223   KPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLL  402
             + C  W  +Y   CLC+  D FS  LGL S++ WGVAEIPQI+TN++ KS+ G+S+LFL 
Sbjct  14    RHCAEWARRYMGYCLCSTKDGFSLSLGLISVLSWGVAEIPQIITNYKKKSAEGLSILFLC  73

Query  403   TWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYY  582
             TWI GD  NL GC+LEPATLPTQ Y A+                                
Sbjct  74    TWIVGDFLNLFGCMLEPATLPTQYYMAM--------------------------------  101

Query  583   FVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGG-  759
                      LYT TT+VL  Q++YY  +Y   K  +   ++   V+      RR  + G 
Sbjct  102   ---------LYTVTTLVLSTQAVYYGHIYPRLKSNKRLQEA---VQAGAPEWRREHNYGL  149

Query  760   --------------SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPS  897
                              PIP   S P      E ++ SARS++ S TP   S      PS
Sbjct  150   DAGQVNNRESWGFSPSSPIPLPLSSPTSSE--EVFFMSARSLSVSRTPTLGSYPALRTPS  207

Query  898   ALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKA---------  1050
                ++ +C S+    E  S  S   PK I       + +T  L   +  +A         
Sbjct  208   --DVERNCPSEPLLGEFRSTQSAPPPK-IKTMLCVVSLITLLLGSFNNQRAESHKNMIFK  264

Query  1051  ------LMPVYAALGGRKLLQGS-----GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIK  1197
                   ++ V   L   K  +GS       E S  G +LGW MA IY+GGR+PQI LNI+
Sbjct  265   SPTRGIVLKVSRQLLEAKAAKGSVQETLDPESSGIGSFLGWGMAVIYLGGRLPQICLNIR  324

Query  1198  RGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQY  1377
             RG+ EGLNPLMF+FAL+ NATYV SIL+ +  W  I+PNLPWL+DA  CV LD FI++Q+
Sbjct  325   RGNAEGLNPLMFVFALVGNATYVASILISSLRWSNIRPNLPWLVDAGGCVILDTFILMQF  384

Query  1378  IYYRY  1392
             IYY Y
Sbjct  385   IYYGY  389



>ref|XP_007161921.1| hypothetical protein PHAVU_001G108900g [Phaseolus vulgaris]
 gb|ESW33915.1| hypothetical protein PHAVU_001G108900g [Phaseolus vulgaris]
Length=392

 Score =   249 bits (636),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 165/432 (38%), Positives = 223/432 (52%), Gaps = 88/432 (20%)
 Frame = +1

Query  211   VAEKKPCVVWVE------KYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             V EK    VW        +  K+ L ++ +  SF LGL S+I W VAEIPQI+TN+RTKS
Sbjct  3     VFEKFILSVWCHGNQHCLQLAKENLSSVRESASFFLGLISVIVWVVAEIPQIITNYRTKS  62

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             + G+SL FL+TWI GD+FNLVGCLLEPATL TQLY A+                      
Sbjct  63    TEGLSLTFLVTWIIGDVFNLVGCLLEPATLLTQLYMAV----------------------  100

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKED----------AGD  702
                                LYT  T+ L LQ+MYY  LY   K K             G+
Sbjct  101   -------------------LYTIITLALGLQTMYYGHLYPQLKYKRQLKVETFAKTGQGE  141

Query  703   SNQLVEEAKK--PLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
                + E++ +     RN S  S IP+P    R A    +  +Y SAR ++ S TP   S 
Sbjct  142   KGSVAEQSIEFENSNRNFSPSSPIPLPACPRRIATG--SGLFYQSARYLSKSHTPTAGSI  199

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTT-----SLSIPHQ  1041
             L     S   +D    S  E++   ++ +  Q  P PR       ++T     ++++  Q
Sbjct  200   LAHKMTSTAALD----SIQESLLGSAIAT--QSAPAPRMKNTLCIVSTLTFLGAINLLQQ  253

Query  1042  TKALMPVYAA----------------LGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRI  1173
                 + + A+                +G  +LL+   +  SS G +LGW M  +Y+GGR+
Sbjct  254   LNTNINLMASNPRQQFVIHVGRKLFQVGDDQLLKTDVSGGSSIGTFLGWAMTFVYLGGRL  313

Query  1174  PQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGL  1353
             PQI LNI+RG VEGLNPLMF+FA+L N+TYV SILV +  W KIKPNLPWL+DA  CV L
Sbjct  314   PQICLNIRRGHVEGLNPLMFMFAVLGNSTYVASILVISLDWSKIKPNLPWLVDAGGCVLL  373

Query  1354  DLFIILQYIYYR  1389
             D FI++Q+IY+R
Sbjct  374   DFFILMQFIYFR  385



>ref|XP_010678217.1| PREDICTED: uncharacterized protein LOC104893776 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=393

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 226/419 (54%), Gaps = 65/419 (16%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W   Y   CLC   +  S  LGL S+ICWGVAEIPQI+TN++TKS  G+S  FLLTW
Sbjct  10    CAAWARDYLGYCLCTNKEAASLYLGLISVICWGVAEIPQILTNYKTKSPEGLSFAFLLTW  69

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD FNL GCL EPATLPTQ YTAL+               +        +++Y     
Sbjct  70    IIGDFFNLFGCLFEPATLPTQFYTALL-------------YTVTTLTLTLQSVYY-----  111

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYR--------WWKDKEDAGDSNQLVE------EA  726
                  GQ+Y    +     +  +D + +         +   E++ D  +L+       ++
Sbjct  112   -----GQIYHRLKI-----NRQFDKVAKPNQTEVAGEYSVHENSDDVEKLINGSCGNRQS  161

Query  727   KKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALG  906
                 + + +  S IP+P  A   ++  + + +Y SAR ++ S TP  RS L       L 
Sbjct  162   SSVFQSDTAMSSPIPLP--AFPRSQSAEQDSFYKSARYLSTSHTPTRRSFL------PLW  213

Query  907   MDNDCSSDDETVEAPSMNSI--SQPKPIPRSAGY------GAFLTTSLSIPHQTK-ALMP  1059
              D      +++VE P +     ++P  +P++           F+  +L+I  +T+ + + 
Sbjct  214   RDPARVDAEDSVEEPLLGGSLPTRPAHLPKTKNLLCIVPATTFIIGTLNICRRTRDSRLN  273

Query  1060  VYAALGGRKLLQGSGTEHSS------FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLN  1221
             + A +  RKLLQ  G +  +       G ++GW MAAIYMGGR+PQI LN +RG+VEGLN
Sbjct  274   LGAEVLNRKLLQVHGVQRITSDVGGGIGSYMGWAMAAIYMGGRLPQICLNFRRGNVEGLN  333

Query  1222  PLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
             PLMFIFALL NATYV SILV +  W KI PNLPWL+DA  C  LD FI+LQ+IY++Y R
Sbjct  334   PLMFIFALLGNATYVASILVNSLDWSKIMPNLPWLVDAGGCSLLDTFILLQFIYFQYRR  392



>ref|XP_009365377.1| PREDICTED: uncharacterized protein LOC103955225 [Pyrus x bretschneideri]
Length=403

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 164/431 (38%), Positives = 221/431 (51%), Gaps = 88/431 (20%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W  KY +  +C++ D  S  LG+ S++ WGVAE+PQI+TN++ K SHG+SL FL+TW
Sbjct  27    CWEWGRKYLEFEVCSVKDGMSLALGVISVLSWGVAEVPQIITNYKAKCSHGLSLAFLITW  86

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GCLLEPATLPTQ YTA+                                  
Sbjct  87    IVGDLFNLFGCLLEPATLPTQYYTAI----------------------------------  112

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLY-RWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSG  765
                    LY  TT+VL +Q++YY ++Y R    ++  G  N   E   K   R       
Sbjct  113   -------LYLTTTLVLSVQTIYYGYIYPRLNNLRQKKGSKNNPAEVPGKASGRVNV----  161

Query  766   IPIPDGASR-------PARQHQAEYYYTSARSMAGSATP------------PFRSNLVKS  888
             I  P   +        P    + E YY SARS++ S TP            PF  N   +
Sbjct  162   IDTPTAGNEWSSPILCPNFSPRRESYYISARSLSRSHTPAEGFHAAQRTTLPFNRNRNPN  221

Query  889   GPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAF--LTTSLSIPHQTK-ALMP  1059
                 LG      +   T  APS N  +    +     +  F   +  LS+ +  +  +M 
Sbjct  222   EEPLLG------ALASTQSAPSNNVKTTLCVVSLMTLFCTFNQRSVDLSVDNPNRGVVMQ  275

Query  1060  VYAALGGRKLLQGS-------GTEHSS-FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEG  1215
             V     GR+LLQ +       GT+HSS  G +LGW MA IY+GGR PQI+LNI++G+V+G
Sbjct  276   V-----GRRLLQVNSRLLREMGTKHSSGIGTFLGWGMAVIYIGGRFPQIYLNIRKGNVDG  330

Query  1216  LNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYC  1395
             LNP MFIFA++ NA YV SILV +  W KI PNL WL+DA  C+ LD+FI+LQ+  Y + 
Sbjct  331   LNPFMFIFAVVGNAAYVASILVNSMEWSKISPNLAWLVDAGGCMLLDIFILLQFFQY-WR  389

Query  1396  RKNSGGSREDS  1428
             R+N GG    S
Sbjct  390   RRNVGGKDRHS  400



>ref|NP_001141539.1| PQ loop repeat family protein [Zea mays]
 ref|XP_008654592.1| PREDICTED: PQ loop repeat family protein isoform X1 [Zea mays]
 gb|ACF86576.1| unknown [Zea mays]
 gb|AFW79601.1| PQ loop repeat family protein [Zea mays]
Length=418

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 163/457 (36%), Positives = 218/457 (48%), Gaps = 79/457 (17%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M +   + P      + C  W   Y K CLC+  +  +  LGL S++ WG+AE+PQI+TN
Sbjct  1     MGVIGGTPPASCPTTRHCAEWARIYLKYCLCSQKEGAALALGLISVVSWGLAEVPQIMTN  60

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             +R KS+ G+S+ FL+TWI GD+FNL GC LEPATLPTQ Y AL                 
Sbjct  61    YRHKSTEGLSVAFLMTWIVGDLFNLAGCFLEPATLPTQFYMAL-----------------  103

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK----------  687
                                     LYT TT++L  Q++YY  +Y   K K          
Sbjct  104   ------------------------LYTITTLILTGQTIYYSHIYHHLKLKNSRAASKPQK  139

Query  688   ---EDAGDSNQLVEEAKKPLRRNKSGGSGI-----PIPDGASRPARQH----QAEYYYTS  831
                 DA    +L+        RN    + +     PIP       + H     A+YYY S
Sbjct  140   HQYRDASLREKLLGAKGSAASRNNESDTTVLIPSSPIPVNMKLVDQYHGSSSNADYYYMS  199

Query  832   ARSMAGSATPPFR----SNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG  999
             ARS++ S  P       SN   S       D   S   E     S  S      +  +  
Sbjct  200   ARSLSRSPVPTAGIWSGSNRQSSRSPPQMNDQRGSLIGEIAPEHSAPSTVTKNALSVAPW  259

Query  1000  YGAFLTTSLS---IPHQTKALMPVYAALGGRKLL---------QGSGTEHSSFGQWLGWM  1143
              G  L T L    I ++ + +        GR+LL           S +  S  G +LGW 
Sbjct  260   MGLLLGTCLLHILIGNKHREMASGTVIPIGRRLLLFVDDHGNSSLSQSSGSEIGSFLGWA  319

Query  1144  MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPW  1323
             MA IYMGGR+PQI LN++RG VEGLNPLMF FALL N+TYVGSILV +  W K++PNLPW
Sbjct  320   MAMIYMGGRLPQILLNMQRGHVEGLNPLMFTFALLGNSTYVGSILVNSLDWSKLRPNLPW  379

Query  1324  LLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             L+++  CV LD  IILQ++Y+ Y ++       D+AD
Sbjct  380   LVESGGCVLLDSCIILQFLYFHYRKRREPSDEHDNAD  416



>ref|XP_004489634.1| PREDICTED: uncharacterized protein LOC101513545 isoform X1 [Cicer 
arietinum]
 ref|XP_004489635.1| PREDICTED: uncharacterized protein LOC101513545 isoform X2 [Cicer 
arietinum]
Length=379

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 163/414 (39%), Positives = 208/414 (50%), Gaps = 101/414 (24%)
 Frame = +1

Query  271   NISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLE  450
             NI+   S  LG+ S+I W VAEIPQ++TN+R KS+HG+S+ FLLTW+ GD+FNL GCLLE
Sbjct  11    NIAMTTSITLGVISVIVWMVAEIPQLITNYREKSAHGLSVAFLLTWMIGDLFNLFGCLLE  70

Query  451   PATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTV  630
             PATLPTQLYTA                                         +LYT TT 
Sbjct  71    PATLPTQLYTA-----------------------------------------ELYTFTTF  89

Query  631   VLVLQSMYYDFLYRWWKDKE--------DAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGA  786
             VL LQ++YY  +    K K+        D G+SN +VE      +R   G S  PI    
Sbjct  90    VLCLQAIYYGHINPQHKCKKQFKIDTTIDEGESNGVVENGNDGDQRTNIGLSS-PINLA-  147

Query  787   SRPARQHQAEYYYTSARSMAGSATP------PFR------------------SNLVKSGP  894
               P    + + YY SAR ++ S TP      P R                  S L KS P
Sbjct  148   --PKSHVETQSYYQSARYLSKSYTPKSEFILPKRLTSSSHILDPIEEPLLVSSVLTKSAP  205

Query  895   SALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAAL  1074
             S       C     T  A ++N +  P     S          +S P Q       +   
Sbjct  206   SLKIKSTLCLVSTLTFLA-AINLLHSPDTRIHSV---------VSNPRQE------FVIY  249

Query  1075  GGRKLLQGSG--------TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLM  1230
              GRKLLQ SG         EHSS G +LGW MA IYMGGR PQI LN ++G+ EG+NPLM
Sbjct  250   VGRKLLQVSGHPLPVHGVEEHSSIGIYLGWAMAVIYMGGRFPQICLNSRKGNFEGVNPLM  309

Query  1231  FIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
             F+FAL+ N TYV SILVR+  W KI PNLPWL+++  C  LD  I++Q++Y+R+
Sbjct  310   FLFALVGNTTYVASILVRSLDWSKIGPNLPWLVESGGCSLLDFLILMQFLYFRH  363



>ref|XP_003618917.1| PQ-loop repeat-containing protein [Medicago truncatula]
Length=434

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 167/427 (39%), Positives = 224/427 (52%), Gaps = 82/427 (19%)
 Frame = +1

Query  193   NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             NS   C+  +  C+  V+   +    + +   S  LG+ S+I W +AEIPQ++TN+R KS
Sbjct  7     NSTSLCLGNQH-CLQLVQMVMR----SDAKTASITLGVISVIVWMIAEIPQLITNYREKS  61

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             SHG+S+ FLLTWI GD+FNL GCLLEPATLPTQLYTA+                      
Sbjct  62    SHGLSVTFLLTWIIGDLFNLFGCLLEPATLPTQLYTAV----------------------  99

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE--------DAGDSN  708
                                LYT  T+ L LQ+ YY  +Y   K K         D G+SN
Sbjct  100   -------------------LYTLITLTLCLQATYYGHIYPRLKHKRQFKIDPPIDDGESN  140

Query  709   QLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKS  888
               VE      +R   G S  PIP  A +   + Q+  YY SAR ++ S TP  +S L + 
Sbjct  141   NGVENGNAADQRTAIGLSS-PIPFPAQKSHVETQS--YYQSARYLSKSHTP--KSELAQR  195

Query  889   GPSALGMDNDCSSDDETVEAPSMNSISQPK-PIPRSAGYGAFLTT--SLSIPH--QTKAL  1053
              PS+L +D      +E +  PS+ + S P   I  +    + LT   +L++ H   T+  
Sbjct  196   MPSSLILD----PIEEPLLVPSVFTKSAPSLKIKNTLCLVSTLTFLGALNLLHSPDTRIH  251

Query  1054  MPV------YAALGGRKLLQGSGTEHS--------SFGQWLGWMMAAIYMGGRIPQIWLN  1191
               V      +    GRKLLQ SG + S        S G +LGW MA IYMGGR+PQI LN
Sbjct  252   SDVAKPRKEFVIYVGRKLLQVSGHKLSDQGVEAYHSIGTYLGWAMAVIYMGGRLPQICLN  311

Query  1192  IKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIIL  1371
             I+RG+ EG+NPLMF+FAL+ N TYV SILV +  W K+ PNLPWL+++  C  LD F+  
Sbjct  312   IRRGNFEGVNPLMFLFALIGNTTYVASILVSSMDWSKLGPNLPWLVESGGCSILDSFVSF  371

Query  1372  QYIYYRY  1392
              Y+  RY
Sbjct  372   SYLLVRY  378



>ref|XP_008654590.1| PREDICTED: PQ loop repeat family protein isoform X2 [Zea mays]
Length=584

 Score =   250 bits (639),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 164/459 (36%), Positives = 219/459 (48%), Gaps = 79/459 (17%)
 Frame = +1

Query  172   ASMSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIV  351
             A M +   + P      + C  W   Y K CLC+  +  +  LGL S++ WG+AE+PQI+
Sbjct  165   ADMGVIGGTPPASCPTTRHCAEWARIYLKYCLCSQKEGAALALGLISVVSWGLAEVPQIM  224

Query  352   TNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*A  531
             TN+R KS+ G+S+ FL+TWI GD+FNL GC LEPATLPTQ Y AL               
Sbjct  225   TNYRHKSTEGLSVAFLMTWIVGDLFNLAGCFLEPATLPTQFYMAL---------------  269

Query  532   AIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK--------  687
                                       LYT TT++L  Q++YY  +Y   K K        
Sbjct  270   --------------------------LYTITTLILTGQTIYYSHIYHHLKLKNSRAASKP  303

Query  688   -----EDAGDSNQLVEEAKKPLRRNKSGGSGI-----PIPDGASRPARQH----QAEYYY  825
                   DA    +L+        RN    + +     PIP       + H     A+YYY
Sbjct  304   QKHQYRDASLREKLLGAKGSAASRNNESDTTVLIPSSPIPVNMKLVDQYHGSSSNADYYY  363

Query  826   TSARSMAGSATPPFR----SNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRS  993
              SARS++ S  P       SN   S       D   S   E     S  S      +  +
Sbjct  364   MSARSLSRSPVPTAGIWSGSNRQSSRSPPQMNDQRGSLIGEIAPEHSAPSTVTKNALSVA  423

Query  994   AGYGAFLTTSLS---IPHQTKALMPVYAALGGRKLL---------QGSGTEHSSFGQWLG  1137
                G  L T L    I ++ + +        GR+LL           S +  S  G +LG
Sbjct  424   PWMGLLLGTCLLHILIGNKHREMASGTVIPIGRRLLLFVDDHGNSSLSQSSGSEIGSFLG  483

Query  1138  WMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNL  1317
             W MA IYMGGR+PQI LN++RG VEGLNPLMF FALL N+TYVGSILV +  W K++PNL
Sbjct  484   WAMAMIYMGGRLPQILLNMQRGHVEGLNPLMFTFALLGNSTYVGSILVNSLDWSKLRPNL  543

Query  1318  PWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
             PWL+++  CV LD  IILQ++Y+ Y ++       D+AD
Sbjct  544   PWLVESGGCVLLDSCIILQFLYFHYRKRREPSDEHDNAD  582



>ref|XP_009788748.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
 ref|XP_009788749.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
 ref|XP_009788750.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
 ref|XP_009788751.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
 ref|XP_009788752.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
 ref|XP_009788753.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
 ref|XP_009788754.1| PREDICTED: probable vacuolar amino acid transporter YPQ3 [Nicotiana 
sylvestris]
Length=380

 Score =   244 bits (622),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 155/400 (39%), Positives = 202/400 (51%), Gaps = 76/400 (19%)
 Frame = +1

Query  289   SFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPT  468
             S  LGL S++ WGVAEIPQI+TN++ KS+ G+SL FL  WI GD+FNL GC+LEPATLPT
Sbjct  17    SLALGLISVVSWGVAEIPQIITNYKQKSTEGLSLFFLFAWIVGDLFNLFGCMLEPATLPT  76

Query  469   QLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQS  648
             Q Y A+                                         LYT TT++L  Q+
Sbjct  77    QYYMAM-----------------------------------------LYTVTTLILTSQT  95

Query  649   MYYDFLY------RWWKDKEDAGD------SNQLVEEAK-KPLRRNKSGGSGIPIPDGAS  789
             +YY  +Y      R W +  ++GD       N  V+E+K + +          PI     
Sbjct  96    LYYAHIYPRLESNRRWHEVSESGDFEKISVHNHGVDESKSRRMSSTSGFSQSSPISLPGR  155

Query  790   RPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSIS  969
              P      + YY SARS++ S TP   S      P    +D + +  +  +E     +  
Sbjct  156   TPIVSSGGDLYYMSARSLSMSHTPTAGSFPSHKTPP---LDAEFNFKEPLLEEIRATNSP  212

Query  970   QPKPIPRSAGYGAFLTTSLS---------IPHQTKALMPVYAAL--GGRKLLQ-------  1095
              P    R     + +T  LS         + H  +   P    +   GRKL Q       
Sbjct  213   PPPHTKRMLCLVSIVTWFLSAVNVLQQDSMKHNLRLQKPTSGIVLQVGRKLQQVNMTLMV  272

Query  1096  -GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
               S T     G +LGW MAAIYMGGR+PQI LNI+RG+VEGLNPLMFIFALL N TYV S
Sbjct  273   NSSTTNSGGVGSFLGWGMAAIYMGGRLPQICLNIRRGNVEGLNPLMFIFALLGNTTYVAS  332

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
             IL  +  W KI PNLPWL+DAA CV LD FI++Q++Y+RY
Sbjct  333   ILASSLDWSKIGPNLPWLVDAAGCVLLDTFILIQFVYFRY  372



>gb|ACG49102.1| PQ loop repeat family protein [Zea mays]
Length=418

 Score =   245 bits (625),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 164/456 (36%), Positives = 217/456 (48%), Gaps = 79/456 (17%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M +   + P      + C  W   Y K CLC+  +  +  LGL S++ WG+AE+PQI+TN
Sbjct  1     MGVIGGTPPASCPATRHCAEWARIYLKYCLCSQKEGAALALGLISVVSWGLAEVPQIMTN  60

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             +R KS+ G+S+ FL+TWI GD+FNL GC LEPATLPTQ Y AL                 
Sbjct  61    YRHKSTEGLSVAFLMTWIVGDLFNLAGCFLEPATLPTQFYMAL-----------------  103

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKED-AGDSNQL  714
                                     LYT TT++L  Q++YY  +Y   K K   A    Q 
Sbjct  104   ------------------------LYTITTLILTGQTIYYSHIYHHLKLKNSRAASKPQK  139

Query  715   VEEAKKPLRRN----KSGGSGI-------------PIPDGASRPARQH----QAEYYYTS  831
              +     LR      K G + I             PIP       + H     A+YYY S
Sbjct  140   HQHRDASLREKLLGAKGGAASINNESDTTVLSPSSPIPVNMKLVDQYHGSSSNADYYYMS  199

Query  832   ARSMAGSATPPFR----SNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG  999
             ARS++ S  P       SN   S       D   S   E     S  S      +  +  
Sbjct  200   ARSLSRSPVPTAGIWSGSNRQSSRSPPQMNDQRGSLIGEIAPEHSAPSTVTKNALSVAPW  259

Query  1000  YGAFLTTSLS---IPHQTKALMPVYAALGGRKLL---------QGSGTEHSSFGQWLGWM  1143
              G  L T L    I ++ + +        GR+LL           S +  S  G +LGW 
Sbjct  260   MGLLLGTCLLHILIGNKHREMASGTVIPIGRRLLLFVDDHGNSSLSQSSRSEIGSFLGWA  319

Query  1144  MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPW  1323
             MA IYMGGR+PQI LN++RG VEGLNPLMF FALL N+TYVGSILV +  W K++PNLPW
Sbjct  320   MAMIYMGGRLPQILLNMQRGHVEGLNPLMFTFALLGNSTYVGSILVNSLDWSKLRPNLPW  379

Query  1324  LLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDSA  1431
             L+++  CV LD  IILQ++Y+ Y ++       D+A
Sbjct  380   LVESGGCVLLDSCIILQFLYFHYRKRREPSDEHDNA  415



>ref|XP_008386922.1| PREDICTED: uncharacterized protein LOC103449379 [Malus domestica]
Length=401

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 167/433 (39%), Positives = 220/433 (51%), Gaps = 89/433 (21%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W  KY K  LC++ D  S  LG+ S++ WGVAE+PQI+TN++ KSS G+SL FL+TW
Sbjct  25    CWEWGRKYLKYELCSVKDGMSLALGVISVLSWGVAEVPQIITNYKAKSSQGLSLAFLITW  84

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GCLLEPATLPTQ YTA+                                  
Sbjct  85    IIGDLFNLFGCLLEPATLPTQYYTAI----------------------------------  110

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLY-RWWKDKEDAGDSNQLVEEAKKPLRR-----NK  750
                    LY  TT+VL +Q++YY ++Y R    ++  G      E   K   R       
Sbjct  111   -------LYLTTTLVLSVQTIYYGYVYPRLNNLRQKKGSKTNPAEVPGKASGRVNVIDTP  163

Query  751   SGGS--GIPIPDGASRPARQHQAEYYYTSARSMAGSATP------------PFRSNLVKS  888
             S G+    PI      P R    E YY SARS++ S TP            PF  N   +
Sbjct  164   SAGNEWTSPILCPNISPGR----ESYYISARSLSRSHTPSEGFHAAQRKILPFNRNRNPN  219

Query  889   GPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSI----PHQTKALM  1056
                 LG      +   T  APS N  +    +     +  F   S+ +    P++   +M
Sbjct  220   EEPLLG------ALASTQSAPSNNVKTTLCVVSLMTLFCTFNQRSVDLIVDNPNR-GVVM  272

Query  1057  PVYAALGGRKLLQGS-------GTEHSS-FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
              V     GR+LLQ +       GT+HSS  G +LGW MA IY+GGR PQI+LNI++G+V+
Sbjct  273   QV-----GRRLLQVNSGLLREMGTKHSSGIGSFLGWGMAVIYIGGRFPQIYLNIRKGNVD  327

Query  1213  GLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
             GLNP MFIFA++ NA YV SILV +  W KI PNL WL+DA  C+ LD+FI+LQ+  Y  
Sbjct  328   GLNPFMFIFAVVGNAAYVASILVNSMEWSKISPNLAWLVDAGGCMLLDIFILLQFFQYWR  387

Query  1393  CRKNSGGSREDSA  1431
              R   G  R  +A
Sbjct  388   HRNVGGKDRHSNA  400



>ref|XP_003520461.1| PREDICTED: probable vacuolar amino acid transporter YPQ1-like 
[Glycine max]
Length=387

 Score =   241 bits (615),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 157/409 (38%), Positives = 210/409 (51%), Gaps = 83/409 (20%)
 Frame = +1

Query  256   KDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLV  435
             K+ + ++ +  SF+LGL S+I W VAEIPQI+TN+RTKS+ G+S+ FL+TWI GD+FNL 
Sbjct  24    KEHMGSVRETASFLLGLISVIVWVVAEIPQILTNYRTKSAEGLSVTFLITWIIGDLFNLS  83

Query  436   GCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLY  615
             GCLLEPATLPTQLY A+                                         LY
Sbjct  84    GCLLEPATLPTQLYMAM-----------------------------------------LY  102

Query  616   TATTVVLVLQSMYYDFLYRWWKDK--------------EDAGDSNQLVEEAKKPLRRNKS  753
             T  T+ L  Q++YY  +Y   K K              E A D+ Q ++       R+  
Sbjct  103   TIITIALGAQTIYYGHIYPQLKYKRQLKIETFTKVGHVEKASDAEQSIQVDGS--NRSTD  160

Query  754   GGSGIPIPDGASRPARQHQA-EYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDC-SS  927
               S IP+P   +RP R     E +Y SAR ++ S TP   S L +  P+   +      S
Sbjct  161   LSSPIPLP---ARPQRISTGRELFYQSARYLSKSNTPTAGSILAQKPPTLDSIQESLLGS  217

Query  928   DDETVEAPSMNSISQPKPIPRSAGYGAF---------LTTSLSIPHQTKALMPVYAALGG  1080
                T  AP++   +    +      GA          + +  S P Q       +    G
Sbjct  218   TIATQSAPALKMKNTLCLVSTLTFLGAINLLQPLDERINSMASNPRQQ------FVIYVG  271

Query  1081  RKLLQGSGTE------HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             RKL Q S  +        S G + GW M  IY+GGR+PQI LNI+RG VEGLNPLMF+FA
Sbjct  272   RKLFQVSDDQLPKTDVSGSIGTFFGWAMTFIYLGGRLPQICLNIRRGHVEGLNPLMFLFA  331

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             ++ NATYV SILV +  W KI+PNLPWL+DA  CV LD FI++Q+IY+R
Sbjct  332   VIGNATYVASILVISLDWSKIRPNLPWLVDAGGCVLLDFFILMQFIYFR  380



>gb|KGN59379.1| hypothetical protein Csa_3G815430 [Cucumis sativus]
Length=459

 Score =   242 bits (617),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 170/457 (37%), Positives = 216/457 (47%), Gaps = 93/457 (20%)
 Frame = +1

Query  106   RLKSSTLHRLLRLIFISGRSMEASMSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDD  285
             RL+    H        SG+ M +     Q+S P C + K  C  WV+   K CLC   D 
Sbjct  34    RLRFVPWHAFEYCSHTSGKQMGS----FQSSKPICPSNKH-CSEWVKNNMKYCLCGTKDG  88

Query  286   FSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLP  465
              S  LG+ S+I WGVAEIPQIVTN+R KSS G+SL FLLTWI GD+FN+ GC+LEPATLP
Sbjct  89    VSLTLGMISVISWGVAEIPQIVTNYREKSSDGLSLAFLLTWILGDLFNVFGCILEPATLP  148

Query  466   TQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQ  645
             TQ Y AL                                         LYT TT +L  Q
Sbjct  149   TQYYMAL-----------------------------------------LYTITTGILFTQ  167

Query  646   SMYYDFLYRWWKDKE---------------DAGDS----------NQLVEEAKKPLRRNK  750
             ++YY  +Y   K +                DA D           NQ+  +       +K
Sbjct  168   AIYYGHIYPQMKYRRRQCKGLVHSEANAQIDARDKAQQSYGSVNVNQVNNDDMSKFNTSK  227

Query  751   -SGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSS  927
                 S  PIP    R       E YY SARS++ S TP    + ++   +   + N    
Sbjct  228   RESASTSPIPLPMLRQNSSTGRELYYMSARSLSRSHTPT-SGSFLRQKMTPPYIHNPMQE  286

Query  928   DDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALG----------  1077
                    PS  S ++P  +         LT   ++ H   A    Y+             
Sbjct  287   PLLDGNEPS--SAARPPNVKTMLCLVFMLTFFSTLNHHHSAESRFYSVSDNSNKGFVIPV  344

Query  1078  GRKLLQGSGTEHSSFGQ--------WLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMF  1233
             GRKLLQ +G   ++  +        +LGW MA IYMGGR+PQI LNIKRG VEGL+PLMF
Sbjct  345   GRKLLQVAGVLQNNVNEGGGGGIGTYLGWAMAVIYMGGRLPQICLNIKRGHVEGLSPLMF  404

Query  1234  IFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVC  1344
             IFAL+ N+TYV SILV +T+W KIKPNLPWL+DA  C
Sbjct  405   IFALIGNSTYVASILVSSTSWSKIKPNLPWLVDAFGC  441



>gb|AES75135.2| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=426

 Score =   239 bits (611),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 164/417 (39%), Positives = 219/417 (53%), Gaps = 82/417 (20%)
 Frame = +1

Query  193   NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             NS   C+  +  C+  V+   +    + +   S  LG+ S+I W +AEIPQ++TN+R KS
Sbjct  7     NSTSLCLGNQH-CLQLVQMVMR----SDAKTASITLGVISVIVWMIAEIPQLITNYREKS  61

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             SHG+S+ FLLTWI GD+FNL GCLLEPATLPTQLYTA+                      
Sbjct  62    SHGLSVTFLLTWIIGDLFNLFGCLLEPATLPTQLYTAV----------------------  99

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE--------DAGDSN  708
                                LYT  T+ L LQ+ YY  +Y   K K         D G+SN
Sbjct  100   -------------------LYTLITLTLCLQATYYGHIYPRLKHKRQFKIDPPIDDGESN  140

Query  709   QLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKS  888
               VE      +R   G S  PIP  A +   + Q+  YY SAR ++ S TP  +S L + 
Sbjct  141   NGVENGNAADQRTAIGLSS-PIPFPAQKSHVETQS--YYQSARYLSKSHTP--KSELAQR  195

Query  889   GPSALGMDNDCSSDDETVEAPSMNSISQPK-PIPRSAGYGAFLTT--SLSIPH--QTKAL  1053
              PS+L +D      +E +  PS+ + S P   I  +    + LT   +L++ H   T+  
Sbjct  196   MPSSLILD----PIEEPLLVPSVFTKSAPSLKIKNTLCLVSTLTFLGALNLLHSPDTRIH  251

Query  1054  MPV------YAALGGRKLLQGSGTEHS--------SFGQWLGWMMAAIYMGGRIPQIWLN  1191
               V      +    GRKLLQ SG + S        S G +LGW MA IYMGGR+PQI LN
Sbjct  252   SDVAKPRKEFVIYVGRKLLQVSGHKLSDQGVEAYHSIGTYLGWAMAVIYMGGRLPQICLN  311

Query  1192  IKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLF  1362
             I+RG+ EG+NPLMF+FAL+ N TYV SILV +  W K+ PNLPWL+++  C  LD F
Sbjct  312   IRRGNFEGVNPLMFLFALIGNTTYVASILVSSMDWSKLGPNLPWLVESGGCSILDSF  368



>ref|XP_009353181.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Pyrus 
x bretschneideri]
Length=398

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 158/427 (37%), Positives = 215/427 (50%), Gaps = 74/427 (17%)
 Frame = +1

Query  223   KPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLL  402
             + C  W  KY    LC++ D  S  LG+ S++ WGVAEIPQI+TN++ KS+HG+SL F +
Sbjct  21    EHCWEWGRKYLGYKLCSVKDFMSLALGVISVLTWGVAEIPQIITNYKAKSTHGLSLAFWM  80

Query  403   TWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYY  582
             TWI GD+FNL GCLLEPATLPTQ YTA+                                
Sbjct  81    TWILGDLFNLFGCLLEPATLPTQYYTAM--------------------------------  108

Query  583   FVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR-----N  747
                       YTATT VL  Q++YY ++Y   K     G  +   E + K   R      
Sbjct  109   ---------FYTATTSVLSAQTIYYRYIYPRLKYNLKKGSKSNPAEVSGKASVRIIVIDT  159

Query  748   KSGG--SGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDC  921
              S G  S  PI      P R    E YY SARS++ S       +  +     L  + + 
Sbjct  160   PSAGNVSSSPILCPNISPGR----ESYYISARSLSRSHASTEEFHAAQRTTRTLNHNRNP  215

Query  922   SSDD------ETVEAPSMNSISQPKPIPRSAGYGAF--LTTSLSIPHQTK-ALMPVYAAL  1074
             + +        T  APS N  +    +      G F   +  LS+ +  +  +M V    
Sbjct  216   NEERLLGALASTQSAPSNNVKTTLCVVSLMILLGTFNHQSVDLSVENPNRGVVMQV----  271

Query  1075  GGRKLLQGS-------GTEHSS-FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLM  1230
              GR LLQ S       GT+ SS  G +LGW M AIY+GGR+P+I+LNI++G+V+GLNP M
Sbjct  272   -GRWLLQVSSGLLRETGTKDSSEIGSFLGWGMTAIYIGGRLPEIYLNIRKGNVDGLNPFM  330

Query  1231  FIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSG  1410
             F+ A++ N TY+ SILV +  W  I+PNL WL+DA  C+ LD+FI+LQ+  Y  C    G
Sbjct  331   FVIAIVGNTTYIASILVNSMEWSNIRPNLAWLVDAGGCMLLDIFILLQFFRYWRCHDVEG  390

Query  1411  GSREDSA  1431
               R  +A
Sbjct  391   MDRHSNA  397



>dbj|BAJ92450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=409

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 157/444 (35%), Positives = 210/444 (47%), Gaps = 106/444 (24%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W + Y K CLC+  D  +  LGL S++ WG+AE+PQI+TN++ KS+ G+S+ FL+TW
Sbjct  18    CAEWAKVYLKYCLCSTKDGVALGLGLASVLSWGIAEVPQIITNYKQKSTEGLSIAFLMTW  77

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GC LEPATLPTQ Y AL                                  
Sbjct  78    IVGDLFNLAGCFLEPATLPTQFYMAL----------------------------------  103

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE------------DAGDSNQLVEEAKK  732
                    LYT TTV+L  Q++YY  +Y     K             DA    +L+    +
Sbjct  104   -------LYTITTVILTGQTIYYSHIYHLKVKKTGTTAKSQKHQRGDASLREKLLGHRDE  156

Query  733   PLRRNKSGGSGIPIPDGA----SRPARQHQ------AEYYYTSARSMAGSATPPFRSNLV  882
               + N   G  IPIP       +   RQ        ++YYY SARS++ S  P       
Sbjct  157   AFKNNIQSGPTIPIPSSPILVNTEVFRQRHGSVSPNSDYYYASARSLSRSPVP-------  209

Query  883   KSGPSALGMDNDCSSDDETVEAPSMNSISQP---KPIPRSAGYGAFLTTSLSIPHQTKAL  1053
                 +   + N+      T   P MN   +    + +P+SA       + L +P  +  L
Sbjct  210   ----TGTWLGNN---RQTTKFPPQMNDEGESLFGESVPQSAPAAVTKNSLLVVPWISVVL  262

Query  1054  -MPVYAALGGRKLLQGSGTEHSSFGQWL------------------------GWMMAAIY  1158
              M V   L G      S       G+ L                        GW MA IY
Sbjct  263   GMCVLHILVGTAQRDASNEIIIPVGRKLLVLADDHAGSSLSHGSGSGIGSFLGWAMAVIY  322

Query  1159  MGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAA  1338
             MGGR+PQI+LN++RG  EGL+PLMF FAL+ N TYVGSILV +  W +++PNLPWL+DA 
Sbjct  323   MGGRLPQIFLNMQRGHAEGLSPLMFTFALVGNTTYVGSILVNSLDWARLRPNLPWLVDAG  382

Query  1339  VCVGLDLFIILQYIYYRYCRKNSG  1410
              CV LD FII Q++Y+ Y RK S 
Sbjct  383   GCVLLDSFIIFQFLYFHY-RKQSA  405



>dbj|BAK03368.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=409

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 156/444 (35%), Positives = 209/444 (47%), Gaps = 106/444 (24%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W + Y K CLC+  D  +  LGL S++ WG+AE+PQI+TN++ KS+ G+S+ FL+TW
Sbjct  18    CAEWAKVYLKYCLCSTKDGVALGLGLASVLSWGIAEVPQIITNYKQKSTEGLSIAFLMTW  77

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GC LEPATLPTQ Y AL                                  
Sbjct  78    IVGDLFNLAGCFLEPATLPTQFYMAL----------------------------------  103

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE------------DAGDSNQLVEEAKK  732
                    LYT TTV+L  Q++YY  +Y     K             DA    +L+    +
Sbjct  104   -------LYTITTVILTGQTIYYSHIYHLKVKKTGTTAKSQKHQRGDASLREKLLGHRDE  156

Query  733   PLRRNKSGGSGIPIPDGA----SRPARQHQ------AEYYYTSARSMAGSATPPFRSNLV  882
               + N   G  IPIP       +   RQ        ++YYY SA S++ S  P       
Sbjct  157   AFKNNIQSGPTIPIPSSPILVNTEVFRQRHGSVSPNSDYYYASAGSLSRSPVP-------  209

Query  883   KSGPSALGMDNDCSSDDETVEAPSMNSISQP---KPIPRSAGYGAFLTTSLSIPHQTKAL  1053
                 +   + N+      T   P MN   +    + +P+SA       + L +P  +  L
Sbjct  210   ----TGTWLGNN---RQTTKFPPQMNDEGESLFGESVPQSAPAAVTKNSLLVVPWISVVL  262

Query  1054  -MPVYAALGGRKLLQGSGTEHSSFGQWL------------------------GWMMAAIY  1158
              M V   L G      S       G+ L                        GW MA IY
Sbjct  263   GMCVLHILVGTAQRDASNEIIIPVGRKLLVLADDHAGSSLSHGSGSGIGSFLGWAMAVIY  322

Query  1159  MGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAA  1338
             MGGR+PQI+LN++RG  EGL+PLMF FAL+ N TYVGSILV +  W +++PNLPWL+DA 
Sbjct  323   MGGRLPQIFLNMQRGHAEGLSPLMFTFALVGNTTYVGSILVNSLDWARLRPNLPWLVDAG  382

Query  1339  VCVGLDLFIILQYIYYRYCRKNSG  1410
              CV LD FII Q++Y+ Y RK S 
Sbjct  383   GCVLLDSFIIFQFLYFHY-RKQSA  405



>ref|XP_007028336.1| PQ-loop repeat family protein / transmembrane family protein 
[Theobroma cacao]
 gb|EOY08838.1| PQ-loop repeat family protein / transmembrane family protein 
[Theobroma cacao]
Length=950

 Score =   241 bits (616),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 156/408 (38%), Positives = 211/408 (52%), Gaps = 77/408 (19%)
 Frame = +1

Query  262   CLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGC  441
             C C   D+ SF LGL S+I W VAEIPQI+TN++ KS  G SL FL+TWI GD+FNL GC
Sbjct  573   CFC-ARDEGSFALGLISIISWSVAEIPQIITNYKEKSVQGFSLGFLITWIVGDLFNLFGC  631

Query  442   LLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTA  621
             +LEPATLPTQ + A+                                         LYT 
Sbjct  632   ILEPATLPTQYHMAV-----------------------------------------LYTM  650

Query  622   TTVVLVLQSMYYDFLYRWWK--------DKEDAGDSNQLVEEAKKPLRRNK-----SGGS  762
             T+ +L  Q++YY  +Y   K         KE   ++ + V E    L   +        S
Sbjct  651   TSSILAAQTVYYGHIYPRLKFKGVCHKGSKEHQPEAVEKVGEQINNLDVKQVIDADRLSS  710

Query  763   GIPIP--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSS---  927
              IP+P  +  S P R    E+YY SARS++ S TP   S L +   +     N       
Sbjct  711   PIPLPAINVKSSPGR----EFYYMSARSLSTSHTPTEGSFLARRMTTPFHTRNSVEEPLL  766

Query  928   ----DDETVEAPSMNSI-SQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLL  1092
                   +T   PS  S+      +   A +   L+    +  + + +   +A   GRKLL
Sbjct  767   SAHVSTQTASPPSTKSLLCLVSALMFIATFNFQLSAFNKLHLKPEIINQGFAIQIGRKLL  826

Query  1093  QGSGTE--------HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALL  1248
             Q +            S  G +LGW MAAIYMGGR+PQI LNI+RG+VEGLNP MF+FAL+
Sbjct  827   QVNAASLGESGIGGGSRVGTFLGWAMAAIYMGGRLPQICLNIRRGNVEGLNPFMFVFALV  886

Query  1249  ANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRY  1392
              N+TYV SILV++T W +I+PNLPWL+DA  CV LD+FI++Q++Y+ Y
Sbjct  887   GNSTYVASILVKSTDWSRIRPNLPWLVDAGGCVLLDIFILIQFLYFCY  934



>ref|XP_002984766.1| hypothetical protein SELMODRAFT_121256 [Selaginella moellendorffii]
 gb|EFJ14016.1| hypothetical protein SELMODRAFT_121256 [Selaginella moellendorffii]
Length=391

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 163/431 (38%), Positives = 214/431 (50%), Gaps = 93/431 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W+ +Y KDC+C++ D  SF LGL S++ WG+AE+PQI+TN++ KS+ GVSLLFL+TW
Sbjct  13    CSQWIFRYLKDCVCDVKDGVSFSLGLISVLSWGIAEVPQIITNYKEKSTEGVSLLFLMTW  72

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             + GD FN+ GCLLEPATLPTQ                                FY     
Sbjct  73    VVGDFFNIAGCLLEPATLPTQ--------------------------------FY-----  95

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGI  768
                 +  LYT TT+VLV Q++YY  +      K    DS  + E    P  R        
Sbjct  96    ----MALLYTLTTLVLVAQTIYYGQI-----AKRHRPDSPSIEEPLIPPEARRAQETPVT  146

Query  769   PIPDGASRPARQHQA---EYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDET  939
             P+                ++YYTSARS+  S TP   S L  SG             D  
Sbjct  147   PVTSQPISSISVPSPSPRQFYYTSARSLTRSHTPTAGSYLSTSG---------VKRGDYL  197

Query  940   VEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ--------  1095
                PS++++          G  A  +   S    +     V+++   R+LLQ        
Sbjct  198   SSHPSLSNLQAVAASLMMFGGYALHSRWESQARSSSGGHVVFSS--ARRLLQVREIRFTP  255

Query  1096  -GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
               SG+ HS  G+ LGW MAAIYMGGR+PQIWLN++    +GLNP+MF  AL+ NATYVGS
Sbjct  256   EDSGS-HSRAGEMLGWGMAAIYMGGRVPQIWLNLRL--FQGLNPMMFFCALMGNATYVGS  312

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLD-----------------LFIILQYIYYRY---  1392
             ILVR+T W K+KPN+PWL+DAAVCV LD                 L I+ Q+ YY     
Sbjct  313   ILVRSTDWTKLKPNMPWLVDAAVCVILDFFVWFFFCFRCSSLTVFLQILAQFCYYHRFVT  372

Query  1393  -CRKNSGGSRE  1422
              C   + GS E
Sbjct  373   KCNSQNSGSEE  383



>ref|XP_002985826.1| hypothetical protein SELMODRAFT_123042 [Selaginella moellendorffii]
 gb|EFJ13003.1| hypothetical protein SELMODRAFT_123042 [Selaginella moellendorffii]
Length=391

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 162/431 (38%), Positives = 214/431 (50%), Gaps = 93/431 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W+ +Y KDC+C++ D  SF LGL S++ WG+AE+PQI+TN++ KS+ GVSL+FL+TW
Sbjct  13    CSQWIFRYLKDCVCDVKDGVSFSLGLISVLSWGIAEVPQIITNYKEKSTEGVSLVFLMTW  72

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             + GD FN+ GCLLEPATLPTQ                                FY     
Sbjct  73    VVGDFFNIAGCLLEPATLPTQ--------------------------------FY-----  95

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGI  768
                 +  LYT TT+VLV Q++YY  +      K    DS  + E    P  R        
Sbjct  96    ----MALLYTLTTLVLVAQTIYYGQI-----AKRHRPDSPSIEEPLIPPEARRAQETPVT  146

Query  769   PIPDGASRPARQHQA---EYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDET  939
             P+                ++YYTSARS+  S TP   S L  SG             D  
Sbjct  147   PVTSQPISSISVPSPSPRQFYYTSARSLTRSHTPTAGSYLSTSG---------VKRGDYL  197

Query  940   VEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ--------  1095
                PS++++          G  A  +   S    +     V+++   R+LLQ        
Sbjct  198   SSHPSLSNLQAVAASLMMFGGYALHSRWESQARSSSGGHVVFSS--ARRLLQVREIRFTP  255

Query  1096  -GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGS  1272
               SG+ HS  G+ LGW MAAIYMGGR+PQIWLN++    +GLNP+MF  AL+ NATYVGS
Sbjct  256   EDSGS-HSRAGEMLGWGMAAIYMGGRVPQIWLNLRL--FQGLNPMMFFCALMGNATYVGS  312

Query  1273  ILVRTTAWDKIKPNLPWLLDAAVCVGLD-----------------LFIILQYIYYRY---  1392
             ILVR+T W K+KPN+PWL+DAAVCV LD                 L I+ Q+ YY     
Sbjct  313   ILVRSTDWTKLKPNMPWLVDAAVCVILDFFVWFFFCFRCSSLTVFLQILAQFCYYHRFVT  372

Query  1393  -CRKNSGGSRE  1422
              C   + GS E
Sbjct  373   KCNSQNSGSEE  383



>ref|XP_008806620.1| PREDICTED: uncharacterized protein LOC103719251 [Phoenix dactylifera]
Length=387

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 155/428 (36%), Positives = 201/428 (47%), Gaps = 89/428 (21%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             MSL   + P+  +  + C  W   Y   CLC+  D  S  LGL S++ WGVAE+PQI+TN
Sbjct  1     MSLLSETLPHACSLNQHCWQWARIYLNYCLCSAKDGMSLALGLVSVVSWGVAEVPQIITN  60

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KS  G+S+ FL+TWI GD+FNL+GCLLEP TLPTQ Y AL                 
Sbjct  61    YKEKSMEGLSIAFLMTWIIGDLFNLIGCLLEPTTLPTQFYMAL-----------------  103

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKED-----AGD  702
                                     LYT TTV+L  Q++YY  +Y   K  +D     +  
Sbjct  104   ------------------------LYTTTTVILTAQTVYYGHIYHRLKANKDRVCHKSHR  139

Query  703   SNQLVEEAKK-----------------------PLRRNKSGGSGIPIPDGASRPAR--QH  807
              +Q  E  K+                       P+R      S  PIP  A    R   +
Sbjct  140   HHQEDEPTKERLLGYNIDDKETRASNYQANGSNPVREGMHMTSS-PIPVTAPVIGRYGSY  198

Query  808   QAEYYYTSARSMAGSATPPFRS---NLVKSGPSALGMDNDCSSDD------ETVEAPSMN  960
               + YY SARS++ S  P   S   +L     +AL  D   S +           AP MN
Sbjct  199   GRDLYYMSARSLSKSPIPTAGSWLAHLHHYSRTALNHDRHSSQEPLVGRLVPQKSAPLMN  258

Query  961   SISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGS--------GTEHS  1116
             + +    +P  A      +  L +     A       L GRKLLQ          G    
Sbjct  259   TKNMLSVVPSVAFLLGIYSIHLFMKKSFNASPHPAVILVGRKLLQDQVFESPVRHGDGSR  318

Query  1117  SFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAW  1296
               G  LGW MAAIYMGGR+PQI LNI+RG+VEGLNPLMFIFA++ N TYVGSI+V +  W
Sbjct  319   GIGNLLGWAMAAIYMGGRLPQICLNIRRGNVEGLNPLMFIFAVIGNTTYVGSIIVNSLDW  378

Query  1297  DKIKPNLP  1320
              +I+PNLP
Sbjct  379   SRIRPNLP  386



>ref|XP_010023561.1| PREDICTED: seven transmembrane protein 1-like [Eucalyptus grandis]
Length=377

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 163/425 (38%), Positives = 220/425 (52%), Gaps = 90/425 (21%)
 Frame = +1

Query  262   CLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGC  441
             CLC+  D  S  LG+ S++ WGVAEIPQIVTN++ KS+ G+SL FL TWI GD+FNL GC
Sbjct  4     CLCSTKDGISLSLGVVSVVSWGVAEIPQIVTNYKLKSAEGLSLAFLTTWILGDLFNLFGC  63

Query  442   LLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTA  621
             +LEPATLPTQ Y A+                                         LYT 
Sbjct  64    MLEPATLPTQYYMAV-----------------------------------------LYTI  82

Query  622   TTVVLVLQSMYYDFLY------RWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDG  783
              T  +  Q++YY  +Y      R  KD     +S++ ++     + R     S IP+P  
Sbjct  83    ATWAIFGQTVYYGHIYPRLKYRRIHKDSVKQHNSSERLQNGSDTIDRQSVLSSPIPLPAL  142

Query  784   ASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSM--  957
              +  + Q     YY SARS + S TP   S      P  +   N  + +  T E P +  
Sbjct  143   PTNASPQQ--GLYYASARSFSSSHTPIAGSCF----PQRMSPKN--ADNQGTFEEPLLAG  194

Query  958   NSISQPKPIPRSAG----------YGAF--------LTTSLSIPHQTKALMPVYAALGGR  1083
             +S  Q  P P++            +G F          +S+S  H  + +M V     GR
Sbjct  195   DSSEQSTPSPKTKNMLCLVSLVMFFGTFNLPKPVKDRASSVSRKHSGR-IMQV-----GR  248

Query  1084  KLLQ---GSGTEH-----SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIF  1239
             KLLQ   G   E+     S  G +LGW MAAIYMGGR+PQI LNI+RG VEGLNP MF+ 
Sbjct  249   KLLQVNDGMLQENGFAGNSGVGTFLGWAMAAIYMGGRLPQICLNIRRGKVEGLNPWMFLL  308

Query  1240  ALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGG-S  1416
             AL+ N TYV SILV +  W KI+PNLPWL++++ C  LD+FI++Q+IY+ Y +K     +
Sbjct  309   ALIGNITYVASILVSSLDWSKIRPNLPWLVESSGCALLDIFILIQFIYFSYQKKQDVKIT  368

Query  1417  REDSA  1431
             REDS+
Sbjct  369   REDSS  373



>gb|AFW79602.1| hypothetical protein ZEAMMB73_686781 [Zea mays]
Length=400

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 154/431 (36%), Positives = 203/431 (47%), Gaps = 79/431 (18%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M +   + P      + C  W   Y K CLC+  +  +  LGL S++ WG+AE+PQI+TN
Sbjct  1     MGVIGGTPPASCPTTRHCAEWARIYLKYCLCSQKEGAALALGLISVVSWGLAEVPQIMTN  60

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             +R KS+ G+S+ FL+TWI GD+FNL GC LEPATLPTQ Y AL                 
Sbjct  61    YRHKSTEGLSVAFLMTWIVGDLFNLAGCFLEPATLPTQFYMAL-----------------  103

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK----------  687
                                     LYT TT++L  Q++YY  +Y   K K          
Sbjct  104   ------------------------LYTITTLILTGQTIYYSHIYHHLKLKNSRAASKPQK  139

Query  688   ---EDAGDSNQLVEEAKKPLRRNKSGGSGI-----PIPDGASRPARQH----QAEYYYTS  831
                 DA    +L+        RN    + +     PIP       + H     A+YYY S
Sbjct  140   HQYRDASLREKLLGAKGSAASRNNESDTTVLIPSSPIPVNMKLVDQYHGSSSNADYYYMS  199

Query  832   ARSMAGSATPPFR----SNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG  999
             ARS++ S  P       SN   S       D   S   E     S  S      +  +  
Sbjct  200   ARSLSRSPVPTAGIWSGSNRQSSRSPPQMNDQRGSLIGEIAPEHSAPSTVTKNALSVAPW  259

Query  1000  YGAFLTTSLS---IPHQTKALMPVYAALGGRKLL---------QGSGTEHSSFGQWLGWM  1143
              G  L T L    I ++ + +        GR+LL           S +  S  G +LGW 
Sbjct  260   MGLLLGTCLLHILIGNKHREMASGTVIPIGRRLLLFVDDHGNSSLSQSSGSEIGSFLGWA  319

Query  1144  MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPW  1323
             MA IYMGGR+PQI LN++RG VEGLNPLMF FALL N+TYVGSILV +  W K++PNLPW
Sbjct  320   MAMIYMGGRLPQILLNMQRGHVEGLNPLMFTFALLGNSTYVGSILVNSLDWSKLRPNLPW  379

Query  1324  LLDAAVCVGLD  1356
             L+++  CV LD
Sbjct  380   LVESGGCVLLD  390



>gb|AES81064.2| PQ-loop protein/transmembrane family protein [Medicago truncatula]
Length=356

 Score =   225 bits (573),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 148/390 (38%), Positives = 203/390 (52%), Gaps = 76/390 (19%)
 Frame = +1

Query  289   SFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPT  468
             S+ LG  S++ W +AEIPQI+TN+R KS+ G+S  FL+TWI GD+FNL GC+LEPATLPT
Sbjct  10    SYTLGWLSVVIWVIAEIPQIITNYRAKSTDGLSATFLITWIIGDLFNLFGCILEPATLPT  69

Query  469   QLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQS  648
             Q Y A+                                         LYT  T VL  Q+
Sbjct  70    QFYMAV-----------------------------------------LYTIITTVLGSQA  88

Query  649   MYYDFLY------RWWKDKE--DAGDSNQLVEEAKKPLRRNKSGGSG--IPIPDGASRPA  798
             +YY ++Y      R  K +    AG   +L +  +     + S G+G   PIP     P+
Sbjct  89    IYYGYIYPRSQYKRLLKVETPTKAGQVEKLSDAEQSHQFDDFSRGTGRSSPIPLPVHLPS  148

Query  799   -RQHQAEYYYTSARSMAGSATPPFRSNLV-KSGPSALGMDNDCSSDDETVEAPSMNSISQ  972
                 + E +Y SARS++ S TP   S +  +  P++  +D    S ++ + +P + + S 
Sbjct  149   IFTGREELFYQSARSLSKSHTPTAGSIIAQRMSPTSPFLD----STEKNLLSPDVATQSD  204

Query  973   PKPIPRSAGYGAFLTTSLSIPHQTKALMPV-----------YAALGGRKLLQGSG-----  1104
             P    +S        T L + +  K+L  +           +    GRKLLQ SG     
Sbjct  205   PSLKIKSTLSVVSTLTFLGVINLHKSLEKIINPLVSNPRQQFVVYVGRKLLQVSGDQLME  264

Query  1105  ---TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
                +  SS G + GW MA IY+GGR+PQI+LNI+RG  EGLNPLMF+FAL+ NATYV SI
Sbjct  265   NGASRTSSIGTFFGWAMAVIYLGGRMPQIFLNIRRGHAEGLNPLMFLFALIGNATYVASI  324

Query  1276  LVRTTAWDKIKPNLPWLLDAAVCVGLDLFI  1365
             LVR+  W  I PNLPWL+DA  CV LD F+
Sbjct  325   LVRSLDWSTIGPNLPWLVDAGGCVLLDFFV  354



>ref|XP_008654591.1| PREDICTED: PQ loop repeat family protein isoform X3 [Zea mays]
Length=566

 Score =   229 bits (584),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 155/433 (36%), Positives = 204/433 (47%), Gaps = 79/433 (18%)
 Frame = +1

Query  172   ASMSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIV  351
             A M +   + P      + C  W   Y K CLC+  +  +  LGL S++ WG+AE+PQI+
Sbjct  165   ADMGVIGGTPPASCPTTRHCAEWARIYLKYCLCSQKEGAALALGLISVVSWGLAEVPQIM  224

Query  352   TNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*A  531
             TN+R KS+ G+S+ FL+TWI GD+FNL GC LEPATLPTQ Y AL               
Sbjct  225   TNYRHKSTEGLSVAFLMTWIVGDLFNLAGCFLEPATLPTQFYMAL---------------  269

Query  532   AIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK--------  687
                                       LYT TT++L  Q++YY  +Y   K K        
Sbjct  270   --------------------------LYTITTLILTGQTIYYSHIYHHLKLKNSRAASKP  303

Query  688   -----EDAGDSNQLVEEAKKPLRRNKSGGSGI-----PIPDGASRPARQH----QAEYYY  825
                   DA    +L+        RN    + +     PIP       + H     A+YYY
Sbjct  304   QKHQYRDASLREKLLGAKGSAASRNNESDTTVLIPSSPIPVNMKLVDQYHGSSSNADYYY  363

Query  826   TSARSMAGSATPPFR----SNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRS  993
              SARS++ S  P       SN   S       D   S   E     S  S      +  +
Sbjct  364   MSARSLSRSPVPTAGIWSGSNRQSSRSPPQMNDQRGSLIGEIAPEHSAPSTVTKNALSVA  423

Query  994   AGYGAFLTTSLS---IPHQTKALMPVYAALGGRKLL---------QGSGTEHSSFGQWLG  1137
                G  L T L    I ++ + +        GR+LL           S +  S  G +LG
Sbjct  424   PWMGLLLGTCLLHILIGNKHREMASGTVIPIGRRLLLFVDDHGNSSLSQSSGSEIGSFLG  483

Query  1138  WMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNL  1317
             W MA IYMGGR+PQI LN++RG VEGLNPLMF FALL N+TYVGSILV +  W K++PNL
Sbjct  484   WAMAMIYMGGRLPQILLNMQRGHVEGLNPLMFTFALLGNSTYVGSILVNSLDWSKLRPNL  543

Query  1318  PWLLDAAVCVGLD  1356
             PWL+++  CV LD
Sbjct  544   PWLVESGGCVLLD  556



>gb|KHN10879.1| Putative membrane protein [Glycine soja]
Length=378

 Score =   223 bits (568),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 150/409 (37%), Positives = 202/409 (49%), Gaps = 92/409 (22%)
 Frame = +1

Query  256   KDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLV  435
             K+ + ++ +  SF+LGL S+I W VAEIPQI+TN+RTKS+ G+S+ FL+TWI GD+FNL 
Sbjct  24    KEHMGSVRETASFLLGLISVIVWVVAEIPQILTNYRTKSAEGLSVTFLITWIIGDLFNLS  83

Query  436   GCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLY  615
             GCLLEPATL                                                  Y
Sbjct  84    GCLLEPATL--------------------------------------------------Y  93

Query  616   TATTVVLVLQSMYYDFLYRWWKDK--------------EDAGDSNQLVEEAKKPLRRNKS  753
             T  T+ L  Q++YY  +Y   K K              E A D+ Q ++       R+  
Sbjct  94    TIITIALGAQTIYYGHIYPQLKYKRQLKIETFTKVGHVEKASDAEQSIQVDGS--NRSTD  151

Query  754   GGSGIPIPDGASRPARQHQA-EYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDC-SS  927
               S IP+P   +RP R     E +Y SAR ++ S TP   S L +  P+   +      S
Sbjct  152   LSSPIPLP---ARPQRISTGRELFYQSARYLSKSNTPTAGSILAQKPPTLDSIQESLLGS  208

Query  928   DDETVEAPSMNSISQPKPIPRSAGYGAF---------LTTSLSIPHQTKALMPVYAALGG  1080
                T  AP++   +    +      GA          + +  S P Q       +    G
Sbjct  209   TIATQSAPALKMKNTLCLVSTLTFLGAINLLQPLDERINSMASNPRQQ------FVIYVG  262

Query  1081  RKLLQGSGTE------HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             RKL Q S  +        S G + GW M  IY+GGR+PQI LNI+RG VEGLNPLMF+FA
Sbjct  263   RKLFQVSDDQLPKTDVSGSIGTFFGWAMTFIYLGGRLPQICLNIRRGHVEGLNPLMFLFA  322

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             ++ NATYV SILV +  W KI+PNLPWL+DA  CV LD FI++Q+IY+R
Sbjct  323   VIGNATYVASILVISLDWSKIRPNLPWLVDAGGCVLLDFFILMQFIYFR  371



>ref|XP_003624846.1| Membrane protein, putative [Medicago truncatula]
Length=398

 Score =   220 bits (561),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 200/392 (51%), Gaps = 79/392 (20%)
 Frame = +1

Query  289   SFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPT  468
             S+ LG  S++ W +AEIPQI+TN+R KS+ G+S  FL+TWI GD+FNL GC+LEPATLPT
Sbjct  10    SYTLGWLSVVIWVIAEIPQIITNYRAKSTDGLSATFLITWIIGDLFNLFGCILEPATLPT  69

Query  469   QLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQS  648
             Q Y A+                                         LYT  T VL  Q+
Sbjct  70    QFYMAV-----------------------------------------LYTIITTVLGSQA  88

Query  649   MYYDFLY------RWWKDKE--DAGDSNQLVEEAKKPLRRNKSGGSG--IPIPDGASRPA  798
             +YY ++Y      R  K +    AG   +L +  +     + S G+G   PIP     P+
Sbjct  89    IYYGYIYPRSQYKRLLKVETPTKAGQVEKLSDAEQSHQFDDFSRGTGRSSPIPLPVHLPS  148

Query  799   -RQHQAEYYYTSARSMAGSATPPFRSNLV-KSGPSALGMDNDCSSDDETVEAPSMNSISQ  972
                 + E +Y SARS++ S TP   S +  +  P++  +D    S ++ + +P + + S 
Sbjct  149   IFTGREELFYQSARSLSKSHTPTAGSIIAQRMSPTSPFLD----STEKNLLSPDVATQSD  204

Query  973   PKPIPRSAGYGAFLTTSLSIPHQTKALMPV-----------YAALGGRKLLQ--------  1095
             P    +S        T L + +  K+L  +           +    GRKLLQ        
Sbjct  205   PSLKIKSTLSVVSTLTFLGVINLHKSLEKIINPLVSNPRQQFVVYVGRKLLQQLQVSGDQ  264

Query  1096  ---GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYV  1266
                   +  SS G + GW MA IY+GGR+PQI+LNI+RG  EGLNPLMF+FAL+ NATYV
Sbjct  265   LMENGASRTSSIGTFFGWAMAVIYLGGRMPQIFLNIRRGHAEGLNPLMFLFALIGNATYV  324

Query  1267  GSILVRTTAWDKIKPNLPWLLDAAVCVGLDLF  1362
              SILVR+  W  I PNLPWL+DA  CV LD F
Sbjct  325   ASILVRSLDWSTIGPNLPWLVDAGGCVLLDFF  356



>ref|XP_008367312.1| PREDICTED: uncharacterized protein LOC103430943 [Malus domestica]
Length=400

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 152/429 (35%), Positives = 215/429 (50%), Gaps = 80/429 (19%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W  KY    LC++ D  S  LG+ S++ WGVAEIPQI+TN++ KS+HG+SL FL+TW
Sbjct  23    CXEWGRKYLGYELCSVKDFMSLALGVISVLTWGVAEIPQIITNYKXKSTHGLSLAFLMTW  82

Query  409   IAGDIFNLVGCLLEPAT--LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYY  582
             I GD+FNL GCLLEPAT  LPTQ YTA+                                
Sbjct  83    ILGDLFNLFGCLLEPATXSLPTQYYTAM--------------------------------  110

Query  583   FVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRR------  744
                       YTATT VL  Q++YY ++Y   K     G  +   E   K   R      
Sbjct  111   ---------FYTATTSVLSAQTIYYRYIYPXLKYNLKKGSKSNPAEVPGKASGRINVIDT  161

Query  745   -NKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDC  921
              +       PI      P R    E YY SARS++ S           +  +   ++++ 
Sbjct  162   PSAXNVXSSPILCPNISPGR----ESYYISARSLSRSXAS--XEEFXXAQRTTRTLNHNR  215

Query  922   SSDDETV--------EAPSMNSISQPKPIPRSAGYGAF--LTTSLSIPHQTKALMPVYAA  1071
             + ++E +         APS N       +     +G F   +  LS+ +  +    V   
Sbjct  216   NPNEEPLLGALASXQSAPSNNVKXTLCVVSLXTLFGTFNHRSVDLSVXNPNRG---VVXQ  272

Query  1072  LGGRK------LLQGSGTEHS-SFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLM  1230
             +G R       LL+ +GT+ S   G +LGW M AIY+GGR+PQI+LNI++G+V+GLNP M
Sbjct  273   VGRRXLQVSSGLLRETGTKDSGGIGSFLGWGMTAIYIGGRLPQIYLNIRKGNVDGLNPFM  332

Query  1231  FIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN--  1404
             FI A++ N TY+ SILV +  W  ++PNL WL+DA  C+ LD+FI+ Q  ++RY R+   
Sbjct  333   FIIAIVGNTTYIASILVNSMEWSNVRPNLAWLVDAGGCMLLDIFILFQ--FFRYWRRQDV  390

Query  1405  SGGSREDSA  1431
              G  R  +A
Sbjct  391   EGTDRHSNA  399



>gb|EYU35636.1| hypothetical protein MIMGU_mgv1a008531mg [Erythranthe guttata]
Length=370

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 157/411 (38%), Positives = 198/411 (48%), Gaps = 89/411 (22%)
 Frame = +1

Query  223   KPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLL  402
             K C  W  KY   CLC+  D FS  LGL S++ W VAEIPQI+TN+R  S+ G+S++FL 
Sbjct  15    KHCSEWAIKYMGYCLCSTKDGFSLALGLISVLTWSVAEIPQIITNYRENSAEGLSIVFLS  74

Query  403   TWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYY  582
             TWI GD FNL GC+LEPATLPTQ YTA+                                
Sbjct  75    TWIVGDFFNLAGCMLEPATLPTQYYTAV--------------------------------  102

Query  583   FVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWK--------DKEDAGDSNQLVEEAKKPL  738
                      LYT T++VL  QS+YY  +    K        D E   D     +  K   
Sbjct  103   ---------LYTVTSLVLASQSVYYGNIKPRLKFNKRLQQEDMERKRDDGYSDDTEKSNN  153

Query  739   RRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDND  918
               +  G    P+P   + P      E Y+ SARS++ S TPP  S L    P        
Sbjct  154   EESFEGAPSSPVPVAHNSPTGFE--EIYFMSARSLSVSHTPPAGSFLTGRTP--------  203

Query  919   CSSDDETV---EAPSMNSISQPKPIPRSAGYGAFLTTSL-SIPHQTKALMPVYAALG---  1077
              +SD E     EA    + S P  I       + +T  + S  +Q  A      +L    
Sbjct  204   -TSDVEKPLLGEARPPQTSSTPPKIKTMLCVVSLMTFFIGSCTNQLAANRENVTSLNNPT  262

Query  1078  -------GRKLLQ---GSGTE-----HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
                    GR+LL+   GS  E      S  G +LGW MA IY+GGR+PQI LN       
Sbjct  263   GGVVFRVGRRLLEATIGSAQETSGSGSSRIGSFLGWGMAVIYVGGRLPQICLN-------  315

Query  1213  GLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFI  1365
             GLNPLMF+FA++ N TYV SILV + +W KIKPNLPWL+DAA CV LD F+
Sbjct  316   GLNPLMFVFAIVGNTTYVASILVNSLSWVKIKPNLPWLVDAAGCVLLDAFV  366



>gb|KFK36620.1| hypothetical protein AALP_AA4G147300 [Arabis alpina]
Length=318

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 194/381 (51%), Gaps = 93/381 (24%)
 Frame = +1

Query  271   NISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLE  450
             ++ D  SF LG+ S+I   V+EIPQI+TN+R KS+ G+S+ FL TW+ GDI NLVGCL++
Sbjct  6     SVRDGLSFSLGIISVITMCVSEIPQIMTNYREKSTEGLSIAFLTTWLVGDIMNLVGCLMD  65

Query  451   PATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTV  630
              ATL TQLYTAL                                          +T TT 
Sbjct  66    TATLRTQLYTAL-----------------------------------------FHTVTTS  84

Query  631   VLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQ  810
             +L +Q +YY  +Y    ++      N+ +E  +     N S GS +     A R A +  
Sbjct  85    LLYVQIIYYGHIYPRLNNRR-----NERIEVERIS---NISSGSYL-----AQRMASEPT  131

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPR  990
              E     A  +  +ATPP   +++    + L +         T   P  N IS+ K I  
Sbjct  132   LE-----APLLPENATPPSTKSMLCVVSAFLFIG--------TFNLP--NLISESKTI--  174

Query  991   SAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ---GSGTEH--SSFGQWLGWMMAAI  1155
                         ++  + +    V+     R LLQ   G+ TE+  S    +LGW MAAI
Sbjct  175   ------------ALGERDR----VFVVGAARNLLQVTSGNVTENQNSKIAIFLGWPMAAI  218

Query  1156  YMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDA  1335
             Y+GGR+PQI LN++RG VEGLNPLMF  A ++N  YV SILVR+  W KI PNLPWL+DA
Sbjct  219   YLGGRLPQICLNMRRGHVEGLNPLMFFIAFVSNIAYVASILVRSVEWSKISPNLPWLVDA  278

Query  1336  AVCVGLDLFIILQYIYYRYCR  1398
               CV LD  I+LQ++YYR CR
Sbjct  279   GGCVVLDFIILLQFVYYR-CR  298



>ref|XP_010111305.1| hypothetical protein L484_027959 [Morus notabilis]
 gb|EXC30783.1| hypothetical protein L484_027959 [Morus notabilis]
Length=376

 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 137/395 (35%), Positives = 195/395 (49%), Gaps = 85/395 (22%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W  +Y + C+C+  D  S  LG+ S++ W VAEIPQI+TN+R KS+ G+S+ FL TW
Sbjct  16    CAKWAIQYLQYCICSAKDGVSLSLGVVSVVTWTVAEIPQIITNYRQKSTQGLSMAFLATW  75

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GDIFNLVGC++EPATLPTQ Y A+                                  
Sbjct  76    ILGDIFNLVGCIMEPATLPTQFYMAV----------------------------------  101

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLY-RWWKDKEDAGDSNQLVEEAK--------KPLR  741
                    LYT T++ LVLQ+MYYD++Y R  + K+   D    +++ +        KP R
Sbjct  102   -------LYTLTSMALVLQAMYYDYIYPRMKRSKQQQKDLLYSMQDPRFNQTGVDVKP-R  153

Query  742   RNKSG--------------GSGIPIPDGASRPAR--------QHQAEYYYTSARSMAGSA  855
             +++SG                 +   D  + P R            + YY SARS+  S+
Sbjct  154   QSRSGVDVIQDYYSDISNKNDTVITSDVLNAPPRLTDYASNTSSGRDLYYVSARSLFKSS  213

Query  856   TPPFRSNLVKSGPSALGMDNDCSSDDETV---EAPSMNSISQPKPIPRSAGYGAFLTT-S  1023
             TPP  S L +   S+       S  D  +   E+    S S+ KP+        FL   +
Sbjct  214   TPPLGSYLAQRLASSTSSQTRSSLQDPLLAPQESAEPKSASRVKPMLSVVSAMTFLGALN  273

Query  1024  LSIPHQTKALMPVYAALGGRKLLQGSG--------TEHSSFGQWLGWMMAAIYMGGRIPQ  1179
             +      +   P +    GR+LLQ +G         E +    +LGW MAAIYMGGR+PQ
Sbjct  274   VHFSALNEKRNPGFVIRVGRRLLQANGGLLQEHGVGEGTGIATFLGWGMAAIYMGGRLPQ  333

Query  1180  IWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR  1284
             I+LN+++G+VEGLNP MF FA++ N+TYV  IL +
Sbjct  334   IFLNMRKGNVEGLNPFMFFFAVVGNSTYVARILTK  368



>ref|XP_010436471.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Camelina 
sativa]
Length=289

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/386 (35%), Positives = 183/386 (47%), Gaps = 115/386 (30%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S  LG+ S+I W VAEIPQI++N+  KS  GVS+ FL TW+ GDIFN+VGCLLEPA+
Sbjct  5     DGLSMSLGVISVISWSVAEIPQIISNYNQKSIDGVSIAFLTTWMLGDIFNIVGCLLEPAS  64

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             L  Q YTA+V                                         Y   T+VL 
Sbjct  65    LAVQFYTAVV-----------------------------------------YALATLVLY  83

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEY  819
             +QS+YY  +Y   K++ +    +Q+V+  ++PL   +           A+RP        
Sbjct  84    VQSIYYGHIYPRLKNRRN----HQVVDNVEEPLLHAE-----------ATRP--------  120

Query  820   YYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG  999
                S +SM            V S    LG               S N +S P+       
Sbjct  121   ---STKSML----------CVVSVFLFLG---------------SFNMLSGPR-------  145

Query  1000  YGAFLTTSLSIPHQTKALMPVYAALGG-RKLLQGS----GTEHSSFGQWLGWMMAAIYMG  1164
                    S+ +  + +    V+  +GG RKLL+ S    G  + + G  LGW MAAIY+G
Sbjct  146   -------SMDLREKDR----VFVVVGGARKLLEVSSGNLGGGNYNMGMLLGWAMAAIYLG  194

Query  1165  GRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVC  1344
             GR+PQI + ++ G   GLNPLMF FA L N TYV SILV++  W  IKPNLPWL+DA  C
Sbjct  195   GRVPQICMTMRNGHAGGLNPLMFFFAFLGNVTYVASILVKSVEWSNIKPNLPWLVDAGGC  254

Query  1345  VGLDLFIILQYIYYRYCRKNSGGSRE  1422
               LD  I+LQ  Y+R    N    ++
Sbjct  255   PVLDFIILLQIFYFRCGNVNKDSDKK  280



>gb|KCW89961.1| hypothetical protein EUGRSUZ_A02167 [Eucalyptus grandis]
Length=329

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 193/425 (45%), Gaps = 133/425 (31%)
 Frame = +1

Query  193   NSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKS  372
             N  P C A +  C  W  KY + CLC+  D  S  LG+ S+I WGVAEIPQIVTN++ KS
Sbjct  6     NDMPQCPASRH-CTRWARKYMQYCLCSTRDGVSLSLGVVSVISWGVAEIPQIVTNYKQKS  64

Query  373   SHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICES  552
             + G+S+ FL+TW+ GD+FNL GC+LEPATLPTQ Y A+                      
Sbjct  65    AEGLSIAFLMTWVVGDVFNLFGCMLEPATLPTQYYMAV----------------------  102

Query  553   LRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDK------------EDA  696
                                LYT TT+VL  Q++YY  +  W K +            E A
Sbjct  103   -------------------LYTVTTMVLTGQAVYYGHVCPWLKYRRPFCKGPKPIQIESA  143

Query  697   G--------------DSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSA  834
             G              +S++ ++     + R     S IP+P  AS          YY SA
Sbjct  144   GNDSKSNCKVSMKEANSSERLQNGSDTIDRQSVLSSPIPLP--ASPTNASPGNGLYYVSA  201

Query  835   RSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAP----SMNSISQPKPIPRSAGY  1002
             RS++ S TP   S         L M  + + ++ T+E P     ++  S P P       
Sbjct  202   RSLSSSHTPTAGSYF------PLRMSPNNADNEGTIEEPLLAGDLSEQSAPSP-------  248

Query  1003  GAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSG-TEHSSFGQWLGWMMAAIYMGGRIPQ  1179
                         +TK ++ +        + +G+G + H   G +LGW MAAIYMGGR+PQ
Sbjct  249   ------------KTKNMLCL--------VDEGNGFSGHVGVGSFLGWAMAAIYMGGRLPQ  288

Query  1180  IWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDL  1359
             I LN+                         SILVR+  W KI+PNLPWL+DAA CV LD+
Sbjct  289   ICLNV-------------------------SILVRSLDWSKIRPNLPWLVDAAGCVLLDI  323

Query  1360  FIILQ  1374
              + L 
Sbjct  324   LVSLN  328



>gb|ABR13292.1| putative PQ-loop repeat family protein [Prunus dulcis]
Length=104

 Score =   184 bits (468),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 83/104 (80%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  1063  YAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             Y  + GRKLLQ    EHS+FGQWLGW+MAAIYMGGR+PQIWLNIKRG+VEGLNPLMF+FA
Sbjct  1     YIGITGRKLLQEHSMEHSAFGQWLGWLMAAIYMGGRLPQIWLNIKRGTVEGLNPLMFVFA  60

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQ  1374
             L+AN TYVGSI+VRTT WD IK N+PWLLDA VCVGLDLFIILQ
Sbjct  61    LVANVTYVGSIVVRTTEWDSIKANMPWLLDAVVCVGLDLFIILQ  104



>ref|XP_006411368.1| hypothetical protein EUTSA_v10017959mg, partial [Eutrema salsugineum]
 gb|ESQ52821.1| hypothetical protein EUTSA_v10017959mg, partial [Eutrema salsugineum]
Length=386

 Score =   184 bits (467),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 138/388 (36%), Positives = 177/388 (46%), Gaps = 112/388 (29%)
 Frame = +1

Query  418   DIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*  597
             DIFNL+GCL+EPATLPTQ Y AL                                     
Sbjct  34    DIFNLLGCLMEPATLPTQFYMAL-------------------------------------  56

Query  598   IVGQLYTATTVVLVLQSMYYDFLYRWWKDKE----DAGDSNQLVEEAKKPLR-RNKS---  753
                 LYT TT +L  QS+YY  +Y   K++     DA   + +  +AK P R RN+    
Sbjct  57    ----LYTVTTSILYAQSIYYGHIYPRLKNRRNQMVDAERISNISSDAKIPSRWRNRCSDA  112

Query  754   ---GGSGIPIP--DGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDND  918
                G    PI    G+ R +   + E +YTSARS++ S TPP          S L     
Sbjct  113   APGGDQTTPITMIPGSHRSSFTGR-ELFYTSARSLSSSHTPP--------AGSVLAQRLA  163

Query  919   CSSDDETVEAPSMNSISQPKPIPRSAG-----------YGAFLTTSLSIPHQTKALMP--  1059
                 + T+E P +     P  +P S              G F   +L    +T AL    
Sbjct  164   RGQSEPTLEEPLLPEDVTPPSLPPSTKSLLCVVSLFLFLGTFNLPNLLSESRTMALGERD  223

Query  1060  -VYAALGGRKLLQ--------GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIK-----  1197
              V+     RKLLQ         +G E+S  G +LGW MAAIY+GGR+PQI LN+K     
Sbjct  224   RVFVVRAARKLLQVTSGNLAENNGGENSKIGMFLGWAMAAIYLGGRLPQICLNVKSLFYT  283

Query  1198  ---------------------RGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPN  1314
                                  RG VEGLNPLMF FAL+ N TYV SILV++  W K+ PN
Sbjct  284   STSTYILDLSFITDIFCMQMRRGHVEGLNPLMFFFALVGNMTYVASILVKSVEWLKLAPN  343

Query  1315  LPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
             LPWL+DA  CV LD  I+LQ+ ++R CR
Sbjct  344   LPWLVDAGGCVVLDFLILLQFFHFR-CR  370



>gb|KCW89962.1| hypothetical protein EUGRSUZ_A02168 [Eucalyptus grandis]
Length=366

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 146/415 (35%), Positives = 203/415 (49%), Gaps = 78/415 (19%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L +   P C A +  C  W  ++ + CLC+  D  S  LG+ S++ WGVAEIPQIVTN
Sbjct  1     MGLLRRDVPQCPAGRH-CAQWFREHMQYCLCSTKDGISLSLGVVSVVSWGVAEIPQIVTN  59

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KS+ G+SL FL TWI GD+FNL GC+LEPAT  T L T+  +               
Sbjct  60    YKLKSAEGLSLAFLTTWILGDLFNLFGCMLEPAT--TILLTSYNV---------------  102

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                    QLYT  T  +  Q++YY  +Y   K +        + 
Sbjct  103   -----------------------QLYTIATWAIFGQTVYYGHIYPRLKYRRPFCKIIVVC  139

Query  718   EEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPS  897
               + +    + +  +G   P   S     +Q  +       +AG ++        +S PS
Sbjct  140   FRSARSFSSSHTPIAGSCFPQRMSPKNADNQGTF---EEPLLAGDSSE-------QSTPS  189

Query  898   ALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALG  1077
                 +  C             + + PKP+   A       +S+S  H  + +M V     
Sbjct  190   PKTKNMLCLVSLVMF----FGTFNLPKPVKDRA-------SSVSRKHSGR-IMQV-----  232

Query  1078  GRKLLQ---GSGTEH-----SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMF  1233
             GRKLLQ   G   E+     S  G +LGW MAAIYMGGR+PQI LNI+RG VEGLNP MF
Sbjct  233   GRKLLQVNDGMLQENGFAGNSGVGTFLGWAMAAIYMGGRLPQICLNIRRGKVEGLNPWMF  292

Query  1234  IFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIIL--QYIYYRY  1392
             + AL+ N TYV SILV +  W KI+PNLPWL++++ C  LD+F+ L  Q   Y+Y
Sbjct  293   LLALIGNITYVASILVSSLDWSKIRPNLPWLVESSGCALLDIFVSLSIQLQMYQY  347



>ref|XP_006294592.1| hypothetical protein CARUB_v10023627mg [Capsella rubella]
 gb|EOA27490.1| hypothetical protein CARUB_v10023627mg [Capsella rubella]
Length=326

 Score =   175 bits (444),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 130/345 (38%), Positives = 169/345 (49%), Gaps = 84/345 (24%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S  LG+ S++ WGVAEIPQI+TN+  KS+ G+S+ FL TWI GDIFNL+GCL+EPAT
Sbjct  9     DGLSLSLGVISVVSWGVAEIPQIMTNYSEKSTEGLSIAFLTTWIIGDIFNLLGCLMEPAT  68

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPTQ Y AL                                         LYT TT VL 
Sbjct  69    LPTQFYMAL-----------------------------------------LYTVTTSVLF  87

Query  640   LQSMYYDFLYRWWKDKE----DAGDSNQLVEEAKKPLR-RNKS-----GGSGIPIP--DG  783
             +QS+YY  +Y   K++     +A   + ++ +AK P R RN S     GG   PI    G
Sbjct  88    VQSIYYGHIYPRLKNRRNQMAEAERISNIISDAKIPGRWRNSSDTAPCGGHTTPITMIPG  147

Query  784   ASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNS  963
             + R +   + E +YTSARS++ S TPP  S L +       M    S  + T+E P +  
Sbjct  148   SHRNSFTGR-ELFYTSARSLSSSHTPPAGSVLAQR------MARGHS--EPTLEEPLLPG  198

Query  964   ISQPKPIPRSAGY-----------GAFLTTSLSIPHQTKALMP---VYAALGGRKLLQ--  1095
              + P  +P S              G F   +L    +T AL     V+     RKLLQ  
Sbjct  199   DATPPSLPPSTKSMLCVVSAFMFLGTFNLPNLLSESRTMALGERDRVFVVQAARKLLQVT  258

Query  1096  ------GSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVE  1212
                     G E S  G +LGW MAAIYMGGR+PQI LN++RG VE
Sbjct  259   GGNVVEHGGGESSRIGMFLGWAMAAIYMGGRLPQICLNMRRGHVE  303



>ref|XP_010678218.1| PREDICTED: uncharacterized protein LOC104893776 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=322

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 124/356 (35%), Positives = 184/356 (52%), Gaps = 65/356 (18%)
 Frame = +1

Query  418   DIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*  597
             D FNL GCL EPATLPTQ YTAL+               +        +++Y        
Sbjct  2     DFFNLFGCLFEPATLPTQFYTALL-------------YTVTTLTLTLQSVYY--------  40

Query  598   IVGQLYTATTVVLVLQSMYYDFLYR--------WWKDKEDAGDSNQLV------EEAKKP  735
               GQ+Y    +     +  +D + +         +   E++ D  +L+       ++   
Sbjct  41    --GQIYHRLKI-----NRQFDKVAKPNQTEVAGEYSVHENSDDVEKLINGSCGNRQSSSV  93

Query  736   LRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDN  915
              + + +  S IP+P  A   ++  + + +Y SAR ++ S TP  RS L       L  D 
Sbjct  94    FQSDTAMSSPIPLP--AFPRSQSAEQDSFYKSARYLSTSHTPTRRSFL------PLWRDP  145

Query  916   DCSSDDETVEAPSMNSI--SQPKPIPRSAGY------GAFLTTSLSIPHQTK-ALMPVYA  1068
                  +++VE P +     ++P  +P++           F+  +L+I  +T+ + + + A
Sbjct  146   ARVDAEDSVEEPLLGGSLPTRPAHLPKTKNLLCIVPATTFIIGTLNICRRTRDSRLNLGA  205

Query  1069  ALGGRKLLQGSGTEHSS------FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLM  1230
              +  RKLLQ  G +  +       G ++GW MAAIYMGGR+PQI LN +RG+VEGLNPLM
Sbjct  206   EVLNRKLLQVHGVQRITSDVGGGIGSYMGWAMAAIYMGGRLPQICLNFRRGNVEGLNPLM  265

Query  1231  FIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
             FIFALL NATYV SILV +  W KI PNLPWL+DA  C  LD FI+LQ+IY++Y R
Sbjct  266   FIFALLGNATYVASILVNSLDWSKIMPNLPWLVDAGGCSLLDTFILLQFIYFQYRR  321



>emb|CBI32879.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 127/384 (33%), Positives = 177/384 (46%), Gaps = 94/384 (24%)
 Frame = +1

Query  178   MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
             M L ++S P C   +  C +W  ++ K CLC++ D+ S  LG+ S+I W +AEIPQI+TN
Sbjct  1     MELFESSLPLCPRHQH-CSLWAWRFMKFCLCSVKDEISLTLGVISVISWAIAEIPQIITN  59

Query  358   FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
             ++ KSS G+S+ FL+TWI GD+FN++GC LEPATLPTQ Y A+                 
Sbjct  60    YKEKSSEGLSIAFLMTWIVGDLFNVLGCFLEPATLPTQFYMAV-----------------  102

Query  538   VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLY------RWWK--DKED  693
                                     LYT TT++L  QS+YY  +Y      RW+       
Sbjct  103   ------------------------LYTITTLILTAQSIYYGHIYHRLKSGRWYHKIKPNQ  138

Query  694   AGDSNQLVEEAKKPLRRNKSGG--------------SGIPIPDGASRPARQHQAEYYYTS  831
              G  N+  E+      R  S G              S IP+   AS        E YY S
Sbjct  139   TGTINKNREDNNSAGGRQVSDGLKNESNVFGEVPLSSPIPVNLPASPRNISPSRELYYMS  198

Query  832   ARSMAGSATPPFRSNLV--KSGPSALGMDNDCSSDDETVEAPSMNSI--SQPKPIPRSAG  999
             ARS++ S  P   S L   K+ PS          D  ++E P ++S+  SQ  P   +  
Sbjct  199   ARSLSKSHAPAMGSFLAQRKTSPSV--------HDSNSLEEPLLSSVVLSQSAPASTTKS  250

Query  1000  YGAFLTTSL-------SIPHQTK-----ALMPVYAALG---GRKLL---QGSGTEHSSFG  1125
               + L+ ++        +P +       A  P    +    GR LL   Q  G  +S  G
Sbjct  251   MLSMLSATMFFLGCFNFLPSENNRDGIAAEKPNQGGIALKVGRTLLQVEQNEGGGNSGIG  310

Query  1126  QWLGWMMAAIYMGGRIPQIWLNIK  1197
              +LGW MAAIY+GGR+PQI LN K
Sbjct  311   TFLGWSMAAIYLGGRLPQIILNKK  334


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  1240  ALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFI  1365
             AL  NATYVGSILV +  W KIKPNLPWL+DA  CV LD F+
Sbjct  417   ALTGNATYVGSILVSSLDWSKIKPNLPWLVDAGGCVLLDAFV  458



>ref|XP_010531580.1| PREDICTED: probable vacuolar amino acid transporter YPQ2 [Tarenaya 
hassleriana]
Length=227

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 110/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query  883   KSGPSALGMDNDCSSDDETVEAPSM------NSISQPKPIPRSAGY-GAFLTTSLSIPHQ  1041
             K  P   G  +  SS+++ V+           S  QP+P+P  A     F    +SI H+
Sbjct  32    KKRPFGFGNRDGSSSEEDDVDTTINTIIITTESTFQPRPVPSPACVPNPFF---ISIGHR  88

Query  1042  TKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLN  1221
                 +    +   R +   S       GQWLGW MAAIYMGGR+PQIWLN KRGSV GLN
Sbjct  89    FDECVHGQTSTTSRLI---SVYAQCVVGQWLGWSMAAIYMGGRVPQIWLNTKRGSVWGLN  145

Query  1222  PLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYY-RYCR  1398
             PLMF FALLAN T V SIL RTT WD IK NLPWLLDA VCV LDL IILQYIYY  +  
Sbjct  146   PLMFAFALLANLTQVASILARTTKWDTIKANLPWLLDAVVCVALDLLIILQYIYYSSFMN  205

Query  1399  KNSGGSREDSAD  1434
             KN     ++  D
Sbjct  206   KNHTHEEDNYGD  217



>gb|KHG16759.1| Protein RTC2 [Gossypium arboreum]
Length=317

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 160/358 (45%), Gaps = 89/358 (25%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
             C  W   Y  DC+C+  D  SF LGL S++ WGVAEIPQI+TN++ KS  G+SL FL+TW
Sbjct  10    CWEWARVYLDDCICSPRDQVSFGLGLISVLSWGVAEIPQIITNYKEKSVEGLSLGFLITW  69

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             I GD+FNL GC+LEPATLPTQ Y A+                                  
Sbjct  70    IIGDLFNLFGCVLEPATLPTQYYMAV----------------------------------  95

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLY-RWWKDKEDAGDSNQLVEEAKKPLRRNKSG---  756
                    LYT TT++L  Q++YY  +Y R   +     DS +   E    + ++ S    
Sbjct  96    -------LYTMTTLILAAQAVYYGHIYPRLKYNNMCNKDSKEYQPEGVDKIGKSISNFRV  148

Query  757   -------GSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDN  915
                     S  PIP   S P R    E YY SARS++ S TP        +  S L    
Sbjct  149   KQLTDVDRSSSPIPLPKSSPGR----ELYYRSARSLSSSHTP--------TAGSLLAQRM  196

Query  916   DCSSDDETVEAPSMNSISQPKPIPRSAGY------GAFLTTSLSIPHQTKALMPVYAA--  1071
                     VE P +++    +  P S+         A +  SL    Q  A+  VY    
Sbjct  197   TSPHSGNLVEEPLLSAYVAKQSTPPSSTKSLLCLVSAVMFISL-FNFQLSAVSKVYIGNE  255

Query  1072  --------LGGRKLLQGSGTE--------HSSFGQWLGWMMAAIYMGGRIPQIWLNIK  1197
                       GRKLLQ +            S  G +LGW MAAIYMGGR+PQI LN++
Sbjct  256   KINQGFVIKTGRKLLQANAVSLGDNGFEGGSKVGTFLGWAMAAIYMGGRLPQICLNVR  313



>ref|XP_010251613.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 isoform 
X4 [Nelumbo nucifera]
Length=393

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 164/312 (53%), Gaps = 44/312 (14%)
 Frame = +1

Query  583   FVLI*IVGQLYTATTVVL---VLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKS  753
             F++  I+G L+     +L    L + YY  +     +  DA D         K  +++  
Sbjct  78    FLITWIIGDLFNLFGCLLEPATLPTQYYMAMSPILPEI-DAVDKEHYTNNFGK--KQSAL  134

Query  754   GGSGI----PIPDGASRPARQHQA--EYYYTSARSMAGSATPPFRSNLV----KSGPSAL  903
             G  G+    PIP      +R      E YY SARS++ S TP   S+L       G +++
Sbjct  135   GDRGVLPSSPIPVSVPSHSRDGSCGRELYYMSARSLSRSHTPTAGSHLACPCGYEGTNSI  194

Query  904   GMDNDCSSDDETV--------EAPSMNSISQPKPIPRSAGYGAFLTT-SLSIPHQTKALM  1056
               D+DC S +E +          P MN+ +    +   +    FL+T  L +   ++  M
Sbjct  195   S-DHDCRSIEEPLLSRVGSMQSTPPMNTKNM---LCVVSALTFFLSTFRLQLSANSRFSM  250

Query  1057  PVYAALGG------RKLLQGS--------GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNI  1194
              +    GG      R+LLQ S        G   SS G +LGW MAAIYMGGR+PQIWLNI
Sbjct  251   YLENQPGGHVIRIGRRLLQKSSGPLLENHGEGSSSVGTFLGWAMAAIYMGGRLPQIWLNI  310

Query  1195  KRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQ  1374
             +RG V GLNPLMF+FAL+ NATYV SILV +    KI+PNLPWL+DA  C+ LD FII+Q
Sbjct  311   RRGHVGGLNPLMFVFALVGNATYVASILVSSLNLSKIRPNLPWLVDAGGCILLDCFIIIQ  370

Query  1375  YIYYRYCRKNSG  1410
             +I++RY RK  G
Sbjct  371   FIHFRY-RKPKG  381


 Score =   116 bits (291),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  229  CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
            C  W   Y K CLC+  D  S  LGL S+I WGVAE+PQI+TN++ KS+  +S+ FL+TW
Sbjct  23   CSEWARTYMKYCLCSAKDGASLTLGLISVISWGVAEVPQIITNYKKKSTESLSIAFLITW  82

Query  409  IAGDIFNLVGCLLEPATLPTQLYTAL  486
            I GD+FNL GCLLEPATLPTQ Y A+
Sbjct  83   IIGDLFNLFGCLLEPATLPTQYYMAM  108



>gb|AFW79603.1| hypothetical protein ZEAMMB73_686781 [Zea mays]
Length=318

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/313 (36%), Positives = 150/313 (48%), Gaps = 38/313 (12%)
 Frame = +1

Query  610   LYTATTVVLVLQSMYYDFLYRWWKDKE-------------DAGDSNQLVEEAKKPLRRNK  750
             LYT TT++L  Q++YY  +Y   K K              DA    +L+        RN 
Sbjct  4     LYTITTLILTGQTIYYSHIYHHLKLKNSRAASKPQKHQYRDASLREKLLGAKGSAASRNN  63

Query  751   SGGSGI-----PIPDGASRPARQH----QAEYYYTSARSMAGSATPPFR----SNLVKSG  891
                + +     PIP       + H     A+YYY SARS++ S  P       SN   S 
Sbjct  64    ESDTTVLIPSSPIPVNMKLVDQYHGSSSNADYYYMSARSLSRSPVPTAGIWSGSNRQSSR  123

Query  892   PSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLS---IPHQTKALMPV  1062
                   D   S   E     S  S      +  +   G  L T L    I ++ + +   
Sbjct  124   SPPQMNDQRGSLIGEIAPEHSAPSTVTKNALSVAPWMGLLLGTCLLHILIGNKHREMASG  183

Query  1063  YAALGGRKLL---------QGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEG  1215
                  GR+LL           S +  S  G +LGW MA IYMGGR+PQI LN++RG VEG
Sbjct  184   TVIPIGRRLLLFVDDHGNSSLSQSSGSEIGSFLGWAMAMIYMGGRLPQILLNMQRGHVEG  243

Query  1216  LNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYC  1395
             LNPLMF FALL N+TYVGSILV +  W K++PNLPWL+++  CV LD  IILQ++Y+ Y 
Sbjct  244   LNPLMFTFALLGNSTYVGSILVNSLDWSKLRPNLPWLVESGGCVLLDSCIILQFLYFHYR  303

Query  1396  RKNSGGSREDSAD  1434
             ++       D+AD
Sbjct  304   KRREPSDEHDNAD  316



>gb|ABD28651.2| Cystinosin/ERS1p repeat [Medicago truncatula]
Length=331

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 148/282 (52%), Gaps = 35/282 (12%)
 Frame = +1

Query  610   LYTATTVVLVLQSMYYDFLYRWWKDKE--------DAGDSNQLVEEAKKPLRRNKSGGSG  765
             LYT  T VL  Q++YY ++Y   + K          AG   +L +  +     + S G+G
Sbjct  12    LYTIITTVLGSQAIYYGYIYPRSQYKRLLKVETPTKAGQVEKLSDAEQSHQFDDFSRGTG  71

Query  766   --IPIPDGASRPA-RQHQAEYYYTSARSMAGSATPPFRSNLV-KSGPSALGMDNDCSSDD  933
                PIP     P+    + E +Y SARS++ S TP   S +  +  P++  +D    S +
Sbjct  72    RSSPIPLPVHLPSIFTGREELFYQSARSLSKSHTPTAGSIIAQRMSPTSPFLD----STE  127

Query  934   ETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPV-----------YAALGG  1080
             + + +P + + S P    +S        T L + +  K+L  +           +    G
Sbjct  128   KNLLSPDVATQSDPSLKIKSTLSVVSTLTFLGVINLHKSLEKIINPLVSNPRQQFVVYVG  187

Query  1081  RKLLQGSG--------TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
             RKLLQ SG        +  SS G + GW MA IY+GGR+PQI+LNI+RG  EGLNPLMF+
Sbjct  188   RKLLQVSGDQLMENGASRTSSIGTFFGWAMAVIYLGGRMPQIFLNIRRGHAEGLNPLMFL  247

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLF  1362
             FAL+ NATYV SILVR+  W  I PNLPWL+DA  CV LD F
Sbjct  248   FALIGNATYVASILVRSLDWSTIGPNLPWLVDAGGCVLLDFF  289



>ref|NP_193743.1| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
 emb|CAA16618.1| putative protein [Arabidopsis thaliana]
 emb|CAB79010.1| putative protein [Arabidopsis thaliana]
 gb|AEE84275.1| PQ-loop repeat family protein / transmembrane family protein 
[Arabidopsis thaliana]
Length=288

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = +1

Query  934   ETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ---GSG  1104
             E  + PS  S+     +    G    L+ S S+  + K  + V    G RKLL+   G+ 
Sbjct  114   EEAKRPSTKSLLCVVSVFLFLGSFNVLSGSRSMDLRGKDRVFVVGGAGARKLLEVSSGNL  173

Query  1105  TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR  1284
              E+++ G WLGW MAAIYMGGR+PQI +N++RG+VEGLNPLMF FA + N TYV SILV 
Sbjct  174   GENNNIGMWLGWAMAAIYMGGRLPQICMNVRRGNVEGLNPLMFFFAFIGNVTYVASILVN  233

Query  1285  TTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGS  1416
             +  W KI+PNLPWL+D+  C  LD  I+LQ+ Y+ +CRK    S
Sbjct  234   SVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYF-HCRKVEADS  276


 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 83/159 (52%), Gaps = 46/159 (29%)
 Frame = +1

Query  274  ISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEP  453
            I DD S  LG+ S+I W VAEIPQI+TN+  KS  GVS+ FL TW+ GDIFN+VGCL+EP
Sbjct  2    IRDDLSLSLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEP  61

Query  454  ATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVV  633
            A+LP Q YTA+                                         LYT  T+V
Sbjct  62   ASLPVQFYTAV-----------------------------------------LYTLATLV  80

Query  634  LVLQSMYYDFLY-RWWKDKEDAG----DSNQLVEEAKKP  735
            L +QS+YY  +Y R  K++ +      +   L EEAK+P
Sbjct  81   LYVQSIYYGHIYPRLMKNRRNHQMVDVEEPLLREEAKRP  119



>ref|XP_002867890.1| PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44149.1| PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=284

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 103/171 (60%), Gaps = 7/171 (4%)
 Frame = +1

Query  934   ETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ---GSG  1104
             E  + PS  S+     +    G    L+ S S+  + K    V+A  G RKLL+   G+ 
Sbjct  115   EEAKRPSTKSMLCVVSVFLFLGTFNLLSGSRSMDLREKD--RVFAVGGARKLLEVSSGNL  172

Query  1105  TEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR  1284
              E S  G WLGW MAAIYMGGR+PQI +NI+RG VEGLNPLMF FA + N TYV SILV 
Sbjct  173   GESSDIGMWLGWAMAAIYMGGRLPQICMNIRRGHVEGLNPLMFFFAFVGNVTYVASILVN  232

Query  1285  TTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYY--RYCRKNSGGSREDSA  1431
             +  W KI+PNLPWL+D+  C  LD  I+LQ+ Y+  R   K+S   + + A
Sbjct  233   SVEWSKIEPNLPWLVDSGGCAVLDFLILLQFFYFGCRKVEKDSDKKKHEEA  283


 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 83/158 (53%), Gaps = 47/158 (30%)
 Frame = +1

Query  280  DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
            D+ S  LG+ S+I W VAEIPQI+TN+  KS  GVS+ FL TW+ GDIFN+VGCL+EPA+
Sbjct  4    DELSLSLGIISVISWSVAEIPQIMTNYSNKSIEGVSIAFLTTWMLGDIFNVVGCLMEPAS  63

Query  460  LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
            LP Q YTA+                                         LYT  T+VL 
Sbjct  64   LPVQFYTAV-----------------------------------------LYTLATLVLY  82

Query  640  LQSMYYDFLY-RWWKDKED---AGDSNQ--LVEEAKKP  735
            +QS+YY  +Y R  K++ +     D  Q  L EEAK+P
Sbjct  83   VQSIYYGHIYPRLMKNRRNHHHVVDVEQPLLHEEAKRP  120



>gb|EEE54293.1| hypothetical protein OsJ_01221 [Oryza sativa Japonica Group]
Length=427

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 117/244 (48%), Gaps = 66/244 (27%)
 Frame = +1

Query  202  PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
            P C +    C  W + Y K CLC+  D  +  LGL S+I WGVAE+PQI+TN++ KS+ G
Sbjct  12   PSCPSAAN-CAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEG  70

Query  382  VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
            +SL FL+TWI GD FNL+GC LEP TLPTQ Y AL                         
Sbjct  71   LSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMAL-------------------------  105

Query  562  NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSN-QLVEEAKKPL  738
                            LYT TTV+L  Q++YY  +Y   K K+    S  Q  + A   L
Sbjct  106  ----------------LYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASL  149

Query  739  R------------RNKSG-GSGIPIPDGA-----SRPARQHQ-----AEYYYTSARSMAG  849
            R            RN S  G+ +PIP  +     +   RQ       +EYYYTSARS++ 
Sbjct  150  REKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRQRHGPSSLSEYYYTSARSLSS  209

Query  850  SATP  861
            S  P
Sbjct  210  SPVP  213


 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 57/76 (75%), Gaps = 7/76 (9%)
 Frame = +1

Query  1138  WMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNL  1317
             W MA IYMGGR+PQIWLN       GLNPLMF FAL+ N TYVGSILV++  W K+KPNL
Sbjct  321   WAMAVIYMGGRLPQIWLN-------GLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNL  373

Query  1318  PWLLDAAVCVGLDLFI  1365
             PWL+DA  CV LD F+
Sbjct  374   PWLVDAGGCVLLDTFV  389



>gb|EEC70372.1| hypothetical protein OsI_01310 [Oryza sativa Indica Group]
Length=427

 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 115/244 (47%), Gaps = 66/244 (27%)
 Frame = +1

Query  202  PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
            P C +    C  W + Y K CLC+  D  +  LGL S+I WGVAE+PQI+TN++ KS+ G
Sbjct  12   PSCPSAAN-CAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEG  70

Query  382  VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRD  561
            +SL FL+TWI GD FNL+GC LEP TLPTQ Y AL                         
Sbjct  71   LSLAFLMTWIVGDFFNLIGCFLEPETLPTQFYMAL-------------------------  105

Query  562  NIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSN-QLVEEAKKPL  738
                            LYT TTV+L  Q++YY  +Y   K K+    S  Q  + A   L
Sbjct  106  ----------------LYTITTVILTGQTVYYSHIYHRLKAKKARATSKPQRHQRADASL  149

Query  739  R------------RNKSG-GSGIPIPDGA----------SRPARQHQAEYYYTSARSMAG  849
            R            RN S  G+ +PIP  +           R      +EYYYTSARS++ 
Sbjct  150  REKLLGPKVIGEIRNNSHLGATVPIPTSSPITVNTEIVRHRHGPSSLSEYYYTSARSLSS  209

Query  850  SATP  861
            S  P
Sbjct  210  SPVP  213


 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 57/76 (75%), Gaps = 7/76 (9%)
 Frame = +1

Query  1138  WMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNL  1317
             W MA IYMGGR+PQIWLN       GLNPLMF FAL+ N TYVGSILV++  W K+KPNL
Sbjct  321   WAMAVIYMGGRLPQIWLN-------GLNPLMFTFALVGNVTYVGSILVKSMDWSKLKPNL  373

Query  1318  PWLLDAAVCVGLDLFI  1365
             PWL+DA  CV LD F+
Sbjct  374   PWLVDAGGCVLLDTFV  389



>ref|XP_006282771.1| hypothetical protein CARUB_v10006199mg [Capsella rubella]
 gb|EOA15669.1| hypothetical protein CARUB_v10006199mg [Capsella rubella]
Length=296

 Score =   140 bits (352),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +1

Query  1075  GGRKLLQGS----GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             GGRKLL  S    G E  + G  LGW MAAIYMGGR+PQIWL IK G V GLNPLMF FA
Sbjct  173   GGRKLLGVSSGNLGGESWNIGMLLGWAMAAIYMGGRLPQIWLTIKTGHVGGLNPLMFFFA  232

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSRE  1422
              L N TYV SILV +  W KI+PNLPWL+DA  C  LD  I+LQ+ Y+R C K+S   + 
Sbjct  233   FLGNVTYVASILVNSVEWSKIEPNLPWLVDAGGCAVLDFLILLQFFYFR-C-KDSDKKKH  290

Query  1423  DSAD  1434
              ++D
Sbjct  291   GTSD  294


 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 81/157 (52%), Gaps = 46/157 (29%)
 Frame = +1

Query  280  DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
            D+ S  LG+ S+I W VAEIPQI+TN+  KS  GVS+ FL TW+ GDIFN+VGCLLEPA+
Sbjct  4    DEVSLALGVISVISWSVAEIPQIMTNYNQKSIEGVSIAFLTTWMLGDIFNVVGCLLEPAS  63

Query  460  LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
            LP Q YTA+                                         L T  T+VL 
Sbjct  64   LPVQFYTAV-----------------------------------------LNTLATLVLY  82

Query  640  LQSMYYDFLYRWWKDKEDAG-----DSNQLVEEAKKP  735
            +QS+YY  +Y   K++++       +   L EEAK+P
Sbjct  83   VQSIYYGHVYPRLKNRKNHDQVVDVEEPLLHEEAKRP  119



>gb|EPS69988.1| hypothetical protein M569_04776, partial [Genlisea aurea]
Length=92

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  1114  SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTA  1293
             SS G  LGW MA IY+GGR+PQI LNIKRG+ +GLNPLMF FAL+AN+TYV SIL+++T 
Sbjct  1     SSLGSILGWGMAFIYLGGRLPQICLNIKRGNTKGLNPLMFAFALVANSTYVASILLKSTE  60

Query  1294  WDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             W KI+PNLPWL+D+  CV LD FI++Q+ YYR
Sbjct  61    WSKIQPNLPWLVDSGGCVFLDTFILMQFFYYR  92



>ref|XP_002520588.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41821.1| conserved hypothetical protein [Ricinus communis]
Length=316

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 127/286 (44%), Gaps = 94/286 (33%)
 Frame = +1

Query  223  KPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLL  402
            K C  W   Y   CLC++ D  S  +GL S+I W VAEIPQIVTN++ KSS G+S+ FL 
Sbjct  10   KQCSEWARIYINYCLCSVKDGISLSVGLLSVISWSVAEIPQIVTNYKEKSSQGLSIAFLT  69

Query  403  TWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYY  582
            TWI GD+FNL GCLLEPATLPTQ Y A+                                
Sbjct  70   TWIIGDLFNLFGCLLEPATLPTQYYMAI--------------------------------  97

Query  583  FVLI*IVGQLYTATTVVLVLQSMYYDFLY------RWWKDKEDAGDSNQLVEEAKKPLRR  744
                     LYT  T++L  Q++YY  +Y      RW K+    G      EEA K  + 
Sbjct  98   ---------LYTFITIILAAQTIYYGHIYPRMKCNRWHKE----GPILNQTEEAVKLTQG  144

Query  745  NKSG-------------GSGI---------PIPDGASRPARQHQAEYYYTSARSMAGSAT  858
             K+G             GS I         PIP  A         E YY SARS++ S T
Sbjct  145  VKNGGLKQINNTEKWRNGSRILDKGNILSSPIPLPAFPHNNSSGRELYYMSARSLSSSHT  204

Query  859  P------------PFRSNLVKSGPSALGMDNDCSSDDETVEAPSMN  960
            P            P RS++ +    AL +D D S    T  AP++N
Sbjct  205  PIAGSYLAHPASYPIRSSIEE----AL-LDGDSS----TQSAPNLN  241



>gb|EMS56021.1| hypothetical protein TRIUR3_23354 [Triticum urartu]
Length=262

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 100/213 (47%), Gaps = 53/213 (25%)
 Frame = +1

Query  178  MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
            M +   + P        C  W + Y K CLC+  D  +  LGL S++ WG+AE+PQI+TN
Sbjct  1    MGIFSGTPPPSCPSAPHCAEWAKVYLKYCLCSTKDGVALGLGLASVLSWGIAEVPQIITN  60

Query  358  FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
            ++ KS+ G+S+ FL+TWI GD+FNLVGC LEPATLPTQ Y AL                 
Sbjct  61   YKQKSTEGLSIAFLMTWIVGDLFNLVGCFLEPATLPTQFYMAL-----------------  103

Query  538  VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRW---------WKDKE  690
                                    LYT TTV+L  Q++YY  +Y              K 
Sbjct  104  ------------------------LYTITTVILTGQTIYYSHIYHLKVKKTGVTAKSQKH  139

Query  691  DAGDSN---QLVEEAKKPLRRNKSGGSGIPIPD  780
              GD++   +L+    +  + N   G  IPIP 
Sbjct  140  QRGDASLREKLLGHRDEAFKNNIQSGPTIPIPS  172



>ref|XP_010451342.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Camelina 
sativa]
Length=288

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 76/115 (66%), Gaps = 5/115 (4%)
 Frame = +1

Query  1060  VYAALGG-RKLLQGS----GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNP  1224
             V+  +GG RKLL  S    G  + + G  LGW MAAIY+GGR PQI++ ++ G   GLNP
Sbjct  154   VFVVVGGARKLLDVSSGNLGGGNYNIGMLLGWAMAAIYLGGRFPQIYMTVRNGHAGGLNP  213

Query  1225  LMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             LMF FALL N TYV SILV +  W  IKPNLPWL+DA  C  LD  I+LQ  Y+R
Sbjct  214   LMFFFALLGNVTYVASILVHSVEWSNIKPNLPWLVDAGGCAVLDFIILLQIFYFR  268


 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 78/158 (49%), Gaps = 53/158 (34%)
 Frame = +1

Query  286  FSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLP  465
             S  LG+ S+I W VAEIPQI++N+  KS  GVS+ FL TW+ GDIFN+VGCLLEPA+LP
Sbjct  7    LSISLGVISVISWSVAEIPQIISNYNQKSIDGVSIAFLTTWMLGDIFNIVGCLLEPASLP  66

Query  466  TQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQ  645
             Q Y A+V                                         Y   T+VL +Q
Sbjct  67   VQFYAAVV-----------------------------------------YALATLVLYVQ  85

Query  646  SMYYDFLYRWWKDKEDAGDSNQLVE--------EAKKP  735
            S+YY   Y   K++ D    +Q+V+        EAK+P
Sbjct  86   SIYYGHYYPRLKNRRD----HQVVDVEEPLLHAEAKRP  119



>gb|EYU43563.1| hypothetical protein MIMGU_mgv11b024317mg, partial [Erythranthe 
guttata]
Length=80

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  265  LCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCL  444
            LCN  D+ SF  GL SL+CWGVAEIPQIVTNFRTKS HG+SL FLLTWIAG IFNLVGCL
Sbjct  1    LCNTRDELSFAFGLISLVCWGVAEIPQIVTNFRTKSGHGISLAFLLTWIAGHIFNLVGCL  60

Query  445  LEPATLPTQLYTALVILS  498
            LEPATL T     LVI S
Sbjct  61   LEPATLYTTSTVVLVIQS  78



>ref|XP_010445255.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Camelina 
sativa]
Length=290

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 72/109 (66%), Gaps = 4/109 (4%)
 Frame = +1

Query  1075  GGRKLLQGS----GTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFA  1242
             G RKLL+ S    G  + + G  LGW MAAIY+GGR+PQI + ++ G   GLNPLMF FA
Sbjct  160   GARKLLEVSSGNLGGGNYNIGMLLGWAMAAIYLGGRVPQICMTMRNGHAGGLNPLMFFFA  219

Query  1243  LLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
              L N TYV SILV +  W  IKPNLPWL+DA  C  LD  I+LQ  YYR
Sbjct  220   FLGNVTYVASILVTSVEWSNIKPNLPWLVDAGGCAVLDFVILLQIFYYR  268


 Score = 94.0 bits (232),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  280  DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
            D  S +LG+ S+I W VAEIPQI++N+  KS  GVS+ FL TW+ GDIFN+VGCLLEPA+
Sbjct  5    DGLSTLLGVISVISWSVAEIPQIMSNYNQKSIDGVSIAFLTTWMLGDIFNIVGCLLEPAS  64

Query  460  LPTQLYTALVILSAQCCVFLST  525
            LP Q Y A+V   A   +++ +
Sbjct  65   LPVQFYAAVVCALATLVLYVQS  86



>ref|XP_008360556.1| PREDICTED: probable vacuolar amino acid transporter YPQ1 [Malus 
domestica]
Length=296

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (68%), Gaps = 12/128 (9%)
 Frame = +1

Query  1078  GRKLLQGS-------GTEHSS-FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMF  1233
             GR+LLQ S       GT+ S   G +LGW M AIY+GGR+PQI+LNI++G+V+GLNP MF
Sbjct  170   GRRLLQVSSGLLRETGTKDSGGIGSFLGWGMTAIYIGGRLPQIYLNIRKGNVDGLNPFMF  229

Query  1234  IFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN--S  1407
             I A++ N TY+ SILV +  W  ++PNL WL+DA  C+ LD+FI+ Q  ++RY R+    
Sbjct  230   IIAIVGNTTYIASILVNSMEWSNVRPNLAWLVDAGGCMLLDIFILFQ--FFRYWRRQDVE  287

Query  1408  GGSREDSA  1431
             G  R  +A
Sbjct  288   GTDRHSNA  295


 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 82/151 (54%), Gaps = 43/151 (28%)
 Frame = +1

Query  223  KPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLL  402
            + C  W  KY    LC++ D  S  LG+ S++ WGVAEIPQI+TN++ KS+HG+SL FL+
Sbjct  21   EHCXEWGRKYLGYELCSVKDFMSLALGVISVLTWGVAEIPQIITNYKXKSTHGLSLAFLM  80

Query  403  TWIAGDIFNLVGCLLEPAT--LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYH  576
            TWI GD+FNL GCLLEPAT  LPTQ YTA+                              
Sbjct  81   TWILGDLFNLFGCLLEPATXSLPTQYYTAM------------------------------  110

Query  577  YYFVLI*IVGQLYTATTVVLVLQSMYYDFLY  669
                        YTATT VL  Q++YY ++Y
Sbjct  111  -----------FYTATTSVLSAQTIYYRYIY  130



>gb|KDP24049.1| hypothetical protein JCGZ_26733 [Jatropha curcas]
Length=248

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  202  PYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHG  381
            P C   K  C  W   Y   CLC+  D  S  LGL S+I WGVAEIPQIVTN++ KS+HG
Sbjct  4    PMCPRTKH-CSQWAMIYISYCLCSFKDGLSLTLGLISVISWGVAEIPQIVTNYKQKSAHG  62

Query  382  VSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALV  489
            +S+ FL+TWI GD+FNL GCLLEPATLPTQ Y AL 
Sbjct  63   LSIAFLITWIIGDLFNLFGCLLEPATLPTQFYMALT  98



>gb|EMT15707.1| hypothetical protein F775_07524 [Aegilops tauschii]
Length=262

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 90/190 (47%), Gaps = 41/190 (22%)
 Frame = +1

Query  178  MSLAQNSGPYCVAEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTN  357
            M +   + P        C  W + Y K CLC+  D  +  LGL S++ WG+AE+PQI+TN
Sbjct  1    MGIFSGTPPPSCPSAPHCAEWAKVYLKYCLCSTKDGVALGLGLASVLSWGIAEVPQIITN  60

Query  358  FRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAI  537
            ++ KS+ G+S+ FL+TWI GD+FNLVGC LEPATLPTQ Y AL                 
Sbjct  61   YKQKSTEGLSIAFLMTWIVGDLFNLVGCFLEPATLPTQFYMAL-----------------  103

Query  538  VICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLV  717
                                    LYT TT++L  Q++YY  +Y     K      +Q  
Sbjct  104  ------------------------LYTITTMILTGQTIYYSHIYHLKVKKTGTTAKSQKH  139

Query  718  EEAKKPLRRN  747
            +     LR  
Sbjct  140  QRGDASLREK  149



>ref|XP_006836190.1| hypothetical protein AMTR_s00101p00070940 [Amborella trichopoda]
 gb|ERM99043.1| hypothetical protein AMTR_s00101p00070940 [Amborella trichopoda]
Length=250

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 108/228 (47%), Gaps = 71/228 (31%)
 Frame = +1

Query  832   ARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAF  1011
             ARS+A  ATP   S L  S  S + +         +VE P +               GAF
Sbjct  56    ARSLASIATPTAGSYLAHSRASPITLL-----QQHSVEEPLL---------------GAF  95

Query  1012  LTTSLSIPHQTKALMPVYAA----LG---------------------------GRKLLQG  1098
             ++T  + P  TK ++  ++A    LG                           GRKLLQ 
Sbjct  96    VSTQSAPPLNTKNMLYSFSAIILFLGSFNLHRSANSQCNEAIHETSQGVVIQLGRKLLQN  155

Query  1099  SGTE------HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANAT  1260
              G        HS  G ++GW MAAIYMGGR+ QI LN        LNPLMFIFAL+ N+T
Sbjct  156   LGESSSLGEGHSLVGNFMGWAMAAIYMGGRLRQICLN-------ELNPLMFIFALIGNST  208

Query  1261  YVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKN  1404
             YVGSILV +  W KI PNLPWL+DA  CV LD F+        +C +N
Sbjct  209   YVGSILVCSIEWSKIHPNLPWLVDAGACVLLDSFV-------SFCFQN  249



>ref|XP_447583.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60520.1| unnamed protein product [Candida glabrata]
Length=309

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 154/365 (42%), Gaps = 89/365 (24%)
 Frame = +1

Query  295   VLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQL  474
             + G  S+ CW V  +PQI  NF  KS+ G+SLLF++ W+AGD+FNLVG +++       L
Sbjct  17    IAGSVSIACWVVVFVPQIYENFYRKSADGLSLLFVVLWLAGDVFNLVGAMMQ------HL  70

Query  475   YTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMY  654
                +VIL+A                                     YTA  V+L++Q ++
Sbjct  71    LLTMVILAAY------------------------------------YTAADVILLIQCLW  94

Query  655   YDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPA-RQHQAEYYYTS  831
             YD                   EE   P+  + +     PI +   +    +HQ       
Sbjct  95    YD------------------NEEKLDPIHFSPAN----PINENVLQDVFNEHQP------  126

Query  832   ARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAF  1011
                            L+ SG    G + + +S  + +EA       + K   RS  +  F
Sbjct  127   ---------------LLTSGEPTRGSEAENNSRSQAIEALLEADEQKTK---RSNLFNDF  168

Query  1012  LTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLN  1191
                +L I     +    Y A     ++     E +   Q  G++ A +Y+G R+PQI LN
Sbjct  169   TIVALVILGGIVSWYVSYCANPPEPIVGEPDVEMNMLAQSFGYLSAVLYLGSRVPQILLN  228

Query  1192  IKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIIL  1371
              KR S EG++ L F+FA L N T++ S+L  +T +  +  N  WL+ ++  + +D  I +
Sbjct  229   FKRKSCEGISFLFFLFACLGNTTFIISVLAISTDYRYLLVNASWLIGSSGTLVMDFIIFI  288

Query  1372  QYIYY  1386
             Q+  Y
Sbjct  289   QFFAY  293



>gb|EPS72867.1| hypothetical protein M569_01891, partial [Genlisea aurea]
Length=96

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  280  DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
            DD S  LGL S++ WGVAE+PQI+TNF+TKS+ G+S++FL+TWI GD+ NL GCLLEPAT
Sbjct  4    DDLSLALGLISVLGWGVAEVPQIITNFKTKSAEGLSIVFLVTWILGDLLNLFGCLLEPAT  63

Query  460  LPTQLYTAL------VILSAQCCVF  516
            LPTQ YTA+      +ILS Q   +
Sbjct  64   LPTQYYTAMLYLVTTLILSVQSLYY  88



>ref|XP_003069914.1| PQ loop repeat family protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER27769.1| PQ loop repeat family protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW16159.1| PQ loop repeat protein [Coccidioides posadasii str. Silveira]
Length=365

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 101/390 (26%), Positives = 160/390 (41%), Gaps = 69/390 (18%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SLLFL+ W+AGD+FN++G +L+   
Sbjct  13    EALSGICGSISIACWVVVFSPQIIENFRRGSADGLSLLFLVIWLAGDVFNILGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLY---RWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQ  810
              Q  YY          K  + A   N   +E ++PL   ++  + + +P   +    Q  
Sbjct  91    AQCFYYRGFTLSDHSLKSTQGASSGNGQAQEQQRPLSPIQTERTAL-LPPHTTHHGPQQP  149

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPR  990
               +      S+A  ++   R  LV S   +  M     S       PS+ +IS+P    +
Sbjct  150   QRHPVDRRTSIASLSSISERLGLVDSTHLSPAMPLIEPSK------PSVRAISKPTTTIQ  203

Query  991   SAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGR  1170
                + +F    +         + + A    ++  +       S GQ  G++ AA Y+G R
Sbjct  204   KLVWNSFAIALVCAAGILGWYVSMRATSRSKRQPEHPALTLDSLGQVFGYLCAAFYLGSR  263

Query  1171  IPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIK--------------  1308
             IPQ+ LN +R S EG++ L F+FA + N TYV SI   +   +  +              
Sbjct  264   IPQLLLNWRRKSTEGVSLLFFLFACVGNLTYVLSIFAYSPICEDTRGHCQPGEQRRIYGR  323

Query  1309  ---PNLPWLLDAAVCVGLDLFIILQYIYYR  1389
                 N  WLL +   + LDL I  Q+I YR
Sbjct  324   YLLVNASWLLGSLGTLFLDLAIFAQFIMYR  353



>ref|XP_002989012.1| hypothetical protein SELMODRAFT_447534 [Selaginella moellendorffii]
 gb|EFJ09806.1| hypothetical protein SELMODRAFT_447534 [Selaginella moellendorffii]
Length=427

 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 116/418 (28%), Positives = 182/418 (44%), Gaps = 63/418 (15%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
              V W+E +F DC+ +  +   F +G+ S+  W +A++PQ V+NF  +S+  +S  FL  W
Sbjct  19    AVRWIEVWFGDCVYSPWEILGFCVGMSSVFFWMIAQMPQFVSNFLRQSADALSPWFLFQW  78

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL----RDNIF--  570
             +AGD  NL+GCLL    L T+ +TA   + A           ++I + L    R+N F  
Sbjct  79    LAGDSLNLLGCLLTGDQLATETFTAYYFIFAD---------GLIISQYLYYRARNNNFDE  129

Query  571   -----YHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                   + Y  ++ I  +  T+    L       + +    K K+D+   NQ V +    
Sbjct  130   SVHKPTNDYQSVLQINSEDGTSRPADLPTPGHASNSI---GKQKQDSKRQNQQVLQ----  182

Query  736   LRRNKSGGSGIPIPDGASR------PARQHQAEYYYTSARSMAGSATPPFRS-------N  876
                  S GS + I     R         QH     Y  A++    A P  R         
Sbjct  183   ----HSNGSQLGILARGERFQDFEEEKLQH---LKYQVAKASQQHACPSRRQLRRVVMEY  235

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
              ++ GP ++       S   T +A  +  ++  +    +      L  +L +     A +
Sbjct  236   GLEYGPPSM-------SKFTTQQASRLPKLNLKRTSGNNKNLNPGLKKALCLAGTVMAGI  288

Query  1057  PVYAAL-GGRKLLQG-SGTEHSSFGQWL-------GWMMAAIYMGGRIPQIWLNIKRGSV  1209
             P   AL   RKLL+  S  +  S  QW+       GW+ + +Y+G RI Q+  N +R S 
Sbjct  289   PGGDALQANRKLLRHCSENQTESRLQWVKQTGTFFGWISSGLYLGSRISQLVKNNQRKSA  348

Query  1210  EGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIY  1383
             EGL+  M   A+LAN TY  +IL+R    D +    PWLL +   V LD+ I LQ  Y
Sbjct  349   EGLSLAMVSCAVLANLTYGAAILMRAKTMDDLIGKAPWLLGSLGTVSLDITIFLQAQY  406



>ref|XP_001242752.1| hypothetical protein CIMG_06648 [Coccidioides immitis RS]
 gb|EAS31466.2| PQ loop repeat protein [Coccidioides immitis RS]
Length=365

 Score =   113 bits (282),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 102/390 (26%), Positives = 159/390 (41%), Gaps = 69/390 (18%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SLLFL+ W+AGD+FN++G +L+   
Sbjct  13    EALSGICGSISIACWVVVFSPQIIENFRRGSADGLSLLFLVIWLAGDVFNILGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLY---RWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQ  810
              Q  YY          K  + A   N   +E ++PL   ++  + + +P   +    Q  
Sbjct  91    AQCFYYRGFTLSDHSLKSTQGASSGNGQAQEQQRPLSPIQTERTAL-LPPHTTHHGPQQP  149

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPR  990
               +      S+A  ++   R  LV S   +  M     S       PS+ +IS+P    +
Sbjct  150   QRHPVDRRTSIASLSSISERLGLVDSTHLSPAMPLIEPSK------PSVRAISKPTTTIQ  203

Query  991   SAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGR  1170
                + +F    +         + + A    ++  +       S GQ  G++ AA Y+G R
Sbjct  204   KLVWNSFAIALVCAAGILGWYVSMRATSRSKRQPEHPALTLDSLGQVFGYLCAAFYLGSR  263

Query  1171  IPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV-----------------RTTAWD  1299
             IPQ+ LN +R S EG++ L F+FA + N TYV SI                   R     
Sbjct  264   IPQLLLNWRRKSTEGVSLLFFLFACVGNLTYVLSIFAYSPICADTRGHCQPGEQRRIYGR  323

Query  1300  KIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
              +  N  WLL +   + LDL I  Q+I YR
Sbjct  324   YLLVNASWLLGSLGTLFLDLAIFAQFIMYR  353



>ref|XP_006380946.1| hypothetical protein POPTR_0006s02600g [Populus trichocarpa]
 gb|ERP58743.1| hypothetical protein POPTR_0006s02600g [Populus trichocarpa]
Length=298

 Score =   111 bits (278),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 127/278 (46%), Gaps = 45/278 (16%)
 Frame = +1

Query  670   RWWKDKEDAG-DSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMA  846
             R  +   DAG   N   ++  +P     + G   PIP          + + YY SARS++
Sbjct  19    RVKQGNSDAGAQVNSADKQRNEPAAPEGTNGLSSPIPFPTLPQKSSPERDLYYASARSLS  78

Query  847   GSATPPFRSNLV-KSGPSALGMDNDCSS-----DDETVEAPSMNSISQPKPIPRSAGY--  1002
              S TP   S L  ++ P +  + N         D  T  AP++N+ +    +        
Sbjct  79    SSHTPTVGSFLAQRTTPPSFSIRNSIEEPLLGEDVATQSAPNLNTKTMLCVVRIYTNLLQ  138

Query  1003  -----GAFLTTSLSIPHQ------TKALMPVYAALG-------GRKLLQGSGT-------  1107
                   + L  +    H+         L  V+           GRK+LQ S         
Sbjct  139   LFFVKNSTLNMTFYYSHRQFFISANSRLDRVFENKNQGIFIQVGRKILQTSSIMSHENDI  198

Query  1108  EHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRT  1287
             + +  G +LGW MAAIYMGGR+PQI LNIKRG VE    + ++F          SILV +
Sbjct  199   DGNVIGTFLGWSMAAIYMGGRLPQICLNIKRGKVE--QGIYYVF---------NSILVDS  247

Query  1288  TAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
              AW KI+ NLPWL+DA  CV LD  I+LQ++Y+RY R+
Sbjct  248   LAWSKIRANLPWLVDAGGCVLLDTCILLQFVYFRYRRR  285



>ref|XP_002983681.1| hypothetical protein SELMODRAFT_422985 [Selaginella moellendorffii]
 gb|EFJ15177.1| hypothetical protein SELMODRAFT_422985 [Selaginella moellendorffii]
Length=427

 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 116/418 (28%), Positives = 180/418 (43%), Gaps = 63/418 (15%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
              V W+E +F DC+ +  +   F +G+ S+  W +A++PQ V+NF  +S+  +S  FL  W
Sbjct  19    AVRWIEVWFGDCVYSPWEILGFCVGMSSVFFWMIAQMPQFVSNFLRQSADALSPWFLFQW  78

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESL----RDNIF--  570
             +AGD  NL+GCLL    L T+ +TA   + A           ++I + L    R+N F  
Sbjct  79    LAGDSLNLLGCLLTGDQLATETFTAYYFIFAD---------GLIISQYLYYRARNNNFDE  129

Query  571   -----YHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKP  735
                   + Y  ++ I  +  T+    L       +      K K+D+   NQ V +    
Sbjct  130   SVHKPTNGYQSVLQINSEDGTSRPADLPTPGHASNSK---GKKKQDSNRQNQQVLQ----  182

Query  736   LRRNKSGGSGIPIPDGASR------PARQHQAEYYYTSARSMAGSATPPFRS-------N  876
                  S GS + I     R         QH     Y  A++    A P  R         
Sbjct  183   ----HSNGSQLGILARGERFQDFEEEKLQH---LKYQVAKASQQHACPSRRQLRRVVMEY  235

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
              ++ GP ++       S   T +A  +  +   +    +      L  +L +     A +
Sbjct  236   GLEYGPPSM-------SKFTTQQASRLPKLDLKRTSGNNKTLNPGLKKALCLAGTVMAGI  288

Query  1057  PVYAAL-GGRKLLQG-SGTEHSSFGQWL-------GWMMAAIYMGGRIPQIWLNIKRGSV  1209
             P   AL   RKLL+  S  +  S  QW+       GW+ + +Y+G RI Q+  N +R S 
Sbjct  289   PGGDALQANRKLLRHCSENQTQSRLQWVKQTGTFFGWISSGLYLGSRISQLVKNNQRKSA  348

Query  1210  EGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIY  1383
             EGL+  M   A+LAN TY  +IL+R    D +    PWLL +   V LD+ I LQ  Y
Sbjct  349   EGLSLAMVSCAVLANLTYGAAILMRAKTMDDLIGKAPWLLGSLGTVSLDITIFLQAQY  406



>ref|XP_002547975.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER33454.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=356

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 108/393 (27%), Positives = 162/393 (41%), Gaps = 92/393 (23%)
 Frame = +1

Query  295   VLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQL  474
             + G  S+ CW +   PQI  NFR KSS G+SL F++ W+AGD+FN++G +L+   LPT  
Sbjct  17    ITGSISIACWIIVFAPQIYENFRRKSSEGLSLTFIILWLAGDVFNVLGAVLQ-GVLPT--  73

Query  475   YTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMY  654
                +VIL+                                      YT   VVL+ Q + 
Sbjct  74    ---MVILAVY------------------------------------YTLADVVLLWQCLV  94

Query  655   YDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSA  834
             Y    +   D      +N L E+  + +  N                   H  E      
Sbjct  95    YGHGEKK-PDLIHLSPANPLNEDVLEVVLSNDD--------------HHNHHQEQQQQQR  139

Query  835   RSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFL  1014
             R      T  F +N            ND + D E+   PS N+      + +S+   +FL
Sbjct  140   RQQEQQVTNAFINN------------NDTTEDLESNSIPSNNT---NNSVSKSSQLQSFL  184

Query  1015  TTSLSIPHQTKA-LMPVYAA-LGGRKLLQGSGTEHSS---------FGQWLGWMMAAIYM  1161
               SL +     + ++  Y + L   K  +  G  H+            Q  GW+ A +Y+
Sbjct  185   LNSLMVFLVIASGVIGWYISYLKDYKNGKHPGKNHAKHPKDLVFDPLAQVFGWLCAFLYL  244

Query  1162  GGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAV  1341
             G RIPQI LN +R S +G++ + F+FA L N TYV SIL    +W+ +  N  WL  +  
Sbjct  245   GSRIPQIVLNYERKSCDGISFMFFLFACLGNLTYVISILSIDMSWNYLWVNSSWLAGSLG  304

Query  1342  CVGLDLFIILQYIYYRYCRKNSGGSREDSADYS  1440
              +GLD  I +Q+  Y        G ++D  DYS
Sbjct  305   TLGLDFTIFVQFFLYN-------GDKDD--DYS  328



>ref|XP_007399607.1| hypothetical protein PHACADRAFT_262162 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM51810.1| hypothetical protein PHACADRAFT_262162 [Phanerochaete carnosa 
HHB-10118-sp]
Length=280

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 108/381 (28%), Positives = 158/381 (41%), Gaps = 117/381 (31%)
 Frame = +1

Query  277   SDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPA  456
             S+  S +LG  S+ CW V   PQI+ N++ KS  G+S+ F+L W+AGD+ NL G +L   
Sbjct  6     SETASSILGWMSIACWVVVYSPQIIENYQLKSGEGLSVFFVLIWLAGDLANLFGAIL-AG  64

Query  457   TLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVL  636
              LPT     ++IL+A                                     YT   +VL
Sbjct  65    LLPT-----IIILAAY------------------------------------YTVCDIVL  83

Query  637   VLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAE  816
             + Q +YY   YRW                    LRR++   S   IP+ A  PAR    E
Sbjct  84    LAQ-IYY---YRW--------------------LRRSQELASSRYIPE-ADVPARVLSEE  118

Query  817   YYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSA  996
                 S R          R+N           +N+ S D                 I +  
Sbjct  119   TPLISER----------RAN-----------ENEKSRDS---------------VIGQCL  142

Query  997   GYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEH-SSFGQW----LGWMMAAIYM  1161
              YG+ L   L       A+         ++L QG   E  S   +W    LGW  A +Y+
Sbjct  143   LYGSALIFVLGTGVAAWAI--------DKRLRQGQSREPPSEIIEWRSQLLGWTSAVLYL  194

Query  1162  GGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAV  1341
             G RIPQI  N +    EGL+  +F+FA+  N TYV SI   +   + I  N  W+  +A+
Sbjct  195   GARIPQIVKNFQT-KCEGLSSALFLFAIAGNTTYVLSIFTLSLEPNHISANAGWIAGSAL  253

Query  1342  CVGLDLFIILQYIYYRYCRKN  1404
              V LD+F++LQ++YY+   ++
Sbjct  254   TVFLDIFVLLQFLYYKTTERS  274



>ref|XP_007203296.1| hypothetical protein PRUPE_ppa025800mg, partial [Prunus persica]
 gb|EMJ04495.1| hypothetical protein PRUPE_ppa025800mg, partial [Prunus persica]
Length=87

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +1

Query  214  AEKKPCVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLL  393
            +  + C  W  KY +  LC++ D  S  LGL S++ WGVAEIPQ++TN++ KS+ G+SL 
Sbjct  6    SRDEHCWEWGRKYMEYNLCSVKDGVSLTLGLISVVSWGVAEIPQVITNYKNKSTDGLSLA  65

Query  394  FLLTWIAGDIFNLVGCLLEPAT  459
            FL+TWI GD+FNL GC+LEPAT
Sbjct  66   FLMTWILGDLFNLFGCMLEPAT  87



>ref|XP_009217994.1| PQ-loop repeat-containing protein 2 [Gaeumannomyces graminis 
var. tritici R3-111a-1]
 gb|EJT81985.1| PQ-loop repeat-containing protein 2 [Gaeumannomyces graminis 
var. tritici R3-111a-1]
Length=414

 Score =   107 bits (268),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 107/412 (26%), Positives = 159/412 (39%), Gaps = 102/412 (25%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQIV NFR  S+ G+SL F++ W+AGD+FN++G +L+   
Sbjct  13    EAISGICGSISIACWVVVFSPQIVENFRRSSADGLSLQFIIIWLAGDVFNILGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTIADIVLL  90

Query  640   LQSMYY-DFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRP-------  795
              Q  YY  F +R           ++ V  A KP R++ S  +G    D    P       
Sbjct  91    GQCFYYRGFTFR-----------DEAVPSAPKP-RKSLSASNGHATNDQIGEPNERTGLL  138

Query  796   ARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQP  975
              R+            +A      + +N     P    +D      D  +  P+  S ++ 
Sbjct  139   TREPDRRRPSAGNAGLAEHRRGSWSNNSHHLSPVVPLLDESAFVRDTALPTPASRSPARG  198

Query  976   KPIPRSAGYGAFLTTSLSI---------------PHQTKALMPVYAALGGRKLLQGSGTE  1110
                 +    G  L   L +                H+ +   P      G  +L     E
Sbjct  199   STASKLQAAGFNLLAVLMVCTAGVAGWYMSRPRPSHRGEDAQPPSPPSTGDDVL-----E  253

Query  1111  HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSIL----  1278
              S +GQ  GW+ A +Y+G R+PQI LN +R S EG++ L F+FA L N TYV SI     
Sbjct  254   FSFWGQIFGWLCAVLYLGSRVPQILLNWRRKSTEGVSMLFFLFACLGNLTYVLSIFAFEP  313

Query  1279  ---VRTTA-------------WDKIKPNLPWLLDAAVCVGLDLFIILQYIYY  1386
                VR +A             W  I  NL WL  +   + LD+ I +Q+  Y
Sbjct  314   SCHVRGSAASGCAPGEAAHAYWQYILVNLSWLAGSLGTLLLDMGIFVQFFLY  365



>ref|XP_452364.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH01215.1| KLLA0C03762p [Kluyveromyces lactis]
Length=306

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 160/383 (42%), Gaps = 90/383 (23%)
 Frame = +1

Query  277   SDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPA  456
             S   S + G  S+ CW +  +PQI  NF  KS+ G+SL+F++ W+AGDIFNL+G +L+  
Sbjct  10    SQTVSGITGSISIACWIIVFVPQIYENFYRKSAEGLSLMFVVLWLAGDIFNLLGAMLQ-H  68

Query  457   TLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVL  636
              LPT     ++IL+A                                     YTA  ++L
Sbjct  69    LLPT-----MIILAA------------------------------------YYTAADIIL  87

Query  637   VLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAE  816
             ++Q ++Y        D      +N + E   + +   +      P+  G      QH   
Sbjct  88    LIQCLFYG--QDGPVDPVHLSPANPINENVLQDVFHERQ-----PLLTG-----HQHNER  135

Query  817   YYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSA  996
               Y    S    AT P                N    +D  +    +N I     I   A
Sbjct  136   RVYVETSSTTSEATAP----------------NADKPEDGKLREQLLNIIIVSSVI--LA  177

Query  997   GYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIP  1176
             G+ ++  + +  PHQ+   + ++                +   Q  G++ A +Y+G RIP
Sbjct  178   GFFSWYISYIKNPHQSNPELDLHM---------------NWLAQSFGYLSAVLYLGSRIP  222

Query  1177  QIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLD  1356
             QI LN +R S EG++ L F+FA L N T++ S+L  + A   +  N  WL+ ++  + +D
Sbjct  223   QILLNYQRKSCEGVSFLFFLFACLGNTTFIISVLSISFAPRYLLVNASWLIGSSGTLIMD  282

Query  1357  LFIILQYIYYRYCRKNSGGSRED  1425
               I  Q+  Y    K++  S +D
Sbjct  283   FIIFAQFFVY---NKDTQPSADD  302



>ref|XP_002501133.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO62391.1| predicted protein, partial [Micromonas sp. RCC299]
Length=269

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +1

Query  1120  FGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWD  1299
              G  LGW M AIY+ GR+PQI  N  RGSVEGL+  MF  A++ NATY+GSIL R+T W 
Sbjct  181   LGPALGWTMTAIYLSGRVPQIARNHARGSVEGLSVSMFALAVVGNATYLGSILARSTRWV  240

Query  1300  KIKPNLPWLLDAAVCVGLDLFIILQYIYY  1386
              I PN+PW++DA +C+ +D  I+ Q  +Y
Sbjct  241   TIAPNMPWIVDAGMCLAMDAVILAQSAWY  269


 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 74/138 (54%), Gaps = 42/138 (30%)
 Frame = +1

Query  280  DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
            D  SFVLG  S++ WGVAE+PQIV N+R +SS GVSL F+ TW+ GD FNLVGC + P T
Sbjct  2    DATSFVLGCVSIVAWGVAELPQIVANWRNRSSEGVSLAFIATWLTGDAFNLVGCAVSP-T  60

Query  460  LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
            LPTQLYTA+                                         LYT+TTVVLV
Sbjct  61   LPTQLYTAM-----------------------------------------LYTSTTVVLV  79

Query  640  LQSMYYDFLYRWWKDKED  693
            +Q ++Y+   R  +  ED
Sbjct  80   VQHLHYNNRKRETEGAED  97



>ref|XP_005850821.1| hypothetical protein CHLNCDRAFT_140375 [Chlorella variabilis]
 gb|EFN58719.1| hypothetical protein CHLNCDRAFT_140375 [Chlorella variabilis]
Length=399

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 106/412 (26%), Positives = 168/412 (41%), Gaps = 76/412 (18%)
 Frame = +1

Query  229   CVVWVEKYFKDCLCNISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTW  408
              ++W+   F DC+ N+ D   F  G+ S+ CW VA+IPQ+  N++TK +  +S  FL +W
Sbjct  9     AILWISDVFGDCIYNVRDLVGFSCGITSICCWMVAQIPQLYKNYKTKHAEALSPWFLASW  68

Query  409   IAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFV  588
             + GD  NL+G                               A++  + L   +F   YF+
Sbjct  69    LLGDTCNLLG-------------------------------ALLKGDQLPTVVFTAQYFI  97

Query  589   LI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSG----  756
              +            V+++Q +YY  L R  +  + +              R + +G    
Sbjct  98    TV----------DCVMMVQYIYYTSLQRRRERMQASRRHRHHHHHHHHRRRHDSTGMQQH  147

Query  757   --GSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDC-SS  927
               GSG   P G++      QA       R   G        +   S  ++    ++C  S
Sbjct  148   QSGSGEQQPGGSA-----EQAWAGSGGDREGRGPHAAADGRDAAASVAASAAAAHECCDS  202

Query  928   DDETVEAPSMNSISQPKPIP------RSAGYGAFLTTSLSIPH--QTKALMPVYAALGGR  1083
               E      +   S  + +P      R     A L T L + H  Q +        LGGR
Sbjct  203   SGEIKPGGVLLGGSSSRAVPAADVSFRPQRVLACLGTLLVVAHLQQPQPDEAGQRGLGGR  262

Query  1084  KLLQ------GSGTEH---------SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGL  1218
             +LL       GSG             + G  LG+  +  Y+  R  QI+ N +R SVEGL
Sbjct  263   RLLAAGVLAAGSGGTGLLAHMPLWAYTAGTVLGYCSSVFYLTSRASQIYRNWQRQSVEGL  322

Query  1219  NPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQ  1374
                MF+ A+ AN+ Y  SIL+R+  W +++ +LPWL+ +   V LD+ I  Q
Sbjct  323   AISMFMCAIAANSLYGASILIRSATWPELRSSLPWLIGSLGTVALDVTIFAQ  374



>gb|EMF11695.1| PQ-loop-domain-containing protein [Sphaerulina musiva SO2202]
Length=388

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 161/410 (39%), Gaps = 101/410 (25%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S V G  S+ CW V   PQI+ NFR  S+ G+S+ F++ W+ GDIFN++G       
Sbjct  14    ETISGVCGSISIACWVVVFSPQIIENFRRSSAEGLSVEFIIIWLLGDIFNILGA------  67

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
                                                +F H    ++ I+   YT   +VL+
Sbjct  68    -----------------------------------VFQHVLATML-ILAIYYTLADIVLL  91

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEY  819
              Q  YY               +   + + K P++  ++       P  A+   R      
Sbjct  92    GQYFYY---------------TGFRLRDPKPPVKHARTEDG----PAAATATERSPLITN  132

Query  820   YYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG  999
              + +  S    A PP  +++ +   S+    +   S D    +P++    QPK  P +  
Sbjct  133   GHANGHSSPARAPPPNAADVERRARSSSAFRDRLLSLDYAHSSPAVPIHDQPKNAPDADA  192

Query  1000  YGAFLTTSL---SIPHQTKALMPVYAALGGRKLL--------------QGSGTEHSSFGQ  1128
                    SL    + + T  L+ V A + G  L               Q    E S+ GQ
Sbjct  193   MKPSQPRSLLQSVLFNGTAILLVVLAGIAGYYLTPSAPEEKRGHAADDQADSLEFSTLGQ  252

Query  1129  WLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV--------R  1284
               G++ A +Y+G R+PQ+ LN +R S EGLN L F+FA + N TYV SIL         R
Sbjct  253   IFGYICAVLYLGSRVPQLLLNYRRKSTEGLNALFFLFACIGNLTYVCSILAFQPICSHHR  312

Query  1285  TTAWDK--IKP-------------NLPWLLDAAVCVGLDLFIILQYIYYR  1389
                W +   KP             NL WLL +   + LD  + +Q+  YR
Sbjct  313   HGHWQESHCKPGEAQAIYGRYILVNLSWLLGSLGTLFLDFAVFVQFWLYR  362



>ref|XP_003015019.1| hypothetical protein ARB_06779 [Arthroderma benhamiae CBS 112371]
 gb|EFE34379.1| hypothetical protein ARB_06779 [Arthroderma benhamiae CBS 112371]
Length=368

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 106/403 (26%), Positives = 166/403 (41%), Gaps = 90/403 (22%)
 Frame = +1

Query  280   DDFSFVLGLF----SLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLL  447
             +D +    +F    S+ CW V   PQI+ NFR  S+ G+SL FL+ W+AGD+FN++G ++
Sbjct  15    EDLTLCADVFDRSISIACWVVVFSPQIIENFRRNSADGLSLEFLIVWLAGDVFNIIGAVM  74

Query  448   EPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATT  627
             +   LPT +                                         I+   YT   
Sbjct  75    Q-GVLPTMI-----------------------------------------ILAVYYTIAD  92

Query  628   VVLVLQSMYYDFLYRWWKDKE---DAGDSNQLVEEA--------KKPLRRNKSGGSGIPI  774
             +VL+ Q  YY  L      K    +AG ++   E A        + PL  N+ GG     
Sbjct  93    IVLLGQCFYYRGLGGSESTKSPEPEAGRASSSSETATQTVPSSERTPLLHNRPGGEHNGS  152

Query  775   PDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPS  954
              DG  RPA + + E   TS  S+    T    ++L  + P    + +       T +  +
Sbjct  153   NDG--RPATKQRRESL-TSVASLRNHLTAVDGTHLSPTVPLRKEVADTPPRPSSTFQIIA  209

Query  955   MNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGT-EHSSFGQW  1131
              N+ S    +  +AG   +  ++ S     K          G  + +  GT +    GQ 
Sbjct  210   FNTFS--ITLVCAAGILGWYVSATSRKRHHK----------GDDIPKSDGTLQFDITGQV  257

Query  1132  LGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV----------  1281
              G++ A  Y+  RIPQ+ LN +R S EG++ L F+FA + N TYV SI            
Sbjct  258   FGYLCALFYLASRIPQLLLNWRRKSTEGVSLLFFLFACIGNLTYVLSIFAYSPVCQGKDG  317

Query  1282  ------RTTAWDK-IKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
                   R + + + +  N  WLL +   + +DL I  Q+I YR
Sbjct  318   RCLPGERQSIYGRYMAVNASWLLGSLGTLFMDLAIFSQFIMYR  360



>ref|XP_003306080.1| hypothetical protein PTT_19107 [Pyrenophora teres f. teres 0-1]
 gb|EFQ85826.1| hypothetical protein PTT_19107 [Pyrenophora teres f. teres 0-1]
Length=369

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 100/397 (25%), Positives = 156/397 (39%), Gaps = 75/397 (19%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSADGLSVVFIVVWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPL---RRNKSGGSGIPIPDGASRPARQHQ  810
             LQ  +Y         K+   D    V   + PL   RR +S GS     +G     ++ +
Sbjct  91    LQCFWYKGFTLRDDYKKPGSDDGSSVASEQSPLLSDRRPQSNGSPYNNNNGNGIEVQRPR  150

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPR  990
                     R  +G +   FR   +    + L        DD T  +   NS+   +P P+
Sbjct  151   IS---DIDRRGSGHSQASFRERFLSIDGTHLSPVTPLH-DDAT--SGRRNSVIAVRPQPQ  204

Query  991   SAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQ---------GSGTEHSSFGQWLGWM  1143
             S            +      +   Y +      L           S    + +GQ  G++
Sbjct  205   SNLQTIMFNLGTIVLVCAAGVFGWYLSARNSPALSPPDEHDPSPESSLHFNFWGQVSGYV  264

Query  1144  MAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV--------------  1281
              A +Y+G R+PQ+ LN +R S EG++ L F+FA L N TYV SILV              
Sbjct  265   CAILYLGSRVPQLLLNYRRKSTEGISMLFFLFACLGNLTYVLSILVYKPKCGNGICRDGE  324

Query  1282  -RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
              R      I  N+ WLL +   + LD  + +QY  YR
Sbjct  325   GRAEYGKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  361



>gb|EHN00330.1| YOL092W-like protein [Saccharomyces cerevisiae x Saccharomyces 
kudriavzevii VIN7]
Length=308

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 90/364 (25%), Positives = 149/364 (41%), Gaps = 98/364 (27%)
 Frame = +1

Query  337   IPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVF  516
             +PQI  NF  KSS G+SLLF++ W+AGD+FNL+G +++       L + ++IL+A     
Sbjct  30    VPQIYENFYRKSSDGLSLLFVILWLAGDVFNLMGAVMQ------HLLSTMIILAAY----  79

Query  517   LST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA  696
                                             YT   ++L+ Q ++YD       +++ A
Sbjct  80    --------------------------------YTVADIILLGQCLWYD------NEEKPA  101

Query  697   GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
              D                      PI    + P  ++     +   + +      P R +
Sbjct  102   VD----------------------PIHLSPANPINENVLTDVFNEQQPLLNPQGRPNRID  139

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG---------YGAFLTTSLS  1029
                + PS+    ND  +DD   E  S N +   K I   AG         Y  +      
Sbjct  140   EEMATPSS----NDDVADDNLREVNSRNLV---KDICIVAGVVFVGIISWYVTYCLNHTQ  192

Query  1030  IPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSV  1209
              P     L+PV               + +   Q  G++ A +Y+G RIPQI LN KR S 
Sbjct  193   PPPTEDPLLPV------------PELQINWMAQIFGYLSAVLYLGSRIPQILLNYKRKSC  240

Query  1210  EGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             EG++ L F+FA L N T++ S+++ +  W  +  N  WL+ ++  + +D  I  Q+  Y+
Sbjct  241   EGISFLFFLFACLGNTTFIFSVVIISLDWKYLILNASWLVGSSGTLFMDFVIFSQFFTYK  300

Query  1390  YCRK  1401
               +K
Sbjct  301   KNKK  304



>ref|XP_009497957.1| hypothetical protein H696_05906 [Fonticula alba]
 gb|KCV67619.1| hypothetical protein H696_05906 [Fonticula alba]
Length=343

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/384 (25%), Positives = 151/384 (39%), Gaps = 101/384 (26%)
 Frame = +1

Query  295   VLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQL  474
             V+GL S++ W  A++PQ+  N++ K +  +S+ FL  W+ GDI NLVGC+L    L TQ 
Sbjct  37    VIGLMSILAWLFAQLPQLYANYKNKDTTALSVGFLFLWLLGDISNLVGCILTD-QLVTQT  95

Query  475   YTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMY  654
              TA+                               YF L            V   L S +
Sbjct  96    ITAI-------------------------------YFCL------------VDACLWSQF  112

Query  655   YDFLYRWWKDKEDA-------------GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRP  795
               F YRW+  + +              GD++ L+  +    + N +  +G P        
Sbjct  113   --FYYRWYNSRRNTTAPQPVPSMTDQLGDNDDLISSSNSSYQENTTSAAGSP--------  162

Query  796   ARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQP  975
                                A P + + L+ SG   +G     +S           + +  
Sbjct  163   ------------------GAVPFYSAALMTSGLLGVGAVASIASLSAGAGLIPGGASAPT  204

Query  976   KPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAI  1155
               +  SAG    ++  L+   +T +               GS       G  + W+  ++
Sbjct  205   SEVLASAGLAG-VSEFLTAAAETAS---------------GSTDPTYIIGLVIAWLCTSL  248

Query  1156  YMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDA  1335
             Y+G R+PQI+ N KR SVEGL+  +FI A L N  Y  SI + +   D +   LP+LL +
Sbjct  249   YLGSRVPQIFHNFKRQSVEGLSLQLFICAALGNLFYSVSIFLYSVDPDYLLERLPYLLGS  308

Query  1336  AVCVGLDLFIILQYIYYRYCRKNS  1407
             A  +  D  I +Q+ YY + R  S
Sbjct  309   AGVLVFDFIITIQFWYYNHYRSRS  332



>gb|EME43547.1| hypothetical protein DOTSEDRAFT_54326 [Dothistroma septosporum 
NZE10]
Length=378

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/409 (25%), Positives = 152/409 (37%), Gaps = 108/409 (26%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+S+ F++ W+ GDIFN++G +L+   
Sbjct  13    EAISGICGSISIACWVVVFSPQIIENFRRSSAEGLSVEFIIIWLLGDIFNILGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             L T +  A+                                          YTA  +VL+
Sbjct  72    LATMIILAI-----------------------------------------YYTAADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAG-DSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAE  816
              Q  YY   +R    + D   DS       + PL  N          +   RPA     E
Sbjct  91    GQYFYYTG-FRLRDPRPDKKPDSENAAPSERSPLISNGHA-------EHTRRPANAVDVE  142

Query  817   YYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSA  996
                  ARS +      FR  L    P+         S  E   A       QP+   ++ 
Sbjct  143   ---IRARSRS-----TFRERLASLDPTHFSPAVPIHSQPEEAAATEALKPHQPRSWIQAI  194

Query  997   GYGAFLTTSLSIPHQTKALMPVYAALGGRKLL---------------QGSGTEHSSFGQW  1131
              +             T  ++ V A + G  L                Q    + S +GQ 
Sbjct  195   LFNG-----------TAIILVVLAGVAGYYLSPSTPQGQHDKSAAADQADSLQFSLWGQI  243

Query  1132  LGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDK---  1302
              G++ A +Y+G R+PQ+ LN +R S EGLN L F+FA + N TYV SI+       +   
Sbjct  244   FGYICALLYLGSRVPQLLLNYRRKSTEGLNALFFLFACIGNLTYVLSIVAFEPICSRHSR  303

Query  1303  --------------------IKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
                                 I  NL WL+ +   + LD  + +Q+  YR
Sbjct  304   GHWRESHCKSGEAASIYGKYILVNLSWLIGSLGTLFLDFAVFVQFWLYR  352



>ref|XP_002489881.1| Putative protein of unknown function [Komagataella pastoris GS115]
 emb|CAY67600.1| Putative protein of unknown function [Komagataella pastoris GS115]
 emb|CCA36694.1| Vacuolar integral membrane protein YDR352W [Komagataella pastoris 
CBS 7435]
Length=327

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/393 (25%), Positives = 152/393 (39%), Gaps = 105/393 (27%)
 Frame = +1

Query  295   VLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQL  474
             + G  S+ CW +   PQI  NF  KS+ G+S+ F++ W+ GDIFN++G +++   LPT +
Sbjct  19    ITGSISIACWIIVFAPQIYENFIRKSAQGLSMTFVVLWLLGDIFNVIGAVMQ-GVLPTMI  77

Query  475   YTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMY  654
                                                      I+   YT   +VL+ Q + 
Sbjct  78    -----------------------------------------ILAIYYTLADIVLLAQCLV  96

Query  655   YDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSA  834
             Y                        K L   K+     PI    + P  +H         
Sbjct  97    Y-----------------------SKGLSALKASQGVDPIHLSPATPLNEHD--------  125

Query  835   RSMAGSATPPFRSNLVKSGPSALGMDNDC--SSDDETVEAPSMNSISQPKPIPRSAGYGA  1008
                          NL++S    L  D D   S+DD   +   + S +  +    + G   
Sbjct  126   -------------NLLES---VLSSDRDYFGSNDDMDTDTTGLGSDADLESFLDTDGISG  169

Query  1009  FLTTSLSIPHQTKALMPVYAALGG---------RKLLQGSGTE--HSSFGQWLGWMMAAI  1155
              ++   SI + T  LM     L G         R    G   E    +  Q  GW+ A +
Sbjct  170   NVSKMSSIYYNT--LMVFLVVLAGVLGWWISDSRNDDTGDDPELVFDTVAQIFGWLCAFL  227

Query  1156  YMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDA  1335
             Y+G R+PQI LN +R S +G++ L F+FA L N TYV SIL   T+++ +  N  WL  +
Sbjct  228   YLGSRVPQILLNYERKSCDGISFLFFLFACLGNLTYVVSILSIDTSYNYLLVNSSWLAGS  287

Query  1336  AVCVGLDLFIILQYIYYRYCRKNSGGSREDSAD  1434
                + LD  I +Q+  Y    K+   S +D  D
Sbjct  288   LGTLFLDFTIFVQFFIYNE-SKDECSSSDDEYD  319



>gb|EUN30194.1| hypothetical protein COCVIDRAFT_91021 [Bipolaris victoriae FI3]
Length=371

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 101/395 (26%), Positives = 160/395 (41%), Gaps = 72/395 (18%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSAEGLSVVFIVIWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQ-LVEEAKKPL---RRNKSGGSGIPIPDGASRPARQH  807
             LQ  +Y         K+   DS++  +   + PL   RR  S GS      G     ++ 
Sbjct  91    LQCFWYKGFTLRDDFKKPTSDSDEDSITSEQSPLLGERRPHSNGSPYNNQHGNGIEVQRP  150

Query  808   QAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIP  987
             +   Y    R  +G++   FR   +    + L         D+     S ++I+   P  
Sbjct  151   RISDY---ERRGSGNSQSSFRERYLSIDGTHLSPVTPLL--DDPTSGRSTSAIATSPPPQ  205

Query  988   RSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGS-----GTEHSSF-GQWLGWMMA  1149
             +S            I      +   Y +     + + S      T H +  GQ  G++ A
Sbjct  206   QSNLQMIIFNAGTVILVCAAGVFGWYLSARNSTVPRDSDPPADSTLHFNLWGQISGYVCA  265

Query  1150  AIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV---------------R  1284
             A+Y+G R+PQ+ LN +R S EG++ L F+FA L N TYV SILV               R
Sbjct  266   ALYLGSRVPQLLLNYRRKSTEGISMLFFLFACLGNLTYVLSILVYKPKCGGGVCHDGEGR  325

Query  1285  TTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
                   I  N+ WLL +   + LD  + +QY  YR
Sbjct  326   AEYGKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  360



>ref|XP_007708737.1| hypothetical protein COCCADRAFT_23411 [Bipolaris zeicola 26-R-13]
 gb|EUC36983.1| hypothetical protein COCCADRAFT_23411 [Bipolaris zeicola 26-R-13]
Length=371

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 102/396 (26%), Positives = 164/396 (41%), Gaps = 74/396 (19%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSAEGLSVVFIVIWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQ-LVEEAKKPL---RRNKSGGSGIPIPDGASRPARQH  807
             LQ  +Y         K+   DS++  +   + PL   RR  S GS      G     ++ 
Sbjct  91    LQCFWYKGFTLRDDFKKPTSDSDEDSITSEQSPLLGERRPHSNGSPYNNQHGNGIEVQRP  150

Query  808   QAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIP  987
             +   Y    R  +G++   FR   +    + L        D  +  + S  + S P   P
Sbjct  151   RISDY---ERRGSGNSQSSFRERYLSIDGTHLSPVTPLLDDPTSGRSTSAIATSPP---P  204

Query  988   RSAGYGAFLTTSLSIPHQTKA-LMPVYAALGGRKLLQGS-----GTEHSSF-GQWLGWMM  1146
             + +     +  + +I     A +   Y +     + + S      T H +  GQ  G++ 
Sbjct  205   QQSNLQMIIFNAGTIILVCAAGVFGWYLSARNSTVPRDSDPPADSTLHFNLWGQISGYVC  264

Query  1147  AAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV---------------  1281
             AA+Y+G R+PQ+ LN +R S EG++ L F+FA L N TYV SILV               
Sbjct  265   AALYLGSRVPQLLLNYRRKSTEGISMLFFLFACLGNLTYVLSILVYKPKCGGGVCHDGEG  324

Query  1282  RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             R      I  N+ WLL +   + LD  + +QY  YR
Sbjct  325   RAEYGKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  360



>ref|XP_007686741.1| hypothetical protein COCMIDRAFT_91999 [Bipolaris oryzae ATCC 
44560]
 gb|EUC46798.1| hypothetical protein COCMIDRAFT_91999 [Bipolaris oryzae ATCC 
44560]
Length=371

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 102/396 (26%), Positives = 165/396 (42%), Gaps = 74/396 (19%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSAEGLSVVFIVIWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQ-LVEEAKKPL---RRNKSGGSGIPIPDGASRPARQH  807
             LQ  +Y         K+   DS++  +   + PL   RR  S GS      G+    ++ 
Sbjct  91    LQCFWYKGFTLRDNFKKPTSDSDEDSITSEQSPLLGERRPHSNGSPYNNQYGSGIEVQRP  150

Query  808   QAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIP  987
             +   Y    R  +G++   FR   +    + L        D  +  + S  + S P   P
Sbjct  151   RISDY---ERRGSGNSQSSFRERYLSIDGTHLSPVTPLLDDPTSGRSTSAIATSPP---P  204

Query  988   RSAGYGAFLTTSLSIPHQTKA-LMPVYAALGGRKLLQGS-----GTEHSSF-GQWLGWMM  1146
             + +     +  + +I     A +   Y +     + + S      T H +  GQ  G++ 
Sbjct  205   QQSNLQMIIFNAGTIILVCAAGVFGWYLSARNSTVPRDSDPPADSTLHFNLWGQISGYVC  264

Query  1147  AAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV---------------  1281
             AA+Y+G R+PQ+ LN +R S EG++ L F+FA L N TYV SILV               
Sbjct  265   AALYLGSRVPQLLLNYRRKSTEGISMLFFLFACLGNLTYVLSILVYKPKCGGNVCHDGEG  324

Query  1282  RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             R      I  N+ WLL +   + LD  + +QY  YR
Sbjct  325   RAEYGKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  360



>ref|XP_007696973.1| hypothetical protein COCSADRAFT_136082 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD67276.1| hypothetical protein COCSADRAFT_136082 [Bipolaris sorokiniana 
ND90Pr]
Length=371

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 103/413 (25%), Positives = 166/413 (40%), Gaps = 108/413 (26%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSAEGLSVVFIVIWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQ-LVEEAKKPL---RRNKSGGSGIPIPDGASRPARQH  807
             LQ  +Y         K+   DS++  +   + PL   RR  S GS      G     ++ 
Sbjct  91    LQCFWYKGFTLRDDFKKPTSDSDEDSITSEQSPLLGERRPHSNGSPYNNQHGNGIEVQRP  150

Query  808   QAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIP  987
             +   Y    R  +G++   FR   +                  +++   ++ ++     P
Sbjct  151   RISDY---ERRGSGNSQSSFRERYL------------------SIDGTHLSPVTPLLDDP  189

Query  988   RSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSG---------------------  1104
              S    + + TS   P Q+   M ++ A G   L+  +G                     
Sbjct  190   TSGRSNSAIATS-PPPQQSNLQMIIFNA-GTVILVCAAGVFGWYLSARNSTVPRDSDPPA  247

Query  1105  --TEHSSF-GQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSI  1275
               T H +  GQ  G++ AA+Y+G R+PQ+ LN +R S EG++ L F+FA L N TYV SI
Sbjct  248   DSTLHFNLWGQISGYVCAALYLGSRVPQLLLNYRRKSTEGISMLFFLFACLGNLTYVLSI  307

Query  1276  LV---------------RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             LV               R      I  N+ WLL +   + LD  + +QY  YR
Sbjct  308   LVYKPKCGGNMCHDGEGRAEYVKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  360



>ref|XP_003190192.1| PQ loop repeat protein [Aspergillus oryzae RIB40]
Length=388

 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 117/444 (26%), Positives = 172/444 (39%), Gaps = 112/444 (25%)
 Frame = +1

Query  253   FKDCLCNIS-DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFN  429
             F   + NI  +  S + G  S+ CW V   PQI+ NFR  S+ G+SLLFL+ W+AGD+FN
Sbjct  2     FHPPVGNIDLEALSGICGSISIACWVVVFSPQIIENFRRGSADGLSLLFLVVWLAGDVFN  61

Query  430   LVGCLLEPATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQ  609
             ++G +L+   LPT +                                         I+  
Sbjct  62    ILGAVLQ-GVLPTMI-----------------------------------------ILAV  79

Query  610   LYTATTVVLVLQSMYY-DFLYR----------WWKDKEDAGDSNQLVEEAKKPLRRNKSG  756
              YT   +VL+ Q  YY  F  R             D ED       V E    L    +G
Sbjct  80    YYTLADIVLLGQCFYYRGFTLRDEPSPPSSRAQESDAEDQPSFPGKVSERTALLSAKANG  139

Query  757   -----------GSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSAL  903
                        G+G P P     P+ Q    Y+    R  A S    FR  L  +     
Sbjct  140   HSYQAHSQEHTGNGYPTPG----PSGQQSFPYHQNHRRHSATS----FRDILHPN-----  186

Query  904   GMDNDCSSDDETVEAPSMNSISQPKPIPR-SAGYGAFLTTSLSIPHQTKALMPVYAALGG  1080
              +D    S       PS     + +P+ R SA   A    S  +      ++  Y + G 
Sbjct  187   -VDGTHLSPVTPFVEPSAK---ETRPVRRLSALQNALFNLSAVVLVCAAGVLGWYVSPGS  242

Query  1081  RKLLQGSGTEHS----SFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALL  1248
              K         S    + GQ  G++ AA+Y+G R+PQI LN +R S +G++ L F+FA +
Sbjct  243   SKAEDKQDDSGSLSFDTLGQVFGYLCAALYLGSRLPQILLNYRRKSTDGVSLLFFLFACI  302

Query  1249  ANATYVGSILVRTTAWDKIKP----------------------NLPWLLDAAVCVGLDLF  1362
              N TYV SIL  +     + P                      NL WL+ +   + LD+ 
Sbjct  303   GNLTYVLSILAYSPVCKGVYPQGRVSQCRPGEAAALYGRYILVNLSWLIGSLGTLFLDMV  362

Query  1363  IILQYIYYRYCRKNSGGSREDSAD  1434
             I +Q+  Y   + N  G  E +++
Sbjct  363   IFVQFFLY---QDNGYGETEGTSE  383



>ref|XP_008028557.1| hypothetical protein SETTUDRAFT_164429 [Setosphaeria turcica 
Et28A]
 gb|EOA84188.1| hypothetical protein SETTUDRAFT_164429 [Setosphaeria turcica 
Et28A]
Length=374

 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 109/415 (26%), Positives = 167/415 (40%), Gaps = 109/415 (26%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSADGLSVVFIVIWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKK-PL---RRNKSGGSGIPIPDGASRPARQH  807
             LQ  +Y         K+   +S+Q  E +++ PL    R +S GS     +G     ++ 
Sbjct  91    LQCFWYKGFTLRDDFKKPMNESDQDSEVSEQSPLLAESRPQSNGSPYTNQNGNGIEVQRP  150

Query  808   QAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIP  987
             +   Y    R  +G +   FR   +              S D T  +P    I  P    
Sbjct  151   RISDY---ERRGSGHSQGSFRERFL--------------SIDGTHLSPVTPLIDDP----  189

Query  988   RSAGYGAFLTTSLSIPHQTKALMPVY----------AALGGRKLLQGSGT------EH--  1113
              + GYG     +   P Q+     V+          A + G  L   + T      EH  
Sbjct  190   -ACGYGNGAVVTSPPPSQSNLQTIVFNVSTVILVCAAGVFGWYLSARNSTAPNPPDEHDP  248

Query  1114  --------SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVG  1269
                     + +GQ  G++ AA+Y+G RIPQ+ LN +R S EG++ L F+FA L N TYV 
Sbjct  249   SSDATLHFNLWGQISGYVCAALYLGSRIPQLLLNYRRKSTEGISMLFFLFACLGNLTYVL  308

Query  1270  SILV---------------RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
             SILV               R      I  N+ WLL +   + LD  + +QY  YR
Sbjct  309   SILVYKPKCGGLACHGGQARAEYGKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  363



>gb|EJT43218.1| YOL092W-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=308

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 147/355 (41%), Gaps = 80/355 (23%)
 Frame = +1

Query  337   IPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVF  516
             +PQI  NF  KSS G+SLLF++ W+AGD+FNL+G +++       L + ++IL+A     
Sbjct  30    VPQIYENFYRKSSDGLSLLFVILWLAGDVFNLMGAVMQ------HLLSTMIILAAY----  79

Query  517   LST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA  696
                                             YT   ++L+ Q ++YD       +++ A
Sbjct  80    --------------------------------YTVADIILLGQCLWYD------NEEKPA  101

Query  697   GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
              D                      PI    + P  ++     +   + +      P R +
Sbjct  102   VD----------------------PIHLSPANPINENVLTDVFNEQQPLLNPQGRPNRID  139

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
                + PS+    ND  +DD   E  S N +   K I   AG       S  +   T  L 
Sbjct  140   EEMATPSS----NDDVADDNLREVNSRNLV---KDICIVAGVVFVGIISWYV---TYCLN  189

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
                        L     + +   Q  G++ A +Y+G RIPQI LN KR S EG++ L F+
Sbjct  190   HTQPPPTEDPPLPVPELQINWMAQIFGYLSAVLYLGSRIPQILLNYKRKSCEGISFLFFL  249

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             FA L N T++ S+++ +  W  +  N  WL+ ++  + +D  I  Q+  Y+  +K
Sbjct  250   FACLGNTTFIFSVVIISLDWKYLILNASWLVGSSGTLFMDFVIFSQFFTYKKNKK  304



>ref|NP_014549.1| Ypq1p [Saccharomyces cerevisiae S288c]
 sp|Q12010.1|YPQ1_YEAST RecName: Full=Probable vacuolar amino acid transporter YPQ1; 
AltName: Full=PQ-loop repeat-containing protein 1 [Saccharomyces 
cerevisiae S288c]
 emb|CAA58187.1| orf 00929 [Saccharomyces cerevisiae]
 emb|CAA99104.1| unnamed protein product [Saccharomyces cerevisiae]
 tpg|DAA10692.1| TPA: Ypq1p [Saccharomyces cerevisiae S288c]
 gb|EIW07838.1| hypothetical protein CENPK1137D_2425 [Saccharomyces cerevisiae 
CEN.PK113-7D]
Length=308

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/355 (25%), Positives = 147/355 (41%), Gaps = 80/355 (23%)
 Frame = +1

Query  337   IPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVF  516
             +PQI  NF  KSS G+SLLF++ W+AGD+FNL+G +++       L + ++IL+A     
Sbjct  30    VPQIYENFYRKSSDGLSLLFVVLWLAGDVFNLMGAVMQ------HLLSTMIILAAY----  79

Query  517   LST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA  696
                                             YT   ++L+ Q ++YD       +++ A
Sbjct  80    --------------------------------YTVADIILLGQCLWYD------NEEKPA  101

Query  697   GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
              D                      PI    + P  ++     +   + +  S   P R +
Sbjct  102   VD----------------------PIHLSPANPINENVLHDVFNEQQPLLNSQGQPNRID  139

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
                + PS+ G     + DD   E  S N I     I     +  F++  ++         
Sbjct  140   EEMAAPSSDG----NAGDDNLREVNSRNLIKDIF-IVSGVVFVGFISWYVTYCVNYTQPP  194

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
             PV         L     + +   Q  G++ A +Y+G RIPQI LN KR S EG++ L F+
Sbjct  195   PV-----EDPSLPVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKSCEGISFLFFL  249

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             FA L N T++ S++V +  W  +  N  WL+ +   + +D  I  Q+  Y+  +K
Sbjct  250   FACLGNTTFIFSVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNKK  304



>ref|XP_001941306.1| PQ loop repeat protein [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU44025.1| PQ loop repeat protein [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=369

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 99/394 (25%), Positives = 156/394 (40%), Gaps = 69/394 (18%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+ GD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSADGLSVVFIVVWLLGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPL---RRNKSGGSGIPIPDGASRPARQHQ  810
             LQ  +Y         K+   D +  V   + PL   RR +S GS     +G     ++ +
Sbjct  91    LQCFWYKGFTLRDDYKKPESDDDSSVASEQSPLLSDRRPQSNGSPYNNNNGNGIEVQRPR  150

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALG-----MDNDCSSDDETVEAPSMNSISQP  975
                     R  +G +   FR   +    + L       D+  S    +V A      S  
Sbjct  151   IS---DIDRRGSGHSQGSFRERFLSIDGTHLSPVTPLHDDPTSGRRNSVIAVRQQPQSSL  207

Query  976   KPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSF-GQWLGWMMAA  1152
             + I  + G    +  +        A      +           + H +F GQ  G++ A 
Sbjct  208   QTIIFNLGTIVLVCAAGVFGWYLSARNSPAPSPPDEHDPSPESSLHFNFWGQVSGYVCAV  267

Query  1153  IYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV---------------RT  1287
             +Y+G R+PQ+ LN +R S EG++ L F+FA L N TYV SILV               R 
Sbjct  268   LYLGSRVPQLLLNYRRKSTEGISMLFFLFACLGNLTYVLSILVYKPKCGNGVCRDGEGRA  327

Query  1288  TAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
                  I  N+ WLL +   + LD  + +QY  YR
Sbjct  328   EYGKYIAVNMSWLLGSFGTLLLDAGVFVQYFMYR  361



>gb|EEU06474.1| YOL092W-like protein [Saccharomyces cerevisiae JAY291]
Length=308

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/355 (25%), Positives = 146/355 (41%), Gaps = 80/355 (23%)
 Frame = +1

Query  337   IPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVF  516
             +PQI  NF  KSS G+SLLF++ W+AGD+FNL+G +++       L + ++IL+A     
Sbjct  30    VPQIYENFYRKSSDGLSLLFVILWLAGDVFNLMGAVMQ------HLLSTMIILAAY----  79

Query  517   LST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA  696
                                             YT   ++L+ Q ++YD       +++ A
Sbjct  80    --------------------------------YTVADIILLGQCLWYD------NEEKPA  101

Query  697   GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
              D                      PI    + P  ++     +   + +  S   P R +
Sbjct  102   VD----------------------PIHLSPANPINENVLHDVFNEQQPLLNSQGQPNRID  139

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
                + PS+ G       DD   E  S N I     I     +  F++  ++         
Sbjct  140   EEMAAPSSDG----NVGDDNLREVNSRNLIKDIF-IVSGVVFVGFISWYVTYCVNYTQPP  194

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
             PV         L     + +   Q  G++ A +Y+G RIPQI LN KR S EG++ L F+
Sbjct  195   PV-----EDPSLPVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKSCEGISFLFFL  249

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             FA L N T++ S++V +  W  +  N  WL+ +   + +D  I  Q+  Y+  +K
Sbjct  250   FACLGNTTFIFSVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNKK  304



>emb|CCE27008.1| uncharacterized protein CPUR_00480 [Claviceps purpurea 20.1]
Length=369

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 99/413 (24%), Positives = 154/413 (37%), Gaps = 118/413 (29%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW +   PQ++ N+   S+  +S+ F++ W+ GD+FN+ G +L+   
Sbjct  13    DAVSGICGSISIACWVLVFTPQLIANWTCGSAEALSIQFIIVWLIGDVFNIAGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   VVL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADVVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEY  819
              Q  YY      W+D+                                 S P+R H    
Sbjct  91    GQCFYYRGFT--WRDEPCTS----------------------------TSEPSRAH----  116

Query  820   YYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAG  999
                     AG A      N   +  +AL +D      D T  +P++  IS   P P +  
Sbjct  117   --------AGDA------NADANEGTALLVDASHHESDWTGLSPAVPHISHADPPPPTVL  162

Query  1000  YGAFLTTSLSIPHQTKALMPVY----AALGGRKLLQGSGTEHSSF---GQWLGWMMAAIY  1158
                   T + +      ++  +    A +G  +   G G +  +F   GQ  G++ A  Y
Sbjct  163   QTVIWNTCIVLMVCAAGILGWFLGQKAKVGETEPSAGRGEDSLTFSVWGQVFGYLCAVFY  222

Query  1159  MGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDK------------  1302
             +  R+PQ+ LN +R + EGL+ L FIFA L N TYV SI+      +             
Sbjct  223   IASRVPQLILNYRRKTTEGLSMLFFIFACLGNVTYVLSIVAYEPRCEHRQCESGEVGRIY  282

Query  1303  ---IKPNLPWLLDAAVCVGLDLFIILQYIYY------RYCRKNSGGSREDSAD  1434
                +  NL WL  A+V + +D  +  QY YY      ++ R N  G    S D
Sbjct  283   GKYMLLNLSWLAGASVTLLMDFVVFCQYFYYSTTHGEKFSRSNDQGEYVRSID  335



>gb|EJT43760.1| RTC2-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=308

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 103/388 (27%), Positives = 166/388 (43%), Gaps = 93/388 (24%)
 Frame = +1

Query  277   SDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPA  456
             + + S + G  S+ CW V  +PQI  NFR +S+ G+SLLF++ W+ GDIFN++G +++  
Sbjct  10    AKNISGIAGSISISCWIVVFVPQIYENFRRQSADGLSLLFIVLWLLGDIFNVIGAMMQ-N  68

Query  457   TLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVL  636
              LPT     ++IL+A                                     YT   +VL
Sbjct  69    LLPT-----MIILAAY------------------------------------YTLADLVL  87

Query  637   VLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKK---PLRRNKSGGSGIPIPDGASRPARQH  807
             ++Q M+YD      K+K+        ++E KK   P+  +      IPI DG+     Q 
Sbjct  88    LVQCMWYD------KNKKG------FLQEVKKDVDPVHLSPV----IPI-DGS---VLQD  127

Query  808   QAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIP  987
                 Y      + G     + S L + G   +  ++  SS D  +    M        I 
Sbjct  128   VFSEYEPLLPRLEGEDNQSYNS-LQRVGTEVIVKEDKNSSSDLLIVWGVMLVGFFSWYIS  186

Query  988   RSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSF-GQWLGWMMAAIYMG  1164
               +G       S  IP +   L                  E  +F  Q LG++ A +Y+G
Sbjct  187   YCSG------VSKGIPDKKPTL------------------EKINFPAQILGYLSAILYLG  222

Query  1165  GRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVC  1344
              R+PQI LN KR S EG++ L F+FA L N +++ S+L  +     +  N  WL+ +A  
Sbjct  223   SRVPQIVLNFKRKSCEGVSFLFFLFACLGNISFIVSVLSMSVDPKYLILNASWLIGSAGT  282

Query  1345  VGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             + +D  + +Q  ++ Y R   G    D+
Sbjct  283   LLMDFTVFIQ--FFLYARSQYGKKAIDN  308



>gb|EDN63783.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gb|EDV10524.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ69481.1| YOL092Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 emb|CAY86198.1| EC1118_1O4_0782p [Saccharomyces cerevisiae EC1118]
 gb|EGA84847.1| YOL092W-like protein [Saccharomyces cerevisiae VL3]
 gb|EWG83029.1| hypothetical protein R008_O10516 [Saccharomyces cerevisiae R008]
 gb|EWH15404.1| hypothetical protein P283_P20481 [Saccharomyces cerevisiae P283]
 gb|AHY77222.1| hypothetical protein H779_YJM993O00070 [Saccharomyces cerevisiae 
YJM993]
Length=308

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/355 (25%), Positives = 146/355 (41%), Gaps = 80/355 (23%)
 Frame = +1

Query  337   IPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVF  516
             +PQI  NF  KSS G+SLLF++ W+AGD+FNL+G +++       L + ++IL+A     
Sbjct  30    VPQIYENFYRKSSDGLSLLFVILWLAGDVFNLMGAVMQ------HLLSTMIILAAY----  79

Query  517   LST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA  696
                                             YT   ++L+ Q ++YD       +++ A
Sbjct  80    --------------------------------YTVADIILLGQCLWYD------NEEKPA  101

Query  697   GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
              D                      PI    + P  ++     +   + +  S   P R +
Sbjct  102   VD----------------------PIHLSPANPINENVLHDVFNEQQPLLNSQGQPNRID  139

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
                + PS+ G       DD   E  S N I     I     +  F++  ++         
Sbjct  140   EEMAAPSSDG----NVGDDNLREVNSRNLIKDIF-IVSGVVFVGFISWYVTYCVNYTQPP  194

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
             PV         L     + +   Q  G++ A +Y+G RIPQI LN KR S EG++ L F+
Sbjct  195   PV-----EDPSLPVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKSCEGISFLFFL  249

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             FA L N T++ S++V +  W  +  N  WL+ +   + +D  I  Q+  Y+  +K
Sbjct  250   FACLGNTTFIFSVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNKK  304



>gb|EZF79000.1| hypothetical protein H105_00033 [Trichophyton soudanense CBS 
452.61]
Length=357

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 103/396 (26%), Positives = 163/396 (41%), Gaps = 83/396 (21%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SL FL+ W+AGD+FN++G +++   
Sbjct  11    EALSGICGSISIACWVVVFSPQIIENFRRSSADGLSLEFLIVWLAGDVFNIIGAVMQ-GV  69

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  70    LPTMI-----------------------------------------ILAVYYTIADIVLL  88

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEY  819
              Q  YY         ++  G  +    E +     + S  +   +P     P  Q++ E 
Sbjct  89    GQCFYY---------RDLGGSESTKSPEPEAGTASSSSETATQTVPSSERTPLLQNRPEG  139

Query  820   YYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSM---NSISQPKPIPR  990
              +    S   SAT   R +L     S   + N  ++ D T  +P++     +    P P 
Sbjct  140   EHNG--SNGRSATKQRRESLT----SVASLRNHLTAVDGTHLSPAVPLRKEVVDIPPRPS  193

Query  991   SA-GYGAFLTTSLSIPHQTKALMPVYAALG----GRKLLQGSGT-EHSSFGQWLGWMMAA  1152
             S     AF T S+++      L    +A      G  + +  GT +    GQ  G++ A 
Sbjct  194   STFQIIAFNTFSITLVCAAGILGWYVSATSRHHIGHDIPKSDGTLQFDITGQLFGYLCAL  253

Query  1153  IYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV----------------R  1284
              Y+  RIPQ+ LN +R S EG++ L F+FA + N TYV SI                  R
Sbjct  254   FYLASRIPQLLLNWRRKSTEGVSLLFFLFACIGNLTYVLSIFAYSPVCQGKDGRCLPGER  313

Query  1285  TTAWDK-IKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
              + + + +  N  WLL +   + +DL I  Q+I YR
Sbjct  314   QSIYGRYMAVNASWLLGSLGTLFMDLAIFSQFIMYR  349



>ref|XP_007585566.1| putative pq loop repeat protein [Neofusicoccum parvum UCRNP2]
 gb|EOD46958.1| putative pq loop repeat protein [Neofusicoccum parvum UCRNP2]
Length=348

 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 109/407 (27%), Positives = 168/407 (41%), Gaps = 95/407 (23%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ NFR  S+ G+S++F++ W+ GD+FN++G +L+   
Sbjct  13    DAVSGITGSISIACWVVVFSPQIIENFRRGSAEGLSVVFIVVWLLGDVFNIIGAVLQ-RV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTLADIVLL  90

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEY  819
              Q  YY    + +  K++     +  +E + P    ++     P  +G SRPAR   AE 
Sbjct  91    AQCFYY----KGFTLKDEVA---KPADEDEPPREPTETSALLRPSGNGQSRPARISDAE-  142

Query  820   YYTSARSMAGSATPPFRSNLVKSG----PSALGMDNDCSSDDETVEAPSMNSIS---QPK  978
                  R    S+   F   L + G    P+   +D    +        +  S+       
Sbjct  143   ---GGRRR--SSYSSFTERLFQDGEHLSPATPFVDTPAPAATPQPPRSAAKSVLFNLVAV  197

Query  979   PIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIY  1158
              +  +AG+  +L T     + T       A  GG  L      + +  GQ  G++   +Y
Sbjct  198   VLVCAAGFLGWLFTYQPPENNT-------ADNGGDTL------QFNVPGQIGGYICCVLY  244

Query  1159  MGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV------------RTTAWDK  1302
             +G R+PQ++LN KR S EG++ L FIFA L N TYV SIL              T     
Sbjct  245   LGSRLPQLYLNYKRQSTEGISMLFFIFACLGNLTYVMSILAYKPVCHGRHGHCETGEAGA  304

Query  1303  IKP-----NLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSGGSREDS  1428
             I       NL WLL +   + LD  + +QY  Y   RK+ G + ED+
Sbjct  305   IYGRYVLVNLSWLLGSFGTLLLDAGVFVQYFMY---RKDDGEAVEDA  348



>ref|XP_003681314.1| hypothetical protein TDEL_0D05190 [Torulaspora delbrueckii]
 emb|CCE92103.1| hypothetical protein TDEL_0D05190 [Torulaspora delbrueckii]
Length=303

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 148/367 (40%), Gaps = 92/367 (25%)
 Frame = +1

Query  295   VLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQL  474
             + G  S+ CW +  +PQI  NF  KS+ G+SLLF++ W+ GD+FNL+G +L+   LPT  
Sbjct  16    ITGSISIACWVIVFVPQIYENFYRKSADGLSLLFVILWLVGDVFNLLGAVLQ-KLLPT--  72

Query  475   YTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMY  654
                ++IL+A                                     YT   + L+LQ + 
Sbjct  73    ---MIILAAY------------------------------------YTVADIALLLQCL-  92

Query  655   YDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSA  834
                    W   E   D                      PI    + P  ++  +  +   
Sbjct  93    -------WYGPEQKID----------------------PIHLSPANPINENVLQDVFNEN  123

Query  835   RSM--AGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGA  1008
             + +  A S+ P  R N+     SA   D+   S+ E V+   ++       I  S     
Sbjct  124   QPLLHAQSSAPLSRDNVGGIIESA---DDLLESEREVVKKNYLHD----SVIVLSVILAG  176

Query  1009  FLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWL  1188
             FL+  +S           Y     R    G   E +   Q  G++ A +Y+G R+PQI L
Sbjct  177   FLSWYIS-----------YCQNPNRSKPDGPSLELNILAQVFGYISAVLYLGSRVPQILL  225

Query  1189  NIKRGSVEGLNPLMFIFALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFII  1368
             N +R S EG++ L F+FA L N T++ S+L  +     +  N  WL+ ++  + +D  I 
Sbjct  226   NFERQSCEGISFLFFLFACLGNTTFIISVLAISFDPQYLLLNASWLVGSSGTLIMDFIIF  285

Query  1369  LQYIYYR  1389
              Q+  Y 
Sbjct  286   AQFFAYH  292



>dbj|GAA26236.1| K7_Yol092wp [Saccharomyces cerevisiae Kyokai no. 7]
Length=308

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 88/355 (25%), Positives = 146/355 (41%), Gaps = 80/355 (23%)
 Frame = +1

Query  337   IPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQLYTALVILSAQCCVF  516
             +PQI  NF  KSS G+SLLF++ W+AGD+FNL+G +++       L + ++IL+A     
Sbjct  30    VPQIYENFYRKSSDGLSLLFVVLWLAGDVFNLMGAVMQ------HLLSTMIILAAY----  79

Query  517   LST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMYYDFLYRWWKDKEDA  696
                                             YT   ++L+ Q ++YD       +++ A
Sbjct  80    --------------------------------YTVADIILLGQCLWYD------NEEKPA  101

Query  697   GDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTSARSMAGSATPPFRSN  876
              D                      PI    + P  ++     +   + +  S   P R +
Sbjct  102   VD----------------------PIHLSPANPINENVLHDVFNEQQPLLNSQGQPNRID  139

Query  877   LVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAFLTTSLSIPHQTKALM  1056
                + PS+ G       DD   E  S N I     I     +  F++  ++         
Sbjct  140   EEMAAPSSDG----NVGDDNLREVNSRNLIKDIF-IVSGVVFVGFISWYVTYCVNYTQPP  194

Query  1057  PVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFI  1236
             PV         L     + +   Q  G++ A +Y+G RIPQI LN KR S EG++ L F+
Sbjct  195   PV-----EDPSLPVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKSCEGISFLFFL  249

Query  1237  FALLANATYVGSILVRTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRK  1401
             FA L N T++ S++V +  W  +  N  WL+ +   + +D  I  Q+  Y+  +K
Sbjct  250   FACLGNTTFIFSVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNKK  304



>ref|XP_001801365.1| hypothetical protein SNOG_11116 [Phaeosphaeria nodorum SN15]
 gb|EAT81615.2| hypothetical protein SNOG_11116 [Phaeosphaeria nodorum SN15]
Length=371

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 101/417 (24%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             D  S + G  S+ CW V   PQI+ N++  S+ G+S++F++ W+AGD FN++G +L+   
Sbjct  13    DAISQIFGSISIACWIVVFSPQIIENWKRSSADGLSVVFIVIWLAGDFFNIIGAVLQ-GV  71

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  72    LPTMI-----------------------------------------ILAVYYTFADIVLL  90

Query  640   LQSMYYD-FLYRW-WKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASR-------  792
             LQ  +Y  F  R  +K   D  DS       + PL   +   S     +G          
Sbjct  91    LQCFWYKGFTLRDDYKKPGDDSDSTTTSASEQSPLLSAQQQPSNGSHANGNGNGYGFDIA  150

Query  793   PARQHQAEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQ  972
             P R    +  Y+S      ++   FR   +    + L       +D      P       
Sbjct  151   PPRISDIDRRYSS------NSQGSFRERFLSIDGTHLSPVTPLHNDPAQTATP-------  197

Query  973   PKPIPRSAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQG--------------SGTE  1110
             P+P P  +     L    +I      L+ + A + G  L                 S   
Sbjct  198   PRPQPAQSTLQTVLFNLGTI------LLVIAAGIFGWYLSASRAPPPHHSHTPSSESTLH  251

Query  1111  HSSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV---  1281
              + +GQ  G++ A +Y+G R+PQ+ LN +R S +G++ L F+FA L N TYV SILV   
Sbjct  252   FNLWGQISGYVCALLYLGSRVPQLLLNYRRKSTDGISMLFFLFACLGNLTYVLSILVYKP  311

Query  1282  --------------RTTAWDKIKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNSG  1410
                           R      +  N  WLL +   + LD  + +QY  YR   ++ G
Sbjct  312   RCAGHHGACADGEARRVYGKYVAVNFSWLLGSFGTLVLDACVFVQYFMYRRDEESDG  368



>gb|EZF36196.1| hypothetical protein H101_00285 [Trichophyton interdigitale H6]
 gb|KDB28212.1| hypothetical protein H109_00028 [Trichophyton interdigitale MR816]
Length=359

 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 103/405 (25%), Positives = 165/405 (41%), Gaps = 99/405 (24%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SL FL+ W+AGD+FN++G +++   
Sbjct  11    EALSGICGSISIACWVVVFSPQIIENFRRSSADGLSLEFLIVWLAGDVFNIIGAVMQ-GV  69

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  70    LPTMI-----------------------------------------ILAVYYTIADIVLL  88

Query  640   LQSMYYDFLYRWWKDK---EDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQ  810
              Q  YY  L      K    +AG ++   E A + +  ++        P   +RP  +H 
Sbjct  89    GQCFYYRGLSGSESTKPPEPEAGRASSSSETATQTVLSSER------TPLLHNRPEGEHN  142

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSM---NSISQPKP  981
                         GS + P      +S  S   + N  ++ D T  +P++     ++   P
Sbjct  143   ------------GSNSRPAAKQRRESLTSVASLRNHLTAVDGTHLSPAVPLRKEVADTPP  190

Query  982   IPRSA----GYGAFLTTSLSIPHQTKALMPVYAALGGRK-------LLQGSGT-EHSSFG  1125
              P S      + AF  T +        ++  Y +   RK       + +  GT +    G
Sbjct  191   RPSSTFQIIAFNAFSITLVC----AAGILGWYVSATSRKRHHKGHDIPKSDGTLQFDITG  246

Query  1126  QWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV--------  1281
             Q  G++ A  Y+  RIPQ+ LN +R S EG++ L F+FA + N TYV SI          
Sbjct  247   QVFGYLCALFYLASRIPQLLLNWRRKSTEGVSLLFFLFACIGNLTYVLSIFAYSPVCQGK  306

Query  1282  --------RTTAWDK-IKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
                     R + + + +  N  WLL +   + +DL I  Q+I YR
Sbjct  307   DARCLPGERQSIYGRYMAVNASWLLGSLGTLFMDLAIFSQFIMYR  351



>gb|EMG50474.1| Vacuolar integral membrane-like protein [Candida maltosa Xu316]
Length=331

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 104/386 (27%), Positives = 155/386 (40%), Gaps = 94/386 (24%)
 Frame = +1

Query  274   ISDDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEP  453
             IS  FSFV    S   W  A++PQI  N+ TKS+ G+S  FL+ W  GD  +   CL+  
Sbjct  11    ISSTFSFV----SCTSWIFAQLPQIYQNYSTKSASGISPSFLILWFMGDFLSFTSCLVNS  66

Query  454   -ATLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTV  630
                L  QLY ++  L             I +C       F +YY+        +Y    V
Sbjct  67    DVVLGFQLYLSIFFLCND----------ITLC-------FQYYYY------NNVYPRKHV  103

Query  631   VLVLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQ  810
                LQ +  +       ++ED                +NK     IP+   AS+    HQ
Sbjct  104   ---LQYVSLNL------NQEDD--------------NKNKDN---IPLTPTASKDISIHQ  137

Query  811   AEYYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPR  990
             A+  +  A S  G        + V S PS+           ++V     N+      + +
Sbjct  138   AQSVHHLAHSNMGET---ISEDYVNSTPSSY----------DSVHEDGNNT-----NLFK  179

Query  991   SAGYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGR  1170
                 G  L       H +KAL       G   +     T  SS G +L W    +Y   R
Sbjct  180   KGAVGTLL-------HASKALALPIGTPGDDPI-----TSKSSLGLFLAWGCTVVYCSSR  227

Query  1171  IPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVRT------TAWDKIKPNLPWLLD  1332
              PQ++ N +R SVEG++PL+F  AL+ N TY  SIL          + D I   LP++L 
Sbjct  228   CPQLYKNYQRKSVEGISPLLFASALMGNLTYTLSILTSCDFVYGENSHDFIIKELPYILG  287

Query  1333  AAVCVGLDLFIILQYIYYRYCRKNSG  1410
             ++  +  D    + Y Y +Y  +N+G
Sbjct  288   SSGTIIFD----IAYFYQKYLYRNNG  309



>dbj|GAA88178.1| PQ loop repeat protein [Aspergillus kawachii IFO 4308]
Length=384

 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 110/427 (26%), Positives = 172/427 (40%), Gaps = 101/427 (24%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SLLFL+ W+AGD+FN++G +L+   
Sbjct  12    EALSGICGSISIACWVVVFSPQIIENFRRGSADGLSLLFLIVWLAGDVFNILGAVLQ-GV  70

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   VVL+
Sbjct  71    LPTMI-----------------------------------------ILAVYYTLADVVLL  89

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNK-SGGSGIPIPDGASRP-------  795
              Q  YY    R +  +++   S         P+  +     + IP P    +P       
Sbjct  90    AQCFYY----RGFTLRDEPSTS----PRPASPITTDAYDEDTEIPSPVVPRKPTEHTALL  141

Query  796   -ARQHQAEYYYT-SARSMAGSAT-----PPFRSNLVKSGPSALGMDNDCSSDDETVEAPS  954
              +++  A Y     ARS A SAT      P  ++   S  S L    D +    +   P 
Sbjct  142   SSKRRSASYQAPLDARSPASSATITPHHQPLLAHRRHSASSFLHTTVDGTH--LSPATPL  199

Query  955   MNSISQPKPIPRSAGY--GAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEH-----  1113
             +    QP+P PR+       F   S  I      ++  Y +         +  +H     
Sbjct  200   VEPAKQPRP-PRTLTMLQATFFNGSAIILVCAAGILGWYISQQSSLSSDNNNNKHKDSTD  258

Query  1114  ----SSFGQWLGWMMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV  1281
                  + GQ  G++ A +Y+G R+PQI LN +R S +G++ L F+FA + N TYV SIL 
Sbjct  259   DLKMDTLGQVFGYLCAVLYLGSRLPQILLNYRRKSTDGVSLLFFLFACIGNLTYVLSILA  318

Query  1282  RTTAWDK------------------IKPNLPWLLDAAVCVGLDLFIILQYIYYRYCRKNS  1407
              +    +                  I  NL WL+ +   + LD+ I +Q+  Y    ++ 
Sbjct  319   YSPVCQRRHHGRCRSDELASLYGRYILVNLSWLIGSFGTLLLDMCIFIQFFLY----QDG  374

Query  1408  GGSREDS  1428
              GS  D+
Sbjct  375   NGSEVDA  381



>gb|EZF89649.1| hypothetical protein H110_00038 [Trichophyton rubrum MR1448]
 gb|EZG00453.1| hypothetical protein H113_00040 [Trichophyton rubrum MR1459]
 gb|KDB38848.1| hypothetical protein H112_00040 [Trichophyton rubrum D6]
Length=357

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 101/396 (26%), Positives = 161/396 (41%), Gaps = 83/396 (21%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SL FL+ W+AGD+FN++G +++   
Sbjct  11    EALSGICGSISIACWVVVFSPQIIENFRRSSADGLSLEFLIVWLAGDVFNIIGAVMQ-GV  69

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  70    LPTMI-----------------------------------------ILAVYYTIADIVLL  88

Query  640   LQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEY  819
              Q  YY         ++  G  +    E +     + S  +   +P     P  Q++ E 
Sbjct  89    GQCFYY---------RDLGGSESTKSPEPEAGTASSSSETATQTVPSSERTPLLQNRPEG  139

Query  820   YYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSM---NSISQPKPIPR  990
              +       GS   P      +S  S   + N  ++ D T  +P++     +    P P 
Sbjct  140   EHN------GSNGRPATKQRRESLTSVASLRNHLTAVDGTHLSPAVPLRKEVVDIPPRPS  193

Query  991   SA-GYGAFLTTSLSIPHQTKALMPVYAALG----GRKLLQGSGT-EHSSFGQWLGWMMAA  1152
             S     AF T S+++      L    +A      G  + +  GT +    GQ  G++ A 
Sbjct  194   STFQIIAFNTFSITLVCAAGILGWYVSATSRHHIGHDIPKSDGTLQFDITGQLFGYLCAL  253

Query  1153  IYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV----------------R  1284
              Y+  RIPQ+ LN +R S EG++ L F+FA + N TYV SI                  R
Sbjct  254   FYLASRIPQLLLNWRRKSTEGVSLLFFLFACIGNLTYVLSIFAYSPVCQGKDGRCLPGER  313

Query  1285  TTAWDK-IKPNLPWLLDAAVCVGLDLFIILQYIYYR  1389
              + + + +  N  WLL +   + +DL I  Q+I YR
Sbjct  314   QSIYGRYMAVNASWLLGSLGTLFMDLAIFSQFIMYR  349



>gb|KEQ59079.1| PQ-loop-domain-containing protein [Aureobasidium melanogenum 
CBS 110374]
Length=354

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 93/385 (24%), Positives = 151/385 (39%), Gaps = 91/385 (24%)
 Frame = +1

Query  295   VLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPATLPTQL  474
             ++G  S+ CW V   PQI+ NFR  S+ G+S+ F++ W+ GD  N++G +++   LPT +
Sbjct  18    IMGSISIACWVVVFSPQIIENFRRSSAEGLSIEFVIIWLLGDFANIIGAVMQ-RVLPTMI  76

Query  475   YTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLVLQSMY  654
                                                      I+   YT   +VL+ Q  Y
Sbjct  77    -----------------------------------------ILAIYYTFADIVLLAQCFY  95

Query  655   YD-FLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAEYYYTS  831
             Y  F +R  K  + +        E    L  N +G S +P    AS    +   E  + S
Sbjct  96    YRGFHFRDPKPVKPSDSEENTPTERSALLSANGNGNSELPRTRSASSFGERFVNEGVHMS  155

Query  832   ARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSAGYGAF  1011
                    A P   +  V+   +A            ++    + +++    +  +   G +
Sbjct  156   P------ANPMHPTPKVQRPRTA----------KRSILQKLLFNLTCIVLVVAAGVAGYY  199

Query  1012  LTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIPQIWLN  1191
             L+ S +  ++T+               Q      +  GQ  G++ AA+Y+G R+PQ+ LN
Sbjct  200   LSPSSNSGNETEEQ-------------QNDSLHFNVVGQVFGYLCAALYLGSRVPQLLLN  246

Query  1192  IKRGSVEGLNPLMFIFALLANATYVGSILV------RTTAWDKIKP-------------N  1314
              +R S EGLN L F+FA + N TYV SI              K +P             N
Sbjct  247   YRRKSTEGLNALFFLFACIGNLTYVLSIFAFNPICHHGKHGQKCRPGEASAIYGRYILVN  306

Query  1315  LPWLLDAAVCVGLDLFIILQYIYYR  1389
             L WLL +   + LD  +  Q+  YR
Sbjct  307   LSWLLGSLGTLFLDFGVFAQFFIYR  331



>gb|EPS34600.1| hypothetical protein PDE_09564 [Penicillium oxalicum 114-2]
Length=384

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 111/415 (27%), Positives = 168/415 (40%), Gaps = 89/415 (21%)
 Frame = +1

Query  280   DDFSFVLGLFSLICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLEPAT  459
             +  S + G  S+ CW V   PQI+ NFR  S+ G+SLLFL+ W+AGD+FN++G +L+   
Sbjct  12    EALSGICGSISIACWVVVFSPQIIENFRRGSADGLSLLFLIVWLAGDVFNILGAVLQ-GV  70

Query  460   LPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVLV  639
             LPT +                                         I+   YT   +VL+
Sbjct  71    LPTMI-----------------------------------------ILAVYYTLADIVLL  89

Query  640   LQSMYY-DFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAE  816
              Q  YY  F  R       + DS+ +VE ++     + S  +  P    +  P     A 
Sbjct  90    GQCFYYRGFNIRDELSSSSSSDSHSVVEGSRDGNEESGSEANASPTERSSLLPKSNGHAH  149

Query  817   YYYTSARSMAGSATPPFRSNLVKSGPSA-LGMDNDCSSDDETVEAPSMNSISQPKPIPRS  993
                      AG A P   S   +   SA LG D      D T  +P+   I       R 
Sbjct  150   -----GEETAGEAGPTGASTAQRQRSSASLGKDIAHHHVDGTHLSPATPFIDPNSERARY  204

Query  994   AGYGAFLTTSLSIPHQTKALMPVYAA-LGGRKLLQGSGTEHSS--------FGQWLGWMM  1146
                   ++T  SI   T A+  V AA + G  +  GS    +          GQ  G++ 
Sbjct  205   QRRRRRISTIQSILFNTTAIALVCAAGILGWYVSPGSKKSKAEPEPLTLDPLGQAFGYLC  264

Query  1147  AAIYMGGRIPQIWLNIKRGSVEGLNPLMFIFALLANATYVGSILV-------RTTAWDKI  1305
             A  Y+G R+PQ+ LN +R S +G++ L F+FA + N TYV SI+         T+A  ++
Sbjct  265   AVFYLGSRVPQLLLNYRRKSTDGVSLLFFLFACIGNLTYVLSIMAYSPVCRGTTSASSEL  324

Query  1306  -------KP-----------------NLPWLLDAAVCVGLDLFIILQYIYYRYCR  1398
                    +P                 NL WL+ +   + LD+ I +Q+  YR  +
Sbjct  325   GEMSHRHRPHCRPGEAAALYGQYVLVNLSWLVGSFGTLVLDMAIFVQFFLYRDAK  379



>ref|XP_712751.1| hypothetical protein CaO19.6950 [Candida albicans SC5314]
 ref|XP_712714.1| hypothetical protein CaO19.14212 [Candida albicans SC5314]
 gb|EAK93543.1| hypothetical protein CaO19.14212 [Candida albicans SC5314]
 gb|EAK93580.1| hypothetical protein CaO19.6950 [Candida albicans SC5314]
Length=335

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 95/384 (25%), Positives = 151/384 (39%), Gaps = 86/384 (22%)
 Frame = +1

Query  289   SFVLGLFS---LICWGVAEIPQIVTNFRTKSSHGVSLLFLLTWIAGDIFNLVGCLLE-PA  456
             SF+   FS    I W  A++PQI+ N+R KS+ G+S  FL+ W  GD  +   CL+    
Sbjct  6     SFISTTFSTTSCISWIFAQLPQILENYRNKSAEGISPSFLILWFMGDFLSFTSCLVNIDI  65

Query  457   TLPTQLYTALVILSAQCCVFLST*AAIVICESLRDNIFYHYYFVLI*IVGQLYTATTVVL  636
              L  QLY ++  L                                            V L
Sbjct  66    VLDFQLYLSVFFL-----------------------------------------CNDVTL  84

Query  637   VLQSMYYDFLYRWWKDKEDAGDSNQLVEEAKKPLRRNKSGGSGIPIPDGASRPARQHQAE  816
               Q  YY+ +Y     +       Q  +++  PL  + S  S + + +   R    +QA+
Sbjct  85    CFQYYYYNSVYP----RLQQQQQQQQRQQSYVPLSTDTSDSSRLTMTNNEDRDISIYQAQ  140

Query  817   YYYTSARSMAGSATPPFRSNLVKSGPSALGMDNDCSSDDETVEAPSMNSISQPKPIPRSA  996
                    + +  +T     + V S PS+    ND                +    I + +
Sbjct  141   DIQQIKHANSNQSTSE---DFVNSTPSSYDSIND----------------NDNGSIIKKS  181

Query  997   GYGAFLTTSLSIPHQTKALMPVYAALGGRKLLQGSGTEHSSFGQWLGWMMAAIYMGGRIP  1176
               GA L T  ++       +P+      ++  +   T  SS G +L W    +Y   R P
Sbjct  182   IVGAILNTGHAVA------LPISTETFCKRDTEDKST--SSVGLYLAWGCTLVYCLSRCP  233

Query  1177  QIWLNIKRGSVEGLNPLMFIFALLANATYVGSILVR------TTAWDKIKPNLPWLLDAA  1338
             Q++ N KR SV+G++PL+F  AL+ N TY  SIL        +   D I   LP++L +A
Sbjct  234   QLYKNYKRKSVDGISPLLFASALMGNLTYTLSILTSCEFAFGSNRQDFILKELPYILGSA  293

Query  1339  VCVGLDLFIILQYIYYRYCRKNSG  1410
               +  D    + Y Y +Y  +NSG
Sbjct  294   GTIVFD----IGYFYQKYLYRNSG  313



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4909380504078