BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25072_g3_i2 len=888 path=[1:0-66 68:67-113 115:114-196 198:197-203
205:204-342 344:343-370 372:371-398 400:399-469 471:470-548
550:549-551 553:552-610 612:611-626 628:627-697 699:698-699
701:700-887]

Length=888
                                                                      Score     E

gb|ADK62516.1|  sucrose transporter 1y                                  492   1e-169   
gb|ADL63119.1|  sucrose transporter 1x                                  481   2e-165   
gb|ADL63118.1|  sucrose transporter 1x                                  481   4e-165   
gb|ADL63117.1|  sucrose transporter 2y                                  400   2e-133   
gb|ADL63115.1|  sucrose transporter 3                                   389   2e-132   
gb|ADL63120.1|  sucrose transporter 2x                                  395   2e-131   
ref|XP_009777676.1|  PREDICTED: sucrose transport protein-like          393   8e-131   
emb|CAA48915.1|  sucrose transport protein                              392   3e-130   Solanum tuberosum [potatoes]
ref|XP_006351170.1|  PREDICTED: sucrose transport protein-like          392   5e-130   
emb|CAQ58420.1|  sucrose transporter                                    389   3e-129   Nicotiana tabacum [American tobacco]
emb|CAQ58421.1|  sucrose transporter                                    389   4e-129   Nicotiana tabacum [American tobacco]
ref|XP_009630281.1|  PREDICTED: sucrose transport protein-like          386   5e-128   
gb|AAD53000.1|U64967_1  sucrose-proton symporter                        387   8e-128   Beta vulgaris subsp. vulgaris [field beet]
emb|CAQ58422.1|  sucrose transporter                                    385   2e-127   Nicotiana tabacum [American tobacco]
ref|XP_011097249.1|  PREDICTED: sucrose transport protein SUC2-like     383   6e-127   
gb|KFK41606.1|  hypothetical protein AALP_AA2G150200                    382   2e-126   
gb|AAF04294.1|AF191024_1  sucrose transporter 1                         382   3e-126   Maurandya barclayana
ref|NP_001289830.1|  sucrose transport protein                          382   3e-126   
gb|AAD45390.1|AF167415_1  sucrose transporter SUT2A                     381   5e-126   Apium graveolens
ref|XP_009348838.1|  PREDICTED: sucrose transport protein-like          380   9e-126   
ref|XP_002871200.1|  sucrose-proton symporter 6                         380   1e-125   
ref|NP_001031241.1|  putative sucrose transport protein SUC7            376   2e-125   Arabidopsis thaliana [mouse-ear cress]
sp|Q03411.1|SUT_SPIOL  RecName: Full=Sucrose transport protein; A...    380   3e-125   Spinacia oleracea
emb|CAA57726.1|  sucrose transporter                                    376   4e-125   Solanum lycopersicum
ref|NP_001290021.1|  sucrose transport protein                          379   4e-125   
ref|NP_001031242.1|  putative sucrose transport protein SUC7            377   4e-125   Arabidopsis thaliana [mouse-ear cress]
gb|ACX33146.1|  sucrose transporter 1                                   379   5e-125   Verbascum phoeniceum [purple mullein]
ref|XP_008381009.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    378   6e-125   
ref|XP_009339088.1|  PREDICTED: sucrose transport protein-like          379   6e-125   
gb|AAC99332.1|  sucrose transporter                                     378   1e-124   Apium graveolens
dbj|BAD44273.1|  hypothetical protein                                   377   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176830.1|  putative sucrose transport protein SUC7               376   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173685.1|  sucrose transport protein SUC2                        376   4e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72840.1|  BnaC06g32880D                                          376   5e-124   
emb|CAA53150.1|  sucrose-proton symporter                               376   6e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105851.1|  PREDICTED: sucrose transport protein SUC1-like     376   6e-124   
ref|XP_008382139.1|  PREDICTED: sucrose transport protein-like          372   1e-123   
ref|XP_010425916.1|  PREDICTED: putative sucrose transport protei...    374   1e-123   
ref|NP_196235.1|  sucrose transport protein SUC9                        375   1e-123   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA89458.1|  sucrose transporter protein                            375   2e-123   Daucus carota [carrots]
ref|XP_009115609.1|  PREDICTED: sucrose transport protein SUC2          375   2e-123   
ref|XP_010477533.1|  PREDICTED: sucrose transport protein SUC2          374   2e-123   
gb|AAL58072.1|  sucrose transporter SUC2                                374   3e-123   Brassica oleracea
ref|XP_010425915.1|  PREDICTED: putative sucrose transport protei...    374   3e-123   
gb|AAM10322.1|  At1g22710/T22J18_12                                     374   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009348390.1|  PREDICTED: sucrose transport protein-like          374   3e-123   
ref|XP_006589462.1|  PREDICTED: sucrose transport protein               374   3e-123   
ref|XP_010503137.1|  PREDICTED: sucrose transport protein SUC8-li...    372   4e-123   
ref|XP_006307270.1|  hypothetical protein CARUB_v10008884mg             374   4e-123   
ref|XP_002893246.1|  sucrose-proton symporter 2                         373   7e-123   
ref|XP_010503136.1|  PREDICTED: sucrose transport protein SUC8-li...    372   8e-123   
ref|XP_007020266.1|  Sucrose transport protein SUC2 isoform 1           372   1e-122   
ref|XP_010415904.1|  PREDICTED: sucrose transport protein SUC1-like     372   2e-122   
ref|XP_009103222.1|  PREDICTED: sucrose transport protein SUC2          372   2e-122   
ref|XP_009375259.1|  PREDICTED: sucrose transport protein-like          372   2e-122   
gb|AAF04295.2|AF191025_1  sucrose transporter 1                         371   3e-122   Alonsoa meridionalis
ref|XP_007201709.1|  hypothetical protein PRUPE_ppa004033mg             372   3e-122   
ref|XP_009130919.1|  PREDICTED: putative sucrose transport protei...    370   4e-122   
emb|CAA57727.1|  sucrose transporter                                    371   4e-122   Nicotiana tabacum [American tobacco]
ref|XP_006390731.1|  hypothetical protein EUTSA_v10018412mg             369   5e-122   
gb|KEH25698.1|  sucrose proton symporter 2                              371   6e-122   
ref|XP_002887046.1|  predicted protein                                  370   6e-122   
ref|XP_010491171.1|  PREDICTED: sucrose transport protein SUC8-like     369   2e-121   
ref|XP_010428037.1|  PREDICTED: sucrose transport protein SUC1-like     370   2e-121   
gb|AHA80795.2|  sucrose transport protein 1                             370   2e-121   
emb|CDY12517.1|  BnaC07g13570D                                          369   2e-121   
emb|CDX80991.1|  BnaC03g02450D                                          368   3e-121   
ref|XP_008245088.1|  PREDICTED: sucrose transport protein               369   3e-121   
ref|XP_010428038.1|  PREDICTED: sucrose transport protein SUC5-like     369   4e-121   
ref|XP_010460033.1|  PREDICTED: sucrose transport protein SUC2-like     369   5e-121   
emb|CAC19689.1|  sucrose/proton symporter                               369   5e-121   Daucus carota [carrots]
emb|CAA76369.1|  sucrose/H+ symporter                                   369   5e-121   Daucus carota [carrots]
ref|XP_006302149.1|  hypothetical protein CARUB_v10020153mg             368   6e-121   
ref|XP_006390730.1|  hypothetical protein EUTSA_v10018412mg             368   8e-121   
gb|ACB47398.1|  sucrose transporter                                     367   1e-120   Brassica napus [oilseed rape]
ref|NP_179074.1|  sucrose transport protein SUC8                        367   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471204.1|  PREDICTED: sucrose transport protein SUC1          367   2e-120   
ref|XP_006399085.1|  hypothetical protein EUTSA_v10015600mg             366   2e-120   
ref|XP_010471205.1|  PREDICTED: sucrose transport protein SUC5-like     367   3e-120   
gb|ABB89051.1|  putative sucrose transporter SUT3                       366   3e-120   Apium graveolens Dulce Group [celery]
gb|EYU22864.1|  hypothetical protein MIMGU_mgv1a004602mg                366   4e-120   
ref|XP_006392340.1|  hypothetical protein EUTSA_v10023916mg             365   4e-120   
ref|XP_007009466.1|  Sucrose transport protein SUC2                     365   5e-120   
gb|KHG14831.1|  Sucrose transport SUC2 -like protein                    365   5e-120   
ref|XP_006285493.1|  hypothetical protein CARUB_v10006922mg             365   6e-120   
ref|XP_010419159.1|  PREDICTED: sucrose transport protein SUC5-like     365   7e-120   
gb|AAL58071.1|  sucrose transporter SUC1                                365   7e-120   Brassica oleracea
gb|KFK44362.1|  hypothetical protein AALP_AA1G247500                    365   8e-120   
ref|XP_006416169.1|  hypothetical protein EUTSA_v10009321mg             364   1e-119   
gb|KEH32639.1|  sucrose transporter 2                                   363   2e-119   
ref|XP_002526849.1|  sucrose transport protein, putative                365   2e-119   Ricinus communis
emb|CAA83436.1|  sucrose carrier                                        365   2e-119   Ricinus communis
gb|AHH34929.1|  sucrose transporter 6                                   363   3e-119   
ref|XP_010063792.1|  PREDICTED: putative sucrose transport protei...    363   6e-119   
ref|XP_006473216.1|  PREDICTED: sucrose transport protein SUC2 is...    361   6e-119   
ref|NP_177333.1|  sucrose transport protein SUC1                        362   1e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CAC19851.1|  sucrose trasporter                                     362   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610412.1|  Sucrose transport protein                          362   2e-118   
emb|CAN67869.1|  hypothetical protein VITISV_020809                     362   2e-118   Vitis vinifera
gb|AAY87138.1|  putative sucrose transporter                            362   2e-118   Vitis vinifera
ref|NP_001268070.1|  sucrose transporter-like                           361   2e-118   
ref|NP_177334.1|  sucrose transport protein SUC5                        362   2e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CAC33492.1|  sucrose carrier                                        354   3e-118   Ricinus communis
gb|AAF65765.1|AF242307_1  sucrose transport protein                     362   3e-118   Euphorbia esula [wolf's milk]
emb|CAA53390.2|  sucrose transporter                                    361   4e-118   Plantago major [cart-track plant]
ref|XP_007151901.1|  hypothetical protein PHAVU_004G085400g             360   4e-118   
gb|KCW71037.1|  hypothetical protein EUGRSUZ_F04137                     360   4e-118   
ref|XP_009122220.1|  PREDICTED: putative sucrose transport protei...    360   5e-118   
ref|XP_004496382.1|  PREDICTED: sucrose transport protein-like          361   5e-118   
ref|XP_006473215.1|  PREDICTED: sucrose transport protein SUC2 is...    361   5e-118   
ref|XP_010063779.1|  PREDICTED: sucrose transport protein SUC2-like     360   5e-118   
gb|KHG01351.1|  Sucrose transport SUC2 -like protein                    360   6e-118   
ref|NP_199174.1|  putative sucrose transport protein SUC6               360   7e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266122.1|  PREDICTED: sucrose transport protein SUC2          360   1e-117   Vitis vinifera
gb|AAU11810.1|  sucrose transporter                                     360   1e-117   Juglans regia
emb|CDY60441.1|  BnaA10g30480D                                          358   2e-117   
ref|XP_006301807.1|  hypothetical protein CARUB_v10022273mg             359   2e-117   
ref|XP_007151897.1|  hypothetical protein PHAVU_004G085100g             359   2e-117   
gb|ABB30164.1|  sucrose transport protein SUT1                          359   2e-117   Phaseolus vulgaris [French bean]
ref|XP_006434634.1|  hypothetical protein CICLE_v10000828mg             358   2e-117   
ref|XP_006434633.1|  hypothetical protein CICLE_v10000828mg             359   3e-117   
gb|KHG00539.1|  Sucrose transport SUC2 -like protein                    358   4e-117   
gb|AET08927.1|  sucrose transporter                                     357   9e-117   
ref|XP_009104886.1|  PREDICTED: sucrose transport protein SUC1-like     357   1e-116   
emb|CAE53179.1|  sucrose transporter                                    357   1e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34473.1|  unknown                                                 350   2e-116   
gb|AHB33870.1|  sucrose transporter                                     357   2e-116   
ref|XP_007020267.1|  Sucrose transport protein SUC2 isoform 2           356   2e-116   
emb|CDP20704.1|  unnamed protein product                                357   2e-116   
emb|CDY36675.1|  BnaCnng07770D                                          356   3e-116   
ref|XP_007151866.1|  hypothetical protein PHAVU_004G082200g             355   3e-116   
gb|AAD41024.1|  sucrose transport protein SUT1                          356   4e-116   Pisum sativum [garden pea]
gb|KCW71038.1|  hypothetical protein EUGRSUZ_F04138                     355   6e-116   
gb|AHH34928.1|  sucrose transporter 5                                   355   7e-116   
emb|CDX98907.1|  BnaC09g49280D                                          354   8e-116   
ref|XP_010063780.1|  PREDICTED: sucrose transport protein SUC8-like     355   8e-116   
ref|XP_010521130.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    355   9e-116   
ref|XP_004138920.1|  PREDICTED: sucrose transport protein SUC2-like     354   1e-115   
ref|NP_001236298.1|  sucrose transporter                                355   1e-115   
emb|CAA59113.1|  SUC1-sucrose proton symporter                          354   1e-115   Plantago major [cart-track plant]
emb|CAB07811.1|  sucrose transport protein                              355   2e-115   Vicia faba [broad bean]
ref|XP_007020264.1|  Sucrose-proton symporter 2 isoform 2               351   2e-115   
gb|AFM28284.1|  SUT1-1                                                  353   5e-115   
ref|XP_004159998.1|  PREDICTED: sucrose transport protein SUC2-like     352   5e-115   
emb|CAA12256.1|  Sucrose carrier                                        346   8e-115   Ricinus communis
ref|XP_006376318.1|  putative sucrose-H+ symporter family protein       353   1e-114   
ref|XP_010438237.1|  PREDICTED: sucrose transport protein SUC8-like     352   2e-114   
emb|CDY03675.1|  BnaA02g15620D                                          352   2e-114   
ref|XP_004515134.1|  PREDICTED: sucrose transport protein SUC5-like     353   2e-114   
gb|ADW94614.1|  sucrose transporter 1                                   352   2e-114   
ref|XP_008465545.1|  PREDICTED: sucrose transport protein SUC8-li...    350   3e-114   
ref|XP_007020263.1|  Sucrose-proton symporter 2 isoform 1               350   3e-114   
ref|XP_004515590.1|  PREDICTED: sucrose transport protein SUC2-like     350   4e-114   
ref|NP_001275850.1|  citrus sucrose transporter 1                       351   4e-114   
ref|XP_007143634.1|  hypothetical protein PHAVU_007G088200g             351   5e-114   
ref|XP_008465544.1|  PREDICTED: sucrose transport protein SUC8-li...    351   6e-114   
ref|XP_004515129.1|  PREDICTED: sucrose transport protein SUC8-like     348   6e-114   
ref|XP_002874582.1|  hypothetical protein ARALYDRAFT_911231             350   7e-114   
ref|XP_011038161.1|  PREDICTED: sucrose transport protein SUC8-like     350   9e-114   
gb|ABJ51933.1|  sucrose transporter 1                                   350   1e-113   Hevea brasiliensis [jebe]
ref|XP_002887397.1|  hypothetical protein ARALYDRAFT_476315             348   6e-113   
gb|ADW94613.1|  sucrose transporter 1                                   348   7e-113   
ref|XP_010540294.1|  PREDICTED: sucrose transport protein SUC2-like     347   1e-112   
gb|KDP34602.1|  hypothetical protein JCGZ_11979                         347   1e-112   
ref|XP_003548078.1|  PREDICTED: sucrose transport protein SUC1-like     347   1e-112   
ref|XP_006371473.1|  hypothetical protein POPTR_0019s11560g             346   1e-112   
ref|XP_009127880.1|  PREDICTED: sucrose transport protein SUC1          347   2e-112   
ref|XP_010455355.1|  PREDICTED: sucrose transport protein SUC8-like     347   2e-112   
ref|XP_002862880.1|  hypothetical protein ARALYDRAFT_497263             346   2e-112   
gb|ADW94615.1|  sucrose transporter 1                                   347   2e-112   
ref|XP_003518348.1|  PREDICTED: sucrose transport protein SUC1-like     346   3e-112   
ref|XP_002326003.2|  sucrose transporter family protein                 346   5e-112   Populus trichocarpa [western balsam poplar]
emb|CAJ33718.1|  sucrose transporter 1                                  346   5e-112   Populus tremula x Populus tremuloides
gb|AIU94753.1|  sucrose proton symporter                                345   6e-112   
gb|AAD45932.1|AF168771_1  sucrose transport protein                     336   6e-112   Betula pendula [white birch]
gb|ADW94616.1|  sucrose transporter 3                                   345   7e-112   
ref|XP_007151903.1|  hypothetical protein PHAVU_004G085500g             342   1e-111   
ref|XP_006286640.1|  hypothetical protein CARUB_v10002510mg             343   1e-111   
gb|KFK32062.1|  hypothetical protein AALP_AA6G194700                    344   3e-111   
ref|XP_003548077.1|  PREDICTED: sucrose transport protein SUC8-like     342   4e-111   
ref|XP_006599449.1|  PREDICTED: sucrose transport protein SUC8-like     342   6e-111   
gb|ABB30165.1|  sucrose transport protein SUF1                          342   7e-111   Phaseolus vulgaris [French bean]
ref|XP_007151902.1|  hypothetical protein PHAVU_004G085500g             342   8e-111   
gb|ADW78350.1|  sucrose proton symporter 2                              342   9e-111   
gb|AHB33871.1|  sucrose transporter                                     342   1e-110   
gb|KHN32799.1|  Sucrose transport protein SUC2                          341   1e-110   
ref|XP_004291895.1|  PREDICTED: sucrose transport protein SUC2-like     341   2e-110   
ref|XP_004298889.1|  PREDICTED: sucrose transport protein SUC2-like     340   3e-110   
gb|AFM28285.1|  SUT1-2                                                  340   4e-110   
gb|AFU61910.1|  sucrose transporter 4                                   340   4e-110   
ref|XP_010421870.1|  PREDICTED: sucrose transport protein SUC8-like     341   5e-110   
ref|XP_011001730.1|  PREDICTED: sucrose transport protein SUC8-like     341   5e-110   
gb|KHF99226.1|  Sucrose transport SUC2 -like protein                    339   1e-109   
gb|ADL29729.1|  sugar transporter                                       338   3e-109   
emb|CDP19968.1|  unnamed protein product                                338   3e-109   
dbj|BAI23067.1|  sucrose transporter                                    330   4e-109   Plantago trinitatis
dbj|BAI23066.1|  sucrose transporter                                    330   4e-109   Plantago trinitatis
dbj|BAI23071.1|  sucrose transporter                                    329   8e-109   Plantago debilis
dbj|BAI23077.1|  sucrose transporter                                    329   8e-109   Plantago spathulata
dbj|BAI23090.1|  sucrose transporter                                    329   8e-109   Plantago spathulata
gb|ABB30166.1|  putative sucrose transport protein SUT3                 336   8e-109   Phaseolus vulgaris [French bean]
dbj|BAI23096.1|  sucrose transporter                                    329   9e-109   Plantago raoulii
ref|XP_004291896.1|  PREDICTED: sucrose transport protein SUC2-like     337   9e-109   
dbj|BAI23098.1|  sucrose transporter                                    329   9e-109   Plantago hakusanensis
dbj|BAI23078.1|  sucrose transporter                                    329   9e-109   Plantago spathulata
dbj|BAI23088.1|  sucrose transporter                                    328   1e-108   Plantago uniglumis
dbj|BAI23074.1|  sucrose transporter                                    328   2e-108   Plantago raoulii
dbj|BAI23065.1|  sucrose transporter                                    328   2e-108   Plantago tomentosa
dbj|BAI23047.1|  sucrose transporter                                    328   2e-108   Plantago asiatica [Asian plantain]
dbj|BAI23060.1|  sucrose transporter                                    328   2e-108   Plantago australis
dbj|BAI23083.1|  sucrose transporter                                    328   3e-108   Plantago rigida
dbj|BAI23073.1|  sucrose transporter                                    328   3e-108   Plantago raoulii
dbj|BAI23075.1|  sucrose transporter                                    327   4e-108   Plantago raoulii
dbj|BAI23042.1|  sucrose transporter                                    327   4e-108   Plantago cornuti
dbj|BAI23038.1|  sucrose transporter                                    327   4e-108   Plantago asiatica var. densiuscula
dbj|BAI23039.1|  sucrose transporter                                    327   4e-108   Plantago asiatica var. densiuscula
dbj|BAI23069.1|  sucrose transporter                                    327   5e-108   Plantago virginica
ref|XP_010673573.1|  PREDICTED: sucrose transport protein SUC2-like     334   5e-108   
dbj|BAI23063.1|  sucrose transporter                                    327   5e-108   Plantago australis
dbj|BAI23089.1|  sucrose transporter                                    327   5e-108   Plantago rugelii [blackseed plantain]
dbj|BAI23062.1|  sucrose transporter                                    327   5e-108   Plantago australis
dbj|BAI23099.1|  sucrose transporter                                    327   6e-108   Plantago hakusanensis
dbj|BAI23091.1|  sucrose transporter                                    327   6e-108   Plantago spathulata
dbj|BAI23057.1|  sucrose transporter                                    327   8e-108   Plantago palmata
ref|XP_006599448.1|  PREDICTED: sucrose transport protein SUC8-li...    332   8e-108   
dbj|BAI23043.1|  sucrose transporter                                    326   1e-107   Plantago formosana
ref|XP_004289897.1|  PREDICTED: sucrose transport protein SUC2-like     333   2e-107   
dbj|BAI23097.1|  sucrose transporter                                    325   2e-107   Plantago hakusanensis
ref|XP_004290438.1|  PREDICTED: sucrose transport protein SUC2-like     333   2e-107   
dbj|BAI23059.1|  sucrose transporter                                    325   2e-107   Plantago rugelii [blackseed plantain]
dbj|BAI23037.1|  sucrose transporter                                    325   3e-107   Plantago tenuiflora
dbj|BAI23061.1|  sucrose transporter                                    325   3e-107   Plantago australis
ref|XP_006599447.1|  PREDICTED: sucrose transport protein SUC8-li...    333   3e-107   
dbj|BAO02526.1|  predicted sucrose transporter-like protein ortholog    331   4e-107   
gb|AAD34610.1|AF149981_1  sucrose transporter-like protein              333   4e-107   Nicotiana tabacum [American tobacco]
ref|XP_009779331.1|  PREDICTED: sucrose transport protein SUC8-like     333   4e-107   
dbj|BAI23081.1|  sucrose transporter                                    324   6e-107   Plantago rigida
dbj|BAI23054.1|  sucrose transporter                                    324   6e-107   Plantago media [hoary plantain]
dbj|BAI23051.1|  sucrose transporter                                    324   8e-107   Plantago maxima
dbj|BAI23058.1|  sucrose transporter                                    323   1e-106   Plantago reniformis
dbj|BAI23100.1|  sucrose transporter                                    322   3e-106   Plantago media [hoary plantain]
ref|XP_002887396.1|  sucrose-proton symporter 1                         330   4e-106   
dbj|BAI23053.1|  sucrose transporter                                    322   5e-106   Plantago media [hoary plantain]
dbj|BAI23055.1|  sucrose transporter                                    322   6e-106   Plantago media [hoary plantain]
ref|XP_001768298.1|  predicted protein                                  329   7e-106   
dbj|BAI23056.1|  sucrose transporter                                    321   7e-106   Plantago palmata
dbj|BAI23085.1|  sucrose transporter                                    321   1e-105   Plantago rigida
dbj|BAI23036.1|  sucrose transporter                                    320   2e-105   Plantago tenuiflora
dbj|BAI23030.1|  sucrose transporter                                    320   2e-105   Plantago alpina
dbj|BAI23032.1|  sucrose transporter                                    320   2e-105   Plantago maritima [goose tongue]
gb|ABK60190.2|  sucrose transporter 3                                   329   2e-105   Hevea brasiliensis [jebe]
emb|CAM34330.1|  sucrose transporter 6                                  329   2e-105   Hevea brasiliensis [jebe]
dbj|BAI23031.1|  sucrose transporter                                    320   2e-105   Plantago alpina
ref|XP_007020260.1|  Sucrose-proton symporter 2 isoform 2               329   4e-105   
gb|AHH34922.1|  sucrose transporter 1 isoform 2                         328   4e-105   
ref|XP_007020259.1|  Sucrose-proton symporter 2 isoform 1               329   5e-105   
ref|XP_001766981.1|  predicted protein                                  326   1e-104   
gb|AAL32020.1|  sucrose transporter                                     324   2e-104   Vitis vinifera
gb|AHH34921.1|  sucrose transporter 1 isoform 1                         327   2e-104   
ref|XP_010675270.1|  PREDICTED: sucrose transport protein SUC2-like     325   3e-104   
ref|XP_001777456.1|  predicted protein                                  325   3e-104   
ref|XP_003518345.1|  PREDICTED: sucrose transport protein SUC8-like     322   5e-103   
ref|XP_002885931.1|  hypothetical protein ARALYDRAFT_319456             318   6e-103   
gb|ACJ85843.1|  unknown                                                 312   2e-102   Medicago truncatula
ref|XP_001777654.1|  predicted protein                                  320   3e-102   
ref|XP_006392336.1|  hypothetical protein EUTSA_v10023799mg             318   1e-101   
gb|ABB30163.2|  sucrose transport protein SUF1                          316   1e-100   Pisum sativum [garden pea]
dbj|BAB78696.1|  sucrose transporter                                    306   2e-99    Nicotiana tabacum [American tobacco]
emb|CDY45308.1|  BnaA03g52810D                                          310   9e-99    
gb|ABK60191.1|  sucrose transporter 4                                   310   2e-98    Hevea brasiliensis [jebe]
ref|XP_002988479.1|  hypothetical protein SELMODRAFT_269407             310   2e-98    
gb|AAU21439.1|  putative sucrose carrier                                308   1e-97    Ricinus communis
ref|XP_002510005.1|  sucrose transport protein, putative                308   1e-97    Ricinus communis
emb|CAD29832.1|  sucrose transporter                                    300   2e-97    Viscum album subsp. album
ref|XP_003615400.1|  Sucrose transport protein                          307   2e-97    
ref|XP_002978870.1|  hypothetical protein SELMODRAFT_177267             308   3e-97    
gb|KHG09278.1|  Sucrose transport SUC4 -like protein                    307   4e-97    
ref|XP_006852724.1|  hypothetical protein AMTR_s00033p00073720          307   4e-97    
gb|AFS33111.1|  SUF4b                                                   305   1e-96    
gb|ABB30162.2|  sucrose transport protein SUF4                          305   1e-96    
ref|XP_010553671.1|  PREDICTED: sucrose transport protein SUC4-like     305   2e-96    
gb|ABA08443.1|  sucrose transporter type 4                              305   2e-96    
gb|EYU34230.1|  hypothetical protein MIMGU_mgv1a005175mg                305   2e-96    
ref|XP_002973765.1|  hypothetical protein SELMODRAFT_232150             304   5e-96    
gb|KGN62782.1|  hypothetical protein Csa_2G372770                       303   5e-96    
gb|ADW94617.1|  sucrose transporter 4                                   304   7e-96    
ref|XP_002975813.1|  hypothetical protein SELMODRAFT_232600             303   9e-96    
gb|KDO81345.1|  hypothetical protein CISIN_1g010639mg                   301   2e-95    
gb|KDO81344.1|  hypothetical protein CISIN_1g010639mg                   301   2e-95    
gb|KHN00701.1|  Sucrose transport protein SUC2                          300   2e-95    
ref|XP_002961568.1|  hypothetical protein SELMODRAFT_76990              303   2e-95    
ref|XP_004148402.1|  PREDICTED: sucrose transport protein SUC4-like     302   3e-95    
gb|ABK60189.1|  sucrose transporter 5                                   301   4e-95    
gb|ADB04246.1|  sucrose transporter                                     301   5e-95    
gb|KFK43298.1|  hypothetical protein AALP_AA1G105900                    301   6e-95    
ref|XP_010939304.1|  PREDICTED: sucrose transport protein SUT2-like     301   6e-95    
ref|XP_011016949.1|  PREDICTED: sucrose transport protein SUC4          301   6e-95    
ref|XP_006472375.1|  PREDICTED: sucrose transport protein SUC4-li...    301   7e-95    
gb|KDO81342.1|  hypothetical protein CISIN_1g010639mg                   301   8e-95    
emb|CDY62732.1|  BnaC05g49240D                                          301   8e-95    
ref|XP_010543261.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    301   8e-95    
gb|AAB60751.1|  Similar to Vicia sucrose transport protein (gb|Z9...    300   9e-95    
ref|XP_007018362.1|  Sucrose proton symporter                           301   1e-94    
ref|XP_010695439.1|  PREDICTED: sucrose transport protein SUC4          301   1e-94    
gb|KHG28870.1|  Sucrose transport SUC4 -like protein                    300   2e-94    
ref|XP_006851036.1|  hypothetical protein AMTR_s00025p00229310          298   2e-94    
ref|NP_172467.1|  sucrose transporter 4                                 300   2e-94    
ref|XP_004490500.1|  PREDICTED: sucrose transport protein SUC4-li...    299   4e-94    
gb|EYU22863.1|  hypothetical protein MIMGU_mgv1a023262mg                297   4e-94    
ref|XP_008357583.1|  PREDICTED: sucrose transport protein SUC4-like     298   5e-94    
ref|XP_009335489.1|  PREDICTED: sucrose transport protein SUC4-like     298   6e-94    
ref|NP_001284446.1|  sucrose transport protein SUC4                     298   6e-94    
ref|XP_010544043.1|  PREDICTED: sucrose transport protein SUC4-like     298   6e-94    
gb|KDP41540.1|  hypothetical protein JCGZ_15947                         298   6e-94    
ref|XP_006417511.1|  hypothetical protein EUTSA_v10007390mg             296   8e-94    
ref|XP_002978868.1|  hypothetical protein SELMODRAFT_109895             298   8e-94    
gb|AAG09191.1|AF175321_1  sucrose transporter SUT4                      298   9e-94    
ref|XP_002988481.1|  hypothetical protein SELMODRAFT_183916             298   1e-93    
emb|CAG70682.1|  putative sucrose-H+ symporter                          298   1e-93    
ref|XP_008444969.1|  PREDICTED: sucrose transport protein SUC4 is...    298   1e-93    
gb|AFO84089.1|  sucrose transport protein                               297   1e-93    
ref|XP_009148315.1|  PREDICTED: sucrose transport protein SUC4          298   1e-93    
emb|CDX93458.1|  BnaA06g05900D                                          298   2e-93    
ref|XP_003523764.1|  PREDICTED: sucrose transport protein SUC4-li...    298   2e-93    
gb|AHG94615.1|  sucrose transporter                                     297   3e-93    
ref|XP_007223388.1|  hypothetical protein PRUPE_ppa004620mg             296   3e-93    
ref|XP_007137288.1|  hypothetical protein PHAVU_009G114700g             295   3e-93    
gb|AFM28289.1|  SUT4-2                                                  296   3e-93    
ref|XP_008219162.1|  PREDICTED: sucrose transport protein SUC4          296   5e-93    
emb|CAD61275.1|  sucrose transporter 4 protein                          296   5e-93    
ref|XP_002889777.1|  sucrose transporter SUT4                           296   7e-93    
ref|XP_010271544.1|  PREDICTED: sucrose transport protein SUC4          296   8e-93    
gb|AGO64129.1|  sucrose transporter                                     295   1e-92    
ref|XP_009615003.1|  PREDICTED: sucrose transport protein SUC4-li...    294   1e-92    
ref|XP_006417508.1|  hypothetical protein EUTSA_v10007390mg             295   1e-92    
ref|XP_009357240.1|  PREDICTED: sucrose transport protein SUC4-like     295   1e-92    
ref|XP_008339011.1|  PREDICTED: sucrose transport protein SUC4-like     294   2e-92    
ref|XP_009615002.1|  PREDICTED: sucrose transport protein SUC4-li...    294   4e-92    
dbj|BAI60050.1|  sucrose transporter                                    294   4e-92    
ref|XP_009765486.1|  PREDICTED: sucrose transport protein SUC4-li...    293   5e-92    
ref|XP_010664062.1|  PREDICTED: sucrose transporter-like isoform X1     293   7e-92    
ref|XP_004299838.1|  PREDICTED: sucrose transport protein SUC4-li...    293   7e-92    
ref|XP_009629211.1|  PREDICTED: sucrose transport protein SUC4-li...    291   9e-92    
ref|XP_009138292.1|  PREDICTED: sucrose transport protein SUC1-like     292   1e-91    
ref|XP_010490497.1|  PREDICTED: sucrose transport protein SUC4          293   1e-91    
ref|XP_010475856.1|  PREDICTED: sucrose transport protein SUC4-like     293   1e-91    
ref|XP_009392956.1|  PREDICTED: sucrose transport protein SUT2          293   2e-91    
gb|AAD55269.1|AF182445_1  sucrose transporter                           292   2e-91    
dbj|BAO96215.1|  sucrose transporter 4                                  292   2e-91    
ref|XP_009629206.1|  PREDICTED: sucrose transport protein SUC4-li...    292   2e-91    
ref|XP_009765485.1|  PREDICTED: sucrose transport protein SUC4-li...    292   2e-91    
ref|NP_001234344.1|  sucrose transporter                                292   2e-91    
ref|XP_010458319.1|  PREDICTED: sucrose transport protein SUC4-like     292   3e-91    
ref|XP_002971245.1|  hypothetical protein SELMODRAFT_94770              292   3e-91    
ref|NP_001280809.1|  sucrose transport protein SUC4-like                291   3e-91    
ref|XP_010060140.1|  PREDICTED: sucrose transport protein SUC4          291   7e-91    
ref|XP_004299837.1|  PREDICTED: sucrose transport protein SUC4-li...    293   2e-90    
ref|XP_006307275.1|  hypothetical protein CARUB_v10008890mg             290   2e-90    
ref|XP_009792133.1|  PREDICTED: sucrose transport protein SUC4-like     289   3e-90    
emb|CDP00966.1|  unnamed protein product                                289   4e-90    
gb|ABF06450.1|  putative sucrose transport protein SUT1                 277   6e-90    
emb|CDY53828.1|  BnaA09g57200D                                          288   9e-90    
emb|CDY22612.1|  BnaC08g42460D                                          288   1e-89    
gb|EPS65755.1|  sucrose transporter                                     286   1e-89    
ref|NP_001268066.1|  sucrose transporter-like                           287   1e-89    
ref|XP_009118285.1|  PREDICTED: sucrose transport protein SUC4-like     287   2e-89    
ref|XP_008790395.1|  PREDICTED: sucrose transport protein SUT2-li...    284   1e-88    
ref|XP_008790396.1|  PREDICTED: sucrose transport protein SUT2-li...    284   1e-88    
ref|XP_008790394.1|  PREDICTED: sucrose transport protein SUT2-li...    284   2e-88    
ref|XP_008790392.1|  PREDICTED: sucrose transport protein SUT2-li...    284   6e-88    
ref|XP_011097239.1|  PREDICTED: sucrose transport protein SUC2-like     283   7e-88    
ref|NP_001275070.1|  sucrose transporter 4                              282   1e-87    
ref|XP_004501070.1|  PREDICTED: sucrose transport protein SUC4-like     282   1e-87    
ref|XP_007141313.1|  hypothetical protein PHAVU_008G185300g             281   3e-87    
gb|ABF06451.1|  putative sucrose transport protein SUT1                 266   5e-86    
gb|AIE90172.1|  sucrose transporter 2A                                  277   2e-85    
ref|XP_010936248.1|  PREDICTED: sucrose transport protein SUT2-like     276   3e-85    
gb|KFK25020.1|  hypothetical protein AALP_AA8G056600                    282   1e-84    
ref|XP_006664797.1|  PREDICTED: sucrose transport protein SUT2-like     275   1e-84    
gb|KFK25021.1|  hypothetical protein AALP_AA8G056600                    281   1e-84    
gb|AIE90174.1|  sucrose transporter 2D                                  274   2e-84    
gb|ABA99632.2|  sucrose/H+ symporter family protein, expressed          271   6e-84    
gb|KDO81341.1|  hypothetical protein CISIN_1g010639mg                   271   2e-83    
ref|XP_003519216.1|  PREDICTED: sucrose transport protein SUC4-li...    271   3e-83    
sp|A2ZN77.2|SUT2_ORYSI  RecName: Full=Sucrose transport protein S...    271   3e-83    
sp|Q0ILJ3.2|SUT2_ORYSJ  RecName: Full=Sucrose transport protein S...    271   3e-83    
ref|XP_007151899.1|  hypothetical protein PHAVU_004G0852000g            260   7e-83    
ref|XP_002443677.1|  hypothetical protein SORBIDRAFT_08g023310          270   7e-83    
gb|ACX71839.1|  sucrose transporter 4                                   269   1e-82    
ref|NP_001137486.1|  sucrose transporter4                               268   2e-82    
tpg|DAA54802.1|  TPA: sucrose transport protein                         268   4e-82    
gb|AAT51689.1|  sucrose transport protein                               268   4e-82    
ref|XP_004963349.1|  PREDICTED: sucrose transport protein SUT2-like     267   8e-82    
gb|ADE22272.1|  sucrose transporter protein                             266   2e-81    
gb|EEE53686.1|  hypothetical protein OsJ_37034                          264   8e-81    
ref|XP_010917013.1|  PREDICTED: sucrose transport protein SUT1 is...    264   1e-80    
gb|AGZ83099.1|  sucrose transporter 4                                   263   2e-80    
emb|CAA76367.1|  sucrose/H+ symporter                                   263   2e-80    
gb|ACO87669.1|  sucrose transport protein                               263   2e-80    
gb|ADY11193.1|  sucrose transporter                                     263   2e-80    
gb|EAY84061.1|  hypothetical protein OsI_39292                          263   3e-80    
ref|XP_003577278.1|  PREDICTED: sucrose transport protein SUT2          263   5e-80    
emb|CDY36888.1|  BnaC08g09590D                                          263   5e-80    
dbj|BAJ93580.1|  predicted protein                                      263   6e-80    
ref|XP_010917011.1|  PREDICTED: sucrose transport protein SUT3 is...    263   1e-79    
emb|CAB75881.1|  sucrose transporter 2                                  261   2e-79    
ref|XP_010917012.1|  PREDICTED: sucrose transport protein SUT1 is...    262   2e-79    
dbj|BAC67163.1|  sucrose transporter                                    261   2e-79    
emb|CDY09350.1|  BnaA02g26600D                                          261   3e-79    
emb|CDY45192.1|  BnaA06g33960D                                          261   4e-79    
gb|AAO38059.1|  sucrose transporter SUC1                                249   1e-78    
ref|XP_009381726.1|  PREDICTED: sucrose transport protein SUT1-like     260   1e-78    
ref|XP_003575214.1|  PREDICTED: sucrose transport protein SUT5-like     258   3e-78    
gb|EMS35632.1|  Sucrose transport protein SUT5                          257   1e-77    
emb|CDY03029.1|  BnaC07g21980D                                          256   2e-77    
emb|CDY41670.1|  BnaC02g34840D                                          256   3e-77    
dbj|BAJ34415.1|  unnamed protein product                                254   1e-76    
gb|EMT11455.1|  Sucrose transport protein SUC3                          254   1e-76    
ref|XP_008797155.1|  PREDICTED: sucrose transport protein SUT1-like     253   4e-76    
gb|EPS58915.1|  hypothetical protein M569_15897                         246   4e-76    
ref|XP_006395753.1|  hypothetical protein EUTSA_v10003879mg             254   5e-76    
ref|XP_002465781.1|  hypothetical protein SORBIDRAFT_01g045720          252   6e-76    
ref|XP_006649472.1|  PREDICTED: sucrose transport protein SUT1-like     251   8e-76    
ref|XP_004143775.1|  PREDICTED: sucrose transport protein SUC3-like     252   5e-75    
ref|XP_008465743.1|  PREDICTED: sucrose transport protein SUC3          252   5e-75    
gb|ABF94214.1|  sucrose transporter, putative, expressed                248   6e-75    
gb|ADK46943.1|  sucrose transporter                                     252   6e-75    
ref|XP_010683228.1|  PREDICTED: sucrose transport protein SUC3          251   8e-75    
gb|AAV41028.1|  sucrose transporter                                     249   9e-75    
ref|XP_004985542.1|  PREDICTED: sucrose transport protein SUT1-like     249   1e-74    
gb|ABF94213.1|  sucrose transporter, putative, expressed                248   1e-74    
ref|XP_004297320.1|  PREDICTED: sucrose transport protein SUC3-li...    251   1e-74    
ref|XP_009129114.1|  PREDICTED: sucrose transport protein SUC3-li...    250   2e-74    
gb|KHN32884.1|  Sucrose transport protein SUC3                          250   2e-74    
ref|XP_006290789.1|  hypothetical protein CARUB_v10016892mg             250   3e-74    
ref|NP_178389.1|  sucrose transport protein SUC3                        249   3e-74    
gb|ACO55747.1|  sucrose transporter                                     248   4e-74    
ref|NP_001104840.1|  sucrose transporter1                               248   4e-74    
gb|EEE58406.1|  hypothetical protein OsJ_09584                          246   5e-74    
ref|NP_001049111.1|  Os03g0170900                                       248   6e-74    
dbj|BAA24071.1|  sucrose transporter                                    247   7e-74    
ref|XP_002876843.1|  hypothetical protein ARALYDRAFT_484195             248   1e-73    
ref|XP_008648004.1|  PREDICTED: sucrose transporter1 isoform X1         246   1e-73    
ref|XP_003558709.1|  PREDICTED: sucrose transport protein SUT1          246   1e-73    
ref|XP_004511224.1|  PREDICTED: sucrose transport protein SUC3-like     248   1e-73    
gb|ABF94212.1|  sucrose transporter, putative, expressed                248   2e-73    
gb|ABX10015.1|  sucrose transporter                                     246   2e-73    
ref|NP_001234321.1|  sucrose transporter-like protein                   248   3e-73    
ref|XP_011075471.1|  PREDICTED: sucrose transport protein SUC3 is...    247   3e-73    
ref|XP_009759496.1|  PREDICTED: sucrose transport protein SUC3 is...    247   3e-73    
ref|XP_007020265.1|  Sucrose transport protein SUC2                     242   4e-73    
ref|XP_007046165.1|  Sucrose transporter 2 isoform 5                    242   4e-73    
ref|XP_003530692.2|  PREDICTED: sucrose transport protein SUC3-like     247   4e-73    
ref|XP_008660500.1|  PREDICTED: sucrose transport protein SUT1-like     245   4e-73    
ref|XP_003573890.1|  PREDICTED: sucrose transport protein SUT3-like     244   5e-73    
ref|XP_007046167.1|  Sucrose transporter 2 isoform 7                    243   5e-73    
gb|KFK33468.1|  hypothetical protein AALP_AA5G017000                    246   5e-73    
ref|XP_006438655.1|  hypothetical protein CICLE_v10030996mg             246   6e-73    
ref|XP_009152233.1|  PREDICTED: sucrose transport protein SUC3 is...    246   8e-73    
ref|NP_001064555.1|  Os10g0404500                                       243   1e-72    
gb|AAT40489.1|  putative sucrose transporter-like protein               246   1e-72    
emb|CAB75882.1|  sucrose transporter 1                                  243   2e-72    
gb|ACY69230.1|  sucrose transporter 1                                   243   2e-72    
gb|ADF28098.1|  sucrose transporter                                     243   2e-72    
gb|KCW86820.1|  hypothetical protein EUGRSUZ_B03418                     244   2e-72    
ref|XP_009593381.1|  PREDICTED: sucrose transport protein SUC3 is...    245   2e-72    
emb|CAJ20123.1|  sucrose transporter 1                                  243   2e-72    
gb|KHG16131.1|  Sucrose transport SUC3 -like protein                    245   2e-72    
gb|KHN06837.1|  Sucrose transport protein SUC3                          250   2e-72    
gb|AAX49396.1|  sucrose transporter 2                                   245   3e-72    
gb|AFO84088.1|  sucrose transport protein                               245   3e-72    
gb|AAM13408.1|AF408842_1  sucrose transporter SUT1A                     242   4e-72    
gb|AAL90455.1|AF408845_1  sucrose transporter SUT1D                     242   4e-72    
ref|XP_007153820.1|  hypothetical protein PHAVU_003G067600g             244   5e-72    
sp|Q944W2.1|SUT3_ORYSI  RecName: Full=Sucrose transport protein S...    242   5e-72    
ref|NP_001141577.1|  uncharacterized protein LOC100273693               242   5e-72    
ref|XP_004986599.1|  PREDICTED: sucrose transport protein SUT3-like     241   6e-72    
gb|AAM13409.1|AF408843_1  sucrose transporter SUT1B                     242   7e-72    
ref|XP_004952871.1|  PREDICTED: sucrose transport protein SUT5-like     241   9e-72    
ref|XP_010044720.1|  PREDICTED: sucrose transport protein SUC3          243   9e-72    
ref|NP_001275773.1|  sucrose transporter 2                              243   1e-71    
gb|ADL14375.1|  sucrose transporter 1                                   241   1e-71    
gb|AFM28287.1|  SUT2                                                    243   1e-71    
gb|KDP41167.1|  hypothetical protein JCGZ_15574                         243   1e-71    
ref|XP_007046163.1|  Sucrose transporter 2 isoform 3                    243   2e-71    
ref|XP_010096375.1|  Sucrose transport protein SUC3                     243   2e-71    
emb|CAD58887.1|  sucrose transporter                                    243   2e-71    
emb|CDP00304.1|  unnamed protein product                                243   2e-71    
ref|XP_007046161.1|  Sucrose transporter 2 isoform 1                    243   2e-71    
ref|XP_010256864.1|  PREDICTED: sucrose transport protein SUC3 is...    242   2e-71    
ref|NP_001275438.1|  sucrose transporter-like protein                   242   3e-71    
ref|XP_001752965.1|  predicted protein                                  239   4e-71    
ref|XP_010527885.1|  PREDICTED: sucrose transport protein SUC3 is...    241   4e-71    
ref|XP_002467275.1|  hypothetical protein SORBIDRAFT_01g022430          239   4e-71    
ref|XP_010256856.1|  PREDICTED: sucrose transport protein SUC3 is...    242   6e-71    
ref|XP_004297321.1|  PREDICTED: sucrose transport protein SUC3-li...    241   7e-71    
ref|XP_010527884.1|  PREDICTED: sucrose transport protein SUC3 is...    241   7e-71    
gb|ABA08446.1|  sucrose transporter type 1                              237   8e-71    
tpg|DAA43619.1|  TPA: hypothetical protein ZEAMMB73_332694              239   9e-71    
gb|ADW94619.1|  sucrose transporter 6                                   241   9e-71    



>gb|ADK62516.1| sucrose transporter 1y [Ipomoea batatas]
Length=503

 Score =   492 bits (1267),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 253/297 (85%), Positives = 267/297 (90%), Gaps = 6/297 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPE----ETPLWKLTVVSAIAAGVQFGWALQLSLLTPY  177
            ME  +SSSSGGGAF+V+Q  +   E    ETPLWK+ VVSAIA GVQFGWALQLSLLTPY
Sbjct  1    MEGASSSSSGGGAFQVQQQQDYSGEGPAGETPLWKMVVVSAIACGVQFGWALQLSLLTPY  60

Query  178  VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVIL  357
            VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFI SGA+LVIFAVIL
Sbjct  61   VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIASGAILVIFAVIL  120

Query  358  IGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKT  537
            IGFAADIGHSTGDPLGK +KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDG KT
Sbjct  121  IGFAADIGHSTGDPLGKESKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGGKT  180

Query  538  RLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIV  717
            RLAN LFSFFMAVGNIGGYAAGAQ TLYKSF FT TDACDVYCANLKSCFIISA+LLL++
Sbjct  181  RLANALFSFFMAVGNIGGYAAGAQPTLYKSFPFTHTDACDVYCANLKSCFIISAVLLLVI  240

Query  718  TAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            T  AVTCV E+ YT+K +EG  G VPF GEL GAFKNLPRPMLILL+VTALNWIAWF
Sbjct  241  TTAAVTCVGEIPYTKKKMEG--GGVPFFGELFGAFKNLPRPMLILLLVTALNWIAWF  295



>gb|ADL63119.1| sucrose transporter 1x [Ipomoea batatas]
Length=503

 Score =   481 bits (1239),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/297 (84%), Positives = 264/297 (89%), Gaps = 6/297 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPE----ETPLWKLTVVSAIAAGVQFGWALQLSLLTPY  177
            ME  +SSSSGGGAF+V+Q  +   E    E PLWK+ VVSAIA GVQFGWALQLSLLTPY
Sbjct  1    MEGASSSSSGGGAFQVQQQKDYSGEGPAGEIPLWKIVVVSAIACGVQFGWALQLSLLTPY  60

Query  178  VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVIL  357
            VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCT+RFGRRRPFI SGA+LVIFAVIL
Sbjct  61   VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTSRFGRRRPFIASGAILVIFAVIL  120

Query  358  IGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKT  537
            IGFAADIGHSTGDPLGK +KPRA V+FIVGFWILDVANNMLQGPCRALLADLS GDG KT
Sbjct  121  IGFAADIGHSTGDPLGKESKPRAIVMFIVGFWILDVANNMLQGPCRALLADLSCGDGGKT  180

Query  538  RLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIV  717
            RLAN LFSFFMAVGNIGGYAAGAQ TLYKSF FT TDACDVYCANLKSCFIISAILLL++
Sbjct  181  RLANALFSFFMAVGNIGGYAAGAQPTLYKSFPFTHTDACDVYCANLKSCFIISAILLLVI  240

Query  718  TAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            T  AVTCV E+ YT+K +EG  G VPF GEL GAFKNLPRPMLILL+VTALNWIAWF
Sbjct  241  TTAAVTCVGEIPYTKKKMEG--GGVPFFGELFGAFKNLPRPMLILLLVTALNWIAWF  295



>gb|ADL63118.1| sucrose transporter 1x [Ipomoea batatas]
Length=503

 Score =   481 bits (1237),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/297 (84%), Positives = 264/297 (89%), Gaps = 6/297 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPE----ETPLWKLTVVSAIAAGVQFGWALQLSLLTPY  177
            ME  +SSSSGGGAF+V+Q  +   E    E PLWK+ VVSAIA GVQFGWALQLSLLTPY
Sbjct  1    MEGASSSSSGGGAFQVQQQKDYSGEGPAGEIPLWKIVVVSAIACGVQFGWALQLSLLTPY  60

Query  178  VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVIL  357
            VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCT+RFGRRRPFI SGA+LVIFAVIL
Sbjct  61   VQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTSRFGRRRPFIASGAILVIFAVIL  120

Query  358  IGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKT  537
            IGFAADIGHSTGDPLGK +KPRA V+FIVGFWILDVANNMLQGPCRALLADLS GDG KT
Sbjct  121  IGFAADIGHSTGDPLGKESKPRAIVMFIVGFWILDVANNMLQGPCRALLADLSCGDGGKT  180

Query  538  RLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIV  717
            RLAN LFSFFMAVGNIGGYAAGAQ TLYKSF FT TDACDVYCANLKSCFIISA+LLL++
Sbjct  181  RLANALFSFFMAVGNIGGYAAGAQPTLYKSFPFTHTDACDVYCANLKSCFIISAVLLLVI  240

Query  718  TAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            T  AVTCV E+ YT+K +EG  G VPF GEL GAFKNLPRPMLILL+VTALNWIAWF
Sbjct  241  TTAAVTCVGEIPYTKKKMEG--GGVPFFGELFGAFKNLPRPMLILLLVTALNWIAWF  295



>gb|ADL63117.1| sucrose transporter 2y [Ipomoea batatas]
 gb|ADL63121.1| sucrose transporter 2y [Ipomoea batatas]
Length=521

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 238/305 (78%), Gaps = 13/305 (4%)
 Frame = +1

Query  10   MEVGT--SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME G   +  +   + +V Q   A P +T LWK+ +V+AIAAGVQFGWA+QLSLLTPYVQ
Sbjct  1    MENGAMKTKQTNKSSLQVHQAAAA-PPQTRLWKIIMVAAIAAGVQFGWAIQLSLLTPYVQ  59

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGI H+++ LIWLCGPISG+IVQP+VGYYSDNCT+RFGRRRPFI +GA LV  AV LIG
Sbjct  60   LLGIKHQYAPLIWLCGPISGMIVQPMVGYYSDNCTSRFGRRRPFIAAGASLVTIAVFLIG  119

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            FAADIGH++GDP+GKV KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   + R 
Sbjct  120  FAADIGHASGDPVGKVIKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGRAKRMRT  179

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN+ FSFFMA+GNI GYAAG+ S+L+K F F+ T ACDVYCANLKSCF ISA LLL VT 
Sbjct  180  ANSFFSFFMAIGNILGYAAGSWSSLHKVFPFSNTKACDVYCANLKSCFFISAALLLSVTT  239

Query  724  VAVTCVSEVQYTRKAVEG----------EEGKVPFVGELLGAFKNLPRPMLILLIVTALN  873
            +A++ VSE + +++  E           E+ K+PF GE+ GA ++LPR M ILL+VT LN
Sbjct  240  LALSTVSEQELSKEVDEADDPDDEKLPTEKSKLPFFGEIFGALRDLPRSMWILLLVTCLN  299

Query  874  WIAWF  888
            WIAWF
Sbjct  300  WIAWF  304



>gb|ADL63115.1| sucrose transporter 3 [Ipomoea batatas]
Length=268

 Score =   389 bits (999),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 210/257 (82%), Gaps = 4/257 (2%)
 Frame = +1

Query  130  GVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRR  309
            GVQFGWALQLSLLTPYVQLLGIPHKF+S +WLCGP+SG+IVQPLVGYYSDNCT RFGRRR
Sbjct  1    GVQFGWALQLSLLTPYVQLLGIPHKFASFMWLCGPVSGMIVQPLVGYYSDNCTWRFGRRR  60

Query  310  PFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGP  489
            PFI SGALLVIFAV LIGFAADIGH+ GD L K TKPRA  +F+VGFWILDVANNMLQGP
Sbjct  61   PFIASGALLVIFAVFLIGFAADIGHAAGDRLDKTTKPRAVTVFVVGFWILDVANNMLQGP  120

Query  490  CRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCA  669
            CRALLADLSGG   K R +N LFSFFMAVGNI GYAAG+ S LYK F F+ T ACD YCA
Sbjct  121  CRALLADLSGGSADKMRASNALFSFFMAVGNILGYAAGSYSHLYKVFPFSKTKACDPYCA  180

Query  670  NLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK----VPFVGELLGAFKNLPR  837
            NLKSCF IS  LLL VT +A+T V E +    A  GE+ +    VPF GE+ GA K+LPR
Sbjct  181  NLKSCFFISVALLLTVTTMALTFVKEQELKDAADGGEKAQKGKGVPFFGEIFGALKDLPR  240

Query  838  PMLILLIVTALNWIAWF  888
            PM ILL+VTALNWIAWF
Sbjct  241  PMWILLLVTALNWIAWF  257



>gb|ADL63120.1| sucrose transporter 2x [Ipomoea batatas]
Length=520

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 226/277 (82%), Gaps = 10/277 (4%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            T LWK+ +V+AIAAGVQFGWA+QLSLLTPYVQLLGI H+++ LIWLCGPISG+IVQP+VG
Sbjct  27   TRLWKIIMVAAIAAGVQFGWAIQLSLLTPYVQLLGIKHQYAPLIWLCGPISGMIVQPMVG  86

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            YYSDNCT+RFGRRRPFI +GA LV  AV LIGFAADIGH++GDP+GKV KPRA  +F+VG
Sbjct  87   YYSDNCTSRFGRRRPFIAAGASLVTIAVFLIGFAADIGHASGDPVGKVIKPRAIAVFVVG  146

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANNMLQGPCRALLADLSGG   + R AN+ FSFFMA+GNI GYAAG+ S+L+K 
Sbjct  147  FWILDVANNMLQGPCRALLADLSGGRAKRMRTANSFFSFFMAIGNILGYAAGSWSSLHKV  206

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEG----------  777
            F F+ T ACDVYCANLKSCF ISA LLL VT +A++ VSE + +++  E           
Sbjct  207  FPFSNTKACDVYCANLKSCFFISAALLLSVTTLALSTVSEQELSKEVDEADDPDDEKLPT  266

Query  778  EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E+ K+PF GE+ GA ++LPR M ILL+VT LNWIAWF
Sbjct  267  EKSKLPFFGEIFGALRDLPRSMWILLLVTCLNWIAWF  303



>ref|XP_009777676.1| PREDICTED: sucrose transport protein-like [Nicotiana sylvestris]
 dbj|BAO47334.1| sucrose transporter [Nicotiana tabacum]
Length=510

 Score =   393 bits (1010),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 233/301 (77%), Gaps = 12/301 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME GT   +   +  VEQ L     ++ LWK+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MENGTKKLNNVSSLAVEQPLP----KSKLWKIIMVASIAAGVQFGWALQLSLLTPYVQLL  56

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHKF+S IWLCGPISG+IVQP+VGYYSDNCT+RFGRRRPFI +GA LV  AV LIGFA
Sbjct  57   GIPHKFASFIWLCGPISGMIVQPVVGYYSDNCTSRFGRRRPFIAAGAALVTIAVFLIGFA  116

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GHS+GDPLGK +KPRA  +F+VGFW+LDVANNMLQGPCRALLADLSGG   + R AN
Sbjct  117  ADLGHSSGDPLGKGSKPRAIAVFVVGFWVLDVANNMLQGPCRALLADLSGGKAGRMRTAN  176

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ S LYK F F+ T ACD+YCANLKSCF I+  LLL +T +A
Sbjct  177  AFFSFFMAVGNVLGYAAGSYSRLYKIFPFSKTPACDIYCANLKSCFFIAVFLLLSLTTLA  236

Query  730  VTCV--------SEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAW  885
            +T V         E +   KA  G + KVPF GE+ GA K+LPRPM ILL+VT LNWIAW
Sbjct  237  LTVVRENELPEKDEQEIDEKAAAGGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIAW  296

Query  886  F  888
            F
Sbjct  297  F  297



>emb|CAA48915.1| sucrose transport protein [Solanum tuberosum]
Length=516

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 230/306 (75%), Gaps = 17/306 (6%)
 Frame = +1

Query  10   MEVGTSSSSGG-----GAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTP  174
            ME GT     G      + +VEQ L      + LWK+ VV++IAAGVQFGWALQLSLLTP
Sbjct  1    MENGTKREGLGKLTVSSSLQVEQPLA----PSKLWKIIVVASIAAGVQFGWALQLSLLTP  56

Query  175  YVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVI  354
            YVQLLGIPHKF+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRRPFI +GA LV+ AV 
Sbjct  57   YVQLLGIPHKFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVMIAVF  116

Query  355  LIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSK  534
            LIGFAAD+GH++GD LGK  KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   +
Sbjct  117  LIGFAADLGHASGDTLGKGFKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKSGR  176

Query  535  TRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLI  714
             R AN  FSFFMAVGNI GYAAG+ S L+K F F+ T ACD+YCANLKSCF I+  LLL 
Sbjct  177  MRTANAFFSFFMAVGNILGYAAGSYSHLFKVFPFSKTKACDMYCANLKSCFFIAIFLLLS  236

Query  715  VTAVAVTCVSEVQYTRKAVE--------GEEGKVPFVGELLGAFKNLPRPMLILLIVTAL  870
            +T +A+T V E +   K  +          + KVPF GE+ GA K LPRPM ILL+VT L
Sbjct  237  LTTIALTLVRENELPEKDEQEIDEKLAGAGKSKVPFFGEIFGALKELPRPMWILLLVTCL  296

Query  871  NWIAWF  888
            NWIAWF
Sbjct  297  NWIAWF  302



>ref|XP_006351170.1| PREDICTED: sucrose transport protein-like [Solanum tuberosum]
Length=515

 Score =   392 bits (1006),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 231/306 (75%), Gaps = 17/306 (6%)
 Frame = +1

Query  10   MEVGTSSSSGG-----GAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTP  174
            ME GT     G      + +VEQ L      + LWK+ VV++IAAGVQFGWALQLSLLTP
Sbjct  1    MENGTKREGLGKLTVSSSLQVEQPLA----PSKLWKIIVVASIAAGVQFGWALQLSLLTP  56

Query  175  YVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVI  354
            YVQLLGIPH+F+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRRPFI +GA LV+ AV 
Sbjct  57   YVQLLGIPHRFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVMIAVF  116

Query  355  LIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSK  534
            LIGFAAD+GH++GD LGK  KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   +
Sbjct  117  LIGFAADLGHASGDTLGKGFKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKSGR  176

Query  535  TRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLI  714
             R AN  FSFFMAVGNI GYAAG+ S L+K F F+ T ACD+YCANLKSCF I+  LLL 
Sbjct  177  MRTANAFFSFFMAVGNILGYAAGSYSHLFKVFPFSKTKACDMYCANLKSCFFIAIFLLLS  236

Query  715  VTAVAVTCVSEVQYTRKAVE--------GEEGKVPFVGELLGAFKNLPRPMLILLIVTAL  870
            +T +A+T V E +   K  +          + KVPF GE+ GA K+LPRPM ILL+VT L
Sbjct  237  LTTIALTLVRENELPEKDEQEIDEKLAGAGKSKVPFFGEIFGALKDLPRPMWILLLVTCL  296

Query  871  NWIAWF  888
            NWIAWF
Sbjct  297  NWIAWF  302



>emb|CAQ58420.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 233/301 (77%), Gaps = 13/301 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME GT   +   +  VEQ L     ++ LWK+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MENGTKKLNVS-SLAVEQPLP----KSKLWKIIMVASIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHKF+S IWLCGPISG+IVQP+VGYYSDNCT+RFGRRRPFI +GA LV  AV LIGFA
Sbjct  56   GIPHKFASFIWLCGPISGMIVQPVVGYYSDNCTSRFGRRRPFIAAGAALVTIAVFLIGFA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GHS+GDPLGK +KPRA  +F+VGFW+LDVANNMLQGPCRALLADLSGG   + R AN
Sbjct  116  ADLGHSSGDPLGKGSKPRAIAVFVVGFWVLDVANNMLQGPCRALLADLSGGKAGRMRTAN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ S LYK F F+ T ACD+YCANLKSCF I+  LLL +T +A
Sbjct  176  AFFSFFMAVGNVLGYAAGSYSRLYKIFPFSKTPACDIYCANLKSCFFIAVFLLLSLTTLA  235

Query  730  VTCV--------SEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAW  885
            +T V         E +   KA  G + KVPF GE+ GA K+LPRPM ILL+VT LNWIAW
Sbjct  236  LTVVRENELPEKDEQEIDEKAAAGGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIAW  295

Query  886  F  888
            F
Sbjct  296  F  296



>emb|CAQ58421.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 233/301 (77%), Gaps = 13/301 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME GT   +   +  VEQ L     ++ LWK+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MENGTKKLNVS-SLAVEQPLP----KSKLWKIIMVASIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHKF+S IWLCGPISG+IVQP+VGYYSDNCT+RFGRRRPFI +GA LV  AV LIGFA
Sbjct  56   GIPHKFASFIWLCGPISGMIVQPVVGYYSDNCTSRFGRRRPFIAAGAALVTIAVFLIGFA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GHS+GDPLGK +KPRA  +F+VGFW+LDVANNMLQGPCRALLADLSGG   + R AN
Sbjct  116  ADLGHSSGDPLGKGSKPRAIAVFVVGFWVLDVANNMLQGPCRALLADLSGGKAGRMRTAN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ S LYK F F+ T ACD+YCANLKSCF I+  LLL +T +A
Sbjct  176  AFFSFFMAVGNVLGYAAGSYSRLYKIFPFSKTPACDIYCANLKSCFFIAVFLLLSLTTLA  235

Query  730  VTCVSE--------VQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAW  885
            +T V E         +   KA  G + KVPF GE+ GA K+LPRPM ILL+VT LNWIAW
Sbjct  236  LTVVRENELPEKDDQEIDEKAAAGGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIAW  295

Query  886  F  888
            F
Sbjct  296  F  296



>ref|XP_009630281.1| PREDICTED: sucrose transport protein-like [Nicotiana tomentosiformis]
 emb|CAM33257.1| sucrose transporter [Nicotiana tabacum]
 dbj|BAO47333.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 198/301 (66%), Positives = 233/301 (77%), Gaps = 13/301 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME GT   +   +  VEQ L     ++ LWK+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MENGTKKLNVS-SLAVEQPLP----KSKLWKIIMVASIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHKF+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRRPFI +GA LV  AV LIGFA
Sbjct  56   GIPHKFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVTIAVFLIGFA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH++GDPLGK +KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   + R +N
Sbjct  116  ADLGHASGDPLGKGSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKAGRMRTSN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ S LYK F F+ T ACD+YCANLKSCF I+  LLL +T +A
Sbjct  176  AFFSFFMAVGNVLGYAAGSYSRLYKIFPFSKTPACDIYCANLKSCFFIAVFLLLSLTILA  235

Query  730  VTCV--------SEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAW  885
            +T V         E +   KA  G + KVPF GE+ GA K+LPRPM ILL+VT LNWIAW
Sbjct  236  LTVVRENELPEKDEHEIDEKAGGGGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIAW  295

Query  886  F  888
            F
Sbjct  296  F  296



>gb|AAD53000.1|U64967_1 sucrose-proton symporter [Beta vulgaris]
Length=539

 Score =   387 bits (993),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 225/292 (77%), Gaps = 9/292 (3%)
 Frame = +1

Query  40   GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLI  219
            G +  +E++  + PE + L KL +V++IAAGVQFGWALQLSLLTPYVQLLGIPH ++  I
Sbjct  18   GSSLSIEKNPISPPEASSLKKLALVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAPYI  77

Query  220  WLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDP  399
            WLCGPISG+IVQP VGYYSD CT++FGRR PFI  GA LV FAV LIGFAADIGH+TGDP
Sbjct  78   WLCGPISGMIVQPTVGYYSDRCTSKFGRRSPFIAVGATLVGFAVSLIGFAADIGHATGDP  137

Query  400  LGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVG  579
             G V KPRA  +F+VGFWILDVANN LQGPCRALLAD++ G  +KTR AN  FSFFMA+G
Sbjct  138  NGNVPKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQAKTRYANAFFSFFMALG  197

Query  580  NIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT  759
            NIGGYAAG+ S LY  F FT T ACD YCANLKSCF IS  LL+++T +A++ V E  +T
Sbjct  198  NIGGYAAGSYSRLYTVFPFTHTKACDTYCANLKSCFFISITLLIVLTILALSVVRERPFT  257

Query  760  RKAVEGEE---------GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               ++ EE          ++PF G+L GA K+LP+PMLILL+VT LNWIAWF
Sbjct  258  LDEIQEEENLKNNTGGCARLPFFGQLFGALKDLPKPMLILLLVTCLNWIAWF  309



>emb|CAQ58422.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 232/301 (77%), Gaps = 13/301 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME GT   +   +  VEQ L     ++ LWK+ +V++IAAGVQFGW LQLSLLTPYVQLL
Sbjct  1    MENGTKKLNVS-SLAVEQPLP----KSKLWKIIMVASIAAGVQFGWVLQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHKF+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRRPFI +GA LV  AV LIGFA
Sbjct  56   GIPHKFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVTIAVFLIGFA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH++GDPLGK +KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   + R +N
Sbjct  116  ADLGHASGDPLGKGSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKAGRMRTSN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ S LYK F F+ T ACD+YCANLKSCF I+  LLL +T +A
Sbjct  176  AFFSFFMAVGNVLGYAAGSYSRLYKIFPFSKTPACDIYCANLKSCFFIAVFLLLSLTILA  235

Query  730  VTCV--------SEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAW  885
            +T V         E +   KA  G + KVPF GE+ GA K+LPRPM ILL+VT LNWIAW
Sbjct  236  LTVVRENELPEKDEHEIDEKAGGGGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIAW  295

Query  886  F  888
            F
Sbjct  296  F  296



>ref|XP_011097249.1| PREDICTED: sucrose transport protein SUC2-like [Sesamum indicum]
Length=506

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 230/297 (77%), Gaps = 7/297 (2%)
 Frame = +1

Query  10   MEVGTS-SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQL  186
            MEVG    ++   +F+++Q     P E PL K+ +V+AIAAGVQFGWALQLSLLTPYVQL
Sbjct  1    MEVGGEVKNNAPSSFQLQQ--PPTPAE-PLRKIILVAAIAAGVQFGWALQLSLLTPYVQL  57

Query  187  LGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGF  366
            LGIPH +++ IWLCGPISGL+VQP+VGYYSDNCT+RFGRRRPFI +GA LV  AV LIGF
Sbjct  58   LGIPHAWAAFIWLCGPISGLLVQPIVGYYSDNCTSRFGRRRPFITAGAGLVAVAVFLIGF  117

Query  367  AADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLA  546
            AAD+GH+ GD LGK  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSGG+  K   A
Sbjct  118  AADLGHAAGDSLGKGPKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGGNARKMSTA  177

Query  547  NTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAV  726
            N LFSFFMAVGN+ GYAAG+ ++LYK F F+ T+ACD+YCANLKSCF IS  LLL +T +
Sbjct  178  NALFSFFMAVGNVLGYAAGSYTSLYKIFPFSKTEACDLYCANLKSCFFISIALLLTMTVL  237

Query  727  AVTCVSEV---QYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            A+T V E        +    ++GK+P  GEL GA K+LPR M ILL+VT LNW+AWF
Sbjct  238  ALTIVRETAPAAAPEQTAVAKKGKIPVFGELFGALKDLPRTMWILLLVTCLNWVAWF  294



>gb|KFK41606.1| hypothetical protein AALP_AA2G150200 [Arabis alpina]
Length=512

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 227/291 (78%), Gaps = 6/291 (2%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            +++G  A E +   E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  9    AANGTAALETQSSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKW  68

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            SSLIWLCGP+SG+IVQP+VGYYSD CT+RFGRRRPFI SGA LV  AV LIG+AAD+GH 
Sbjct  69   SSLIWLCGPVSGMIVQPIVGYYSDRCTSRFGRRRPFIASGAFLVAVAVFLIGYAADLGHK  128

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L    + RA  IF +GFWILDVANN LQGPCRA LADL+GGD  KTR+AN+ FSFF
Sbjct  129  MGDKLEATPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAGGDAKKTRVANSFFSFF  188

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  ++  V++
Sbjct  189  MAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVND  248

Query  748  VQYTRKAVEGEEGK----VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             Q++     GE+G+    VPF GE+ GAF+ + RPM +LLIVTALNWIAWF
Sbjct  249  KQWS--PAPGEDGEKAPSVPFFGEIFGAFRVMQRPMWMLLIVTALNWIAWF  297



>gb|AAF04294.1|AF191024_1 sucrose transporter 1 [Asarina barclaiana]
Length=510

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 227/296 (77%), Gaps = 7/296 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME G   ++   AF+++Q   + PE  P+  + +V+AIAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MENGDHRTAP--AFQLQQ--ASPPEAAPVRNIILVAAIAAGVQFGWALQLSLLTPYVQLL  56

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPH +++ IWLCGP+SG++VQP+VGYYSDNCT RFGRR+PFI  GA LV+ AV LIGFA
Sbjct  57   GIPHTWTAFIWLCGPVSGMLVQPIVGYYSDNCTLRFGRRKPFIAGGAGLVVVAVFLIGFA  116

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIG++ GD LGK TKPRAT +F+VGFWILDVANNMLQGPCRALLADLSGG+  K   AN
Sbjct  117  ADIGYAAGDTLGKGTKPRATAVFVVGFWILDVANNMLQGPCRALLADLSGGNARKMSNAN  176

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             L+SFFMAVGN+ GYAAG+ + L+K F F+ T ACDVYCANLKSCF IS  LLL V+A+A
Sbjct  177  ALYSFFMAVGNVSGYAAGSYTHLFKIFPFSKTKACDVYCANLKSCFFISVALLLCVSALA  236

Query  730  VTCVSEVQYTRKAVEGE---EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +T V E      A   E   + K+P  GEL  A KNLPRPM  LL+V  LNWIAWF
Sbjct  237  LTIVRETPPPETAEAPEATKKKKIPVFGELFSALKNLPRPMWFLLLVACLNWIAWF  292



>ref|NP_001289830.1| sucrose transport protein [Solanum lycopersicum]
 dbj|BAO96213.1| sucrose transporter 1 [Solanum lycopersicum]
Length=511

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 234/302 (77%), Gaps = 13/302 (4%)
 Frame = +1

Query  10   MEVGTSSS-SGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQL  186
            ME GT    +   + ++EQ L      + LWK+ VV++IAAGVQFGWALQLSLLTPYVQL
Sbjct  1    MENGTKGKLTVSSSLQIEQPLP----PSKLWKIIVVASIAAGVQFGWALQLSLLTPYVQL  56

Query  187  LGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGF  366
            LGIPH+F+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRRPFI +GA LV  AV LIGF
Sbjct  57   LGIPHRFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVTIAVFLIGF  116

Query  367  AADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLA  546
            AAD+GH++GDPLGK +KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   + R A
Sbjct  117  AADLGHASGDPLGKGSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKSGRMRTA  176

Query  547  NTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAV  726
            N  FSFFMAVGNI GYAAG+ S L+K F F+ T ACD+YCANLKSCF I+  LLL +T +
Sbjct  177  NAFFSFFMAVGNILGYAAGSYSRLFKVFPFSKTKACDMYCANLKSCFFIAIFLLLSLTTL  236

Query  727  AVTCVSEVQYTRK-AVEGEE-------GKVPFVGELLGAFKNLPRPMLILLIVTALNWIA  882
            A+T V E +   K  +E +E        KVPF GE+ GA K+LPRPM ILL+VT LNWIA
Sbjct  237  ALTLVRENELPEKEELEIDEKLSGAGKSKVPFFGEIFGALKSLPRPMWILLLVTCLNWIA  296

Query  883  WF  888
            WF
Sbjct  297  WF  298



>gb|AAD45390.1|AF167415_1 sucrose transporter SUT2A [Apium graveolens]
 gb|AAD45391.1|AF167416_1 sucrose transporter SUT2B [Apium graveolens]
Length=512

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 224/298 (75%), Gaps = 5/298 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPL--WKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME GT   +          ++  P + P+  WKL +V+AIAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MENGTKELNKQPPPSAAMQVQTSPPKLPIATWKLILVAAIAAGVQFGWALQLSLLTPYVQ  60

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPHK+++ IWLCGPISG++VQP+VGYYSD C + FGRRRPFI SGA  V  +VILIG
Sbjct  61   LLGIPHKWAAYIWLCGPISGMLVQPIVGYYSDRCQSSFGRRRPFIASGAGCVAISVILIG  120

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            FAADIG+  GD + K  KPRA   F++GFWILDVANNMLQGPCRALLADL  GD  + R 
Sbjct  121  FAADIGYKAGDDMTKTLKPRAVTGFVIGFWILDVANNMLQGPCRALLADLCNGDTRRMRS  180

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  +SFFMAVGNI GYAAG+ + LYK F F+ T ACD+YCANLKSCFIIS +LL+ +T 
Sbjct  181  ANAFYSFFMAVGNILGYAAGSYNNLYKLFPFSKTHACDLYCANLKSCFIISIVLLIFITV  240

Query  724  VAVTCVSEVQYTRKAVEGE---EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +A+T V E Q++    + E    GK+P  GEL GA K+LPRPML+LL+VT LNWIAWF
Sbjct  241  LALTVVREKQWSPDEADEEPPSSGKIPVFGELFGALKDLPRPMLMLLVVTCLNWIAWF  298



>ref|XP_009348838.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=508

 Score =   380 bits (977),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 230/299 (77%), Gaps = 14/299 (5%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            MEV T+  +     E+EQ +      +PL K+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEVETADKNSQA--ELEQQV------SPLKKIILVASIAAGVQFGWALQLSLLTPYVQLL  52

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            G+PH +++ IWLCGPISGL+VQP+VGY+SD CT+RFGRR PFI SG+ LV  AV LIG+A
Sbjct  53   GVPHTWAAFIWLCGPISGLLVQPIVGYHSDRCTSRFGRRSPFIASGSALVAVAVFLIGYA  112

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH TGD L K TKPRA  IF+VGFWILDVANNMLQGPCRALLAD+SG D  K R AN
Sbjct  113  ADLGHLTGDSLEKATKPRAVSIFVVGFWILDVANNMLQGPCRALLADISGSDPKKMRTAN  172

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             LF+FFMAVGN+ GYAAGA + L++ F FT+T ACD+YCANLKSCF +S  LL+I+T +A
Sbjct  173  ALFAFFMAVGNVLGYAAGAYNNLHRMFPFTMTKACDIYCANLKSCFFLSIALLIILTVLA  232

Query  730  VTCVSEVQY-TRKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +T V E      +  E EE      KVPF G+++GAFK L RPML+LL+VT LNWIAWF
Sbjct  233  LTNVKETTADVAQPDEPEEESTTTSKVPFFGQMIGAFKELKRPMLVLLLVTCLNWIAWF  291



>ref|XP_002871200.1| sucrose-proton symporter 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47459.1| sucrose-proton symporter 6 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/271 (68%), Positives = 217/271 (80%), Gaps = 1/271 (0%)
 Frame = +1

Query  76   LPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQ  255
            L   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWLCGPISGL+VQ
Sbjct  24   LDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQ  83

Query  256  PLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVI  435
            P VGY+SD C +RFGRRRPFI +GALLV  AVILIGFAAD GH+ GD L +  K RA   
Sbjct  84   PSVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKMRAVGF  143

Query  436  FIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQST  615
            F++GFWILDVANN LQGPCRA L DL+ GD  KTR AN +FSFFMAVGN+ GYAAG+ + 
Sbjct  144  FVIGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTN  203

Query  616  LYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVP  795
            L+K F FT+T ACD+YCANLKSCFIIS  LLL+VT +A+  V + Q++ KA  G++ K P
Sbjct  204  LHKIFPFTVTKACDIYCANLKSCFIISITLLLVVTIIALWYVEDKQWSPKADSGKD-KTP  262

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  263  FFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  293



>ref|NP_001031241.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
 gb|AEE34529.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
Length=417

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 215/271 (79%), Gaps = 1/271 (0%)
 Frame = +1

Query  76   LPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQ  255
            L   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+ S IWLCGP+SGL+VQ
Sbjct  23   LDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQ  82

Query  256  PLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVI  435
            P VGY+SD CT+RFGRRRPFI +GALLV  +V+LIG+AAD GHS GD + K  K RA VI
Sbjct  83   PSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVI  142

Query  436  FIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQST  615
            F +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + 
Sbjct  143  FALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTN  202

Query  616  LYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVP  795
            LYK F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA + +  K P
Sbjct  203  LYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKA-DSDNEKTP  261

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  262  FFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  292



>sp|Q03411.1|SUT_SPIOL RecName: Full=Sucrose transport protein; AltName: Full=Sucrose 
permease; AltName: Full=Sucrose-proton symporter [Spinacia 
oleracea]
 emb|CAA47604.1| sucrose permease [Spinacia oleracea]
Length=525

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/307 (63%), Positives = 235/307 (77%), Gaps = 12/307 (4%)
 Frame = +1

Query  4    KKMEVGTSSSSGGGAFEVEQDLEALPE-ETPLWKLTVVSAIAAGVQFGWALQLSLLTPYV  180
            + ++ G ++   G +  +E++    PE E  L KL +V+++AAGVQFGWALQLSLLTPYV
Sbjct  4    RNIKNGENNKIAGSSLHLEKNPTTPPEAEATLKKLGLVASVAAGVQFGWALQLSLLTPYV  63

Query  181  QLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILI  360
            QLLGIPH +++ IWLCGPISG+IVQPLVGYYSD CT+RFGRRRPFI +GA LV  AV LI
Sbjct  64   QLLGIPHTWAAYIWLCGPISGMIVQPLVGYYSDRCTSRFGRRRPFIAAGAALVAVAVGLI  123

Query  361  GFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTR  540
            GFAADIG ++GDP G V KPRA  +F+VGFWILDVANN LQGPCRALLAD++ G  +KTR
Sbjct  124  GFAADIGAASGDPTGNVAKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQTKTR  183

Query  541  LANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVT  720
             AN  FSFFMA+GNIGGYAAG+ S LY  F FT T ACDVYCANLKSCF IS  LL+++T
Sbjct  184  YANAFFSFFMALGNIGGYAAGSYSRLYTVFPFTKTAACDVYCANLKSCFFISITLLIVLT  243

Query  721  AVAVTCVSEVQYTRKAVEGEE-----------GKVPFVGELLGAFKNLPRPMLILLIVTA  867
             +A++ V E Q T   ++ EE            ++PF G+L+GA K+LP+PMLILL+VTA
Sbjct  244  ILALSVVKERQITIDEIQEEEDLKNRNNSSGCARLPFFGQLIGALKDLPKPMLILLLVTA  303

Query  868  LNWIAWF  888
            LNWIAWF
Sbjct  304  LNWIAWF  310



>emb|CAA57726.1| sucrose transporter [Solanum lycopersicum]
Length=429

 Score =   376 bits (966),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 232/302 (77%), Gaps = 13/302 (4%)
 Frame = +1

Query  10   MEVGTSSS-SGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQL  186
            ME GT    +   + ++EQ L      + LWK+ VV++IAAGVQFGWALQLSLLTPYVQL
Sbjct  1    MENGTKGKLTVSSSLQIEQPLP----PSKLWKIIVVASIAAGVQFGWALQLSLLTPYVQL  56

Query  187  LGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGF  366
            LGIPH+F+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRRPFI +GA LV  AV LIGF
Sbjct  57   LGIPHRFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVTIAVFLIGF  116

Query  367  AADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLA  546
            AAD+GH++GDPLGK +KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG   K R A
Sbjct  117  AADLGHASGDPLGKGSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKSGKMRTA  176

Query  547  NTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAV  726
            N  FSFF AVGNI GYAAG+ S L+K F F+ T ACD+Y ANLKSCF I+  LLL +T +
Sbjct  177  NAFFSFFKAVGNILGYAAGSYSRLFKVFPFSKTKACDMYRANLKSCFFIAIFLLLSLTTL  236

Query  727  AVTCVSEVQYTRK-AVEGEE-------GKVPFVGELLGAFKNLPRPMLILLIVTALNWIA  882
            A+T V E +   K  +E +E        KVPF GE+ GA K+LPRPM ILL+VT LNWIA
Sbjct  237  ALTLVRENELPEKEELEIDEKLSGAGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIA  296

Query  883  WF  888
            WF
Sbjct  297  WF  298



>ref|NP_001290021.1| sucrose transport protein [Beta vulgaris subsp. vulgaris]
 emb|CAA58730.1| sucrose/proton-symporter [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/292 (64%), Positives = 223/292 (76%), Gaps = 10/292 (3%)
 Frame = +1

Query  40   GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLI  219
            G +  +E++  + PE + L KL +V++IAAGVQFGWALQLSLLTPYVQLLGIPH ++  I
Sbjct  18   GSSLSIEKNPISPPEASSLKKLALVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAPYI  77

Query  220  WLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDP  399
            WLCGPISG+IVQP VGYYSD CT++FGRR PFI  GA LV FAV LIGFAADIGH+TGDP
Sbjct  78   WLCGPISGMIVQPTVGYYSDRCTSKFGRRSPFIAVGATLVGFAVSLIGFAADIGHATGDP  137

Query  400  LGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVG  579
             G V KPRA  +F+VGFWILDVANN LQGPCRALLAD++ G  +KTR AN  FSFFMA+G
Sbjct  138  NGNVPKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQAKTRYANAFFSFFMALG  197

Query  580  NIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT  759
            NIGGY AG+   LY  F FT T ACD YCANLKSCF IS  LL+++T +A++ V E  +T
Sbjct  198  NIGGY-AGSYGRLYTVFPFTHTKACDTYCANLKSCFFISITLLIVLTILALSVVRERPFT  256

Query  760  RKAVEGEE---------GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               ++ EE          ++PF G+L GA K+LP+PMLILL+VT LNWIAWF
Sbjct  257  LDEIQEEENLKNNTGGCARLPFFGQLFGALKDLPKPMLILLLVTCLNWIAWF  308



>ref|NP_001031242.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
 gb|AEE34530.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
Length=456

 Score =   377 bits (968),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 215/271 (79%), Gaps = 1/271 (0%)
 Frame = +1

Query  76   LPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQ  255
            L   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+ S IWLCGP+SGL+VQ
Sbjct  23   LDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQ  82

Query  256  PLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVI  435
            P VGY+SD CT+RFGRRRPFI +GALLV  +V+LIG+AAD GHS GD + K  K RA VI
Sbjct  83   PSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVI  142

Query  436  FIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQST  615
            F +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + 
Sbjct  143  FALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTN  202

Query  616  LYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVP  795
            LYK F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA + +  K P
Sbjct  203  LYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKA-DSDNEKTP  261

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  262  FFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  292



>gb|ACX33146.1| sucrose transporter 1 [Verbascum phoeniceum]
Length=511

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 188/285 (66%), Positives = 226/285 (79%), Gaps = 7/285 (2%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            +F+++   EA     PL K+ +V+AIAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWL
Sbjct  15   SFQIQPPPEA---AAPLRKIILVAAIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWL  71

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISGL+VQP+VGYYSDNCT+RFGRRRPFI +G+ LV  AV LIGFAADIGH+ GD +G
Sbjct  72   CGPISGLLVQPVVGYYSDNCTSRFGRRRPFIAAGSALVAVAVFLIGFAADIGHAAGDSIG  131

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSGG+  K   AN L+SFFMAVGN+
Sbjct  132  KGPKPRAISVFVVGFWILDVANNMLQGPCRAFLADLSGGNAKKMGSANALYSFFMAVGNV  191

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE--VQYT  759
             GYAAG+ + L+K F F+ T ACDVYCANLKSCF IS  LLLIVT +A++ V E  +Q T
Sbjct  192  LGYAAGSYTHLFKVFPFSKTKACDVYCANLKSCFFISIALLLIVTILALSIVRETAIQST  251

Query  760  RKAVEG--EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +   G  ++ K+P  GEL GA K+LP+PM ILL+VT LNWIAWF
Sbjct  252  PEPPTGASKKRKIPVFGELFGALKDLPKPMWILLLVTCLNWIAWF  296



>ref|XP_008381009.1| PREDICTED: LOW QUALITY PROTEIN: sucrose transport protein-like 
[Malus domestica]
Length=508

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 188/299 (63%), Positives = 227/299 (76%), Gaps = 14/299 (5%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            MEV T+  +     E         + +PL K+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEVETADKNSQAKLE--------QQVSPLKKIILVASIAAGVQFGWALQLSLLTPYVQLL  52

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            G+PH +++ IWLCGPISGL+VQP+VGY+SD CT+RFGRRRPFI SG+ LV  AV LIG+A
Sbjct  53   GVPHTWAAFIWLCGPISGLLVQPIVGYHSDRCTSRFGRRRPFIASGSALVAVAVFLIGYA  112

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH TGD L K TKPRA  IF+VGFWILDVANNMLQGPCRALLAD+SG    K R AN
Sbjct  113  ADLGHLTGDSLEKATKPRAVSIFVVGFWILDVANNMLQGPCRALLADISGSRTKKMRTAN  172

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             LF+FFMAVGN+ GYAAGA + L++ F FT+T ACD+YCANLKSCF +S  LL+I+T +A
Sbjct  173  ALFAFFMAVGNVLGYAAGAYNNLHRMFPFTMTKACDIYCANLKSCFFLSIALLIILTVLA  232

Query  730  VTCVSEVQYT-RKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +T V E      +  E EE      KVPF G+++GAFK L RPML+LL+VT LNWIAWF
Sbjct  233  LTNVKETTANVAQPDEPEEESATTSKVPFFGQMIGAFKELKRPMLVLLLVTCLNWIAWF  291



>ref|XP_009339088.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=512

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 229/299 (77%), Gaps = 14/299 (5%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            MEV T+  +     E+EQ +      +PL K+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEVETADKNSQA--ELEQQV------SPLKKIILVASIAAGVQFGWALQLSLLTPYVQLL  52

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            G+PH +++ IWLCGPISGL+VQP+VGY+SD C +RFGRR PFI SG+ LV  AV LIG+A
Sbjct  53   GVPHTWAAFIWLCGPISGLLVQPIVGYHSDRCISRFGRRSPFIASGSALVAVAVFLIGYA  112

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH TGD L K TKPRA  IF+VGFWILDVANNMLQGPCRALLAD+SG D  K R AN
Sbjct  113  ADLGHLTGDSLEKATKPRAVSIFVVGFWILDVANNMLQGPCRALLADISGSDPKKMRTAN  172

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             LF+FFMAVGN+ GYAAGA + L++ F FT+T ACD+YCANLKSCF +S  LL+I+T +A
Sbjct  173  ALFAFFMAVGNVLGYAAGAYNNLHRMFPFTMTKACDIYCANLKSCFFLSIALLIILTVLA  232

Query  730  VTCVSEVQY-TRKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +T V E      +  E EE      KVPF G+++GAFK L RPML+LL+VT LNWIAWF
Sbjct  233  LTNVKETTADVAQPDEPEEESTTTSKVPFFGQMIGAFKELKRPMLVLLLVTCLNWIAWF  291



>gb|AAC99332.1| sucrose transporter [Apium graveolens]
Length=512

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 223/298 (75%), Gaps = 5/298 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPL--WKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME GT   +          ++  P + P+  WKL +V+AIAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MENGTKELNKQPPPSAAMQVQTSPPKLPIATWKLILVAAIAAGVQFGWALQLSLLTPYVQ  60

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPHK+++ IWLCGPISG++VQP+VGYYSD C + FGRRRPFI SGA  V  +VILIG
Sbjct  61   LLGIPHKWAAYIWLCGPISGMLVQPIVGYYSDRCQSSFGRRRPFIASGAGCVAISVILIG  120

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            FAADIG+  GD + K  KPRA  +F++GFWILDVANNMLQGPCRALLADL  GD  + R 
Sbjct  121  FAADIGYKAGDDMNKTLKPRAVTVFVIGFWILDVANNMLQGPCRALLADLCNGDTRRMRS  180

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN L+ FFMAVGNI G AAG+ + LYK F F+ T ACD+YCANLKSCFIIS +LL+ +T 
Sbjct  181  ANALYRFFMAVGNILGNAAGSYNNLYKLFPFSKTHACDLYCANLKSCFIISIVLLIFITV  240

Query  724  VAVTCVSEVQYTRKAVEGE---EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +A+T V E Q++    + E    GK+P  GELL A K+LPRPML+LL VT LNWIAWF
Sbjct  241  LALTVVREKQWSPDEADEEPPSSGKIPVFGELLRALKDLPRPMLMLLAVTCLNWIAWF  298



>dbj|BAD44273.1| hypothetical protein [Arabidopsis thaliana]
Length=491

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 215/271 (79%), Gaps = 1/271 (0%)
 Frame = +1

Query  76   LPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQ  255
            L   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+ S IWLCGP+SGL+VQ
Sbjct  23   LDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQ  82

Query  256  PLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVI  435
            P VGY+SD CT+RFGRRRPFI +GALLV  +V+LIG+AAD GHS GD + K  K RA VI
Sbjct  83   PSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVI  142

Query  436  FIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQST  615
            F +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + 
Sbjct  143  FALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTN  202

Query  616  LYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVP  795
            LYK F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA + +  K P
Sbjct  203  LYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKA-DSDNEKTP  261

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  262  FFGEIFGAFKVMKRPMWVLLIVTALNWIAWF  292



>ref|NP_176830.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
 sp|Q67YF8.2|SUC7_ARATH RecName: Full=Sucrose transport protein SUC7; AltName: Full=Sucrose 
permease 7; AltName: Full=Sucrose-proton symporter 7 
[Arabidopsis thaliana]
 gb|AAG51172.1|AC079285_5 sucrose-proton symporter, putative [Arabidopsis thaliana]
 gb|ABJ17121.1| At1g66570 [Arabidopsis thaliana]
 gb|AEE34528.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
Length=491

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 215/271 (79%), Gaps = 1/271 (0%)
 Frame = +1

Query  76   LPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQ  255
            L   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+ S IWLCGP+SGL+VQ
Sbjct  23   LDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQ  82

Query  256  PLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVI  435
            P VGY+SD CT+RFGRRRPFI +GALLV  +V+LIG+AAD GHS GD + K  K RA VI
Sbjct  83   PSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVI  142

Query  436  FIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQST  615
            F +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + 
Sbjct  143  FALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTN  202

Query  616  LYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVP  795
            LYK F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA + +  K P
Sbjct  203  LYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKA-DSDNEKTP  261

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  262  FFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  292



>ref|NP_173685.1| sucrose transport protein SUC2 [Arabidopsis thaliana]
 sp|Q39231.2|SUC2_ARATH RecName: Full=Sucrose transport protein SUC2; AltName: Full=Sucrose 
permease 2; AltName: Full=Sucrose transporter 1; AltName: 
Full=Sucrose-proton symporter 2 [Arabidopsis thaliana]
 gb|AAC25515.1| Match to sucrose-proton symporter (SUC2) gene gb|X75382 from 
A. thaliana [Arabidopsis thaliana]
 gb|AAK82518.1| At1g22710/T22J18_12 [Arabidopsis thaliana]
 gb|AAK93663.1| putative sucrose transport protein SUC2 [Arabidopsis thaliana]
 gb|AAM44994.1| putative sucrose transport protein SUC2 [Arabidopsis thaliana]
 gb|AAM66097.1| putative sucrose transport protein SUC2 [Arabidopsis thaliana]
 gb|AAN31829.1| putative sucrose transport protein, SUC2 [Arabidopsis thaliana]
 gb|AEE30276.1| sucrose transport protein SUC2 [Arabidopsis thaliana]
Length=512

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 220/289 (76%), Gaps = 3/289 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             +++G  A E +      PE   L K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    KAANGASALETQTGELDQPER--LRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHK  65

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH
Sbjct  66   WASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGH  125

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            S GD L K  K RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSF
Sbjct  126  SMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSF  185

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLLIVT V++  V 
Sbjct  186  FMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVK  245

Query  745  EVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  246  EKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>emb|CDX72840.1| BnaC06g32880D [Brassica napus]
Length=508

 Score =   376 bits (965),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 228/296 (77%), Gaps = 6/296 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            M++G   ++      +E+D +   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MKMGAKDTAALETQSIEEDFD---QPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLL  57

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK+SSLIWLCGPISG+IVQP+VGYYSD CT+RFGRRRPFI SGA LV  AV LIG+A
Sbjct  58   GIPHKWSSLIWLCGPISGMIVQPIVGYYSDRCTSRFGRRRPFIASGAALVAVAVFLIGYA  117

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIG+  GD L +  + RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN
Sbjct  118  ADIGYKMGDKLEQTPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVAN  177

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             +FSFFMAVGN+ GYAAG+ + L+K F F +T+ACD+YCANLKSCF +S  LLLIVT  +
Sbjct  178  AVFSFFMAVGNVLGYAAGSYTNLHKMFPFAMTNACDIYCANLKSCFFLSITLLLIVTVTS  237

Query  730  VTCVSEVQYTRKAVE-GEEG--KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V + Q++   V  GEE    VPF GE+ GAF+ + RPM +LLIVTALNWIAWF
Sbjct  238  LWYVKDKQWSPPQVNPGEENTKTVPFFGEIFGAFRVMERPMWMLLIVTALNWIAWF  293



>emb|CAA53150.1| sucrose-proton symporter [Arabidopsis thaliana]
Length=512

 Score =   376 bits (965),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 187/288 (65%), Positives = 218/288 (76%), Gaps = 1/288 (0%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
              +  GA  +E     L +   L K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  7    EKAANGASALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKW  66

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            +SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGHS
Sbjct  67   ASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHS  126

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L K  K RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSFF
Sbjct  127  MGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFF  186

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLLIVT V++  V E
Sbjct  187  MAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKE  246

Query  748  VQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  247  KPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>ref|XP_009105851.1| PREDICTED: sucrose transport protein SUC1-like [Brassica rapa]
 emb|CDX96357.1| BnaA07g29680D [Brassica napus]
Length=508

 Score =   376 bits (965),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 227/296 (77%), Gaps = 6/296 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            M++G   ++      +E+D +   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MKMGAKDTAALETQSIEEDFD---QPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLL  57

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK+SSLIWLCGPISG+IVQP+VGYYSD CT+RFGRRRPFI SGA LV  AV LIG+A
Sbjct  58   GIPHKWSSLIWLCGPISGMIVQPIVGYYSDRCTSRFGRRRPFIASGAALVAVAVFLIGYA  117

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIG+  GD L +  + RA  +F +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN
Sbjct  118  ADIGYKMGDKLEQTPRVRAIGVFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVAN  177

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             +FSFFMAVGN+ GYAAG+ + L+K F F +T+ACD+YCANLKSCF +S  LLLIVT  +
Sbjct  178  AVFSFFMAVGNVLGYAAGSYTNLHKMFPFAMTNACDIYCANLKSCFFLSITLLLIVTVTS  237

Query  730  VTCVSEVQYTRKAVEGEEGK---VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V + Q++   V   E K   VPF GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  238  LWYVKDKQWSPPPVNPGEEKTKTVPFFGEIFGAFKVMERPMWMLLIVTALNWIAWF  293



>ref|XP_008382139.1| PREDICTED: sucrose transport protein-like [Malus domestica]
Length=423

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/298 (62%), Positives = 226/298 (76%), Gaps = 13/298 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            MEV  ++ +       EQ+ +A    +PL K+ +V++IAAGVQFGWALQLSL TPYVQLL
Sbjct  1    MEVENANKNP----HAEQEQQA----SPLKKIILVASIAAGVQFGWALQLSLXTPYVQLL  52

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            G+PH +++ IWLCGPISGL+VQP+VGY+SD CT+RFGRRRPFI +G+ LV  AV LIG+A
Sbjct  53   GVPHTWAAFIWLCGPISGLLVQPIVGYHSDRCTSRFGRRRPFIAAGSALVAVAVFLIGYA  112

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH TGD L K TKPRA  +F+VGFWILDVANN LQGPCRALLAD+SG D  + R +N
Sbjct  113  ADLGHLTGDSLEKATKPRAVSVFVVGFWILDVANNTLQGPCRALLADISGSDPKRMRTSN  172

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
             LF+FFMAVGN+ GYAAGA + L+K F FT T ACD+YCANLKSCF +S  LL+ +T +A
Sbjct  173  ALFAFFMAVGNVLGYAAGAYNNLHKMFPFTKTKACDIYCANLKSCFFLSIALLITLTVLA  232

Query  730  VTCVSEVQYTRKAVEGEEG-----KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +T V E        E EE      KVPF G+++GAFK L RPML+LL+VT LNWIAWF
Sbjct  233  LTIVKETPADVAPDEPEEESTTTPKVPFFGQMIGAFKELQRPMLVLLLVTCLNWIAWF  290



>ref|XP_010425916.1| PREDICTED: putative sucrose transport protein SUC6 isoform X2 
[Camelina sativa]
Length=458

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 211/267 (79%), Gaps = 0/267 (0%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SSLIWLCGPISGL+VQP VG
Sbjct  29   SPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSLIWLCGPISGLLVQPTVG  88

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            YYSD C +RFGRRRPFI +GA LV  AV LIG+AAD GHS GD + +  K +A VIF +G
Sbjct  89   YYSDRCQSRFGRRRPFIAAGAFLVAVAVFLIGYAADFGHSLGDKVEERVKSKAVVIFALG  148

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ S L+K 
Sbjct  149  FWILDVANNTLQGPCRAFLGDLAAGDARKTRTANAAFSFFMAVGNVLGYAAGSYSHLHKI  208

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGE  807
            F FT+T +CD+YCANLKSCF +S  LLL+VT +++  V +  ++ KA   EE K PF GE
Sbjct  209  FPFTMTKSCDIYCANLKSCFFLSITLLLVVTIISLWYVEDKPWSPKADSNEEKKTPFFGE  268

Query  808  LLGAFKNLPRPMLILLIVTALNWIAWF  888
            L GAFK + RPM +LLI T+LNWIAWF
Sbjct  269  LFGAFKVMKRPMWMLLITTSLNWIAWF  295



>ref|NP_196235.1| sucrose transport protein SUC9 [Arabidopsis thaliana]
 sp|Q9FG00.1|SUC9_ARATH RecName: Full=Sucrose transport protein SUC9; AltName: Full=Sucrose 
permease 9; AltName: Full=Sucrose-proton symporter 9 
[Arabidopsis thaliana]
 dbj|BAB09682.1| sucrose transporter protein [Arabidopsis thaliana]
 gb|AED90978.1| sucrose transport protein SUC9 [Arabidopsis thaliana]
Length=491

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/269 (67%), Positives = 214/269 (80%), Gaps = 1/269 (0%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWLCGPISGL+VQP 
Sbjct  26   EPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQPT  85

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD C +RFGRRRPFI +GALLV  AVILIGFAAD GH+ GD L +  K RA   F+
Sbjct  86   VGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFV  145

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANN LQGPCRA L DL+ GD  KTR AN +FSFFMAVGN+ GYAAG+ + L+
Sbjct  146  VGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLH  205

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT+T ACD+YCANLKSCFIIS  LL+++T +A+  V + Q++  A + +  K PF 
Sbjct  206  KIFPFTVTKACDIYCANLKSCFIISITLLIVLTIIALWYVEDKQWSPNA-DSDNEKTPFF  264

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE+ GAFK + RPM +LL VTALNWIAWF
Sbjct  265  GEIFGAFKVMKRPMWMLLAVTALNWIAWF  293



>dbj|BAA89458.1| sucrose transporter protein [Daucus carota]
Length=515

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 227/297 (76%), Gaps = 7/297 (2%)
 Frame = +1

Query  13   EVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLG  192
            E+         A +++  ++ +P  T  WKL +V+AIAAGVQFGWALQLSLLTPYVQLLG
Sbjct  7    ELNKPQPPSSAAMQLQTPVQKIPTAT--WKLVLVAAIAAGVQFGWALQLSLLTPYVQLLG  64

Query  193  IPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAA  372
            IPHK+++ IWLCGPISG++VQP+VGYYSD+C + FGRRRPFI SGA  V  +VILIGFAA
Sbjct  65   IPHKWAAYIWLCGPISGMLVQPIVGYYSDHCQSSFGRRRPFIASGAGCVAISVILIGFAA  124

Query  373  DIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANT  552
            DIG+  GD + K  KPRA  +F++GFWILDVANNMLQGPCRALLADL  GD  + R AN 
Sbjct  125  DIGYKAGDDMSKTLKPRAVTVFVIGFWILDVANNMLQGPCRALLADLCSGDTRRMRSANA  184

Query  553  LFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAV  732
             +SFFMAVGNI GYAAG+ + LYK F F+ T ACD+YCANLKSCFIIS  LL+I+T VA+
Sbjct  185  FYSFFMAVGNILGYAAGSYNNLYKLFPFSKTHACDLYCANLKSCFIISIALLIIITVVAL  244

Query  733  TCVSEVQYTRKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + V E Q++    +  +     GK+P  GELLGA K+LPRPML+LLIVT LNWIAWF
Sbjct  245  SVVREKQWSPDDADAADEPPSSGKIPVFGELLGALKDLPRPMLLLLIVTCLNWIAWF  301



>ref|XP_009115609.1| PREDICTED: sucrose transport protein SUC2 [Brassica rapa]
 emb|CDY21384.1| BnaA09g30430D [Brassica napus]
Length=508

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 222/294 (76%), Gaps = 6/294 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME G++ S+      +E     L +   L K+  VS+IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEKGSNGSA-----ALEMQTSELDQPAALRKIISVSSIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+A
Sbjct  56   GIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIGHS GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN
Sbjct  116  ADIGHSMGDQLDKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTAN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+   LYK   FT+T +CD+YCANLK+CF +S  LLL+VT ++
Sbjct  176  AFFSFFMAVGNVLGYAAGSYKNLYKVVPFTMTKSCDLYCANLKTCFFLSITLLLLVTFMS  235

Query  730  VTCVSEVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V+E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  236  LCYVTEKPWTPEPTADGKSSSVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  289



>ref|XP_010477533.1| PREDICTED: sucrose transport protein SUC2 [Camelina sativa]
Length=512

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 221/289 (76%), Gaps = 3/289 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             +++G GA E +      PE   L K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    KAANGVGALETQMGELDQPER--LRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHK  65

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH
Sbjct  66   WASLIWLCGPISGMLVQPVVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGH  125

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            S GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSF
Sbjct  126  SMGDQLNKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSF  185

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLL+VT V++  V 
Sbjct  186  FMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLLVTFVSLCYVK  245

Query  745  EVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  246  EKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>gb|AAL58072.1| sucrose transporter SUC2 [Brassica oleracea]
 emb|CDY04792.1| BnaC05g17970D [Brassica napus]
Length=508

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 222/294 (76%), Gaps = 6/294 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME G++ S+      +E     L +   L K+  VS+IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEKGSNGSA-----ALEMQTSELDQPAALRKIISVSSIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+A
Sbjct  56   GIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIGHS GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN
Sbjct  116  ADIGHSMGDQLDKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTAN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+   LYK   FT+T +CD+YCANLK+CF +S  LLL+VT ++
Sbjct  176  AFFSFFMAVGNVLGYAAGSYKNLYKVVPFTMTKSCDLYCANLKTCFFLSITLLLLVTFMS  235

Query  730  VTCVSEVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V+E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  236  LCYVTEKPWTPEPTADGKPSSVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  289



>ref|XP_010425915.1| PREDICTED: putative sucrose transport protein SUC6 isoform X1 
[Camelina sativa]
Length=493

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 211/267 (79%), Gaps = 0/267 (0%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SSLIWLCGPISGL+VQP VG
Sbjct  29   SPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSLIWLCGPISGLLVQPTVG  88

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            YYSD C +RFGRRRPFI +GA LV  AV LIG+AAD GHS GD + +  K +A VIF +G
Sbjct  89   YYSDRCQSRFGRRRPFIAAGAFLVAVAVFLIGYAADFGHSLGDKVEERVKSKAVVIFALG  148

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ S L+K 
Sbjct  149  FWILDVANNTLQGPCRAFLGDLAAGDARKTRTANAAFSFFMAVGNVLGYAAGSYSHLHKI  208

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGE  807
            F FT+T +CD+YCANLKSCF +S  LLL+VT +++  V +  ++ KA   EE K PF GE
Sbjct  209  FPFTMTKSCDIYCANLKSCFFLSITLLLVVTIISLWYVEDKPWSPKADSNEEKKTPFFGE  268

Query  808  LLGAFKNLPRPMLILLIVTALNWIAWF  888
            L GAFK + RPM +LLI T+LNWIAWF
Sbjct  269  LFGAFKVMKRPMWMLLITTSLNWIAWF  295



>gb|AAM10322.1| At1g22710/T22J18_12 [Arabidopsis thaliana]
Length=512

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 220/289 (76%), Gaps = 3/289 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             +++G  A E +      PE   L K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    KAANGASALETQTGELDQPER--LRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHK  65

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH
Sbjct  66   WASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGH  125

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            S GD L K  K RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSF
Sbjct  126  SMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSF  185

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+   LYK   FT+T++CD+YCA+LK+CF +S  LLLIVT V++  V 
Sbjct  186  FMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCASLKTCFFLSITLLLIVTFVSLCYVK  245

Query  745  EVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  246  EKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>ref|XP_009348390.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=507

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 217/274 (79%), Gaps = 5/274 (2%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + +PL K+ +V++IAAGVQFGWALQLSLLTPYVQLLG+PH +++ IWLCGPISGL+VQP+
Sbjct  17   QASPLKKIILVASIAAGVQFGWALQLSLLTPYVQLLGVPHTWAAFIWLCGPISGLLVQPI  76

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD CT+RFGRRRPFI +G+ LV  AV LIG+AAD+GH TGD L K TKPRA  +F+
Sbjct  77   VGYHSDRCTSRFGRRRPFIAAGSALVAVAVFLIGYAADLGHLTGDSLEKATKPRAVSVFV  136

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANN LQGPCRALLAD+SG D  + R +N LF+FFMAVGNI GYAAGA + L+
Sbjct  137  VGFWILDVANNTLQGPCRALLADISGSDPKRMRTSNALFAFFMAVGNILGYAAGAYNNLH  196

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-----  786
            K F FT T ACD+YCANLKSCF +S  LL+ +T +A+T V E        E EE      
Sbjct  197  KMFPFTKTKACDIYCANLKSCFFLSIALLITLTVLALTIVKETPADVAPDEPEEESTTAP  256

Query  787  KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            KVPF G+++GAFK L RPML+LL+VT LNWIAWF
Sbjct  257  KVPFFGQMIGAFKELQRPMLVLLLVTCLNWIAWF  290



>ref|XP_006589462.1| PREDICTED: sucrose transport protein [Glycine max]
Length=521

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 216/277 (78%), Gaps = 7/277 (3%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            PE +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP
Sbjct  26   PEASPLRKIMVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQP  85

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIF  438
            +VGY+SD CT+RFGRRRPFI +G+L V  AV LIG+AAD+GH  GD L K T+PRA  IF
Sbjct  86   IVGYHSDRCTSRFGRRRPFIAAGSLAVAIAVFLIGYAADLGHMFGDSLAKKTRPRAIAIF  145

Query  439  IVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTL  618
            +VGFWILDVANNMLQGPCRALLADL  GD  KTR AN  FSFFMAVGN+ GYAAG+ S L
Sbjct  146  VVGFWILDVANNMLQGPCRALLADLCAGDHRKTRNANAFFSFFMAVGNVLGYAAGSYSGL  205

Query  619  YKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEV-----QYTRKAVE--G  777
            +  F FT T ACDVYCANLKSCF +S  LLL ++ +A+T V E      +  R +VE  G
Sbjct  206  HNVFPFTKTKACDVYCANLKSCFFLSIALLLTLSTIALTYVKEKTVSSEKTVRSSVEEDG  265

Query  778  EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              G +P  G+L GAF+ L RPM ILL+VT LNWIAWF
Sbjct  266  SHGGMPCFGQLFGAFRELKRPMWILLLVTCLNWIAWF  302



>ref|XP_010503137.1| PREDICTED: sucrose transport protein SUC8-like isoform X2 [Camelina 
sativa]
Length=456

 Score =   372 bits (955),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 211/267 (79%), Gaps = 0/267 (0%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SSLIWLCGPISGL+VQP VG
Sbjct  27   SPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSLIWLCGPISGLLVQPTVG  86

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            YYSD C +RFGRRRPFI +GA LV  AV LIG+AAD GHS GD + +  K +A VIF +G
Sbjct  87   YYSDRCQSRFGRRRPFIAAGAFLVAVAVFLIGYAADFGHSLGDKVEERVKSKAVVIFALG  146

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ S L+K 
Sbjct  147  FWILDVANNTLQGPCRAFLGDLAAGDARKTRTANAAFSFFMAVGNVLGYAAGSYSHLHKI  206

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGE  807
            F FT+T +CD+YCANLKSCF +S  LLL+VT +++  V +  ++ KA   EE K PF GE
Sbjct  207  FPFTMTKSCDIYCANLKSCFFLSITLLLVVTIISLWYVEDKPWSPKADSNEEKKTPFFGE  266

Query  808  LLGAFKNLPRPMLILLIVTALNWIAWF  888
            L GAFK + +PM +LLI T+LNWIAWF
Sbjct  267  LFGAFKVMKKPMWMLLITTSLNWIAWF  293



>ref|XP_006307270.1| hypothetical protein CARUB_v10008884mg [Capsella rubella]
 gb|EOA40168.1| hypothetical protein CARUB_v10008884mg [Capsella rubella]
Length=512

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 221/289 (76%), Gaps = 3/289 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             +++G GA E +      PE   L K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    KAANGVGALETQTAELDQPER--LRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHK  65

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH
Sbjct  66   WASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGH  125

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            S GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSF
Sbjct  126  SMGDQLNKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSF  185

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLL+VT V++  V 
Sbjct  186  FMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLLVTFVSLCYVK  245

Query  745  EVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  246  EKPWTPEPTADGKPSNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>ref|XP_002893246.1| sucrose-proton symporter 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69505.1| sucrose-proton symporter 2 [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   373 bits (957),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 220/289 (76%), Gaps = 3/289 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             +++G  A E +      PE   L K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  3    KAANGASALETQTGELDQPER--LRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHK  60

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH
Sbjct  61   WASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGH  120

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            S GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSF
Sbjct  121  SMGDQLNKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSF  180

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLL+VT V++  V 
Sbjct  181  FMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLLVTFVSLCYVK  240

Query  745  EVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  241  EKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  289



>ref|XP_010503136.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Camelina 
sativa]
Length=491

 Score =   372 bits (956),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 211/267 (79%), Gaps = 0/267 (0%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SSLIWLCGPISGL+VQP VG
Sbjct  27   SPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSLIWLCGPISGLLVQPTVG  86

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            YYSD C +RFGRRRPFI +GA LV  AV LIG+AAD GHS GD + +  K +A VIF +G
Sbjct  87   YYSDRCQSRFGRRRPFIAAGAFLVAVAVFLIGYAADFGHSLGDKVEERVKSKAVVIFALG  146

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ S L+K 
Sbjct  147  FWILDVANNTLQGPCRAFLGDLAAGDARKTRTANAAFSFFMAVGNVLGYAAGSYSHLHKI  206

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGE  807
            F FT+T +CD+YCANLKSCF +S  LLL+VT +++  V +  ++ KA   EE K PF GE
Sbjct  207  FPFTMTKSCDIYCANLKSCFFLSITLLLVVTIISLWYVEDKPWSPKADSNEEKKTPFFGE  266

Query  808  LLGAFKNLPRPMLILLIVTALNWIAWF  888
            L GAFK + +PM +LLI T+LNWIAWF
Sbjct  267  LFGAFKVMKKPMWMLLITTSLNWIAWF  293



>ref|XP_007020266.1| Sucrose transport protein SUC2 isoform 1 [Theobroma cacao]
 gb|EOY17491.1| Sucrose transport protein SUC2 isoform 1 [Theobroma cacao]
Length=491

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 218/280 (78%), Gaps = 5/280 (2%)
 Frame = +1

Query  55   VEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGP  234
            +E  LEA     PLWK+ VV+AIAAGVQFGWALQLSLLTPYVQ LG+PH +++ IWLCGP
Sbjct  1    MEDGLEA---PGPLWKIIVVAAIAAGVQFGWALQLSLLTPYVQTLGVPHTWAAFIWLCGP  57

Query  235  ISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVT  414
            ISGL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA DIGH  GD L K T
Sbjct  58   ISGLLVQPIVGYNSDRCTSRFGRRRPFIAAGACCVAGAVFLIGFAKDIGHKAGDSLDKST  117

Query  415  KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGY  594
            KPRA  +F+ GFWILDVANNMLQGPCRALLADLS  +  + R+AN  FSFFMAVGN+ GY
Sbjct  118  KPRAVAVFVTGFWILDVANNMLQGPCRALLADLSANNHKRMRVANGWFSFFMAVGNVLGY  177

Query  595  AAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVE  774
            AAG+ S L+K F FT+T ACDVYCANLK+CFII  + LL+VT  A++CV E   ++K ++
Sbjct  178  AAGSYSNLHKIFPFTVTTACDVYCANLKTCFIIDILFLLLVTITAISCVKETPLSKKVMK  237

Query  775  GEEGK--VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             EE K   P VGELL AFK L +PM ILL+VT LNWIAWF
Sbjct  238  QEEEKASTPLVGELLTAFKTLKKPMWILLLVTCLNWIAWF  277



>ref|XP_010415904.1| PREDICTED: sucrose transport protein SUC1-like [Camelina sativa]
Length=515

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 222/291 (76%), Gaps = 4/291 (1%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            S+    A E +Q  E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  9    STKDAAALETQQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKW  68

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            SSLIWLCGPISG+IVQP+VG++SD CT+RFGRRRPFI +GA LV  AV LIG+AADIG+ 
Sbjct  69   SSLIWLCGPISGMIVQPIVGFHSDRCTSRFGRRRPFIATGAALVAVAVFLIGYAADIGNK  128

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L +  K RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN  FSFF
Sbjct  129  MGDKLDQKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFF  188

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  ++  V +
Sbjct  189  MAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVKD  248

Query  748  VQYTRKAVEGEEGK----VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             Q++  A   ++ +    VP  GE+ GAF+ + RPM +LLIVTALNWIAWF
Sbjct  249  KQWSPPARNPDDDEKTSSVPLFGEIFGAFRVMKRPMWMLLIVTALNWIAWF  299



>ref|XP_009103222.1| PREDICTED: sucrose transport protein SUC2 [Brassica rapa]
 emb|CDY25750.1| BnaA07g10320D [Brassica napus]
Length=513

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/288 (64%), Positives = 220/288 (76%), Gaps = 3/288 (1%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            +S+G  A E +     L +   L K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  9    ASNGTSALETQT--AELDQPAALRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKW  66

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            +SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AAD+GHS
Sbjct  67   ASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADLGHS  126

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSFF
Sbjct  127  MGDQLNKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFF  186

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LL++VT V++  V E
Sbjct  187  MAVGNVLGYAAGSYRDLYKMVPFTMTESCDLYCANLKTCFFLSITLLVLVTFVSLCYVKE  246

Query  748  VQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  247  KPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>ref|XP_009375259.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=507

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/274 (65%), Positives = 216/274 (79%), Gaps = 5/274 (2%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + +PL K+ +V++IAAGVQFGWALQLSLLTPYVQLLG+PH +++ IWLCGPISGL+VQP+
Sbjct  17   QASPLKKIILVASIAAGVQFGWALQLSLLTPYVQLLGVPHTWAAFIWLCGPISGLLVQPI  76

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD CT+RFGRRRPFI +G+ LV  AV LIG+AAD+GH TGD L K  KPRA  +F+
Sbjct  77   VGYHSDRCTSRFGRRRPFIAAGSALVAVAVFLIGYAADLGHLTGDSLEKAPKPRAVSVFV  136

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANN LQGPCRALLAD+SG D  + R +N LF+FFMAVGNI GYAAGA + L+
Sbjct  137  VGFWILDVANNTLQGPCRALLADISGSDPKRMRTSNALFAFFMAVGNILGYAAGAYNNLH  196

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-----  786
            K F FT T ACD+YCANLKSCF +S  LL+ +T +A+T V E        E EE      
Sbjct  197  KMFPFTKTKACDIYCANLKSCFFLSIALLITLTVLALTIVKETPADVAPDEPEEESTTAP  256

Query  787  KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            KVPF G+++GAFK L RPML+LL+VT LNWIAWF
Sbjct  257  KVPFFGQMIGAFKELQRPMLVLLLVTCLNWIAWF  290



>gb|AAF04295.2|AF191025_1 sucrose transporter 1 [Alonsoa meridionalis]
Length=502

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 225/298 (76%), Gaps = 16/298 (5%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALP--EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            MEVG  + S            ALP  +  P+  + VV+AIAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MEVGNEAKS-----------TALPPAQAAPVKNIIVVAAIAAGVQFGWALQLSLLTPYVQ  49

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLG+PH +++ IWLCGPISGL+VQP+VGYYSDNCT+RFGRRRPFI +GA LV  AV LIG
Sbjct  50   LLGVPHVWAAFIWLCGPISGLLVQPIVGYYSDNCTSRFGRRRPFIAAGAGLVAVAVFLIG  109

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            FAAD+GH  GD LGK TKPRA  +F+VGFWILDVANNMLQGPCRALLAD+S G+  K   
Sbjct  110  FAADLGHMGGDSLGKGTKPRAVAVFVVGFWILDVANNMLQGPCRALLADMSAGNAKKMSS  169

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN++FSFFMAVGN+ GYAAG+ + LYK F F+ T+AC VYCANLKSCF IS  LLL VT 
Sbjct  170  ANSMFSFFMAVGNVLGYAAGSYTRLYKVFPFSKTEACAVYCANLKSCFFISVALLLTVTI  229

Query  724  VAVTCVSEVQYTRKAVEG---EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +A+  V E  YT    E    ++  VP  GEL GA K+LPRPM +LL+VTALNW+AWF
Sbjct  230  IALCIVRETPYTAPPEEAGTVKKHTVPVFGELFGALKDLPRPMWMLLLVTALNWVAWF  287



>ref|XP_007201709.1| hypothetical protein PRUPE_ppa004033mg [Prunus persica]
 gb|EMJ02908.1| hypothetical protein PRUPE_ppa004033mg [Prunus persica]
Length=534

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/274 (66%), Positives = 218/274 (80%), Gaps = 8/274 (3%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PL K+ +V++IAAGVQFGWALQLSLLTPY+QLLG+PH +S+ +WLCGPISG+IVQP+VGY
Sbjct  39   PLPKIILVASIAAGVQFGWALQLSLLTPYIQLLGVPHTWSAFVWLCGPISGMIVQPIVGY  98

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD CT+RFGRRRPFI +G+ LV  AV LIG+AADIGH +GD L K TKPRA  +F+VGF
Sbjct  99   HSDRCTSRFGRRRPFIAAGSGLVAVAVFLIGYAADIGHLSGDSLEKSTKPRAVAVFVVGF  158

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRALLAD+SG D  + R AN+LF+FFMAVGN+ GYAAGA S L+K F
Sbjct  159  WILDVANNMLQGPCRALLADISGDDPKRMRTANSLFAFFMAVGNVLGYAAGAYSHLHKMF  218

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV-EGE-------EG  786
             FT+T ACDVYCANLKSCF +S  LLL++T VA+T V E       V EGE         
Sbjct  219  PFTITKACDVYCANLKSCFFLSITLLLVLTIVALTSVKETTPNDGVVAEGEIEPQSTTAK  278

Query  787  KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             VPF G+++ AF+ L RPML+LL+VT LNW+AWF
Sbjct  279  SVPFFGQMIAAFRELRRPMLVLLLVTCLNWVAWF  312



>ref|XP_009130919.1| PREDICTED: putative sucrose transport protein SUC6 [Brassica 
rapa]
 emb|CDY11357.1| BnaA03g01930D [Brassica napus]
Length=477

 Score =   370 bits (950),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 216/273 (79%), Gaps = 1/273 (0%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            + L E +P+ K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++
Sbjct  7    DQLGEPSPMRKMISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGML  66

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP VGYYSD CT++FGRRRPFI SGA+LV  A ILIG+AAD+G   GD L +  K RA 
Sbjct  67   VQPTVGYYSDRCTSKFGRRRPFIASGAVLVAVAGILIGYAADLGRVLGDKLEETVKVRAI  126

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
             IF +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGNI GYAAG+ 
Sbjct  127  CIFALGFWILDVANNTLQGPCRAFLADLAAGDARKTRTANAFFSFFMAVGNILGYAAGSY  186

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK  789
            + L+K F FT+T+ACD+YCANLKSCF +S ILLL VT  ++  V + Q++ +  + +  K
Sbjct  187  TNLHKIFPFTMTEACDIYCANLKSCFFLSIILLLFVTVSSLGYVKDKQWSPEEADSDV-K  245

Query  790  VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             PF GE+ GAFK + RPM +L+IVTALNWIAWF
Sbjct  246  TPFFGEVFGAFKVMERPMWMLIIVTALNWIAWF  278



>emb|CAA57727.1| sucrose transporter [Nicotiana tabacum]
Length=507

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 230/300 (77%), Gaps = 13/300 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME GT   +   +  VEQ L     ++ LWK+ +V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MENGTKKLNVS-SLAVEQPLP----KSKLWKIIMVASIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHKF+S IWLCGPISG+IVQP+VGYYSDNC++RFGRRR FI +GA LV  AV LIGFA
Sbjct  56   GIPHKFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRGFIAAGAALVTIAVFLIGFA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD+GH+TGDPLGK +KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG  ++ R +N
Sbjct  116  ADLGHATGDPLGKGSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGK-ARMRTSN  174

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ S L K F F+ T ACD+YCANLKSCF I+  LLL +T +A
Sbjct  175  AFFSFFMAVGNVLGYAAGSYSRLCKIFPFSKTPACDIYCANLKSCFFIAVFLLLSLTILA  234

Query  730  VTCVSEVQYTRKAVE-------GEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +T V E +   K            + KVPF GE+ GA K+LPRPM ILL+VT+LNWIA F
Sbjct  235  LTVVRENELPEKDEHEIDEKAGARKSKVPFFGEIFGALKDLPRPMWILLLVTSLNWIARF  294



>ref|XP_006390731.1| hypothetical protein EUTSA_v10018412mg [Eutrema salsugineum]
 gb|ESQ28017.1| hypothetical protein EUTSA_v10018412mg [Eutrema salsugineum]
Length=447

 Score =   369 bits (947),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 220/284 (77%), Gaps = 3/284 (1%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A E +  +E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWL
Sbjct  15   ALETQSSMEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWL  74

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGP+SG+IVQP+VGYYSD CT+RFGRRRPFI +GA +V  AV LIG+AADIGH  GD L 
Sbjct  75   CGPVSGMIVQPIVGYYSDRCTSRFGRRRPFIAAGAAMVAVAVFLIGYAADIGHKMGDKLE  134

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            +  + RA  IF +GFWILDVANN LQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+
Sbjct  135  QTPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKKTRVANAFFSFFMAVGNV  194

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+K F F +T ACD+YCANLK+CF +S  LLLIVT  ++  V + Q++  
Sbjct  195  LGYAAGSYTNLHKMFPFAMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVKDKQWSPS  254

Query  766  AVEGEEGK---VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             V  ++ K   VPF GE+ GAFK + RPM +LL+VTALNWIAWF
Sbjct  255  PVNDDDEKVSSVPFFGEIFGAFKVMKRPMWMLLVVTALNWIAWF  298



>gb|KEH25698.1| sucrose proton symporter 2 [Medicago truncatula]
Length=511

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 212/271 (78%), Gaps = 1/271 (0%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            P  +PL K+ VV++IAAG+QFGWALQLSLLTPYVQ LG+PH +SS IWLCGPISGL+VQP
Sbjct  28   PVSSPLRKMVVVASIAAGIQFGWALQLSLLTPYVQTLGVPHVWSSFIWLCGPISGLLVQP  87

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIF  438
            +VGYYSD  T+RFGRRRPFIFSGAL V  AV LIG+AAD+GHS GD L K T+PRA   F
Sbjct  88   IVGYYSDRSTSRFGRRRPFIFSGALAVAIAVFLIGYAADLGHSFGDDLSKKTRPRAVTFF  147

Query  439  IVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTL  618
            ++GFWILDVANNMLQGPCRA LADL+ GD  K R AN  FSFFMAVGNI GYAAG+ S L
Sbjct  148  VIGFWILDVANNMLQGPCRAFLADLAAGDEKKMRTANGFFSFFMAVGNILGYAAGSYSKL  207

Query  619  YKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV-EGEEGKVP  795
            +K F FT T+AC+V+CANLKSCF  S +LL+I+   A+  V +   T+  V + +E  V 
Sbjct  208  HKIFPFTETEACNVFCANLKSCFFFSILLLIILATFALIYVEDTPKTKPEVKDADETPVT  267

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              GEL GAFK L RPM IL++VTA+NWIAWF
Sbjct  268  CFGELFGAFKELKRPMWILMLVTAVNWIAWF  298



>ref|XP_002887046.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63305.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 221/298 (74%), Gaps = 11/298 (4%)
 Frame = +1

Query  1    KKKMEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYV  180
            KK + VG   SS             L   +PL K+  V++IAAG+QFGWALQLSLLTPYV
Sbjct  7    KKDVAVGDRQSSSSSM--------VLDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYV  58

Query  181  QLLGIPHKFSSLIWLC--GPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVI  354
            QLLG+PHK+SS IWLC  GPISGL+VQP VGY+SD C +RFGRRRPFI + ALLV  AVI
Sbjct  59   QLLGVPHKWSSFIWLCLCGPISGLLVQPSVGYFSDRCKSRFGRRRPFIATSALLVALAVI  118

Query  355  LIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSK  534
            LIGFAAD GH+ GD L +  K RA   F+VGFWILDVANN LQGPCRA L DL+ GD  K
Sbjct  119  LIGFAADFGHTMGDKLDEAVKMRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKK  178

Query  535  TRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLI  714
            TR AN +FSFFMAVGN+ GYAAG+ + L+K F FT+T A D+YCANLKSCFIIS  LLL+
Sbjct  179  TRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKAYDIYCANLKSCFIISITLLLV  238

Query  715  VTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            VT +A+  V + Q++ KA + E  K PF GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  239  VTIIALWYVEDKQWSPKA-DSENDKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  295



>ref|XP_010491171.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=494

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 215/275 (78%), Gaps = 2/275 (1%)
 Frame = +1

Query  64   DLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISG  243
            DL+  P   PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SSLIWLCGP+SG
Sbjct  24   DLDDGP--APLRKMIAVTSIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSLIWLCGPVSG  81

Query  244  LIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPR  423
            L+VQP VGY+SD C +RFGRRRPFI +GALLV  AV LIG+AADIGH  GD L    K  
Sbjct  82   LLVQPTVGYFSDRCQSRFGRRRPFIATGALLVAVAVFLIGYAADIGHRMGDKLDDHVKSS  141

Query  424  ATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAG  603
            A  IF +GFWILDVANN LQGPCRA L DL+ GD  KT++AN  FSFFMAVGN+ GYAAG
Sbjct  142  AVGIFALGFWILDVANNTLQGPCRAFLGDLAAGDARKTQIANAFFSFFMAVGNVLGYAAG  201

Query  604  AQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEE  783
            + + L+K F FT+T ACD+YCANLKSCF +S  LL++VT++++  V + Q++ K    E+
Sbjct  202  SYTHLHKIFPFTVTKACDIYCANLKSCFFLSITLLVVVTSISLWYVEDKQWSPKPDSEED  261

Query  784  GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             K PF GE+ GAFK + RPM +LLIVT+LNWIAWF
Sbjct  262  KKTPFFGEIFGAFKVMKRPMWMLLIVTSLNWIAWF  296



>ref|XP_010428037.1| PREDICTED: sucrose transport protein SUC1-like [Camelina sativa]
Length=515

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/291 (62%), Positives = 221/291 (76%), Gaps = 4/291 (1%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            S+    A E +Q  E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  9    STKDAAALETQQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKW  68

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            SSLIWLCGP+SG+IVQP+VG++SD CT+RFGRRRPFI +GA+LV  AV LIG+AAD+G  
Sbjct  69   SSLIWLCGPVSGMIVQPIVGFHSDRCTSRFGRRRPFIATGAVLVAVAVFLIGYAADLGSK  128

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L +  K RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN  FSFF
Sbjct  129  MGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFF  188

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+ + L++ F FT T ACD+YCANLK+CF +S  LLLIVT  ++  V +
Sbjct  189  MAVGNVLGYAAGSYTNLHRMFPFTRTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVKD  248

Query  748  VQYTRKAVEGEEGK----VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             Q++  A   +E +    VP  GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  249  KQWSPPARNPDEDEKTSGVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  299



>gb|AHA80795.2| sucrose transport protein 1 [Paeonia suffruticosa]
Length=519

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 229/292 (78%), Gaps = 11/292 (4%)
 Frame = +1

Query  46   AFEVEQDLEAL-PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIW  222
            +F+++Q  + L P E+P+ K+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IW
Sbjct  12   SFQIQQQEDPLQPAESPVKKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIW  71

Query  223  LCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL  402
            LCGPISG++VQP+VGY+SD C++RFGRRRPFI +GA LV  AV LIGFAAD+GH  GD  
Sbjct  72   LCGPISGMVVQPVVGYHSDRCSSRFGRRRPFIAAGAGLVGIAVFLIGFAADLGHLFGDNF  131

Query  403  GKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGN  582
             +  KPRA  +F+VGFWILDVANNMLQGPCRALLADLSG +  +TR +N L+SFFMAVGN
Sbjct  132  KESLKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGNNQKRTRTSNALYSFFMAVGN  191

Query  583  IGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTR  762
            + GYAAG+   +YK F FT T ACD+YCANLKSCFIIS +LL+ +T +A+T V+E+  ++
Sbjct  192  VLGYAAGSFRQMYKIFPFTKTHACDIYCANLKSCFIISIVLLMTLTILALTMVTEIPLSK  251

Query  763  KA---------VEGEEGK-VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +         +E EEGK  PF+ ++L A K + +PM +LL+VT LNWIAWF
Sbjct  252  LSPRKTDNNGDIEEEEGKSAPFLVQMLAALKEMKKPMWVLLLVTCLNWIAWF  303



>emb|CDY12517.1| BnaC07g13570D [Brassica napus]
Length=508

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 220/288 (76%), Gaps = 3/288 (1%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            +S+G  A E +     L +   L K+  VS+IAAGVQFGWALQLSLLTPYVQLLGI HK+
Sbjct  4    ASNGTSALETQT--AELDQPAALRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIQHKW  61

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            +SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AAD+GHS
Sbjct  62   ASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADLGHS  121

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD + K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSFF
Sbjct  122  MGDQINKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFF  181

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LL++VT V++  V+E
Sbjct  182  MAVGNVLGYAAGSYRDLYKMVPFTMTESCDLYCANLKTCFFLSITLLVLVTFVSLCYVTE  241

Query  748  VQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              +T     EG+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  242  KPWTPEPTAEGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  289



>emb|CDX80991.1| BnaC03g02450D [Brassica napus]
Length=477

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/273 (66%), Positives = 214/273 (78%), Gaps = 1/273 (0%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            + L E +P+ K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++
Sbjct  7    DELGEPSPMRKMISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGML  66

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP VGYYSD CT++FGRRRPFI SGA+LV  A ILIG+AAD+G   GD L +  K RA 
Sbjct  67   VQPTVGYYSDRCTSKFGRRRPFIASGAVLVAVAGILIGYAADLGRVLGDKLEETVKVRAI  126

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
             IF +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ 
Sbjct  127  CIFALGFWILDVANNTLQGPCRAFLADLAAGDARKTRTANAFFSFFMAVGNVLGYAAGSY  186

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK  789
            + L+K F FT+T ACD+YCANLKSCF +S ILLL VT  ++  V + Q + +  + +  K
Sbjct  187  TNLHKMFPFTMTKACDIYCANLKSCFFLSIILLLFVTVSSLWYVKDKQLSPEEADSDV-K  245

Query  790  VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             PF GE+ GAFK + RPM +L+IVTALNWIAWF
Sbjct  246  TPFFGEVFGAFKVMERPMWMLIIVTALNWIAWF  278



>ref|XP_008245088.1| PREDICTED: sucrose transport protein [Prunus mume]
Length=511

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 217/274 (79%), Gaps = 8/274 (3%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PL K+ +V++IAAGVQFGWALQLSLLTPY+QLLG+PH +S+ +WLCGPISG+IVQP+VGY
Sbjct  16   PLPKIILVASIAAGVQFGWALQLSLLTPYIQLLGVPHTWSAFVWLCGPISGMIVQPIVGY  75

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD CT+RFGRRRPFI +GA LV  +V LIG+AADIG  +GD L K TKPRA  +F+VGF
Sbjct  76   HSDRCTSRFGRRRPFIAAGAALVASSVFLIGYAADIGPLSGDSLEKSTKPRAVAVFVVGF  135

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRALLAD+SG D  + R AN+LF+FFMAVGN+ GYAAGA S L+K F
Sbjct  136  WILDVANNMLQGPCRALLADISGDDPRRMRTANSLFAFFMAVGNVLGYAAGAYSHLHKMF  195

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV-EGE-------EG  786
             FT+T ACDVYCANLKSCF +S  LLL++T VA+T V E       V EGE         
Sbjct  196  PFTITKACDVYCANLKSCFFLSITLLLVLTIVALTSVKETTPNDGVVAEGEIEPQSTTAK  255

Query  787  KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +PF G+++ AF+ L RPML+LL+VT LNWIAWF
Sbjct  256  SLPFFGQMIAAFRELQRPMLVLLLVTCLNWIAWF  289



>ref|XP_010428038.1| PREDICTED: sucrose transport protein SUC5-like [Camelina sativa]
Length=512

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 222/288 (77%), Gaps = 1/288 (0%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            +++G    E++   E L + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  10   AANGAAGLEIQSAPEDLNQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKW  69

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            S+ +WLCGPISG++VQP+VGY+SD C +RFGRRRPFI  GA+LV  +V LIGF+AD+GHS
Sbjct  70   SAYMWLCGPISGILVQPIVGYHSDRCESRFGRRRPFIAVGAVLVAISVFLIGFSADLGHS  129

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD +    K RA +IF VGFWILDVANN LQGPCRA LADL+ GD  KTRLAN  FSFF
Sbjct  130  FGDKIDDKVKTRAIIIFTVGFWILDVANNTLQGPCRAFLADLAAGDAKKTRLANACFSFF  189

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+   ++K F FT+T+ACD+YCANLKSCF +S  LLLIVT  ++T V E
Sbjct  190  MAVGNVMGYAAGSYPHIHKMFPFTMTNACDIYCANLKSCFFLSITLLLIVTFTSLTYVKE  249

Query  748  VQYTRKAV-EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             ++T+  V +G+   V F GE++ A K + RPM +LLIVT  NWIAWF
Sbjct  250  KKWTKPPVDDGKTSGVFFFGEIVRALKVMERPMWMLLIVTVFNWIAWF  297



>ref|XP_010460033.1| PREDICTED: sucrose transport protein SUC2-like [Camelina sativa]
Length=516

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/293 (63%), Positives = 221/293 (75%), Gaps = 7/293 (2%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             +++G GA E +      PE   L K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    KAANGVGALETQMGELDQPER--LRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHK  65

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH
Sbjct  66   WASLIWLCGPISGMLVQPVVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGH  125

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            S GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSF
Sbjct  126  SMGDQLNKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSF  185

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLL+VT V++  V 
Sbjct  186  FMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLLVTFVSLCYVK  245

Query  745  EVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV----TALNWIAWF  888
            E  +T     +G+   VPF GE+ GAFK L RPM +LLIV    TALNWIAWF
Sbjct  246  EKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALXTALNWIAWF  298



>emb|CAC19689.1| sucrose/proton symporter [Daucus carota]
Length=515

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 223/297 (75%), Gaps = 7/297 (2%)
 Frame = +1

Query  13   EVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLG  192
            E+         A +++  ++ +P  T  WKL +V+AIAAGVQFGWALQLSLLTPYVQLLG
Sbjct  7    ELNKPQPPSSAAMQLQTPVQKIPTAT--WKLVLVAAIAAGVQFGWALQLSLLTPYVQLLG  64

Query  193  IPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAA  372
            IPHK+++ IWLCGPISG++VQP+VGYYSD+C + FGRRRPFI SGA  V  +VILIGFAA
Sbjct  65   IPHKWAAYIWLCGPISGMLVQPIVGYYSDHCQSSFGRRRPFIASGAGCVAISVILIGFAA  124

Query  373  DIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANT  552
            DI +  GD + K  KPRA  +F++GFWILDVANNMLQGPCRALLADL  GD  + R AN 
Sbjct  125  DISYKAGDDMSKTLKPRAVTVFVIGFWILDVANNMLQGPCRALLADLCSGDTRRMRSANA  184

Query  553  LFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAV  732
             +SFFMAVGNI GYAAG+ + LYK F F+ T ACD+YCANLKSCFIIS  LL+I+T VA+
Sbjct  185  FYSFFMAVGNILGYAAGSYNNLYKLFPFSKTHACDLYCANLKSCFIISIALLIIITVVAL  244

Query  733  TCVSEVQYTRKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + V E        +  E     GK+P  GELLGA K+LPRPML+LLIVT LNWIAWF
Sbjct  245  SVVRENSGPPDDADAAEEPPSSGKIPVFGELLGALKDLPRPMLLLLIVTCLNWIAWF  301



>emb|CAA76369.1| sucrose/H+ symporter [Daucus carota]
Length=515

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 223/297 (75%), Gaps = 7/297 (2%)
 Frame = +1

Query  13   EVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLG  192
            E+         A +++  ++ +P  T  WKL +V+AIAAGVQFGWALQLSLLTPYVQLLG
Sbjct  7    ELNKPQPPSSAAMQLQTPVQKIPTAT--WKLVLVAAIAAGVQFGWALQLSLLTPYVQLLG  64

Query  193  IPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAA  372
            IPHK+++ IWLCGPISG++VQP+VGYYSD+C + FGRRRPFI SGA  V  +VILIGFAA
Sbjct  65   IPHKWAAYIWLCGPISGMLVQPIVGYYSDHCQSSFGRRRPFIASGAGCVAISVILIGFAA  124

Query  373  DIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANT  552
            DI +  GD + K  KPRA  +F++GFWILDVANNMLQGPCRALLADL  GD  + R AN 
Sbjct  125  DISYKAGDDMSKTLKPRAVTVFVIGFWILDVANNMLQGPCRALLADLCSGDTRRMRSANA  184

Query  553  LFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAV  732
             +SFFMAVGNI GYAAG+ + LYK F F+ T ACD+YCANLKSCFIIS  LL+I+T VA+
Sbjct  185  FYSFFMAVGNILGYAAGSYNNLYKLFPFSKTHACDLYCANLKSCFIISIALLIIITVVAL  244

Query  733  TCVSEVQYTRKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + V E        +  E     GK+P  GELLGA K+LPRPML+LLIVT LNWIAWF
Sbjct  245  SVVRENSGPPDDADAAEEPPSSGKIPVFGELLGALKDLPRPMLLLLIVTCLNWIAWF  301



>ref|XP_006302149.1| hypothetical protein CARUB_v10020153mg [Capsella rubella]
 gb|EOA35047.1| hypothetical protein CARUB_v10020153mg [Capsella rubella]
Length=514

 Score =   368 bits (945),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 221/297 (74%), Gaps = 15/297 (5%)
 Frame = +1

Query  43   GAFEVE-----------QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            GAFE E           Q  E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  2    GAFETEKSSKDAAGLETQSSEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLL  61

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK+SSLIWLCGP+SG+IVQP+VG++SD CT+RFGRRRPFI SGA LV  AV LIG+A
Sbjct  62   GIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCTSRFGRRRPFIASGAALVAVAVFLIGYA  121

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIG+  GD L +  K RA  IF +GFWILDVANN LQGPCRA LADL+ GD  KTR+AN
Sbjct  122  ADIGNKMGDKLDQKIKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKKTRVAN  181

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  +
Sbjct  182  AFFSFFMAVGNVLGYAAGSYTDLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTS  241

Query  730  VTCVSEVQYT---RKAVEGEE-GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V + Q++   R   + E    VP  GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  242  LWYVKDKQWSPPPRNPDDDENTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  298



>ref|XP_006390730.1| hypothetical protein EUTSA_v10018412mg [Eutrema salsugineum]
 gb|ESQ28016.1| hypothetical protein EUTSA_v10018412mg [Eutrema salsugineum]
Length=514

 Score =   368 bits (945),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 220/284 (77%), Gaps = 3/284 (1%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A E +  +E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWL
Sbjct  15   ALETQSSMEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWL  74

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGP+SG+IVQP+VGYYSD CT+RFGRRRPFI +GA +V  AV LIG+AADIGH  GD L 
Sbjct  75   CGPVSGMIVQPIVGYYSDRCTSRFGRRRPFIAAGAAMVAVAVFLIGYAADIGHKMGDKLE  134

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            +  + RA  IF +GFWILDVANN LQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+
Sbjct  135  QTPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKKTRVANAFFSFFMAVGNV  194

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+K F F +T ACD+YCANLK+CF +S  LLLIVT  ++  V + Q++  
Sbjct  195  LGYAAGSYTNLHKMFPFAMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVKDKQWSPS  254

Query  766  AVEGEEGK---VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             V  ++ K   VPF GE+ GAFK + RPM +LL+VTALNWIAWF
Sbjct  255  PVNDDDEKVSSVPFFGEIFGAFKVMKRPMWMLLVVTALNWIAWF  298



>gb|ACB47398.1| sucrose transporter [Brassica napus]
Length=508

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 219/294 (74%), Gaps = 6/294 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME G++ S+      +E     L +   L K+  VS+IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEKGSNGSA-----ALEMQTSELDQPAALRKIISVSSIAAGVQFGWALQLSLLTPYVQLL  55

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+A
Sbjct  56   GIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYA  115

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIGHS GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN
Sbjct  116  ADIGHSMGDQLDKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTAN  175

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+   LYK   FT+T +CD+YCANLK+CF +S  LL++VT ++
Sbjct  176  AFFSFFMAVGNVLGYAAGSYKNLYKVVPFTMTKSCDLYCANLKTCFFLSITLLVLVTFIS  235

Query  730  VTCVSEVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V E  +T     +GE   VPF GE+ GAFK L RPM +LLIVTAL  IAWF
Sbjct  236  LCYVKEKPWTPEPTADGEASSVPFFGEIFGAFKELKRPMWMLLIVTALRGIAWF  289



>ref|NP_179074.1| sucrose transport protein SUC8 [Arabidopsis thaliana]
 sp|Q9ZVK6.1|SUC8_ARATH RecName: Full=Sucrose transport protein SUC8; AltName: Full=Sucrose 
permease 8; AltName: Full=Sucrose-proton symporter 8 
[Arabidopsis thaliana]
 gb|AAC69375.1| putative sucrose-proton symporter [Arabidopsis thaliana]
 gb|AEC06318.1| sucrose transport protein SUC8 [Arabidopsis thaliana]
Length=492

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/279 (66%), Positives = 218/279 (78%), Gaps = 1/279 (0%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            +    L  L   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWLCG
Sbjct  16   QSSSSLADLDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCG  75

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            P+SGL+VQP VGY+SD CT+RFGRRRPFI +GALLV  AV+LIG+AAD GHS GD + K 
Sbjct  76   PVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKP  135

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
             K RA VIF +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ G
Sbjct  136  VKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLG  195

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+ + LYK F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA 
Sbjct  196  YAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKA-  254

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + +  K PF GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  255  DSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  293



>ref|XP_010471204.1| PREDICTED: sucrose transport protein SUC1 [Camelina sativa]
Length=514

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 221/291 (76%), Gaps = 5/291 (2%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
            S+    A E  Q  E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  9    STKDAAALET-QSPEDFNQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKW  67

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            SSLIWLCGPISG+IVQP+VG++SD CT+RFGRRRPFI +GA LV  AV LIG+AADIG+ 
Sbjct  68   SSLIWLCGPISGMIVQPIVGFHSDRCTSRFGRRRPFIATGAALVAVAVFLIGYAADIGNK  127

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L +  K RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN  FSFF
Sbjct  128  MGDKLDQKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFF  187

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  ++  V +
Sbjct  188  MAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVKD  247

Query  748  VQYTRKAVEGEEGK----VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             Q++  A   ++ +    VP  GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  248  KQWSPPARNPDDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  298



>ref|XP_006399085.1| hypothetical protein EUTSA_v10015600mg [Eutrema salsugineum]
 gb|ESQ40538.1| hypothetical protein EUTSA_v10015600mg [Eutrema salsugineum]
Length=496

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/269 (66%), Positives = 214/269 (80%), Gaps = 1/269 (0%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++VQP 
Sbjct  30   EPSPLRKMISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMLVQPT  89

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD CT+RFGRRRPFI +GA+LV  A ILIG+AAD+G  TGD L +  K RA   F 
Sbjct  90   VGYYSDRCTSRFGRRRPFIATGAVLVAVAGILIGYAADLGQLTGDKLEQTIKKRAIWFFA  149

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + L+
Sbjct  150  LGFWILDVANNTLQGPCRAFLADLAAGDARKTRTANAFFSFFMAVGNVLGYAAGSYTNLH  209

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT+T+ACD+YCANLKSCF IS ILLL +T  ++  V + Q++ +  + +  K PF 
Sbjct  210  KIFPFTMTNACDIYCANLKSCFFISIILLLGLTIASLLYVKDKQWSPEKGDSDV-KTPFF  268

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE+ GAF+ + RPM +L+IVTALNWIAWF
Sbjct  269  GEIFGAFRVMKRPMWMLIIVTALNWIAWF  297



>ref|XP_010471205.1| PREDICTED: sucrose transport protein SUC5-like [Camelina sativa]
Length=512

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 218/280 (78%), Gaps = 1/280 (0%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E++  LE   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+S+ +WLCG
Sbjct  18   EIQLSLEDPNQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSAYMWLCG  77

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG++VQP+VGY+SD C +RFGRRRPFI  GA+LV  +V LIGF+AD+GH  GD + + 
Sbjct  78   PISGILVQPIVGYHSDRCESRFGRRRPFIAVGAVLVAISVFLIGFSADLGHRFGDKIEEK  137

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
             K RA +IF VGFWILDVANN LQGPCRA LADL+ GD  KTRLAN  FSFFMAVGN+ G
Sbjct  138  VKTRAIIIFTVGFWILDVANNTLQGPCRAFLADLAAGDAKKTRLANACFSFFMAVGNVMG  197

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+   ++K F FTLT ACD+YCANLKSCF +S  LLLIVT  ++T V E ++T+  V
Sbjct  198  YAAGSYPHIHKMFPFTLTKACDIYCANLKSCFFLSITLLLIVTFASLTYVKEKKWTKPPV  257

Query  772  -EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +G+   V F GE++GA K + RPM +LLIVT  NWIAWF
Sbjct  258  DDGKTSGVFFFGEIVGALKVMERPMWMLLIVTFFNWIAWF  297



>gb|ABB89051.1| putative sucrose transporter SUT3 [Apium graveolens Dulce Group]
Length=515

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/284 (65%), Positives = 217/284 (76%), Gaps = 6/284 (2%)
 Frame = +1

Query  49   FEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLC  228
             +++     LP  TP WKL +V+AIAAGVQFGWALQLSLLTPYVQLLGIPHK+++ IWLC
Sbjct  20   MQIQAPPTVLP--TPTWKLILVAAIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAYIWLC  77

Query  229  GPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGK  408
            GPISG++VQP+VGYYSD C + FGRRRP+I SGA  V  +VILIGFAADIG+  GD + K
Sbjct  78   GPISGMLVQPIVGYYSDRCQSSFGRRRPYIASGAACVTISVILIGFAADIGYKAGDDMTK  137

Query  409  VTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIG  588
              KPRA  +F++GFWILDVANNMLQGPCRALLADL   D  + R AN  FSFFMAVGNI 
Sbjct  138  HLKPRAVTVFVIGFWILDVANNMLQGPCRALLADLCISDTRRMRSANAFFSFFMAVGNIL  197

Query  589  GYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT---  759
            GYAAG+ + LYK F F+ T ACD+YCANLKSCFIIS  LL+ +T VA+T V E Q+T   
Sbjct  198  GYAAGSYNDLYKIFPFSKTHACDLYCANLKSCFIISIALLISITVVALTLVREKQWTPEE  257

Query  760  -RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                     GK+P  GEL GA K+LPRPMLILL+VT LNWIAWF
Sbjct  258  FSSEESPSSGKIPVFGELFGALKDLPRPMLILLLVTCLNWIAWF  301



>gb|EYU22864.1| hypothetical protein MIMGU_mgv1a004602mg [Erythranthe guttata]
Length=518

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 227/298 (76%), Gaps = 5/298 (2%)
 Frame = +1

Query  10   MEVGTSSSSG-GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQL  186
            MEV  S ++    +F+++Q         PL K+ +V+AIAAGVQFGWALQLSLLTPYVQL
Sbjct  1    MEVKNSGATATSSSFQLQQQNPPPLAAEPLRKIILVAAIAAGVQFGWALQLSLLTPYVQL  60

Query  187  LGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGF  366
            LGIPH +++ IWLCGP+SGL+VQP+VGYYSDNCT+RFGRRRPFI +G  LV  AV LIGF
Sbjct  61   LGIPHTWAAFIWLCGPVSGLLVQPIVGYYSDNCTSRFGRRRPFIAAGTALVAVAVFLIGF  120

Query  367  AADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLA  546
            AAD+GH+ GD  GK +KPRA  +F+VGFWILDVANNMLQGPCRALLADLSGG+  K   A
Sbjct  121  AADLGHAAGDSTGKGSKPRAITVFVVGFWILDVANNMLQGPCRALLADLSGGNARKMSAA  180

Query  547  NTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAV  726
            N+L+SFFMAVGN+ GYAAGA + LY+ F F+ T ACD+YCANLKSCF+IS  LL+ +T +
Sbjct  181  NSLYSFFMAVGNVLGYAAGAYTRLYRIFPFSKTSACDLYCANLKSCFLISIALLVTLTVL  240

Query  727  AVTCVSE----VQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            A+T V E         +A   ++   P  GEL GA K+LPRPM +LL+VT LNWIAWF
Sbjct  241  ALTMVHEKAAAASPPEQAATVKKRGFPVFGELFGALKDLPRPMWMLLLVTCLNWIAWF  298



>ref|XP_006392340.1| hypothetical protein EUTSA_v10023916mg [Eutrema salsugineum]
 gb|ESQ29626.1| hypothetical protein EUTSA_v10023916mg [Eutrema salsugineum]
Length=496

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/270 (66%), Positives = 214/270 (79%), Gaps = 3/270 (1%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++VQP 
Sbjct  30   EPSPLRKMISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMLVQPT  89

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD CT+RFGRRRPFI +GA+LV  A ILIG+AAD+G   GD L +  K RA   F 
Sbjct  90   VGYYSDRCTSRFGRRRPFIATGAVLVAVAGILIGYAADLGQMAGDKLEQTPKKRAIWFFA  149

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + L+
Sbjct  150  LGFWILDVANNTLQGPCRAFLADLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLH  209

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-KVPF  798
            K F FT+T+ACD+YCANLKSCF IS ILLL +T  ++  V + Q++ +  +G+   K PF
Sbjct  210  KIFPFTMTNACDIYCANLKSCFFISIILLLSLTVASLLYVKDKQWSPE--KGDSNVKTPF  267

Query  799  VGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             GE+ GAF+ + RPM +L+IVTALNWIAWF
Sbjct  268  FGEIFGAFRVMKRPMWMLIIVTALNWIAWF  297



>ref|XP_007009466.1| Sucrose transport protein SUC2 [Theobroma cacao]
 gb|EOY18276.1| Sucrose transport protein SUC2 [Theobroma cacao]
Length=488

 Score =   365 bits (937),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/278 (67%), Positives = 214/278 (77%), Gaps = 4/278 (1%)
 Frame = +1

Query  55   VEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGP  234
            +E  LEA     PLWK+ VV+AIAAGVQFGWALQLSLLTPYVQ LG+PH +++ IWLCGP
Sbjct  1    MEDGLEA---PGPLWKIIVVAAIAAGVQFGWALQLSLLTPYVQTLGVPHIWAAFIWLCGP  57

Query  235  ISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVT  414
            ISGL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA DIGH  GD L K T
Sbjct  58   ISGLLVQPIVGYNSDRCTSRFGRRRPFIAAGACCVAAAVFLIGFAKDIGHKAGDSLEKNT  117

Query  415  KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGY  594
            KPRA  +F+ GFWILDVANNMLQGPCRALLADLS  +  + R+AN  FSFFMAVGN+ GY
Sbjct  118  KPRAVAVFVAGFWILDVANNMLQGPCRALLADLSANNHKRMRVANECFSFFMAVGNVLGY  177

Query  595  AAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVE  774
            AAG+ S L+K F FT T ACDVYCANLK+CFII  + LL+VT  A+  V E   + K  E
Sbjct  178  AAGSYSNLHKIFPFTRTTACDVYCANLKTCFIIHIVFLLLVTITAIISVKETPLSMKQ-E  236

Query  775  GEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E+   PFVGELL AFK+L +PM ILL+VT LNWIAWF
Sbjct  237  EEKASTPFVGELLTAFKSLKKPMWILLLVTCLNWIAWF  274



>gb|KHG14831.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=494

 Score =   365 bits (937),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 176/269 (65%), Positives = 205/269 (76%), Gaps = 3/269 (1%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            P+W + +VSAIAAG+QFGWALQLSLLTPYVQ LG+PH +++ IWLCGPISGL+VQP+VGY
Sbjct  13   PIWNIVMVSAIAAGIQFGWALQLSLLTPYVQTLGVPHVWAAFIWLCGPISGLLVQPIVGY  72

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD+CT+R GRRRPFI +GA LV  AV  IGFA DIGH  GD L   TKPRA  +F+ GF
Sbjct  73   FSDHCTSRIGRRRPFIAAGACLVAMAVFFIGFAKDIGHRAGDSLDNPTKPRAVAVFVTGF  132

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRA LADLSG D  + R+AN  FSFFMA+GN+ GYAAG+ S LYK  
Sbjct  133  WILDVANNMLQGPCRAFLADLSGNDHKRMRIANGWFSFFMAIGNVLGYAAGSYSNLYKLL  192

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV--EGEEGKV-PFV  801
             FT T ACDVYCANLK+CFII  + LL VT  A+T V E          EGE G   PF+
Sbjct  193  PFTTTTACDVYCANLKTCFIIDIVFLLSVTTTAITTVKETPLKSNGSLDEGEGGSSEPFI  252

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE++ AFK L +PM ILL+VT LNWIAWF
Sbjct  253  GEIVTAFKTLKKPMWILLLVTCLNWIAWF  281



>ref|XP_006285493.1| hypothetical protein CARUB_v10006922mg [Capsella rubella]
 gb|EOA18391.1| hypothetical protein CARUB_v10006922mg [Capsella rubella]
Length=494

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 175/273 (64%), Positives = 209/273 (77%), Gaps = 0/273 (0%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            +A+   + + K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWLCGP+SGL+
Sbjct  24   KAVDGSSSMKKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLL  83

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP VGYYSD C +RFGRRRPFI  GA LV  AV LIGFAAD GHS GD L    K +A 
Sbjct  84   VQPTVGYYSDRCQSRFGRRRPFIAIGAFLVAVAVFLIGFAADFGHSLGDKLEDRVKGKAV  143

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
            VIF +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ 
Sbjct  144  VIFALGFWILDVANNTLQGPCRAFLGDLAAGDARKTRTANAAFSFFMAVGNVLGYAAGSY  203

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK  789
            + L+K F FT+T ACD+YCANLKSCF +S  LLL VT +++  V + Q++ K    ++ K
Sbjct  204  TNLHKIFPFTITKACDLYCANLKSCFFLSITLLLFVTIISLWYVEDKQWSPKEDSEDDKK  263

Query  790  VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             PF GEL GAFK + RPM +LLI T+LNWIAWF
Sbjct  264  TPFFGELFGAFKVMKRPMWMLLITTSLNWIAWF  296



>ref|XP_010419159.1| PREDICTED: sucrose transport protein SUC5-like, partial [Camelina 
sativa]
Length=500

 Score =   365 bits (937),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/274 (65%), Positives = 217/274 (79%), Gaps = 1/274 (0%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            E L + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+S+ +WLCGPISG++
Sbjct  12   EDLNQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSAYMWLCGPISGIL  71

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP+VGY+SD C +RFGRRRPFI  GA+LV  +V LIGF+AD+GHS GD + +  K RA 
Sbjct  72   VQPIVGYHSDRCESRFGRRRPFIAVGAVLVAISVFLIGFSADLGHSFGDKIEEKVKTRAI  131

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
            +IF VGFWILDVANN LQGPCRA LADL+ GD  KTRLAN  FSFFMAVGN+ GYAAG+ 
Sbjct  132  IIFTVGFWILDVANNTLQGPCRAFLADLAAGDSKKTRLANACFSFFMAVGNVMGYAAGSY  191

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV-EGEEG  786
              ++K F FTLT+ACD+YCANLKSCF +S  LLLIVT  ++T V E ++T+  V +G+  
Sbjct  192  PHIHKMFPFTLTNACDIYCANLKSCFFLSITLLLIVTFASLTYVKEKKWTKPPVDDGKTS  251

Query  787  KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             V F GE++GA K + RPM +LLIVT  NWIAWF
Sbjct  252  GVFFFGEIVGALKVMERPMWMLLIVTFFNWIAWF  285



>gb|AAL58071.1| sucrose transporter SUC1 [Brassica oleracea]
 gb|AEG89530.1| sucrose transporter [Brassica napus]
 emb|CDX82207.1| BnaC02g20830D [Brassica napus]
Length=513

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/290 (63%), Positives = 224/290 (77%), Gaps = 2/290 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
            +++    A E +  LE   + +PL K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    NTAKDAAALETQSSLEEFNQPSPLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHK  67

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            +SSLIWLCGP+SG+IVQP+VG++SD CT+RFGRRRPFI +GA +V  AV LIG+AADIG+
Sbjct  68   WSSLIWLCGPVSGMIVQPIVGFHSDRCTSRFGRRRPFIAAGAAMVAVAVFLIGYAADIGY  127

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
              GD L +  + RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN  FSF
Sbjct  128  KMGDKLEQTPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSF  187

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+ + L+K F F +T+ACD+YCANLKSCF +S  LLLIVT  ++  V 
Sbjct  188  FMAVGNVLGYAAGSFTNLHKMFPFAMTNACDLYCANLKSCFFLSITLLLIVTVTSLWYVK  247

Query  745  EVQYTRKAVEGEEGK--VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + Q++   V  +E K  VPF GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  248  DKQWSPPPVAADEEKKSVPFFGEIFGAFKVMERPMWMLLIVTALNWIAWF  297



>gb|KFK44362.1| hypothetical protein AALP_AA1G247500 [Arabis alpina]
Length=513

 Score =   365 bits (938),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 186/288 (65%), Positives = 220/288 (76%), Gaps = 1/288 (0%)
 Frame = +1

Query  28   SSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKF  207
              +  GA  +E     L + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+
Sbjct  7    EKAANGAAALETQTAELDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKW  66

Query  208  SSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHS  387
            +SLIWLCGPISG++VQP+VGYYSD CT+RFGRRRPFI +GA LV  AV LIG+AADIGHS
Sbjct  67   ASLIWLCGPISGMLVQPVVGYYSDCCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHS  126

Query  388  TGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFF  567
             GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSFF
Sbjct  127  MGDKLDKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFF  186

Query  568  MAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE  747
            MAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLL+VT V++  V E
Sbjct  187  MAVGNVLGYAAGSYKNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLLVTVVSLCYVEE  246

Query  748  VQ-YTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             Q +     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  247  KQWFPEPTADGKVSNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  294



>ref|XP_006416169.1| hypothetical protein EUTSA_v10009321mg [Eutrema salsugineum]
 gb|ESQ34522.1| hypothetical protein EUTSA_v10009321mg [Eutrema salsugineum]
Length=503

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 220/296 (74%), Gaps = 16/296 (5%)
 Frame = +1

Query  4    KKMEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
             +ME    +S+G  A E++     L + +PL K+  V++IAAGVQFGWALQLSLLTPYVQ
Sbjct  4    HQME---KASNGTAALEMQTG--ELDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQ  58

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPHK++SLIWLCGPISG++VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG
Sbjct  59   LLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIG  118

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AADIGHS GD L K  + RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR 
Sbjct  119  YAADIGHSMGDQLNKPPRTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRT  178

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  FSFFMAVGN+ GYAAG+   LYK   FT+T++CD+YCANLK+CF +S  LLL+   
Sbjct  179  ANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLL---  235

Query  724  VAVTCVSEVQYT-RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                   E  +T     +G+   VPF GE+ GAFK L RPM +LLIVTALNWIAWF
Sbjct  236  -------EKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWF  284



>gb|KEH32639.1| sucrose transporter 2 [Medicago truncatula]
Length=463

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/281 (61%), Positives = 215/281 (77%), Gaps = 0/281 (0%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            + +VE++  A  +  PL K+ VV++IAAG+QFGWALQLSLLTPY+QLLG+PHK+++ IWL
Sbjct  17   SLQVEEEEAADQKPCPLRKMIVVASIAAGIQFGWALQLSLLTPYIQLLGVPHKWAANIWL  76

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISG+IVQP+VGYYSD   +RFGRRRPFIFSG+L V  AV  IG+AAD+G+S GD L 
Sbjct  77   CGPISGMIVQPIVGYYSDRSHSRFGRRRPFIFSGSLAVAIAVFFIGYAADLGYSMGDDLS  136

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            K T+PRA VIFI+GFW+LDVANNMLQGPCRA L DL+ GD  + R+ N +FSFFMAVGNI
Sbjct  137  KKTRPRAVVIFILGFWVLDVANNMLQGPCRAFLGDLAAGDHRRMRMGNAMFSFFMAVGNI  196

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ S LY  F FT T ACDV+CANLK+CF +S  LL +V++ A+  V ++    K
Sbjct  197  LGYAAGSFSKLYHMFPFTQTKACDVFCANLKTCFFLSIFLLALVSSFALYYVEDIPLQSK  256

Query  766  AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 +  V   GELL AF  L +PM +L+IVTA+NW+AWF
Sbjct  257  PQSQSKDDVGCFGELLSAFSGLKKPMWMLMIVTAINWVAWF  297



>ref|XP_002526849.1| sucrose transport protein, putative [Ricinus communis]
 gb|EEF35584.1| sucrose transport protein, putative [Ricinus communis]
Length=533

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 220/284 (77%), Gaps = 12/284 (4%)
 Frame = +1

Query  73   ALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIV  252
            A P  +PL K+ +V++IAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++V
Sbjct  28   AEPNSSPLRKVVMVASIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLV  87

Query  253  QPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATV  432
            QP+VGY+SD CT+RFGRRRPFI SGA  V  AV LIG+AAD+GH +GD L K  K RA  
Sbjct  88   QPIVGYHSDRCTSRFGRRRPFIASGAAFVAIAVFLIGYAADLGHLSGDSLDKSPKTRAIA  147

Query  433  IFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQS  612
            IF+VGFWILDVANNMLQGPCRALLADLSG    KTR AN LFSFFMAVGN+ GYAAGA +
Sbjct  148  IFVVGFWILDVANNMLQGPCRALLADLSGTSQKKTRTANALFSFFMAVGNVLGYAAGAYT  207

Query  613  TLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT-RKAVEGEEGK  789
             LYK F FT T ACDVYCANLKSCF IS +LLL +T +A++ V E  ++  +AV+  E  
Sbjct  208  HLYKLFPFTKTTACDVYCANLKSCFFISIVLLLSLTVLALSYVKEKPWSPDQAVDNAEDD  267

Query  790  -----------VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                       +PF GE+LGAFKNL RPM ILL+VT LNWIAWF
Sbjct  268  TASQASSSAQPMPFFGEILGAFKNLKRPMWILLLVTCLNWIAWF  311



>emb|CAA83436.1| sucrose carrier [Ricinus communis]
Length=533

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 220/284 (77%), Gaps = 12/284 (4%)
 Frame = +1

Query  73   ALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIV  252
            A P  +PL K+ +V++IAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++V
Sbjct  28   AEPNSSPLRKVVMVASIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLV  87

Query  253  QPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATV  432
            QP+VGY+SD CT+RFGRRRPFI SGA  V  AV LIG+AAD+GH +GD L K  K RA  
Sbjct  88   QPIVGYHSDRCTSRFGRRRPFIASGAAFVAIAVFLIGYAADLGHLSGDSLDKSPKTRAIA  147

Query  433  IFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQS  612
            IF+VGFWILDVANNMLQGPCRALLADLSG    KTR AN LFSFFMAVGN+ GYAAGA +
Sbjct  148  IFVVGFWILDVANNMLQGPCRALLADLSGTSQKKTRTANALFSFFMAVGNVLGYAAGAYT  207

Query  613  TLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT-RKAVEGEEGK  789
             LYK F FT T ACDVYCANLKSCF IS +LLL +T +A++ V E  ++  +AV+  E  
Sbjct  208  HLYKLFPFTKTTACDVYCANLKSCFFISIVLLLSLTVLALSYVKEKPWSPDQAVDNAEDD  267

Query  790  -----------VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                       +PF GE+LGAFKNL RPM ILL+VT LNWIAWF
Sbjct  268  TASQASSSAQPMPFFGEILGAFKNLKRPMWILLLVTCLNWIAWF  311



>gb|AHH34929.1| sucrose transporter 6 [Theobroma cacao]
Length=488

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/278 (67%), Positives = 213/278 (77%), Gaps = 4/278 (1%)
 Frame = +1

Query  55   VEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGP  234
            +E  LEA     PLWK+ VV+AIAAGVQFGWALQLSLLTPYVQ LG+PH +++ IWLCGP
Sbjct  1    MEDGLEA---PGPLWKIIVVAAIAAGVQFGWALQLSLLTPYVQTLGVPHIWAAFIWLCGP  57

Query  235  ISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVT  414
            ISGL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA DIGH  GD L K  
Sbjct  58   ISGLLVQPIVGYNSDRCTSRFGRRRPFIAAGACCVAAAVFLIGFAKDIGHKAGDSLEKNA  117

Query  415  KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGY  594
            KPRA  +F+ GFWILDVANNMLQGPCRALLADLS  +  + R+AN  FSFFMAVGN+ GY
Sbjct  118  KPRAVAVFVAGFWILDVANNMLQGPCRALLADLSANNHKRMRVANECFSFFMAVGNVLGY  177

Query  595  AAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVE  774
            AAG+ S L+K F FT T ACDVYCANLK+CFII  + LL+VT  A+  V E   + K  E
Sbjct  178  AAGSYSNLHKIFPFTRTTACDVYCANLKTCFIIDIVFLLLVTITAIISVKETPLSMKQ-E  236

Query  775  GEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E+   PFVGELL AFK+L +PM ILL+VT LNWIAWF
Sbjct  237  EEKASTPFVGELLTAFKSLKKPMWILLLVTCLNWIAWF  274



>ref|XP_010063792.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 ref|XP_010063793.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 ref|XP_010063795.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 gb|KCW71043.1| hypothetical protein EUGRSUZ_F04144 [Eucalyptus grandis]
Length=513

 Score =   363 bits (932),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 216/288 (75%), Gaps = 7/288 (2%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A + EQ  +  P  +P+ K+  V+AIAAGVQFGWALQLSLLTPYVQLLGIPHK+++ IWL
Sbjct  6    ANKEEQQHQQQPRPSPMRKMVTVAAIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAFIWL  65

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGP+SG+IVQP+VGY+SD C++RFGRRRPFI +G+  V  AV LIG+AAD+GH  GD   
Sbjct  66   CGPVSGMIVQPVVGYHSDRCSSRFGRRRPFIAAGSAHVALAVFLIGYAADLGHLLGDRHD  125

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            + +KPRA  +F+VGFWILDVANNMLQGPCRALLADLS G+  KTR AN L+SFFM VGN+
Sbjct  126  RTSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSAGNQKKTRAANALYSFFMGVGNV  185

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+  F FT T ACDVYC+NLKSCF IS  LLL VTA A+  V E   +  
Sbjct  186  LGYAAGSYTHLHDLFPFTSTAACDVYCSNLKSCFFISIALLLGVTAFALATVHETPLSEL  245

Query  766  AVEG-------EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              +        E  + PF+GE+LGA ++L RPM  LLIVT LNWIAWF
Sbjct  246  RSDAVSESECSEREREPFLGEILGALRSLQRPMWTLLIVTCLNWIAWF  293



>ref|XP_006473216.1| PREDICTED: sucrose transport protein SUC2 isoform X2 [Citrus 
sinensis]
Length=454

 Score =   361 bits (927),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 209/268 (78%), Gaps = 4/268 (1%)
 Frame = +1

Query  94   LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYY  273
            +WK+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG+IVQP+VG++
Sbjct  33   MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFH  92

Query  274  SDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFW  453
            SD C +RFGRRRPFI +GA+LV  AV LIG+AADIGHS GD +    K RA +IF++GFW
Sbjct  93   SDTCKSRFGRRRPFILAGAVLVAIAVFLIGYAADIGHSAGDSVTDSVKTRAIIIFVIGFW  152

Query  454  ILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFS  633
            ILDVANN LQGPCRALLADLSG    KTR AN+ FSFFMAVGN+ GYAAG+ + LY    
Sbjct  153  ILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLP  212

Query  634  FTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG---KVPFVG  804
            FT + ACDVYCANLK+CF +S  LL+ +T +A+  V+E Q   +  + E     K PF  
Sbjct  213  FTKSKACDVYCANLKTCFFLSIALLITLTTIALFYVTE-QRLEEIDDKETAPSTKDPFFS  271

Query  805  ELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E+ GA K L +PM ILL VTALNWIAWF
Sbjct  272  EIFGALKGLQKPMWILLAVTALNWIAWF  299



>ref|NP_177333.1| sucrose transport protein SUC1 [Arabidopsis thaliana]
 sp|Q39232.1|SUC1_ARATH RecName: Full=Sucrose transport protein SUC1; AltName: Full=Sucrose 
permease 1; AltName: Full=Sucrose-proton symporter 1 
[Arabidopsis thaliana]
 gb|AAG52225.1|AC021665_8 sucrose transport protein SUC1; 26672-28438 [Arabidopsis thaliana]
 emb|CAA53147.1| sucrose-proton symporter [Arabidopsis thaliana]
 gb|AAK83617.1| At1g71880/F17M19_3 [Arabidopsis thaliana]
 gb|AAV97807.1| At1g71880 [Arabidopsis thaliana]
 gb|AEE35247.1| sucrose transport protein SUC1 [Arabidopsis thaliana]
Length=513

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 222/297 (75%), Gaps = 15/297 (5%)
 Frame = +1

Query  43   GAFEVE-----------QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            GA+E E           Q  E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  2    GAYETEKPTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLL  61

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK+SSLIWLCGP+SG+IVQP+VG++SD C ++FGRRRPFI +GA LV  AV LIG+A
Sbjct  62   GIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYA  121

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD G+  GD L +  K RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN
Sbjct  122  ADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVAN  181

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  +
Sbjct  182  AFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTS  241

Query  730  VTCVSEVQYT---RKAVEGEE-GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V++ Q++   R A + E+   VP  GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  242  LWYVNDKQWSPPPRNADDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWF  298



>emb|CAC19851.1| sucrose trasporter [Arabidopsis thaliana]
Length=509

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 216/283 (76%), Gaps = 2/283 (1%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A E +   E L + +PL K+  V++IAAGVQFGWALQLSLLTPY+QLLGIPHK+SS +WL
Sbjct  15   ALETQSSPEDLSQPSPLRKIISVASIAAGVQFGWALQLSLLTPYIQLLGIPHKWSSYMWL  74

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISG+IVQP+VGY+SD C +RFGRRRPFI +G  LV  +V LIGFAAD+GHS GD L 
Sbjct  75   CGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLE  134

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
               + RA +IF+ GFW LDVANN LQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+
Sbjct  135  NKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNV  194

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  ++  V + Q++  
Sbjct  195  LGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTFSSLWYVKDKQWSPP  254

Query  766  AVEGEE--GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              + EE    + F GE+ GA +++ RPM++LLIVT +NWIAWF
Sbjct  255  QGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWF  297



>ref|XP_003610412.1| Sucrose transport protein [Medicago truncatula]
 gb|AES92609.1| sucrose transporter 2 [Medicago truncatula]
 gb|AFK47244.1| unknown [Medicago truncatula]
 gb|AFM28286.1| SUT1-3 [Medicago truncatula]
Length=511

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/281 (61%), Positives = 215/281 (77%), Gaps = 0/281 (0%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            + +VE++  A  +  PL K+ VV++IAAG+QFGWALQLSLLTPY+QLLG+PHK+++ IWL
Sbjct  17   SLQVEEEEAADQKPCPLRKMIVVASIAAGIQFGWALQLSLLTPYIQLLGVPHKWAANIWL  76

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISG+IVQP+VGYYSD   +RFGRRRPFIFSG+L V  AV  IG+AAD+G+S GD L 
Sbjct  77   CGPISGMIVQPIVGYYSDRSHSRFGRRRPFIFSGSLAVAIAVFFIGYAADLGYSMGDDLS  136

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            K T+PRA VIFI+GFW+LDVANNMLQGPCRA L DL+ GD  + R+ N +FSFFMAVGNI
Sbjct  137  KKTRPRAVVIFILGFWVLDVANNMLQGPCRAFLGDLAAGDHRRMRMGNAMFSFFMAVGNI  196

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ S LY  F FT T ACDV+CANLK+CF +S  LL +V++ A+  V ++    K
Sbjct  197  LGYAAGSFSKLYHMFPFTQTKACDVFCANLKTCFFLSIFLLALVSSFALYYVEDIPLQSK  256

Query  766  AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 +  V   GELL AF  L +PM +L+IVTA+NW+AWF
Sbjct  257  PQSQSKDDVGCFGELLSAFSGLKKPMWMLMIVTAINWVAWF  297



>emb|CAN67869.1| hypothetical protein VITISV_020809 [Vitis vinifera]
Length=505

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/276 (64%), Positives = 212/276 (77%), Gaps = 0/276 (0%)
 Frame = +1

Query  61   QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
            QD ++    TP+WK  VV++IAAG+QFGWALQLSLLTPYVQLLGIPHK+++ IWLCGPIS
Sbjct  13   QDHQSSSPPTPIWKTVVVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWAAFIWLCGPIS  72

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G+IVQP+VGY+SD CT+RFGRRRPFI +GA+LV  AV LIG+AADIG  +GDPL    K 
Sbjct  73   GMIVQPVVGYHSDRCTSRFGRRRPFIAAGAVLVAIAVFLIGYAADIGRVSGDPLHNTIKT  132

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  +F+VGFWILDVANNMLQGPCRALLADLSG    +TR AN L+SFFMAVGN+ GYAA
Sbjct  133  RAVAVFVVGFWILDVANNMLQGPCRALLADLSGTSARRTRTANALYSFFMAVGNVLGYAA  192

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+ S L+K F F  T ACD+YCANLKSCF +S  LLLI+T +A   V E    R  +   
Sbjct  193  GSFSKLHKMFPFARTQACDLYCANLKSCFFLSIALLLILTIIAFATVHETPLNRADIAVV  252

Query  781  EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E   PF  +++ AF+ L RPM +LL+VT LNWI WF
Sbjct  253  EAGKPFYSQMMNAFRQLKRPMWVLLLVTCLNWIGWF  288



>gb|AAY87138.1| putative sucrose transporter [Vitis vinifera]
 gb|ADP37123.1| sucrose transporter [Vitis vinifera]
Length=505

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/276 (64%), Positives = 212/276 (77%), Gaps = 0/276 (0%)
 Frame = +1

Query  61   QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
            QD ++    TP+WK  VV++IAAG+QFGWALQLSLLTPYVQLLGIPHK+++ IWLCGPIS
Sbjct  13   QDHQSSSPPTPIWKTVVVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWAAFIWLCGPIS  72

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G+IVQP+VGY+SD CT+RFGRRRPFI +GA+LV  AV LIG+AADIG  +GDPL    K 
Sbjct  73   GMIVQPVVGYHSDRCTSRFGRRRPFIAAGAVLVAIAVFLIGYAADIGRVSGDPLHNTIKT  132

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  +F+VGFWILDVANNMLQGPCRALLADLSG    +TR AN L+SFFMAVGN+ GYAA
Sbjct  133  RAVAVFVVGFWILDVANNMLQGPCRALLADLSGTSARRTRTANALYSFFMAVGNVLGYAA  192

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+ S L+K F F  T ACD+YCANLKSCF +S  LLLI+T +A   V E    R  +   
Sbjct  193  GSFSKLHKMFPFARTQACDLYCANLKSCFFLSIALLLILTIIAFATVHETPLNRADIAVV  252

Query  781  EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E   PF  +++ AF+ L RPM +LL+VT LNWI WF
Sbjct  253  EAGQPFYSQMMNAFRQLRRPMWVLLLVTCLNWIGWF  288



>ref|NP_001268070.1| sucrose transporter-like [Vitis vinifera]
 gb|AAF08331.1|AF021810_1 putative sucrose transporter [Vitis vinifera]
Length=505

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/276 (64%), Positives = 212/276 (77%), Gaps = 0/276 (0%)
 Frame = +1

Query  61   QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
            QD ++    TP+WK  VV++IAAG+QFGWALQLSLLTPYVQLLGIPHK+++ IWLCGPIS
Sbjct  13   QDHQSSSPPTPIWKTVVVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWAAFIWLCGPIS  72

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G+IVQP+VGY+SD CT+RFGRRRPFI +GA+LV  AV LIG+AADIG  +GDPL    K 
Sbjct  73   GMIVQPVVGYHSDRCTSRFGRRRPFIAAGAVLVAIAVFLIGYAADIGRVSGDPLHNTIKT  132

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  +F+VGFWILDVANNMLQGPCRALLADLSG    +TR AN L+SFFMAVGN+ GYAA
Sbjct  133  RAVAVFVVGFWILDVANNMLQGPCRALLADLSGTSARRTRTANALYSFFMAVGNVLGYAA  192

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+ S L+K F F  T ACD+YCANLKSCF +S  LLLI+T +A   V E    R  +   
Sbjct  193  GSFSKLHKMFPFARTQACDLYCANLKSCFFLSIALLLILTIIAFATVHETPLNRADIAVV  252

Query  781  EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E   PF  +++ AF+ L RPM +LL+VT LNWI WF
Sbjct  253  EAGQPFYSQMMNAFRQLRRPMWVLLLVTCLNWIGWF  288



>ref|NP_177334.1| sucrose transport protein SUC5 [Arabidopsis thaliana]
 sp|Q9C8X2.1|SUC5_ARATH RecName: Full=Sucrose transport protein SUC5; AltName: Full=Sucrose 
permease 5; AltName: Full=Sucrose-proton symporter 5 
[Arabidopsis thaliana]
 gb|AAG52226.1|AC021665_9 putative sucrose transport protein; 30830-32911 [Arabidopsis 
thaliana]
 gb|AEE35248.1| sucrose transport protein SUC5 [Arabidopsis thaliana]
Length=512

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 216/283 (76%), Gaps = 2/283 (1%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A E +   E L + +PL K+  V++IAAGVQFGWALQLSLLTPY+QLLGIPHK+SS +WL
Sbjct  15   ALETQSSPEDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYIQLLGIPHKWSSYMWL  74

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISG+IVQP+VGY+SD C +RFGRRRPFI +G  LV  +V LIGFAAD+GHS GD L 
Sbjct  75   CGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLE  134

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
               + RA +IF+ GFW LDVANN LQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+
Sbjct  135  NKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNV  194

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  ++  V + Q++  
Sbjct  195  LGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTFSSLWYVKDKQWSPP  254

Query  766  AVEGEE--GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              + EE    + F GE+ GA +++ RPM++LLIVT +NWIAWF
Sbjct  255  QGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWF  297



>emb|CAC33492.1| sucrose carrier [Ricinus communis]
Length=306

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/272 (67%), Positives = 213/272 (78%), Gaps = 12/272 (4%)
 Frame = +1

Query  109  VVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCT  288
            +V++IAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+VGY+SD CT
Sbjct  1    MVASIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPIVGYHSDRCT  60

Query  289  NRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVA  468
            +RFGRRRPFI SGA  V  AV LIG+AAD+GH +GD L K  K RA  IF+VGFWILDVA
Sbjct  61   SRFGRRRPFIASGAAFVAIAVFLIGYAADLGHLSGDSLDKSPKTRAIAIFVVGFWILDVA  120

Query  469  NNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTD  648
            NNMLQGPCRALLADLSG    KTR AN LFSFFMAVGN+ GYAAGA + LYK F FT T 
Sbjct  121  NNMLQGPCRALLADLSGTSQKKTRTANALFSFFMAVGNVLGYAAGAYTHLYKLFPFTKTT  180

Query  649  ACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT-RKAVEGEEGK-----------V  792
            ACDVYCANLKSCF IS +LLL +T +A++ V E  ++  +AV+  E             +
Sbjct  181  ACDVYCANLKSCFFISIVLLLSLTVLALSYVKEKPWSPDQAVDNAEDDTASQASSSAQPM  240

Query  793  PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            PF GE+LGAFKNL RPM ILL+VT LNWIAWF
Sbjct  241  PFFGEILGAFKNLKRPMWILLLVTCLNWIAWF  272



>gb|AAF65765.1|AF242307_1 sucrose transport protein [Euphorbia esula]
Length=530

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 216/278 (78%), Gaps = 13/278 (5%)
 Frame = +1

Query  94   LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYY  273
            L K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+VGY+
Sbjct  29   LKKIVVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPIVGYH  88

Query  274  SDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFW  453
            SD CT+RFGRRRPFI +GA  V  AV LIG+AAD+GH +GD +GK  K RA  IF+VGFW
Sbjct  89   SDRCTSRFGRRRPFIAAGAASVAVAVFLIGYAADLGHMSGDSIGKSPKIRAIAIFVVGFW  148

Query  454  ILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFS  633
            ILDVANNMLQGPCRALLADLSG    KTRLAN LFSFFMAVGNI GYAAGA + LYK   
Sbjct  149  ILDVANNMLQGPCRALLADLSGTSQKKTRLANALFSFFMAVGNILGYAAGAYTHLYKIAP  208

Query  634  FTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT---RKAVEGEEGK-----  789
            FTLT ACDVYCANLK+CF IS  LLL++T +A+T V E Q++    K V G +G      
Sbjct  209  FTLTKACDVYCANLKTCFFISIALLLVLTVIALTYVKEKQWSPEIAKTVAGVDGDDEDGP  268

Query  790  -----VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 +PF GE+  A KNL RPM ILL+VT LNWIAWF
Sbjct  269  VEAAPLPFFGEIFAALKNLQRPMRILLLVTCLNWIAWF  306



>emb|CAA53390.2| sucrose transporter [Plantago major]
Length=511

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 226/291 (78%), Gaps = 3/291 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
            +S+ G GA  +        E  P+  + +V+AIAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  3    NSNRGVGAKTIITTTPPPEEAAPIRNIFLVAAIAAGVQFGWALQLSLLTPYVQLLGIPHK  62

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            ++S IWLCGPISG+IVQP+VGY+SDNCT+RFGRRRPFI +GA LV  AV+LIGFAAD+GH
Sbjct  63   WASYIWLCGPISGMIVQPVVGYFSDNCTSRFGRRRPFIAAGAGLVGVAVVLIGFAADLGH  122

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
            + GD LG   KPRA  +F+ GFWILDVANNMLQGPCRALLADLSGG+  K   AN+ FSF
Sbjct  123  AGGDSLGDGLKPRAIGVFVFGFWILDVANNMLQGPCRALLADLSGGNTKKMANANSFFSF  182

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+ S +YK F F+ T ACD+YCANLKSCFIIS  LL+ +T +A++ V 
Sbjct  183  FMAVGNVLGYAAGSYSRMYKVFPFSKTKACDIYCANLKSCFIISITLLITLTTLALSIVR  242

Query  745  EVQYT--RKAVEGEEG-KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E ++    +    ++G K+P   EL GA K+LPRPM +LL+VTALNWIAWF
Sbjct  243  EKRHVAEEQVTAAKKGFKIPVFPELFGALKDLPRPMWVLLLVTALNWIAWF  293



>ref|XP_007151901.1| hypothetical protein PHAVU_004G085400g [Phaseolus vulgaris]
 gb|ESW23895.1| hypothetical protein PHAVU_004G085400g [Phaseolus vulgaris]
Length=496

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 211/276 (76%), Gaps = 6/276 (2%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            PE +PL K+  VS+IAAG+QFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+VQP
Sbjct  7    PESSPLRKMVAVSSIAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWLCGPISGLLVQP  66

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIF  438
            +VGY SD C + FGRRRPFI +GAL V  A+ILIG+AADIG   GD + + T+PRA  IF
Sbjct  67   IVGYSSDRCQSAFGRRRPFILAGALAVAIAIILIGYAADIGQLAGDDITQKTRPRAVAIF  126

Query  439  IVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTL  618
            +VGFWILDVANNMLQGPCRA L DL+ GD  KTR AN+ FSFFMAVGN+ GYAAG+   L
Sbjct  127  VVGFWILDVANNMLQGPCRAFLGDLAAGDQKKTRTANSFFSFFMAVGNVLGYAAGSYDGL  186

Query  619  YKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEG---EEGK  789
            +K F FT T+AC+V+CANLKSCF  S +LLL +  + +TCV++ QY     E    EEGK
Sbjct  187  HKIFPFTETEACNVFCANLKSCFFFSIVLLLALCIIVLTCVNDPQYIPSNPEKEAEEEGK  246

Query  790  VP---FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 F+GE   AFK L RPM +L++VTA+NWIAWF
Sbjct  247  TQVSCFLGECCVAFKGLQRPMWMLMLVTAINWIAWF  282



>gb|KCW71037.1| hypothetical protein EUGRSUZ_F04137 [Eucalyptus grandis]
Length=485

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 207/268 (77%), Gaps = 2/268 (1%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PLW + VV++IAAGVQFGWALQLSLLTPY Q LGIPH ++S IWLCGP+SGL+VQP+VGY
Sbjct  3    PLWNIIVVASIAAGVQFGWALQLSLLTPYSQQLGIPHMWASFIWLCGPVSGLLVQPIVGY  62

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD   NRFGRRRPFI +GA  V  AV LIGFAAD+GH  GD +  + KPRA  IF+VGF
Sbjct  63   FSDRTKNRFGRRRPFIVAGAGFVAVAVFLIGFAADLGHMAGDKIDALMKPRAVAIFVVGF  122

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRALLADLSG +  + R+AN  FSFFMAVGN+ GYAAG+ S L+K  
Sbjct  123  WILDVANNMLQGPCRALLADLSGHNHKRMRVANGFFSFFMAVGNVLGYAAGSVSNLHKFL  182

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK-AVEGE-EGKVPFVG  804
             FT T ACDVYCANLK+CF+I  +LL+ VTA+AV  V E  +  K  V GE E   PF  
Sbjct  183  PFTTTPACDVYCANLKTCFLIDIVLLITVTAIAVCSVKETVHPHKDVVTGESEPMTPFGR  242

Query  805  ELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E+  AFKNL +PM +L +VTALNWIAWF
Sbjct  243  EVTTAFKNLTKPMWLLYLVTALNWIAWF  270



>ref|XP_009122220.1| PREDICTED: putative sucrose transport protein SUC6 [Brassica 
rapa]
Length=492

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/269 (68%), Positives = 214/269 (80%), Gaps = 3/269 (1%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++VQP 
Sbjct  28   EPSPLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMLVQPT  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD CT+RFGRRRPFI SGA+LV  A +LIG+AAD+G   GD L +  K RA   F 
Sbjct  88   VGYYSDRCTSRFGRRRPFIASGAVLVAVAGLLIGYAADLGKLAGDKLDETVKVRAIWFFA  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGNI GYAAG+ + L+
Sbjct  148  LGFWILDVANNTLQGPCRAFLADLAAGDARKTRTANAFFSFFMAVGNILGYAAGSYTNLH  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT+T ACDVYCANLKSCF +S ILLL++T V++  V + Q+ +   E  + K PF 
Sbjct  208  KMFPFTMTKACDVYCANLKSCFFLSIILLLVLTVVSLYYVKDKQWEK---EDSDVKTPFF  264

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE+LGAFK + RPM +L+IVTALNWIAWF
Sbjct  265  GEILGAFKVMERPMWMLIIVTALNWIAWF  293



>ref|XP_004496382.1| PREDICTED: sucrose transport protein-like [Cicer arietinum]
Length=523

 Score =   361 bits (927),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 215/285 (75%), Gaps = 10/285 (4%)
 Frame = +1

Query  64   DLEALP-EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
             +E+ P E +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPIS
Sbjct  25   HVESPPLEPSPLRKIMVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPIS  84

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G++VQP+VGY+SD CT+RFGRRRPFI +G+  V  AV LIG+AAD+GH  GD L + T+P
Sbjct  85   GMLVQPIVGYHSDRCTSRFGRRRPFIAAGSFAVAIAVFLIGYAADLGHMFGDNLAQKTRP  144

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  IF+VGFWILDVANNMLQGPCRALLADL  G+  KTR AN  FSFFMAVGN+ GYAA
Sbjct  145  RAIAIFVVGFWILDVANNMLQGPCRALLADLCAGNQRKTRNANAFFSFFMAVGNVLGYAA  204

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK---AV  771
            G+ + LY  F FT T ACDVYCANLKSCF +S  LL I+   A+  V E   + +   AV
Sbjct  205  GSYNGLYHMFPFTKTKACDVYCANLKSCFFLSIALLTILATAALIYVKETAISSEKTAAV  264

Query  772  EGEE------GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              EE      G +P  GEL GAFK L RPM ILL+VT LNWIAWF
Sbjct  265  VAEEDGAGSRGGMPCFGELSGAFKELKRPMWILLLVTCLNWIAWF  309



>ref|XP_006473215.1| PREDICTED: sucrose transport protein SUC2 isoform X1 [Citrus 
sinensis]
Length=528

 Score =   361 bits (927),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 209/268 (78%), Gaps = 4/268 (1%)
 Frame = +1

Query  94   LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYY  273
            +WK+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG+IVQP+VG++
Sbjct  33   MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFH  92

Query  274  SDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFW  453
            SD C +RFGRRRPFI +GA+LV  AV LIG+AADIGHS GD +    K RA +IF++GFW
Sbjct  93   SDTCKSRFGRRRPFILAGAVLVAIAVFLIGYAADIGHSAGDSVTDSVKTRAIIIFVIGFW  152

Query  454  ILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFS  633
            ILDVANN LQGPCRALLADLSG    KTR AN+ FSFFMAVGN+ GYAAG+ + LY    
Sbjct  153  ILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLP  212

Query  634  FTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG---KVPFVG  804
            FT + ACDVYCANLK+CF +S  LL+ +T +A+  V+E Q   +  + E     K PF  
Sbjct  213  FTKSKACDVYCANLKTCFFLSIALLITLTTIALFYVTE-QRLEEIDDKETAPSTKDPFFS  271

Query  805  ELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E+ GA K L +PM ILL VTALNWIAWF
Sbjct  272  EIFGALKGLQKPMWILLAVTALNWIAWF  299



>ref|XP_010063779.1| PREDICTED: sucrose transport protein SUC2-like [Eucalyptus grandis]
Length=494

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 207/268 (77%), Gaps = 2/268 (1%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PLW + VV++IAAGVQFGWALQLSLLTPY Q LGIPH ++S IWLCGP+SGL+VQP+VGY
Sbjct  12   PLWNIIVVASIAAGVQFGWALQLSLLTPYSQQLGIPHMWASFIWLCGPVSGLLVQPIVGY  71

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD   NRFGRRRPFI +GA  V  AV LIGFAAD+GH  GD +  + KPRA  IF+VGF
Sbjct  72   FSDRTKNRFGRRRPFIVAGAGFVAVAVFLIGFAADLGHMAGDKIDALMKPRAVAIFVVGF  131

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRALLADLSG +  + R+AN  FSFFMAVGN+ GYAAG+ S L+K  
Sbjct  132  WILDVANNMLQGPCRALLADLSGHNHKRMRVANGFFSFFMAVGNVLGYAAGSVSNLHKFL  191

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK-AVEGE-EGKVPFVG  804
             FT T ACDVYCANLK+CF+I  +LL+ VTA+AV  V E  +  K  V GE E   PF  
Sbjct  192  PFTTTPACDVYCANLKTCFLIDIVLLITVTAIAVCSVKETVHPHKDVVTGESEPMTPFGR  251

Query  805  ELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E+  AFKNL +PM +L +VTALNWIAWF
Sbjct  252  EVTTAFKNLTKPMWLLYLVTALNWIAWF  279



>gb|KHG01351.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=500

 Score =   360 bits (924),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 201/272 (74%), Gaps = 6/272 (2%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PLW + V+SAIAAG+QFGWALQLSLLTPYVQ LG+PH +++ IWLCGPISGL+VQP+VGY
Sbjct  11   PLWNIVVISAIAAGIQFGWALQLSLLTPYVQTLGVPHVWAAFIWLCGPISGLVVQPIVGY  70

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
             SD CT+R GRRRPFI  GA  V  AV +IGFA DIGH +GD L   TKPRA  IF+ GF
Sbjct  71   SSDRCTSRIGRRRPFIAVGACFVAVAVFMIGFAKDIGHRSGDSLQNPTKPRAVAIFVTGF  130

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRA LADLS  D  + R+AN  FSFFMAVGN+ GYAAG+ S L+K  
Sbjct  131  WILDVANNMLQGPCRAFLADLSSNDHKRMRIANAWFSFFMAVGNVLGYAAGSFSDLHKLL  190

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV------EGEEGKV  792
             FT T ACDVYCANLK+CFII  + LL +T  A+T V E   TRK        EG     
Sbjct  191  PFTQTTACDVYCANLKTCFIIDIVFLLSITITAITTVKETPITRKEAGDEEDNEGRSSGR  250

Query  793  PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            PF  EL+ AFK L +PM ILL+VT LNW+AWF
Sbjct  251  PFFAELVMAFKTLKKPMWILLLVTCLNWMAWF  282



>ref|NP_199174.1| putative sucrose transport protein SUC6 [Arabidopsis thaliana]
 sp|Q6A329.2|SUC6_ARATH RecName: Full=Putative sucrose transport protein SUC6; AltName: 
Full=Sucrose permease 6; AltName: Full=Sucrose-proton symporter 
6 [Arabidopsis thaliana]
 dbj|BAB11624.1| sucrose transporter protein [Arabidopsis thaliana]
 gb|AED94987.1| putative sucrose transport protein SUC6 [Arabidopsis thaliana]
Length=492

 Score =   360 bits (923),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 213/267 (80%), Gaps = 1/267 (0%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            +P+ K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWLCGP+SGL+VQP VG
Sbjct  28   SPMRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVG  87

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            Y+SD C +RFGRRRPFI  GALLV  AV+LIG+AAD GHS GD + +  K RA VIF +G
Sbjct  88   YFSDRCKSRFGRRRPFIAMGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALG  147

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+ + LYK 
Sbjct  148  FWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKI  207

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGE  807
            F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA + +  K PF GE
Sbjct  208  FPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKA-DSDNEKTPFFGE  266

Query  808  LLGAFKNLPRPMLILLIVTALNWIAWF  888
            + GAFK + RPM +LLIVTALNWIAWF
Sbjct  267  IFGAFKVMKRPMWMLLIVTALNWIAWF  293



>ref|XP_002266122.1| PREDICTED: sucrose transport protein SUC2 [Vitis vinifera]
 gb|ADP37124.1| putative sucrose transporter [Vitis vinifera]
Length=506

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/277 (63%), Positives = 217/277 (78%), Gaps = 8/277 (3%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + TPL K+ +V++IAAGVQFGWALQLSLLTPYVQLLG+PH ++S IWLCGPISG+++QP 
Sbjct  21   QSTPLSKIILVASIAAGVQFGWALQLSLLTPYVQLLGVPHTWASFIWLCGPISGMLIQPT  80

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD+C +++GRRRPFI  G +LV  AVILIGFAADIG S GDP  KV K RA V+F+
Sbjct  81   VGYYSDHCNSQWGRRRPFIIVGTILVTLAVILIGFAADIGKSAGDPPDKVPKVRAVVVFV  140

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFW+LDVANNM+QGPCRALLAD+SG +  KTR AN+ +SFFMAVGN+ GYAAG+ + LY
Sbjct  141  LGFWVLDVANNMMQGPCRALLADMSGHNHKKTRTANSYYSFFMAVGNVLGYAAGSYTDLY  200

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE------VQYTRKAVEGEE  783
            K F FT T ACDVYCANLK+CFI + ILLL++T  A+T V E       QY     E +E
Sbjct  201  KVFPFTKTKACDVYCANLKTCFIFAIILLLVLTTAAMTLVKERPLVLTQQYNADQDEEDE  260

Query  784  GKV--PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +V  PF G++L A  NL R M +L++VT+LNW+AWF
Sbjct  261  EEVSMPFFGQILSALGNLSRSMWMLIVVTSLNWLAWF  297



>gb|AAU11810.1| sucrose transporter [Juglans regia]
Length=516

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/293 (62%), Positives = 216/293 (74%), Gaps = 15/293 (5%)
 Frame = +1

Query  52   EVE---QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIW  222
            EVE   +D+ A    T L ++ +V++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IW
Sbjct  2    EVESANKDMRAAQRST-LIRIVLVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIW  60

Query  223  LCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL  402
            LCGPISG++VQP+VGYYSD CT+RFGRRRPFI  GA  V  AV LIG+AAD+GH  GD +
Sbjct  61   LCGPISGMLVQPIVGYYSDRCTSRFGRRRPFIAVGACFVAMAVFLIGYAADLGHLCGDHV  120

Query  403  GKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGN  582
             K T+PRA   F+VGFW+LDV+NNMLQGPCRALLADLSG D  K R +N LFSFFMAVGN
Sbjct  121  DKPTRPRAIAFFVVGFWVLDVSNNMLQGPCRALLADLSGNDQKKMRTSNALFSFFMAVGN  180

Query  583  IGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTR  762
            + GYAAG+ +  YK F FT T ACDVYCANLKSCF +S  LL  VT +A+T V E   + 
Sbjct  181  VLGYAAGSYTRFYKIFPFTKTKACDVYCANLKSCFFLSIALLSTVTILALTSVKERALSS  240

Query  763  K------AVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +      A E EE       +PF GE+  AFK L RPM ILL+VT LNWIAWF
Sbjct  241  QPKPENAAGEDEERVTESAGLPFFGEMWSAFKGLQRPMRILLLVTCLNWIAWF  293



>emb|CDY60441.1| BnaA10g30480D [Brassica napus]
Length=492

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/269 (68%), Positives = 213/269 (79%), Gaps = 3/269 (1%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++VQP 
Sbjct  28   EPSPLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMLVQPT  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD CT+RFGRRRPFI SGA+LV  A +LIG+AAD+G   GD L +  K RA   F 
Sbjct  88   VGYYSDRCTSRFGRRRPFIASGAVLVAVAGLLIGYAADLGKLAGDKLDETVKVRAIWFFA  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGNI GYAAG+ + L+
Sbjct  148  LGFWILDVANNTLQGPCRAFLADLAAGDARKTRTANAFFSFFMAVGNILGYAAGSYTNLH  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT+T ACDVYCANLKSCF +S ILLL++T V++  V + Q+ +   E  + K PF 
Sbjct  208  KMFPFTMTKACDVYCANLKSCFFLSIILLLVLTVVSLYYVKDKQWEK---EDTDVKAPFF  264

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE+ GAFK + RPM +L+IVTALNWIAWF
Sbjct  265  GEIFGAFKVMERPMWMLIIVTALNWIAWF  293



>ref|XP_006301807.1| hypothetical protein CARUB_v10022273mg [Capsella rubella]
 gb|EOA34705.1| hypothetical protein CARUB_v10022273mg [Capsella rubella]
Length=513

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/281 (61%), Positives = 216/281 (77%), Gaps = 2/281 (1%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E++   E   + +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLGIPHK+S+ +WLCG
Sbjct  18   EIQSSSEDPDQPSPLRKIVSVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWSAYMWLCG  77

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG++VQP+VGYYSD   +RFGRRRPFI  GA+LV  +V  IGFAAD+GH  GDP+G+ 
Sbjct  78   PISGILVQPIVGYYSDRSESRFGRRRPFIAVGAVLVALSVFFIGFAADLGHKLGDPIGEK  137

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
             K RA +IF VGFWILDVANN LQGPCRA L DL+ GD  +TRLAN  FSFFMAVGN+ G
Sbjct  138  VKTRAIIIFTVGFWILDVANNTLQGPCRAFLGDLAAGDAKRTRLANACFSFFMAVGNVLG  197

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTR--K  765
            YAAG+ + ++K F FT+T ACD YCANLKSCF +S  LLL+VT  ++  V E Q+++  +
Sbjct  198  YAAGSYTNIHKMFPFTVTKACDTYCANLKSCFFVSITLLLLVTFSSLWYVKEKQWSKPPQ  257

Query  766  AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            A + ++  + F  E+ GA K + RPM +LLIVTA+NWIAWF
Sbjct  258  ADDNKKSGLFFFREIFGALKVMERPMWMLLIVTAINWIAWF  298



>ref|XP_007151897.1| hypothetical protein PHAVU_004G085100g [Phaseolus vulgaris]
 gb|ESW23891.1| hypothetical protein PHAVU_004G085100g [Phaseolus vulgaris]
Length=503

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 209/273 (77%), Gaps = 4/273 (1%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + +PL K+  VS+I AG+QFGWALQLSLLTPYVQ LG+PH +SS IWLCGPISGL+VQP+
Sbjct  17   QPSPLRKMFAVSSIGAGIQFGWALQLSLLTPYVQTLGVPHAWSSFIWLCGPISGLLVQPI  76

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY SD CT+RFGRRRPFI SGA+ V  +V LIG+AADIGH+TGD + K T+PRA  IF+
Sbjct  77   VGYSSDRCTSRFGRRRPFILSGAVAVAISVFLIGYAADIGHATGDDITKKTRPRAVAIFV  136

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRA L DL+ GD  KTR AN  +SFFMA+GN+ GYAAG+   L+
Sbjct  137  VGFWILDVANNMLQGPCRAFLGDLAAGDQKKTRTANAFYSFFMAIGNVLGYAAGSYDKLH  196

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKV---  792
              F FT T+AC V+CANLKSCF  S +LLL++ A+ +TCV + Q+T   V     +    
Sbjct  197  HLFRFTETEACGVFCANLKSCFFFSIVLLLVLCAIVLTCVDDPQFTPDCVNANNPQTGSW  256

Query  793  -PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                GEL  AFK L +PML+L++VTA+NW+AWF
Sbjct  257  YSCFGELGIAFKGLQKPMLMLMLVTAINWVAWF  289



>gb|ABB30164.1| sucrose transport protein SUT1 [Phaseolus vulgaris]
Length=503

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 209/273 (77%), Gaps = 4/273 (1%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + +PL K+  VS+I AG+QFGWALQLSLLTPYVQ LG+PH +SS IWLCGPISGL+VQP+
Sbjct  17   QPSPLRKMFAVSSIGAGIQFGWALQLSLLTPYVQTLGVPHAWSSFIWLCGPISGLLVQPI  76

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY SD CT+RFGRRRPFI SGA+ V  +V LIG+AADIGH+TGD + K T+PRA  IF+
Sbjct  77   VGYSSDRCTSRFGRRRPFILSGAVAVAISVFLIGYAADIGHATGDDITKKTRPRAVAIFV  136

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRA L DL+ GD  KTR AN  +SFFMA+GN+ GYAAG+   L+
Sbjct  137  VGFWILDVANNMLQGPCRAFLGDLAAGDQKKTRTANAFYSFFMAIGNVLGYAAGSYDKLH  196

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKV---  792
              F FT T+AC V+CANLKSCF  S +LLL++ A+ +TCV + Q+T   V     +    
Sbjct  197  HLFRFTETEACGVFCANLKSCFFFSIVLLLVLCAIVLTCVDDPQFTPDCVNANNPQTGSW  256

Query  793  -PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                GEL  AFK L +PML+L++VTA+NW+AWF
Sbjct  257  YSCFGELGIAFKGLQKPMLMLMLVTAINWVAWF  289



>ref|XP_006434634.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
 gb|ESR47874.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
Length=484

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/272 (64%), Positives = 210/272 (77%), Gaps = 9/272 (3%)
 Frame = +1

Query  94   LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYY  273
            +WK+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG+IVQP+VG++
Sbjct  33   MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFH  92

Query  274  SDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFW  453
            SD C +RFGRRRPFI +GA+LV  AV LIG+AADIGH+ GD +    K RA +IF++GFW
Sbjct  93   SDTCKSRFGRRRPFILAGAVLVAIAVFLIGYAADIGHAAGDSVTDSVKTRAIIIFVIGFW  152

Query  454  ILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFS  633
            ILDVANN LQGPCRALLADLSG    +TR AN+ FSFFMAVGN+ GYAAG+ + LY    
Sbjct  153  ILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLP  212

Query  634  FTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-------KV  792
            FT + ACDVYCANLK+CF +S  LL+ +T VA+  V+E +   + ++  E        K 
Sbjct  213  FTKSKACDVYCANLKTCFFLSIALLITLTTVALFYVTEKRL--EEIDDNENKETALSTKE  270

Query  793  PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            PF  E+ GA K L +PM ILL VTALNWIAWF
Sbjct  271  PFFSEIFGALKGLQKPMWILLAVTALNWIAWF  302



>ref|XP_006434633.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
 gb|ESR47873.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
Length=531

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/272 (64%), Positives = 210/272 (77%), Gaps = 9/272 (3%)
 Frame = +1

Query  94   LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYY  273
            +WK+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG+IVQP+VG++
Sbjct  33   MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFH  92

Query  274  SDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFW  453
            SD C +RFGRRRPFI +GA+LV  AV LIG+AADIGH+ GD +    K RA +IF++GFW
Sbjct  93   SDTCKSRFGRRRPFILAGAVLVAIAVFLIGYAADIGHAAGDSVTDSVKTRAIIIFVIGFW  152

Query  454  ILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFS  633
            ILDVANN LQGPCRALLADLSG    +TR AN+ FSFFMAVGN+ GYAAG+ + LY    
Sbjct  153  ILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLP  212

Query  634  FTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-------KV  792
            FT + ACDVYCANLK+CF +S  LL+ +T VA+  V+E +   + ++  E        K 
Sbjct  213  FTKSKACDVYCANLKTCFFLSIALLITLTTVALFYVTEKRL--EEIDDNENKETALSTKE  270

Query  793  PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            PF  E+ GA K L +PM ILL VTALNWIAWF
Sbjct  271  PFFSEIFGALKGLQKPMWILLAVTALNWIAWF  302



>gb|KHG00539.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=494

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 212/271 (78%), Gaps = 1/271 (0%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            P  +PL K+  V++IAAG+QFGWALQLSLLTPYVQ LG+PH +++ IWLCGPISGL+VQP
Sbjct  8    PAPSPLRKIITVASIAAGIQFGWALQLSLLTPYVQTLGVPHAWAAFIWLCGPISGLLVQP  67

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIF  438
            +VGY SD CT+RFGRRRPFI  GAL V  AV LIGFA DIGH  GD L + TKPRA  IF
Sbjct  68   IVGYNSDRCTSRFGRRRPFIVIGALSVSIAVFLIGFAKDIGHHAGDSLERTTKPRAVAIF  127

Query  439  IVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTL  618
            +VGFWILDVANNMLQGPCRALLADLS  D  K R AN  FSFFMAVGN+ GYAAG+ S L
Sbjct  128  VVGFWILDVANNMLQGPCRALLADLSANDHKKMRTANGWFSFFMAVGNVLGYAAGSYSHL  187

Query  619  YKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK-AVEGEEGKVP  795
            YK F FT T ACD+YCANLKSCF I  ++LL+VT  AVT V E  +T++   +G +   P
Sbjct  188  YKIFPFTKTTACDMYCANLKSCFTIDIMILLLVTVTAVTTVKEDPFTKQIQDDGSKESTP  247

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F+GE++ AFK+L +PM ILL+VT LNWIAWF
Sbjct  248  FIGEMIAAFKSLKKPMWILLLVTCLNWIAWF  278



>gb|AET08927.1| sucrose transporter [Brassica napus]
 emb|CDX68295.1| BnaA07g23350D [Brassica napus]
Length=514

 Score =   357 bits (917),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 182/282 (65%), Positives = 217/282 (77%), Gaps = 3/282 (1%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E +   E   + +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLGIPHK+SSLIWLCG
Sbjct  17   ETQPPSEDFDQPSPLRKIISVASIAAGLQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCG  76

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL-GK  408
            P+SG+IVQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH  GD L  K
Sbjct  77   PVSGMIVQPIVGYHSDRCTSRFGRRRPFIAAGAALVAVAVFLIGYAADIGHKMGDKLEQK  136

Query  409  VTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIG  588
              + RA  IF  GFWILDVANN LQGPCRA LADLS GD  +TR+AN  FSFFMAVGN+ 
Sbjct  137  SPRVRAIGIFAFGFWILDVANNTLQGPCRAFLADLSAGDAKRTRVANGFFSFFMAVGNVL  196

Query  589  GYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKA  768
            GYAAG+ + L+K F F +T ACD+YCANLKSCF +S  LL+IVT  ++  V + Q++   
Sbjct  197  GYAAGSYTNLHKMFPFAMTKACDIYCANLKSCFFLSITLLIIVTVSSLWYVKDKQWSPAV  256

Query  769  VEGEE--GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              G+E    VPF GE+LGAFK + RPM +LLIVTALNWIAWF
Sbjct  257  NSGDEKTSSVPFFGEILGAFKVMQRPMWMLLIVTALNWIAWF  298



>ref|XP_009104886.1| PREDICTED: sucrose transport protein SUC1-like [Brassica rapa]
 gb|AET08928.1| sucrose transporter [Brassica napus]
Length=514

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/282 (65%), Positives = 217/282 (77%), Gaps = 3/282 (1%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E +   E   + +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLGIPHK+SSLIWLCG
Sbjct  17   ETQPPSEDFDQPSPLRKIISVASIAAGLQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCG  76

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL-GK  408
            P+SG+IVQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH  GD L  K
Sbjct  77   PVSGMIVQPIVGYHSDRCTSRFGRRRPFIAAGAALVAVAVFLIGYAADIGHKMGDKLEQK  136

Query  409  VTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIG  588
              + RA  IF  GFWILDVANN LQGPCRA LADLS GD  +TR+AN  FSFFMAVGN+ 
Sbjct  137  SPRVRAIGIFAFGFWILDVANNTLQGPCRAFLADLSAGDAKRTRVANGFFSFFMAVGNVL  196

Query  589  GYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKA  768
            GYAAG+ + L+K F F +T ACD+YCANLKSCF +S  LL+IVT  ++  V + Q++   
Sbjct  197  GYAAGSYTNLHKMFPFAMTKACDIYCANLKSCFFLSITLLIIVTVSSLWYVKDKQWSPAP  256

Query  769  VEGEE--GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              G+E    VPF GE+LGAFK + RPM +LLIVTALNWIAWF
Sbjct  257  NSGDEKTSSVPFFGEILGAFKVMQRPMWMLLIVTALNWIAWF  298



>emb|CAE53179.1| sucrose transporter [Arabidopsis thaliana]
Length=492

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 212/267 (79%), Gaps = 1/267 (0%)
 Frame = +1

Query  88   TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVG  267
            +P+ K+  V+ IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWLCGP+SGL+VQP VG
Sbjct  28   SPMRKMISVAPIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVG  87

Query  268  YYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVG  447
            Y+SD C +RFGRRRPFI +GALLV  AV+LIG+AAD GHS GD + +  K RA VIF +G
Sbjct  88   YFSDRCKSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALG  147

Query  448  FWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKS  627
            FWILDVANN LQGPCRA L DL+ GD +KTR AN  FSFFM VGN+ G+AAG+ + LYK 
Sbjct  148  FWILDVANNTLQGPCRAFLGDLAAGDATKTRTANAFFSFFMGVGNVLGHAAGSYTNLYKI  207

Query  628  FSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGE  807
            F FT+T ACD+YCANLKSCF +S  LLL+VT +A+  V + Q++ KA    E K PF GE
Sbjct  208  FPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKADSDNE-KTPFFGE  266

Query  808  LLGAFKNLPRPMLILLIVTALNWIAWF  888
            + GAFK + RPM +LLIVTALNWIAWF
Sbjct  267  IFGAFKVMKRPMWMLLIVTALNWIAWF  293



>gb|AFK34473.1| unknown [Medicago truncatula]
Length=328

 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 214/286 (75%), Gaps = 11/286 (4%)
 Frame = +1

Query  64   DLEALP-EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
             +E+ P E +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPIS
Sbjct  23   HVESPPLEPSPLRKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPIS  82

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G++VQP+VGY+SD CT+RFGRRRPFI +G+  V  AV LIG+AAD+GHS G+ L K  +P
Sbjct  83   GMLVQPIVGYHSDRCTSRFGRRRPFIAAGSFAVAIAVFLIGYAADLGHSFGEDLSKKVRP  142

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  IF+VGFWILDVANNMLQGPCRALL DL  G+  KTR AN  FSFFMAVGNI GYAA
Sbjct  143  RAIGIFVVGFWILDVANNMLQGPCRALLGDLCAGNHQKTRNANAFFSFFMAVGNILGYAA  202

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEG-  777
            GA S L+  F FT T ACD+YCANLKSCF +S  LL  V   A+  V E+  + + V G 
Sbjct  203  GAYSKLFHVFPFTKTKACDIYCANLKSCFFLSIALLTAVATAALIYVKEIPLSPEKVTGN  262

Query  778  ----EEGKV-----PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                E+G V     P  GEL GAF+ L RPM ILL+VT LNWIAWF
Sbjct  263  GVTDEDGNVTKSSNPCFGELSGAFRELKRPMWILLLVTCLNWIAWF  308



>gb|AHB33870.1| sucrose transporter [Fraxinus excelsior]
Length=517

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/282 (67%), Positives = 216/282 (77%), Gaps = 12/282 (4%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            P + PL KL  V+AIAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGP+SGL VQP
Sbjct  19   PPQEPLRKLIPVAAIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPVSGLFVQP  78

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL---GKVTKPRAT  429
            +VGYYSDNC++RFGRRRPFI +GA LV  AV LIGFAADIGH++GDPL   GK  KPRA 
Sbjct  79   IVGYYSDNCSSRFGRRRPFIAAGAALVAVAVFLIGFAADIGHASGDPLGNDGKTAKPRAI  138

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
             +F+VGFWILDVANNMLQGPCRALLADLSGG+  K R AN  FSFFMAVG++ GYAAG+ 
Sbjct  139  AVFVVGFWILDVANNMLQGPCRALLADLSGGNAQKMRTANAFFSFFMAVGSVLGYAAGSY  198

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-  786
            + L+K F FT T ACDVYCANLKSCF +S  LLL +T +A+T V E  +     E  E  
Sbjct  199  THLFKIFPFTKTKACDVYCANLKSCFFLSIFLLLTLTILALTIVRETAFVPSQAEPPENI  258

Query  787  --------KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                    K+P +GEL GA K LPRPM  LL+VT LNWIAWF
Sbjct  259  GHGVVKKRKIPVLGELFGALKGLPRPMRALLLVTCLNWIAWF  300



>ref|XP_007020267.1| Sucrose transport protein SUC2 isoform 2 [Theobroma cacao]
 gb|EOY17492.1| Sucrose transport protein SUC2 isoform 2 [Theobroma cacao]
Length=491

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 218/280 (78%), Gaps = 5/280 (2%)
 Frame = +1

Query  55   VEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGP  234
            +E  LEA     PLWK+ VV+A+AAGVQFGWALQLSLLTPYVQ LG+PH +++ IWLCGP
Sbjct  1    MEDGLEA---PGPLWKIIVVAAVAAGVQFGWALQLSLLTPYVQTLGVPHTWAAFIWLCGP  57

Query  235  ISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVT  414
            ISGL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA DIGH  GD L K T
Sbjct  58   ISGLLVQPIVGYNSDRCTSRFGRRRPFIAAGACCVAGAVFLIGFAKDIGHKAGDSLDKST  117

Query  415  KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGY  594
            KPRA  +F+ GFWILDVANNMLQGPCRALLADLS  +  + R+AN  FSFFMAVGN+ GY
Sbjct  118  KPRAVAVFVTGFWILDVANNMLQGPCRALLADLSANNHKRMRVANGWFSFFMAVGNVLGY  177

Query  595  AAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVE  774
            AAG+ S L+K F FT+T ACDVYCANLK+CFII  + LL+VT  A++CV E   ++K ++
Sbjct  178  AAGSYSNLHKIFPFTVTTACDVYCANLKTCFIIDILFLLLVTITAISCVKETPLSKKVMK  237

Query  775  GEEGK--VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             EE K   P VGELL AFK L +PM ILL+VT LNWIAWF
Sbjct  238  QEEEKASTPLVGELLTAFKTLKKPMWILLLVTCLNWIAWF  277



>emb|CDP20704.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/271 (67%), Positives = 214/271 (79%), Gaps = 8/271 (3%)
 Frame = +1

Query  100  KLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSD  279
             L +V+AIAAG+QFGWALQLSLLTPYVQLLGI HK + +IWLCGPISG++VQP+VGYYSD
Sbjct  41   NLIMVAAIAAGIQFGWALQLSLLTPYVQLLGISHKLAPIIWLCGPISGMLVQPMVGYYSD  100

Query  280  NCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWIL  459
            NCT+RFGRRRPFI +GA LV  AV+LIGFAAD+GH  GD LGK +KPRA  +FIVGF IL
Sbjct  101  NCTSRFGRRRPFIAAGASLVAIAVVLIGFAADLGHLCGDTLGKTSKPRAIAVFIVGFAIL  160

Query  460  DVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFT  639
            DVANNMLQGPCRALLADLS G+  KTR++   +SFFMAVGN+ GYAAG+ S LYK F FT
Sbjct  161  DVANNMLQGPCRALLADLSDGNARKTRMSYAGYSFFMAVGNVLGYAAGSYSKLYKLFPFT  220

Query  640  LTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK---AVEGEE-----GKVP  795
             T ACD+YCANLK CFIIS  LLL +T +A+T V E  ++     + +G E      K+P
Sbjct  221  QTKACDIYCANLKGCFIISIALLLTLTILALTFVREKPFSGPDPGSADGTESGKHHAKIP  280

Query  796  FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            F GE+ GA K+LPRPM ILL+VT LNWI WF
Sbjct  281  FFGEIFGALKDLPRPMWILLVVTCLNWIGWF  311



>emb|CDY36675.1| BnaCnng07770D [Brassica napus]
Length=514

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/282 (64%), Positives = 218/282 (77%), Gaps = 3/282 (1%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E +   E   + +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLGI HK+SSLIWLCG
Sbjct  17   ETQSPEEDFDQPSPLRKIISVASIAAGLQFGWALQLSLLTPYVQLLGIRHKWSSLIWLCG  76

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            P+SG+IVQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIG+AADIGH  GD L + 
Sbjct  77   PVSGMIVQPIVGYHSDRCTSRFGRRRPFIAAGAALVAVAVFLIGYAADIGHKMGDKLEQK  136

Query  412  T-KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIG  588
            T + RA  IF  GFWILDVANN LQGPCRA LADLS GD  +TR+AN  FSFFMAVGN+ 
Sbjct  137  TPRVRAIGIFAFGFWILDVANNTLQGPCRAFLADLSAGDAKRTRVANGFFSFFMAVGNVL  196

Query  589  GYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKA  768
            GYAAG+ + L+K F F +T ACD+YCANLKSCF +S  LL+IVT  ++  V + Q++   
Sbjct  197  GYAAGSYTNLHKMFPFAMTKACDIYCANLKSCFFLSITLLIIVTVSSLWYVKDKQWSPAV  256

Query  769  VEGEE--GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              G+E    VPF+GE+LGAFK + RPM +LLIVTALNWIAWF
Sbjct  257  NSGDEKTSSVPFLGEILGAFKVMQRPMWMLLIVTALNWIAWF  298



>ref|XP_007151866.1| hypothetical protein PHAVU_004G082200g [Phaseolus vulgaris]
 gb|ESW23860.1| hypothetical protein PHAVU_004G082200g [Phaseolus vulgaris]
Length=494

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 213/274 (78%), Gaps = 5/274 (2%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  VS+IAAGVQFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+VQP+
Sbjct  8    EPSPLRKMVAVSSIAAGVQFGWALQLSLLTPYVQTLGVPHAWASFIWLCGPISGLLVQPI  67

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY SD C + FGRRRPFI +G+L V  A+ILIG+AADIG   GD + + T+PRA  IF+
Sbjct  68   VGYSSDRCQSPFGRRRPFILTGSLAVAVAIILIGYAADIGQLAGDDITQKTRPRAVAIFV  127

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+ GYAAG+   L+
Sbjct  128  VGFWILDVANNMLQGPCRAFLGDLAAGDQKKTRTANGFFSFFMAVGNVLGYAAGSYDGLH  187

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY--TRKAVEGEEGKVP  795
            K F FT T+AC+V+CANLKSCF  S +LLL + ++ +TCV++ QY  +++    +EGK  
Sbjct  188  KIFPFTETEACNVFCANLKSCFFFSIVLLLSLCSIVLTCVNDPQYIPSKQEEAEDEGKTH  247

Query  796  ---FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               F+GEL  AFK L +PM +L++VTA+NW+AWF
Sbjct  248  FSCFLGELCVAFKGLQKPMWMLMLVTAINWLAWF  281



>gb|AAD41024.1| sucrose transport protein SUT1 [Pisum sativum]
Length=524

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 209/275 (76%), Gaps = 6/275 (2%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGI H +++ IWLCGPISG++VQP+
Sbjct  31   EPSPLRKIMVVASIAAGVQFGWALQLSLLTPYVQLLGIHHTWAAYIWLCGPISGMLVQPV  90

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD CT+RFGRRRPFI +G++ V  AV LIG+AAD+GHS GD L K  +PRA  IF+
Sbjct  91   VGYHSDRCTSRFGRRRPFIAAGSIAVAIAVFLIGYAADLGHSFGDNLDKKVRPRAIGIFV  150

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALL DL  G+  KTR AN  FSFFMAVGN+ GYAAGA S LY
Sbjct  151  VGFWILDVANNMLQGPCRALLGDLCAGNQRKTRNANAFFSFFMAVGNVLGYAAGAYSKLY  210

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY-TRKAV-----EGEE  783
              F FT T+AC+VYCANLKSCF +S  LL ++   A+  V E      KAV      G  
Sbjct  211  HVFPFTKTEACNVYCANLKSCFFLSIALLTVLATAALIYVKETPLIAEKAVVTAEDGGSN  270

Query  784  GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            G +P  G+L GAFK L RPM ILL+VT LNWIAWF
Sbjct  271  GGMPCFGQLSGAFKELKRPMWILLLVTCLNWIAWF  305



>gb|KCW71038.1| hypothetical protein EUGRSUZ_F04138 [Eucalyptus grandis]
Length=486

 Score =   355 bits (910),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 203/269 (75%), Gaps = 3/269 (1%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PLWK+ VV++IAAGVQFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+VQP+VGY
Sbjct  3    PLWKIVVVASIAAGVQFGWALQLSLLTPYVQQLGVPHMWASFIWLCGPISGLLVQPIVGY  62

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD   NR GRRRPFI +GAL V  +VILIGFAAD+G+  GD L +  KPRA  IF++GF
Sbjct  63   FSDRTKNRLGRRRPFIITGALFVATSVILIGFAADLGYKVGDRLDREMKPRAVAIFVIGF  122

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRALLADLS  D  + R+AN  +SFFMAVGN+ GYA G+   LYK  
Sbjct  123  WILDVANNMLQGPCRALLADLSANDHRRMRIANAFYSFFMAVGNVLGYAVGSIDNLYKML  182

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY--TRKAVEGE-EGKVPFV  801
             FT T ACD YCANLK+CF+I  + L +VT   V  V EV +   ++   G+ E   PF 
Sbjct  183  PFTATVACDTYCANLKTCFLIDIVFLAVVTIGVVATVKEVIHPSPKELANGDPEPMTPFS  242

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E+  AFKNL RPM +L +VTALNW+AWF
Sbjct  243  SEVTSAFKNLSRPMWLLYLVTALNWVAWF  271



>gb|AHH34928.1| sucrose transporter 5 [Theobroma cacao]
Length=491

 Score =   355 bits (910),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 218/280 (78%), Gaps = 5/280 (2%)
 Frame = +1

Query  55   VEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGP  234
            +E  LEA     PLWK+ VV+A+AAGVQFGWALQLSLLTPYVQ LG+PH +++ IWLCGP
Sbjct  1    MEDGLEA---PGPLWKIIVVAAVAAGVQFGWALQLSLLTPYVQTLGVPHTWAAFIWLCGP  57

Query  235  ISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVT  414
            ISGL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA DIGH  GD L K T
Sbjct  58   ISGLLVQPIVGYNSDRCTSRFGRRRPFIAAGACCVAGAVFLIGFAKDIGHKAGDSLDKST  117

Query  415  KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGY  594
            KPRA  +F+ GFWILDVANNMLQGPCRALLADLS  +  + R+AN  FSFFMAVGN+ GY
Sbjct  118  KPRAVAVFVTGFWILDVANNMLQGPCRALLADLSANNHKRMRVANGWFSFFMAVGNVLGY  177

Query  595  AAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVE  774
            AAG+ S L+K F FT+T ACDVYCANLK+CFII  + LL+VT  A++CV E   +++ ++
Sbjct  178  AAGSYSNLHKIFPFTVTTACDVYCANLKTCFIIDILFLLLVTITAISCVKETPLSKEVMK  237

Query  775  GEEGK--VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             EE K   P VGELL AFK L +PM ILL+VT LNWIAWF
Sbjct  238  QEEEKASTPLVGELLTAFKTLKKPMWILLLVTCLNWIAWF  277



>emb|CDX98907.1| BnaC09g49280D [Brassica napus]
Length=492

 Score =   354 bits (909),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 181/269 (67%), Positives = 212/269 (79%), Gaps = 3/269 (1%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E + L K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG++VQP 
Sbjct  28   EPSALRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMLVQPT  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD CT+RFGRRRPFI SGA+LV  A +LIG+AAD+G   GD L +  K RA   F 
Sbjct  88   VGYYSDRCTSRFGRRRPFIASGAVLVAVAGLLIGYAADLGKLAGDKLDETVKVRAIWFFA  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANN LQGPCRA LADL+ GD  KTR AN  FSFFMAVGNI GYAAG+ + L+
Sbjct  148  LGFWILDVANNTLQGPCRAFLADLAAGDARKTRTANAFFSFFMAVGNILGYAAGSYTNLH  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT+T ACDVYCANLKSCF +S ILLL++T V++  V + Q+ +   E  + K PF 
Sbjct  208  KMFPFTMTKACDVYCANLKSCFFLSIILLLVLTVVSLYYVKDKQWEK---EDTDVKTPFF  264

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE+LGAF  + RPM +L+IVTALNWIAWF
Sbjct  265  GEILGAFNVMERPMWMLIIVTALNWIAWF  293



>ref|XP_010063780.1| PREDICTED: sucrose transport protein SUC8-like [Eucalyptus grandis]
Length=499

 Score =   355 bits (910),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 203/269 (75%), Gaps = 3/269 (1%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PLWK+ VV++IAAGVQFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+VQP+VGY
Sbjct  16   PLWKIVVVASIAAGVQFGWALQLSLLTPYVQQLGVPHMWASFIWLCGPISGLLVQPIVGY  75

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD   NR GRRRPFI +GAL V  +VILIGFAAD+G+  GD L +  KPRA  IF++GF
Sbjct  76   FSDRTKNRLGRRRPFIITGALFVATSVILIGFAADLGYKVGDRLDREMKPRAVAIFVIGF  135

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRALLADLS  D  + R+AN  +SFFMAVGN+ GYA G+   LYK  
Sbjct  136  WILDVANNMLQGPCRALLADLSANDHRRMRIANAFYSFFMAVGNVLGYAVGSIDNLYKML  195

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY--TRKAVEGE-EGKVPFV  801
             FT T ACD YCANLK+CF+I  + L +VT   V  V EV +   ++   G+ E   PF 
Sbjct  196  PFTATVACDTYCANLKTCFLIDIVFLAVVTIGVVATVKEVIHPSPKELANGDPEPMTPFS  255

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E+  AFKNL RPM +L +VTALNW+AWF
Sbjct  256  SEVTSAFKNLSRPMWLLYLVTALNWVAWF  284



>ref|XP_010521130.1| PREDICTED: LOW QUALITY PROTEIN: sucrose transport protein SUC2-like 
[Tarenaya hassleriana]
Length=508

 Score =   355 bits (910),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 211/282 (75%), Gaps = 3/282 (1%)
 Frame = +1

Query  43   GAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIW  222
            GA  +E     L E +PL K   + +IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIW
Sbjct  12   GAAALETQGAELMEPSPLRK---IXSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIW  68

Query  223  LCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL  402
            LCGPISG++VQP+VGY+SD CT+RFGRRRPFI +G  LV  AV LIG+AAD+G S GD  
Sbjct  69   LCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIAAGTALVTVAVFLIGYAADLGQSMGDSK  128

Query  403  GKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGN  582
             K  K RA  IF +GFWILDVANN LQGPCRA LADLS G+  KTR AN  FSFFMAVGN
Sbjct  129  VKTPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNARKTRTANAFFSFFMAVGN  188

Query  583  IGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTR  762
            + GYAAG+   LYK F FT TDACDVYCANLKSCF +S  LLL+VT  ++  V + Q++ 
Sbjct  189  VLGYAAGSYKNLYKVFPFTSTDACDVYCANLKSCFFLSITLLLLVTVSSLWYVKDKQWSP  248

Query  763  KAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +        VPF GE+ GA K + RPM +LLIVTALNWIAWF
Sbjct  249  EPGSESGSSVPFFGEIFGALKEMKRPMWMLLIVTALNWIAWF  290



>ref|XP_004138920.1| PREDICTED: sucrose transport protein SUC2-like [Cucumis sativus]
Length=485

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 197/253 (78%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  GVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRR  309
            GVQFGWALQLSLLTPYVQ LG+ H +S+ IWLCGP+SGLIVQP VGYYSD CT+RFGRRR
Sbjct  21   GVQFGWALQLSLLTPYVQQLGVSHTWSAFIWLCGPLSGLIVQPTVGYYSDRCTSRFGRRR  80

Query  310  PFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGP  489
            PFI +G+  V  AV LIGFAADIGH+ GDPL K TKPRA  IF+VGFW+LDVANNMLQGP
Sbjct  81   PFIVAGSTFVATAVFLIGFAADIGHAVGDPLNKPTKPRAVAIFVVGFWVLDVANNMLQGP  140

Query  490  CRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCA  669
            CRALLAD+S  +  K R+AN  FSFFM VGN+ GYAAG+ + LYK   FTLT ACD YCA
Sbjct  141  CRALLADMSCNNHKKMRMANGFFSFFMGVGNVLGYAAGSYNKLYKFLPFTLTKACDSYCA  200

Query  670  NLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLI  849
            NLK+CF+I  + LL+VT  AV  VSE Q+    +E +E   PF G+L GA K L RPM +
Sbjct  201  NLKTCFLIDIVFLLLVTTFAVLMVSENQF--DPLEIDEEATPFFGKLFGALKKLERPMWL  258

Query  850  LLIVTALNWIAWF  888
            LL+VTALNWI WF
Sbjct  259  LLLVTALNWIGWF  271



>ref|NP_001236298.1| sucrose transporter [Glycine max]
 emb|CAD91334.1| sucrose transporter [Glycine max]
Length=520

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 213/279 (76%), Gaps = 4/279 (1%)
 Frame = +1

Query  64   DLEALP-EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
             +E+ P E +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPIS
Sbjct  23   HVESPPLEPSPLRKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPIS  82

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G++VQP+VGY+SD CT+RFGRRRPFI +G+  V  AV LIG+AAD+GHS GD L K  +P
Sbjct  83   GMLVQPIVGYHSDRCTSRFGRRRPFIAAGSFAVAIAVFLIGYAADLGHSFGDDLSKKVRP  142

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  IF+VGFWILDVANNMLQGPCRALL DL  G+  KTR AN  FSFFMAVGN+ GYAA
Sbjct  143  RAIGIFVVGFWILDVANNMLQGPCRALLGDLCAGNHQKTRNANAFFSFFMAVGNVLGYAA  202

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT-RKAV--  771
            GA S LY  F FT T ACDVYCANLKSCF +S  LL  +   A+  V EV  +  KAV  
Sbjct  203  GAYSKLYHVFPFTKTTACDVYCANLKSCFFLSIALLTTLATAALVYVKEVPLSPEKAVID  262

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              + G +P  G+L GAF+ L RPM ILL+VT LNWIAWF
Sbjct  263  SDDNGGMPCFGQLFGAFRELKRPMWILLLVTCLNWIAWF  301



>emb|CAA59113.1| SUC1-sucrose proton symporter [Plantago major]
 emb|CAI59556.1| sucrose transporter [Plantago major]
Length=503

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/279 (61%), Positives = 211/279 (76%), Gaps = 1/279 (0%)
 Frame = +1

Query  55   VEQDLEALPEET-PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            +E   +A+ EE  P+WK  +V+++AAG+QFGWALQLSLLTPY+Q+LG+PH  +S IWLCG
Sbjct  7    IENGNKAIGEEAIPVWKFVLVASLAAGIQFGWALQLSLLTPYIQMLGLPHGAASFIWLCG  66

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            P+SGL+VQPL GY+SD C +RFGRRRPFI SGA LV  AVILIGFAADIGHS GD + K 
Sbjct  67   PVSGLLVQPLAGYFSDRCKSRFGRRRPFIMSGACLVAAAVILIGFAADIGHSAGDDMTKK  126

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKPRA V+F+VGFWILDVANNMLQGPCRA LADLS GD  K   A + F+FFM +GN+ G
Sbjct  127  TKPRAVVVFVVGFWILDVANNMLQGPCRAFLADLSAGDEKKMTHAMSFFAFFMGIGNVLG  186

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+ + L++   FT TDAC+++CANLK+CF+I   LL+ +T  A++ V E        
Sbjct  187  YAAGSYNNLHRLLPFTRTDACEIFCANLKTCFLIHICLLMCLTITALSVVKEPLVNVVDD  246

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E + G +    EL GA KNL +PM IL++VT LNWIAWF
Sbjct  247  ERKGGSLMVFVELFGALKNLSKPMWILMLVTCLNWIAWF  285



>emb|CAB07811.1| sucrose transport protein [Vicia faba]
Length=523

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 207/275 (75%), Gaps = 6/275 (2%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGI H +++ IWLCGPISG++VQP+
Sbjct  30   EPSPLRKIMVVASIAAGVQFGWALQLSLLTPYVQLLGIHHTWAAYIWLCGPISGMLVQPI  89

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD CT+RFGRRRPFI +G++ V  AV LIG+AAD+GHS GD L +  +PRA  IF+
Sbjct  90   VGYHSDRCTSRFGRRRPFIAAGSIAVAIAVFLIGYAADLGHSFGDSLDQKVRPRAIGIFV  149

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALL DL  G+  KTR AN  FSFFMAVGN+ GYAAGA S LY
Sbjct  150  VGFWILDVANNMLQGPCRALLGDLCAGNQRKTRNANAFFSFFMAVGNVLGYAAGAYSKLY  209

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV------EGEE  783
              F FT T AC+VYCANLKSCF +S  LL ++   A+  V E   T +         G  
Sbjct  210  HVFPFTKTKACNVYCANLKSCFFLSIALLTVLATSALIYVKETALTPEKTVVTTEDGGSS  269

Query  784  GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            G +P  G+L GAFK L RPM ILL+VT LNWIAWF
Sbjct  270  GGMPCFGQLSGAFKELKRPMWILLLVTCLNWIAWF  304



>ref|XP_007020264.1| Sucrose-proton symporter 2 isoform 2 [Theobroma cacao]
 gb|EOY17489.1| Sucrose-proton symporter 2 isoform 2 [Theobroma cacao]
 gb|AHH34926.1| sucrose transporter 3 isoform 2 [Theobroma cacao]
Length=425

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 212/277 (77%), Gaps = 1/277 (0%)
 Frame = +1

Query  61   QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
            ++ + +   +PL K+  ++AIAAG+QFGWALQLSLLTPYVQ LG+PH +++ IWLCGPIS
Sbjct  2    ENGDIIQSPSPLRKIVTIAAIAAGIQFGWALQLSLLTPYVQTLGVPHTWAAFIWLCGPIS  61

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            GL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA D+GH  GD L   TKP
Sbjct  62   GLLVQPIVGYNSDRCTSRFGRRRPFIAAGATFVSIAVFLIGFAKDMGHHAGDSLESPTKP  121

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  IF+VGFWILDVANNMLQGPCRALLADLS  D  K R AN  FSFFMAVGN+ GYAA
Sbjct  122  RAVAIFVVGFWILDVANNMLQGPCRALLADLSANDHKKMRTANGWFSFFMAVGNVLGYAA  181

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+ S LY+ F FT T ACDVYCANLKSCF I  ++LL+VT  AVT V E   T++  E E
Sbjct  182  GSYSHLYRIFPFTRTKACDVYCANLKSCFTIDIMILLLVTVTAVTTVKEDPLTKQVQEEE  241

Query  781  -EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             + +  FVGE++ AFK L +PM ILL+VT LNWIAWF
Sbjct  242  TKTQAAFVGEIVTAFKTLKKPMWILLLVTCLNWIAWF  278



>gb|AFM28284.1| SUT1-1 [Medicago truncatula]
 gb|KEH43584.1| sucrose proton symporter, putative [Medicago truncatula]
Length=525

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 214/286 (75%), Gaps = 11/286 (4%)
 Frame = +1

Query  64   DLEALP-EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
             +E+ P E +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPIS
Sbjct  23   HVESPPLEPSPLRKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPIS  82

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            G++VQP+VGY+SD CT+RFGRRRPFI +G+  V  AV LIG+AAD+GHS GD L K  +P
Sbjct  83   GMLVQPIVGYHSDRCTSRFGRRRPFIAAGSFAVAIAVFLIGYAADLGHSFGDDLSKKVRP  142

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  IF+VGFWILDVANNMLQGPCRALL DL  G+  KTR AN  FSFFMAVGNI GYAA
Sbjct  143  RAIGIFVVGFWILDVANNMLQGPCRALLGDLCAGNHQKTRNANAFFSFFMAVGNILGYAA  202

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEG-  777
            GA S L+  F FT T ACD+YCANLKSCF +S  LL  V   A+  V E+  + + V G 
Sbjct  203  GAYSKLFHVFPFTKTKACDIYCANLKSCFFLSIALLTAVATAALIYVKEIPLSPEKVTGN  262

Query  778  ----EEGKV-----PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                E+G V     P  GEL GAF+ L RPM ILL+VT LNWIAWF
Sbjct  263  GVTDEDGNVTKSSNPCFGELSGAFRELKRPMWILLLVTCLNWIAWF  308



>ref|XP_004159998.1| PREDICTED: sucrose transport protein SUC2-like [Cucumis sativus]
Length=495

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 197/253 (78%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  GVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRR  309
            GVQFGWALQLSLLTPYVQ LG+ H +S+ IWLCGP+SGLIVQP VGYYSD CT+RFGRRR
Sbjct  31   GVQFGWALQLSLLTPYVQQLGVSHTWSAFIWLCGPLSGLIVQPTVGYYSDRCTSRFGRRR  90

Query  310  PFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGP  489
            PFI +G+  V  AV LIGFAADIGH+ GDPL K TKPRA  IF+VGFW+LDVANNMLQGP
Sbjct  91   PFIVAGSTFVATAVFLIGFAADIGHAVGDPLNKPTKPRAVAIFVVGFWVLDVANNMLQGP  150

Query  490  CRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCA  669
            CRALLAD+S  +  K R+AN  FSFFM VGN+ GYAAG+ + LYK   FTLT ACD YCA
Sbjct  151  CRALLADMSCNNHKKMRMANGFFSFFMGVGNVLGYAAGSYNKLYKFLPFTLTKACDSYCA  210

Query  670  NLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLI  849
            NLK+CF+I  + LL+VT  AV  VSE Q+    +E +E   PF G+L GA K L +PM +
Sbjct  211  NLKTCFLIDIVFLLLVTTFAVLMVSENQF--DPLEIDEEATPFFGKLFGALKKLEKPMWL  268

Query  850  LLIVTALNWIAWF  888
            LL+VTALNWI WF
Sbjct  269  LLLVTALNWIGWF  281



>emb|CAA12256.1| Sucrose carrier [Ricinus communis]
Length=334

 Score =   346 bits (888),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 180/265 (68%), Positives = 206/265 (78%), Gaps = 12/265 (5%)
 Frame = +1

Query  130  GVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRR  309
            GVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+VGY+SD CT+RFGRRR
Sbjct  2    GVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPIVGYHSDRCTSRFGRRR  61

Query  310  PFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGP  489
            PFI SGA  V  AV LIG+AAD+GH +GD L K  K RA  IF+VGFWILDVANNMLQGP
Sbjct  62   PFIASGAAFVAIAVFLIGYAADLGHLSGDSLDKSPKTRAIAIFVVGFWILDVANNMLQGP  121

Query  490  CRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCA  669
            CRALLADLSG    KTR AN LFSFFMAVGN+ GYAAGA + LYK F FT T ACDVYCA
Sbjct  122  CRALLADLSGTSQKKTRTANALFSFFMAVGNVLGYAAGAYTHLYKLFPFTKTTACDVYCA  181

Query  670  NLKSCFIISAILLLIVTAVAVTCVSEVQYT-RKAVEGEEGK-----------VPFVGELL  813
            NLKSCF IS +LLL +T +A++ V E  ++  +AV+  E             +PF GE+L
Sbjct  182  NLKSCFFISIVLLLSLTVLALSYVKEKPWSPDQAVDNAEDDTASQASSSAQPMPFFGEIL  241

Query  814  GAFKNLPRPMLILLIVTALNWIAWF  888
            GAFKNL RPM ILL+VT LNWIAWF
Sbjct  242  GAFKNLKRPMWILLLVTCLNWIAWF  266



>ref|XP_006376318.1| putative sucrose-H+ symporter family protein [Populus trichocarpa]
 gb|ERP54115.1| putative sucrose-H+ symporter family protein [Populus trichocarpa]
Length=535

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 221/311 (71%), Gaps = 19/311 (6%)
 Frame = +1

Query  10   MEVGTSSSSG--GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME G    +     +F ++Q   A    +PL K+ +V++IAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MESGVRKENNPPSSSFSLQQQPPAT-NPSPLRKIIMVASIAAGVQFGWALQLSLLTPYVQ  59

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPH +++ IWLCGPISG++VQP VGYYSD CT+RFGRRRPFI +GA  V  +V LIG
Sbjct  60   LLGIPHTWAAFIWLCGPISGMLVQPTVGYYSDRCTSRFGRRRPFIAAGAGFVAISVFLIG  119

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AADIGH +GD L K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG D  KTR 
Sbjct  120  YAADIGHLSGDSLTKTAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGTDHKKTRT  179

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  +SFFMAVGN+ G+A+G+ + LY+ F F+ T ACDVYCANLKSCF IS  LLL +T 
Sbjct  180  ANAFYSFFMAVGNVLGFASGSYTHLYRIFPFSRTKACDVYCANLKSCFFISIALLLTLTI  239

Query  724  VAVTCVSEVQYTRKAVEG----------------EEGKVPFVGELLGAFKNLPRPMLILL  855
            +A++ V E  ++ +   G                E    PF GE++ A KNL RPM ILL
Sbjct  240  LALSYVREKPWSPEGSSGDGGNEEEKEVEGGEAKESTPAPFFGEIVAALKNLQRPMRILL  299

Query  856  IVTALNWIAWF  888
            +VT LNW+AWF
Sbjct  300  LVTCLNWVAWF  310



>ref|XP_010438237.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
 ref|XP_010438245.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=521

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/288 (61%), Positives = 214/288 (74%), Gaps = 19/288 (7%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
              +PL +   V++IAAG+QFGWALQLSLLTPYVQLLGIPHK++SLIWLCGPISG++VQP+
Sbjct  11   SSSPLKQTIAVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPI  70

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD C +RFGRRRPFI +GALLV  AV+LIG+AADIG   GD +    KP A  +F 
Sbjct  71   VGYHSDRCESRFGRRRPFIAAGALLVAIAVVLIGYAADIGEILGDRVDLTPKPHAIAVFA  130

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALLADLSG    KTR AN+LFSFFMAVGN+ G+AAGA + L+
Sbjct  131  VGFWILDVANNMLQGPCRALLADLSGNSAKKTRTANSLFSFFMAVGNVLGFAAGAFAHLH  190

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY--TRKAVE---GEEG  786
             +F FT+T+ACDVYCANLKSCF  S ++L+ +T  A+  V E ++  T    E   GEE 
Sbjct  191  DAFPFTMTEACDVYCANLKSCFFFSILILMSLTTFALWYVDEKRWSSTETVTEVNGGEED  250

Query  787  --------------KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                          +VP  GEL  A K++ RPM++LL+VT LNWIAWF
Sbjct  251  GEIKEEVTAPLKVVRVPLFGELFSAVKDMKRPMVMLLLVTCLNWIAWF  298



>emb|CDY03675.1| BnaA02g15620D [Brassica napus]
Length=513

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 223/290 (77%), Gaps = 2/290 (1%)
 Frame = +1

Query  25   SSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHK  204
             ++    A E +  LE   + +PL K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK
Sbjct  8    KTAKDAAALETQSSLEEFNQPSPLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHK  67

Query  205  FSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGH  384
            +SSLIWLCGP+SG+IVQP+VG++SD CT+RFGRRRPFI +GA +V  AV LIG+AADIG+
Sbjct  68   WSSLIWLCGPVSGMIVQPIVGFHSDRCTSRFGRRRPFIAAGAAMVAVAVFLIGYAADIGY  127

Query  385  STGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSF  564
              GD L +  + RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN  FSF
Sbjct  128  KMGDKLEETPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSF  187

Query  565  FMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVS  744
            FMAVGN+ GYAAG+ + L+K F F +T+ACD+YCANLKSCF +S  LLL+VT  ++  V 
Sbjct  188  FMAVGNVLGYAAGSFTNLHKMFPFAMTNACDLYCANLKSCFFLSITLLLLVTVTSLWYVK  247

Query  745  EVQYTRKAVEGEEGK--VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + Q++   V  +E K  VPF GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  248  DKQWSPPPVAADEEKKSVPFFGEIFGAFKVMERPMWMLLIVTALNWIAWF  297



>ref|XP_004515134.1| PREDICTED: sucrose transport protein SUC5-like [Cicer arietinum]
Length=568

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/281 (61%), Positives = 213/281 (76%), Gaps = 6/281 (2%)
 Frame = +1

Query  52   EVEQDLEALPEE--TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            E    +EA  +   +PL K+  V++IAAG+QFGWALQLSLLTPY+QLLG+PHK+++ IWL
Sbjct  82   EASLHVEAAQQRKPSPLRKMIAVASIAAGIQFGWALQLSLLTPYIQLLGVPHKWAANIWL  141

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISG+IVQPLVGYYSD   +RFGRRRPFIF GA+ V  AV LIG+AADIGH+ GD L 
Sbjct  142  CGPISGMIVQPLVGYYSDRSHSRFGRRRPFIFFGAIAVAIAVFLIGYAADIGHTLGDDLT  201

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            K T+ RA VIF++GFWILDVANNMLQGPCRA L DL+  D S+ R  N LFSFFMAVGN+
Sbjct  202  KKTRTRAVVIFVLGFWILDVANNMLQGPCRAFLGDLAADDHSRMRTGNALFSFFMAVGNV  261

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ S L+K F FT T ACDV+CANLK+CF  S  LL +V+A A+  V ++  T +
Sbjct  262  LGYAAGSYSNLHKLFPFTETKACDVFCANLKTCFFFSIFLLALVSAFALIYVEDIPITSQ  321

Query  766  AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                EE +V   GELLGA   + +PM +L++VTA+NW+AWF
Sbjct  322  ----EEIQVSCFGELLGAVNGIKKPMWMLMLVTAINWVAWF  358



>gb|ADW94614.1| sucrose transporter 1 [Populus trichocarpa]
Length=535

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 221/311 (71%), Gaps = 19/311 (6%)
 Frame = +1

Query  10   MEVGTSSSSG--GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME G    +     +F ++Q   A    +PL K+ +V++IAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MESGVRKENNPPSSSFSLQQQPPAT-NPSPLRKIIMVASIAAGVQFGWALQLSLLTPYVQ  59

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPH +++ IWLCGPISG++VQP VGYYSD CT+RFGRRRPFI +GA  V  +V LIG
Sbjct  60   LLGIPHTWAAFIWLCGPISGMLVQPTVGYYSDRCTSRFGRRRPFIAAGAGFVAISVFLIG  119

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AADIGH +GD L K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG D  KTR 
Sbjct  120  YAADIGHLSGDSLTKTAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGTDHKKTRT  179

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  +SFFMA+GN+ G+A+G+ + LY+ F F+ T ACDVYCANLKSCF IS  LLL +T 
Sbjct  180  ANAFYSFFMAIGNVLGFASGSYTHLYRIFPFSRTKACDVYCANLKSCFFISIALLLTLTI  239

Query  724  VAVTCVSEVQYTRKAVEG----------------EEGKVPFVGELLGAFKNLPRPMLILL  855
            +A++ V E  ++ +   G                E    PF GE++ A KNL RPM ILL
Sbjct  240  LALSYVREKPWSPEGSSGDGGNEEEKEVEGGEAKESTPAPFFGEIVAALKNLQRPMRILL  299

Query  856  IVTALNWIAWF  888
            +VT LNW+AWF
Sbjct  300  LVTCLNWVAWF  310



>ref|XP_008465545.1| PREDICTED: sucrose transport protein SUC8-like isoform X2 [Cucumis 
melo]
Length=495

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 196/253 (77%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  GVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRR  309
            GVQFGWALQLSLLTPYVQ LG+ H +S+ IWLCGP+SGLIVQP VGYYSD CT+RFGRRR
Sbjct  31   GVQFGWALQLSLLTPYVQQLGVSHTWSAFIWLCGPLSGLIVQPTVGYYSDRCTSRFGRRR  90

Query  310  PFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGP  489
            PFI +GA  V  AV LIGFAADIGH+ GD L K  KPRA  IF+VGFW+LDVANNMLQGP
Sbjct  91   PFIVAGASFVATAVFLIGFAADIGHAVGDELSKPIKPRAVAIFVVGFWVLDVANNMLQGP  150

Query  490  CRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCA  669
            CRALLAD+S  +  K R+AN  FSFFM VGN+ GYAAG+ + L+K   FTLTDACD YCA
Sbjct  151  CRALLADMSCNNHKKMRMANGFFSFFMGVGNVLGYAAGSNNKLHKFLPFTLTDACDTYCA  210

Query  670  NLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLI  849
            NLK+CF+I  + LL++T  AV  V+E  + R  +E +E   PF G+L GA K L +PM I
Sbjct  211  NLKTCFLIDIVFLLLITTFAVLTVTEKPFER--LEIDEEATPFFGKLFGALKKLEKPMWI  268

Query  850  LLIVTALNWIAWF  888
            LL+VTALNWI WF
Sbjct  269  LLLVTALNWIGWF  281



>ref|XP_007020263.1| Sucrose-proton symporter 2 isoform 1 [Theobroma cacao]
 gb|EOY17488.1| Sucrose-proton symporter 2 isoform 1 [Theobroma cacao]
 gb|AHH34925.1| sucrose transporter 3 isoform 1 [Theobroma cacao]
Length=494

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 212/277 (77%), Gaps = 1/277 (0%)
 Frame = +1

Query  61   QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
            ++ + +   +PL K+  ++AIAAG+QFGWALQLSLLTPYVQ LG+PH +++ IWLCGPIS
Sbjct  2    ENGDIIQSPSPLRKIVTIAAIAAGIQFGWALQLSLLTPYVQTLGVPHTWAAFIWLCGPIS  61

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            GL+VQP+VGY SD CT+RFGRRRPFI +GA  V  AV LIGFA D+GH  GD L   TKP
Sbjct  62   GLLVQPIVGYNSDRCTSRFGRRRPFIAAGATFVSIAVFLIGFAKDMGHHAGDSLESPTKP  121

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  IF+VGFWILDVANNMLQGPCRALLADLS  D  K R AN  FSFFMAVGN+ GYAA
Sbjct  122  RAVAIFVVGFWILDVANNMLQGPCRALLADLSANDHKKMRTANGWFSFFMAVGNVLGYAA  181

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+ S LY+ F FT T ACDVYCANLKSCF I  ++LL+VT  AVT V E   T++  E E
Sbjct  182  GSYSHLYRIFPFTRTKACDVYCANLKSCFTIDIMILLLVTVTAVTTVKEDPLTKQVQEEE  241

Query  781  -EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             + +  FVGE++ AFK L +PM ILL+VT LNWIAWF
Sbjct  242  TKTQAAFVGEIVTAFKTLKKPMWILLLVTCLNWIAWF  278



>ref|XP_004515590.1| PREDICTED: sucrose transport protein SUC2-like [Cicer arietinum]
Length=509

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 213/295 (72%), Gaps = 2/295 (1%)
 Frame = +1

Query  10   MEVGT-SSSSGGGAFEVEQDLEAL-PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            MEV + S S+ G       +L+ + P  +PL K+  V++IAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MEVTSPSKSNHGDPMGSSLELDCVQPVGSPLRKMIAVASIAAGVQFGWALQLSLLTPYVQ  60

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
             LG+PH +++ IWLCGPISGL+VQP+ GYYSD  T+RFGRRRPFIF G++ V  AV LIG
Sbjct  61   SLGVPHVWAAFIWLCGPISGLLVQPIAGYYSDRSTSRFGRRRPFIFCGSVAVGIAVFLIG  120

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AAD+GHS GD L K T+PRA   F+VGFWILDVANNMLQGPCRA LADL+ GD   TR 
Sbjct  121  YAADLGHSFGDNLSKKTRPRAVGFFVVGFWILDVANNMLQGPCRAFLADLAAGDEKMTRR  180

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  FSFFMAVGNI GYAAG+ S LYK F FT TDAC+++CANLKSCF  S +LL  +  
Sbjct  181  ANAFFSFFMAVGNILGYAAGSYSGLYKIFPFTETDACNIFCANLKSCFFFSILLLTFLAG  240

Query  724  VAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +A+  V +    R  V     +V   G L  A K L RPM +L++VT +NWIAWF
Sbjct  241  IALVYVEDTPRLRAEVSDNNEQVSCFGHLFRALKELKRPMWMLMLVTCVNWIAWF  295



>ref|NP_001275850.1| citrus sucrose transporter 1 [Citrus sinensis]
 gb|AAM29150.1| citrus sucrose transporter 1 [Citrus sinensis]
Length=528

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/269 (65%), Positives = 209/269 (78%), Gaps = 6/269 (2%)
 Frame = +1

Query  94   LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYY  273
            +WK+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWLCGPISG+IVQP+VG++
Sbjct  33   MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFH  92

Query  274  SDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFW  453
            SD C +RFGRRRPFI +GA+LV  AV LIG+AADIGHS GD +    K RA +IF++GFW
Sbjct  93   SDTCKSRFGRRRPFILAGAVLVAIAVFLIGYAADIGHSAGDSVTDSVKTRAIIIFVIGFW  152

Query  454  ILDVANNMLQGPCRALLADLSGGDGSK-TRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            ILDVANN LQGPCRAL ADLS G  +K TR AN+ FSFFMAVGN+ GYAAG+ + LY   
Sbjct  153  ILDVANNTLQGPCRAL-ADLSSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHML  211

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG---KVPFV  801
             FT + ACDVYCANLK+CF +S  LL+ +T +A+  V+E Q   +  + E     K PF 
Sbjct  212  PFTKSKACDVYCANLKTCFFLSIALLITLTTIALFYVTE-QRLEEIDDKETAPSTKDPFF  270

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E+ GA K L +PM ILL VTALNWIAWF
Sbjct  271  SEIFGALKGLQKPMWILLAVTALNWIAWF  299



>ref|XP_007143634.1| hypothetical protein PHAVU_007G088200g [Phaseolus vulgaris]
 gb|ESW15628.1| hypothetical protein PHAVU_007G088200g [Phaseolus vulgaris]
Length=521

 Score =   351 bits (900),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 183/277 (66%), Positives = 216/277 (78%), Gaps = 7/277 (3%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            PE +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP
Sbjct  26   PEPSPLRKIMVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQP  85

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIF  438
            +VGY+SD+CT+RFGRRRPFI +GAL V  AV LIG+AAD+GH  GD L K T+PRA  IF
Sbjct  86   IVGYHSDHCTSRFGRRRPFIAAGALAVAIAVFLIGYAADLGHMFGDSLAKKTRPRAIAIF  145

Query  439  IVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTL  618
            +VGFWILDVANNMLQGPCRALLADLS GD  KTR AN  FSFFMAVGN+ GYAAG+ S L
Sbjct  146  VVGFWILDVANNMLQGPCRALLADLSAGDHRKTRNANAFFSFFMAVGNVLGYAAGSYSGL  205

Query  619  YKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV-------EG  777
            +  F FT T ACDVYCANLKSCF +S  LLL +  +A+T V E + + +         +G
Sbjct  206  HHVFPFTKTKACDVYCANLKSCFFLSIALLLTLATIALTYVKEERVSSEKSSANVAEEDG  265

Query  778  EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              G +P  G+L GAF+ L RPM ILL+VT LNWIAWF
Sbjct  266  SRGGMPCFGQLFGAFRELKRPMWILLLVTCLNWIAWF  302



>ref|XP_008465544.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Cucumis 
melo]
Length=528

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 196/253 (77%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  GVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRR  309
            GVQFGWALQLSLLTPYVQ LG+ H +S+ IWLCGP+SGLIVQP VGYYSD CT+RFGRRR
Sbjct  31   GVQFGWALQLSLLTPYVQQLGVSHTWSAFIWLCGPLSGLIVQPTVGYYSDRCTSRFGRRR  90

Query  310  PFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGP  489
            PFI +GA  V  AV LIGFAADIGH+ GD L K  KPRA  IF+VGFW+LDVANNMLQGP
Sbjct  91   PFIVAGASFVATAVFLIGFAADIGHAVGDELSKPIKPRAVAIFVVGFWVLDVANNMLQGP  150

Query  490  CRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCA  669
            CRALLAD+S  +  K R+AN  FSFFM VGN+ GYAAG+ + L+K   FTLTDACD YCA
Sbjct  151  CRALLADMSCNNHKKMRMANGFFSFFMGVGNVLGYAAGSNNKLHKFLPFTLTDACDTYCA  210

Query  670  NLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLI  849
            NLK+CF+I  + LL++T  AV  V+E  + R  +E +E   PF G+L GA K L +PM I
Sbjct  211  NLKTCFLIDIVFLLLITTFAVLTVTEKPFER--LEIDEEATPFFGKLFGALKKLEKPMWI  268

Query  850  LLIVTALNWIAWF  888
            LL+VTALNWI WF
Sbjct  269  LLLVTALNWIGWF  281



>ref|XP_004515129.1| PREDICTED: sucrose transport protein SUC8-like [Cicer arietinum]
Length=437

 Score =   348 bits (892),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 218/296 (74%), Gaps = 3/296 (1%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQ-DLEAL-PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            MEV + + S  G  +    +L+ + P  +PL K+ +V+++AAGVQFGWALQLSLLTPYVQ
Sbjct  1    MEVTSPTKSNRGDLKGSSLELDCVEPVASPLPKMIIVASVAAGVQFGWALQLSLLTPYVQ  60

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
             LG+PH ++S IWLCGP+SGL+VQP+VGYYSD  T+RFGRRRPFIF G L V  AV LIG
Sbjct  61   TLGVPHIWASFIWLCGPMSGLLVQPVVGYYSDRSTSRFGRRRPFIFFGTLSVAVAVFLIG  120

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AAD+GHS GD L + T+PRA   F++GFWILDVANNMLQGPCRA LADL+  D   TR 
Sbjct  121  YAADLGHSFGDDLSQKTRPRAVAFFVLGFWILDVANNMLQGPCRAFLADLAASDEKMTRT  180

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
             N  FSFFMAVGNI GYAAG+ S+LYK F FT T AC+++CANLKSCF  S +L+ I+  
Sbjct  181  GNAFFSFFMAVGNILGYAAGSYSSLYKIFPFTETAACNIFCANLKSCFFFSILLITILAG  240

Query  724  VAVTCVSEVQYTRKAV-EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +A+T V +    +  V + ++ +V   G+L  A K L +PM +L++VT +NWIAWF
Sbjct  241  IALTYVEDKPRMKSEVSDDDDQQVSCFGQLFHALKELKKPMWMLMLVTCVNWIAWF  296



>ref|XP_002874582.1| hypothetical protein ARALYDRAFT_911231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50841.1| hypothetical protein ARALYDRAFT_911231 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   350 bits (899),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/291 (61%), Positives = 212/291 (73%), Gaps = 22/291 (8%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
              +PL +   V++IAAG+QFGWALQLSLLTPYVQLLGIPHK++SLIWLCGPISG++VQP+
Sbjct  11   SSSPLKQTIAVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPI  70

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD C +RFGRRRPFI +GA LV  AV+LIG+AADIG   GD +    K  A V+F 
Sbjct  71   VGYHSDRCKSRFGRRRPFIAAGAGLVAIAVVLIGYAADIGEILGDRVDSTPKSHAIVVFA  130

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALLADLSG  G KTR AN  FSFFMAVGN+ G+AAGA + L+
Sbjct  131  VGFWILDVANNMLQGPCRALLADLSGNSGKKTRTANYFFSFFMAVGNVLGFAAGAFTHLH  190

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY---TRKAVEG-----  777
             +F FTLT ACDVYCANLKSCF  S ++L+ +T  A+  V E Q+   T K V G     
Sbjct  191  DAFPFTLTKACDVYCANLKSCFFFSILILMSLTIFALWYVDEKQWSPETEKEVNGGGEVD  250

Query  778  --------------EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                          +E +VP  GEL  A K++ RPM++LL+VT LNWIAWF
Sbjct  251  DGNMEITEEVTALSKEVRVPLFGELFSAVKDMERPMVMLLLVTCLNWIAWF  301



>ref|XP_011038161.1| PREDICTED: sucrose transport protein SUC8-like [Populus euphratica]
Length=531

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 175/293 (60%), Positives = 217/293 (74%), Gaps = 12/293 (4%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            +F ++Q        +PL K+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWL
Sbjct  15   SFSLQQQQPPATNPSPLRKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWL  74

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGPISG++VQP VGYYSD CT+RFGRRRPFI +G+  V  +V LIG+AADIGH +GD L 
Sbjct  75   CGPISGMLVQPTVGYYSDRCTSRFGRRRPFIAAGSGFVAISVFLIGYAADIGHLSGDSLT  134

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG D  KTR AN  +SFFMAVGN+
Sbjct  135  KTAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGTDHKKTRTANAFYSFFMAVGNV  194

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             G+A+G+ + LY+ F F+ T ACDVYCANLKSCF IS  LLL++T +A++ V E  ++ +
Sbjct  195  LGFASGSYTHLYRIFPFSRTKACDVYCANLKSCFFISIALLLVLTILALSYVREKTWSPE  254

Query  766  AVE------------GEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                            E    PF G+++ AFKNL RPM ILL+VT LNW+AWF
Sbjct  255  GSSGDGGNEEEGGEAKESTPAPFFGKIVAAFKNLQRPMRILLLVTCLNWVAWF  307



>gb|ABJ51933.1| sucrose transporter 1 [Hevea brasiliensis]
Length=531

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 211/276 (76%), Gaps = 13/276 (5%)
 Frame = +1

Query  100  KLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSD  279
            K+ +V++IAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+VGY+SD
Sbjct  31   KIVMVASIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPIVGYHSD  90

Query  280  NCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWIL  459
             C +RFGRRRPFI +G+  V  AV LIG+AAD+GH +GDP+ K  KPRA  +F+VGFWIL
Sbjct  91   RCASRFGRRRPFIAAGSFAVAVAVFLIGYAADLGHLSGDPIAKSPKPRAIAVFVVGFWIL  150

Query  460  DVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFT  639
            DVANNMLQGPCRALLADLSG +  KTR AN LFSFFMAVGN+ G+AAGA + LYK F FT
Sbjct  151  DVANNMLQGPCRALLADLSGSNQKKTRTANALFSFFMAVGNVLGFAAGAYTHLYKIFPFT  210

Query  640  LTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK-------------AVEGE  780
             T ACDVYCANLKSCF IS  LLL +T +A+T V E Q++ +                 E
Sbjct  211  KTKACDVYCANLKSCFFISIFLLLTLTVLALTYVHEKQWSPEQGNAAAGDAEEEEDGPFE  270

Query  781  EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               +PF GE+  A KNL +PM ILL+VT LNWIAWF
Sbjct  271  SSPMPFFGEIFAALKNLQKPMWILLLVTCLNWIAWF  306



>ref|XP_002887397.1| hypothetical protein ARALYDRAFT_476315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63656.1| hypothetical protein ARALYDRAFT_476315 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/280 (62%), Positives = 216/280 (77%), Gaps = 1/280 (0%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E +   E L + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SS +WLCG
Sbjct  17   ETQSSSEDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSYMWLCG  76

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG++VQP+VGY+SD C +RFGRRRPFI +GA+LV  +V LIGFAAD+GHS GD L   
Sbjct  77   PISGMLVQPIVGYHSDRCESRFGRRRPFIATGAVLVAVSVFLIGFAADMGHSFGDKLENK  136

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
             + RA +IF+ GFW+LDVANN LQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ G
Sbjct  137  VRTRAIIIFLTGFWVLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLG  196

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+ + L+K F FT+T ACDVYCANLK+CF +S  LLLI+T  ++  V + Q++    
Sbjct  197  YAAGSYTNLHKMFPFTMTKACDVYCANLKTCFFLSITLLLILTFSSLWYVKDKQWSPPHG  256

Query  772  EGEE-GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E E+   V F GE+ GA + + RPM +LL+VT +NWIAWF
Sbjct  257  EKEKTSSVFFFGEIFGAVRVMKRPMWMLLMVTVINWIAWF  296



>gb|ADW94613.1| sucrose transporter 1 [Populus trichocarpa]
Length=535

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 179/311 (58%), Positives = 220/311 (71%), Gaps = 19/311 (6%)
 Frame = +1

Query  10   MEVGTSSSSG--GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME G    +     +F +++   A    +PL K+ +V++IAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MESGVRKENNPPSSSFSLQKQPPAT-NPSPLRKIIMVASIAAGVQFGWALQLSLLTPYVQ  59

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPH +++ IWLCGPISG++VQP VGYYSD CT+RFGRR PFI +GA  V  +V LIG
Sbjct  60   LLGIPHTWAAFIWLCGPISGMLVQPTVGYYSDRCTSRFGRRSPFIAAGAGFVAISVFLIG  119

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AADIGH +GD L K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG D  KTR 
Sbjct  120  YAADIGHLSGDSLTKTAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGTDHKKTRT  179

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  +SFFMAVGN+ G+A+G+ + LY+ F F+ T ACDVYCANLKSCF IS  LLL +T 
Sbjct  180  ANAFYSFFMAVGNVLGFASGSYTHLYRIFPFSRTKACDVYCANLKSCFFISIALLLTLTI  239

Query  724  VAVTCVSEVQYTRKAVEG----------------EEGKVPFVGELLGAFKNLPRPMLILL  855
            +A++ V E  ++ +   G                E    PF GE++ A KNL RPM ILL
Sbjct  240  LALSYVREKPWSPEGSSGDGANEEEKEVEGGEAKESTPAPFFGEIVAALKNLQRPMRILL  299

Query  856  IVTALNWIAWF  888
            +VT LNW+AWF
Sbjct  300  LVTCLNWVAWF  310



>ref|XP_010540294.1| PREDICTED: sucrose transport protein SUC2-like [Tarenaya hassleriana]
Length=516

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/282 (61%), Positives = 204/282 (72%), Gaps = 0/282 (0%)
 Frame = +1

Query  43   GAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIW  222
            GA  +E     L E +PL K+ +V++IAAGVQFGWA+Q+SLLTPYVQ LG PHK+SSLIW
Sbjct  12   GAVALETQGAELMEPSPLRKIILVASIAAGVQFGWAIQVSLLTPYVQYLGFPHKWSSLIW  71

Query  223  LCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL  402
            + GPIS ++VQP++GY+SD CT+RFGRRRPFI +G  L   AV LIG+AAD+G S GD  
Sbjct  72   MFGPISSMLVQPIIGYHSDRCTSRFGRRRPFIAAGTALFTVAVFLIGYAADLGQSMGDSK  131

Query  403  GKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGN  582
             K  K RA  IF +GFWILD+ANN LQGPCRA LADLS G+  K   AN  FSFFMAVGN
Sbjct  132  VKTPKTRAIAIFALGFWILDIANNTLQGPCRAFLADLSAGNARKMLTANAFFSFFMAVGN  191

Query  583  IGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTR  762
              GYA G+   LYK F FTLTDACDVYCANLKSCF +S I LL+VT  ++  V + Q++ 
Sbjct  192  AMGYATGSYKNLYKGFPFTLTDACDVYCANLKSCFFLSIIRLLLVTVSSLWYVKDKQWSP  251

Query  763  KAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +        VPF GE+  A K L  PM +LLIVTALNWIAWF
Sbjct  252  EPGSESGSCVPFFGEIFSALKELKHPMWMLLIVTALNWIAWF  293



>gb|KDP34602.1| hypothetical protein JCGZ_11979 [Jatropha curcas]
Length=529

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 214/285 (75%), Gaps = 16/285 (6%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + +PL K+ VV++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+
Sbjct  23   KASPLRKIVVVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPI  82

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD CT+RFGRRRPFI +G+  V  AV LIG+AADIGH +GD LGK  K RA  +F+
Sbjct  83   VGYHSDRCTSRFGRRRPFIAAGSACVAVAVFLIGYAADIGHLSGDSLGKSPKTRAIAVFV  142

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALLADLSG +  KTR AN LFSFFMAVGN+ GYAAG+ + LY
Sbjct  143  VGFWILDVANNMLQGPCRALLADLSGTNQKKTRTANALFSFFMAVGNVLGYAAGSYTHLY  202

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE----------------VQ  753
            K F FT T ACDVYCANLKSCF IS  LLLI+T +A+  V E                V 
Sbjct  203  KIFPFTKTIACDVYCANLKSCFFISIFLLLILTLIALFYVKEKPWSPEQENSGQRNGQVD  262

Query  754  YTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               +    E   +PF GE+L A KNL RPM ILL+VT LNWIAWF
Sbjct  263  DDEEETPSESTPMPFFGEILSALKNLQRPMWILLLVTCLNWIAWF  307



>ref|XP_003548078.1| PREDICTED: sucrose transport protein SUC1-like [Glycine max]
Length=511

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 212/276 (77%), Gaps = 2/276 (1%)
 Frame = +1

Query  64   DLEALPEE-TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
             LEA P + +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PH  +S IWLCGPIS
Sbjct  23   SLEAGPAQASPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAAASFIWLCGPIS  82

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            GL+VQP+VGYYSD+CT+RFGRRRPFI  GAL V  AV LIG+AADIG++ GD + K T+P
Sbjct  83   GLVVQPIVGYYSDHCTSRFGRRRPFILGGALAVAVAVFLIGYAADIGYAAGDDISKTTRP  142

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  +F++GFWILDVANNMLQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ GYAA
Sbjct  143  RAVGVFVIGFWILDVANNMLQGPCRAFLADLAAGDQRKTRIANGFFSFFMAVGNVLGYAA  202

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+   L+K F FT T ACDV+CANLKSCF  S +LLL +  VA+  V + Q   +A++  
Sbjct  203  GSYKGLHKMFPFTETKACDVFCANLKSCFFFSILLLLFLATVALLYVKDKQVEARALDDA  262

Query  781  EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 F  +L GA K L RPM +L++VTA+NW+ WF
Sbjct  263  TQPSCFF-QLFGALKELKRPMWMLMLVTAVNWVGWF  297



>ref|XP_006371473.1| hypothetical protein POPTR_0019s11560g [Populus trichocarpa]
 gb|ERP49270.1| hypothetical protein POPTR_0019s11560g [Populus trichocarpa]
Length=482

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 209/282 (74%), Gaps = 16/282 (6%)
 Frame = +1

Query  91   PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGY  270
            PL K+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+VGY
Sbjct  32   PLKKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPVVGY  91

Query  271  YSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGF  450
            +SD CT+RFGRRRPFI +GA  V  AV LIG+AADIGH +GD L K  KPRA  +F+VGF
Sbjct  92   HSDRCTSRFGRRRPFIAAGAAFVTIAVFLIGYAADIGHLSGDSLTKTAKPRAIAVFVVGF  151

Query  451  WILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSF  630
            WILDVANNMLQGPCRA LADLSG +  KTR +N  FSFFMAVGN+ GYAAG+ + LYK F
Sbjct  152  WILDVANNMLQGPCRAFLADLSGTNQKKTRTSNAFFSFFMAVGNVLGYAAGSYTHLYKLF  211

Query  631  SFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT----------------R  762
             F+ T ACDVYCANLKSCF IS  LLL +T +A++ V E  ++                 
Sbjct  212  PFSRTKACDVYCANLKSCFFISIALLLTLTILALSYVREKPWSPEGSPGEGGDEEEEEEA  271

Query  763  KAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 E   +PF GE+  A KNL RPM ILL+VT LNW+AWF
Sbjct  272  IGEAKESAPMPFFGEIFAALKNLQRPMWILLLVTCLNWVAWF  313



>ref|XP_009127880.1| PREDICTED: sucrose transport protein SUC1 [Brassica rapa]
Length=513

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 219/283 (77%), Gaps = 2/283 (1%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A E +  LE   + +PL K+  VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+SSLIWL
Sbjct  15   ALETQSSLEEFNQPSPLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWL  74

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGP+SG+IVQP+VG++SD CT+RFGRRRPFI +GA +V  AV LIG+AADIG+  GD L 
Sbjct  75   CGPVSGMIVQPIVGFHSDRCTSRFGRRRPFIAAGAAMVAVAVFLIGYAADIGYKMGDKLE  134

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
            +  + RA  IF +GFWILDVANN LQGPCRA LADL+ GD  + R+AN  FS FMAVGN+
Sbjct  135  ETPRVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRKRVANAFFSSFMAVGNV  194

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+K F F +T+ACD+YCANLKSCF +S  LLL+VT  ++  V + Q++  
Sbjct  195  LGYAAGSFTNLHKMFPFAMTNACDLYCANLKSCFFLSITLLLLVTVTSLWYVKDKQWSPP  254

Query  766  AVEGEEGK--VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             V  +E K  VPF GE+ GAFK + RPM +LLIVTALNWIAWF
Sbjct  255  PVAADEEKKSVPFFGEIFGAFKVMERPMWMLLIVTALNWIAWF  297



>ref|XP_010455355.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=521

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/288 (60%), Positives = 213/288 (74%), Gaps = 19/288 (7%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
              +PL +   V++IAAG+QFGWALQLSLLTPYVQLLGIPHK++SLIWLCGPISG++VQP+
Sbjct  11   SSSPLKQTIAVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPI  70

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD C +RFGRRRPFI +GALLV+ AV+LIG+AADIG   GD +    K  A  +F 
Sbjct  71   VGYHSDRCESRFGRRRPFIAAGALLVVIAVVLIGYAADIGEILGDRVDSTPKSHAIAVFA  130

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALLADLSG    KTR AN+LFSFFMAVGN+ G+AAGA + L+
Sbjct  131  VGFWILDVANNMLQGPCRALLADLSGNSAKKTRTANSLFSFFMAVGNVLGFAAGAFAHLH  190

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY--TRKAVE---GEEG  786
             +F FT+T+ACDVYC NLKSCF  S ++L+ +T  A+  V E ++  T    E   GEE 
Sbjct  191  DAFPFTVTEACDVYCVNLKSCFFFSILILMSLTTFALWYVDEKRWSSTETVTEVNGGEED  250

Query  787  --------------KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                          +VP  GEL  A K++ RPM++LL+VT L+WIAWF
Sbjct  251  GEIKEEVTAPLKVVRVPLFGELFSAVKDMNRPMVMLLLVTCLSWIAWF  298



>ref|XP_002862880.1| hypothetical protein ARALYDRAFT_497263 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39139.1| hypothetical protein ARALYDRAFT_497263 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/280 (61%), Positives = 216/280 (77%), Gaps = 1/280 (0%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E +   E L + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLLGIPHK+SS +WLCG
Sbjct  17   ETQSSSEDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSYMWLCG  76

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG++VQP+VGY+SD C +RFGRRRPFI +GA+LV  +V LIGFAAD+GHS GD L   
Sbjct  77   PISGMLVQPIVGYHSDRCESRFGRRRPFIATGAVLVAVSVFLIGFAADMGHSFGDKLENK  136

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
             + RA +IF+ GFW+LDVANN LQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ G
Sbjct  137  VRTRAIIIFLTGFWVLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLG  196

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+ + L+K F FT+T ACDVYCANLK+CF +S  LLLI+T  ++  V + Q++    
Sbjct  197  YAAGSYTNLHKMFPFTMTKACDVYCANLKTCFFLSITLLLILTFSSLWYVKDKQWSPPHG  256

Query  772  EGEE-GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E E+   + F GE+ GA + + RPM +LL+VT +NWIAWF
Sbjct  257  EKEKTSSLFFFGEIFGAVRVMKRPMWMLLMVTVINWIAWF  296



>gb|ADW94615.1| sucrose transporter 1 [Populus tremula x Populus alba]
Length=535

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 219/311 (70%), Gaps = 19/311 (6%)
 Frame = +1

Query  10   MEVGTSSSSG--GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME G    +     +F ++Q   A    +PL K+ VV++IAAGVQFGWALQLSLLTPYVQ
Sbjct  1    MESGVRKENNPPSSSFSLQQQPPAT-NPSPLRKIIVVASIAAGVQFGWALQLSLLTPYVQ  59

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPH +++ IWLCGPISG++VQP VGYYSD CT+RFGRRRPFI +GA  V  +V LIG
Sbjct  60   LLGIPHTWAAFIWLCGPISGMLVQPTVGYYSDRCTSRFGRRRPFIAAGAGFVAISVFLIG  119

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AADIGH +GD L K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG D  KTR 
Sbjct  120  YAADIGHLSGDSLTKTAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGKDHKKTRT  179

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  +SFFMAVGN+ G+A+G+ + LY+ F F+ T ACDVYCANLKSCF IS  LLL +T 
Sbjct  180  ANAFYSFFMAVGNVLGFASGSYTHLYRIFPFSRTKACDVYCANLKSCFFISIALLLTLTI  239

Query  724  VAVTCVSEVQYT----------------RKAVEGEEGKVPFVGELLGAFKNLPRPMLILL  855
            +A++ V E  ++                      E    PF GE++ A KNL RPM ILL
Sbjct  240  LALSYVREKPWSPEGSSGEGGNEEEKEEEGGEAKESTPAPFFGEIVAALKNLQRPMRILL  299

Query  856  IVTALNWIAWF  888
            +VT LNW+AWF
Sbjct  300  LVTCLNWVAWF  310



>ref|XP_003518348.1| PREDICTED: sucrose transport protein SUC1-like [Glycine max]
Length=511

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 210/276 (76%), Gaps = 2/276 (1%)
 Frame = +1

Query  64   DLEALP-EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPIS  240
             LE  P E +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PH  +S IWLCGPIS
Sbjct  23   SLEGGPGEASPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAAASFIWLCGPIS  82

Query  241  GLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKP  420
            GL+VQP+VGYYSD+CT+RFGRRRPFI  GAL V  AV LIG+AADIGHS GD + K T+P
Sbjct  83   GLVVQPIVGYYSDHCTSRFGRRRPFILGGALAVAIAVFLIGYAADIGHSAGDDITKKTRP  142

Query  421  RATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAA  600
            RA  +F++GFWILDVANNMLQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ GYAA
Sbjct  143  RAVGVFVIGFWILDVANNMLQGPCRAFLADLAAGDQQKTRIANGFFSFFMAVGNVLGYAA  202

Query  601  GAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE  780
            G+ S L+K F FT T ACDV+CANLKSCF  S +LLL +  VA+  V + Q     ++  
Sbjct  203  GSYSGLHKIFPFTETKACDVFCANLKSCFFFSILLLLFLATVALLYVKDKQVEAIPLDDA  262

Query  781  EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                 F  +L GA K L RPM +L++VTA+NW+ WF
Sbjct  263  TQPSCFF-QLFGALKELKRPMWMLMLVTAVNWVGWF  297



>ref|XP_002326003.2| sucrose transporter family protein [Populus trichocarpa]
 gb|EEF00385.2| sucrose transporter family protein [Populus trichocarpa]
Length=535

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 176/285 (62%), Positives = 210/285 (74%), Gaps = 16/285 (6%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            +  PL K+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGPISG++VQP+
Sbjct  29   KPGPLKKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPISGMLVQPV  88

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD CT+RFGRRRPFI +GA  V  AV LIG+AADIGH +GD L K  KPRA  +F+
Sbjct  89   VGYHSDRCTSRFGRRRPFIAAGAAFVTIAVFLIGYAADIGHLSGDSLTKTAKPRAIAVFV  148

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRA LADLSG +  KTR +N  FSFFMAVGN+ GYAAG+ + LY
Sbjct  149  VGFWILDVANNMLQGPCRAFLADLSGTNQKKTRTSNAFFSFFMAVGNVLGYAAGSYTHLY  208

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT--------------  759
            K F F+ T ACDVYCANLKSCF IS  LLL +T +A++ V E  ++              
Sbjct  209  KLFPFSRTKACDVYCANLKSCFFISIALLLTLTILALSYVREKPWSPEGSPGEGGDEEEE  268

Query  760  --RKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                    E   +PF GE+  A KNL RPM ILL+VT LNW+AWF
Sbjct  269  EEAIGEAKESAPMPFFGEIFAALKNLQRPMWILLLVTCLNWVAWF  313



>emb|CAJ33718.1| sucrose transporter 1 [Populus tremula x Populus tremuloides]
Length=534

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 218/311 (70%), Gaps = 19/311 (6%)
 Frame = +1

Query  10   MEVGTSSSSG--GGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQ  183
            ME G    +     +F ++Q   A    +PL K+ VV++IAAGVQFGWALQL LLTPYVQ
Sbjct  1    MESGVRKENNPPSSSFSLQQQPPAT-NPSPLRKIIVVASIAAGVQFGWALQLPLLTPYVQ  59

Query  184  LLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIG  363
            LLGIPH +++ IWLCGPISG++VQP VGYYSD CT+RFGRRRPFI +GA  V  +V LIG
Sbjct  60   LLGIPHTWAAFIWLCGPISGMLVQPTVGYYSDRCTSRFGRRRPFIAAGAGFVAISVFLIG  119

Query  364  FAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRL  543
            +AADIGH +GD L K  KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG D  KTR 
Sbjct  120  YAADIGHLSGDSLTKTAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGKDHKKTRT  179

Query  544  ANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTA  723
            AN  +SFFMAVGN+ G+A+G+ + LY+ F F+ T ACDVYCANLKSCF IS  LLL +T 
Sbjct  180  ANAFYSFFMAVGNVLGFASGSYTHLYRIFPFSRTKACDVYCANLKSCFFISIALLLTLTI  239

Query  724  VAVTCVSEVQYT----------------RKAVEGEEGKVPFVGELLGAFKNLPRPMLILL  855
            +A++ V E  ++                      E    PF GE++ A KNL RPM ILL
Sbjct  240  LALSYVREKPWSPEGSSGEGGNEEEKEEEGGEAKESTPAPFFGEIVAALKNLQRPMRILL  299

Query  856  IVTALNWIAWF  888
            +VT LNWIAWF
Sbjct  300  LVTCLNWIAWF  310



>gb|AIU94753.1| sucrose proton symporter [Morus alba var. multicaulis]
Length=519

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 217/299 (73%), Gaps = 6/299 (2%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            MEV +  +   G      ++    E  PL KL  V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  1    MEVESGIAKMNGKSNNSSEVPPPLEAEPLRKLIAVASIAAGVQFGWALQLSLLTPYVQLL  60

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPH +++ IWLCGP+SGL+VQP+VGY+SD CT+RFGRRRPFI +GA LV  AV LIGFA
Sbjct  61   GIPHTWAAFIWLCGPVSGLLVQPIVGYHSDRCTSRFGRRRPFIAAGAALVAAAVFLIGFA  120

Query  370  ADIGHSTGDPLGKV-TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLA  546
            AD+GH  GD  G++  KPR+  +F+VGFWILDVANNMLQGPCRALLADLSG D  K R+A
Sbjct  121  ADLGHLFGDDPGRLGAKPRSIAVFVVGFWILDVANNMLQGPCRALLADLSGDDRRKMRIA  180

Query  547  NTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAV  726
            N  +SFFMAVGN+ G++AG+ + L+    FT T ACDVYCANLK+CF IS  LLL +T +
Sbjct  181  NGFYSFFMAVGNVLGFSAGSYTHLHSFLPFTKTKACDVYCANLKTCFFISIFLLLSLTTI  240

Query  727  AVTCVSEVQYTRKAVEGEE-----GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            A+T V E Q   +     E       VP  GE+ GAF+ L +PM +LL+VT LNW+AWF
Sbjct  241  ALTSVRERQQNPQNDNDNERSQPSAAVPVFGEMAGAFRELKKPMWVLLLVTCLNWVAWF  299



>gb|AAD45932.1|AF168771_1 sucrose transport protein [Betula pendula]
Length=262

 Score =   336 bits (862),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 202/261 (77%), Gaps = 5/261 (2%)
 Frame = +1

Query  121  IAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFG  300
            IAAGVQFGWALQLS LTPYVQLLGIPH ++  IWLCGPISGL VQP+VGYYSD CT+RFG
Sbjct  1    IAAGVQFGWALQLSPLTPYVQLLGIPHTWAPFIWLCGPISGLFVQPVVGYYSDRCTSRFG  60

Query  301  RRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNML  480
            RRRPFI +G+ LV  AV LIG+AAD+GH  GDP+ K TK RA  +F++GFWILDVANNML
Sbjct  61   RRRPFIAAGSSLVAIAVFLIGYAADLGHVFGDPIDKTTKTRAIAVFVLGFWILDVANNML  120

Query  481  QGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDV  660
            QGPCRALLADLSG D  + R  N L+SFFMAVGN+ G+AAG+ + LYK F FT T+ACDV
Sbjct  121  QGPCRALLADLSGDDQRRMRTGNALYSFFMAVGNVLGFAAGSYTRLYKLFPFTSTEACDV  180

Query  661  YCANLKSCFIISAILLLIVTAVAVTCVSEV----QYTRKAVEGEEGK-VPFVGELLGAFK  825
            YCANLKSCF +S  LLLI+T +A+T V E     Q       GEE + VPF GE+  A K
Sbjct  181  YCANLKSCFFLSIALLLILTTIALTAVKEQILSPQPEPGTAGGEEKQVVPFFGEIFFALK  240

Query  826  NLPRPMLILLIVTALNWIAWF  888
             L RPM ILL+VT LNWIAWF
Sbjct  241  GLQRPMRILLMVTCLNWIAWF  261



>gb|ADW94616.1| sucrose transporter 3 [Populus tremula x Populus alba]
Length=532

 Score =   345 bits (886),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 215/294 (73%), Gaps = 19/294 (6%)
 Frame = +1

Query  64   DLEALPEET---PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGP  234
            +L  LP      PL K+ +V++IAAGVQFGWALQLSLLTPYVQLLGIPH +++ IWLCGP
Sbjct  17   NLPQLPPSVKPGPLRKIIMVASIAAGVQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGP  76

Query  235  ISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVT  414
            ISG++VQP+VGY+SD CT+RFGRRRPFI +GA  V  AV LIG+AADIGH +GD L K  
Sbjct  77   ISGMLVQPVVGYHSDRCTSRFGRRRPFIAAGAAFVTIAVFLIGYAADIGHLSGDSLTKTA  136

Query  415  KPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGY  594
            KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG +  KTR +N  FSFFMAVGN+ GY
Sbjct  137  KPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGTNQKKTRTSNAFFSFFMAVGNVLGY  196

Query  595  AAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVE  774
            AAG+ + LYK F F+ T ACDVYCANLKSCF IS  LLL +T +A++ V E  ++ +   
Sbjct  197  AAGSYTHLYKLFPFSRTKACDVYCANLKSCFFISIALLLTLTILALSYVREKPWSPEGSP  256

Query  775  GEEG----------------KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            GE G                  PF GE+  A KNL RPM ILL+VT LNW+AWF
Sbjct  257  GEGGDEEEEEEATGEAKESVPAPFFGEIFAALKNLQRPMWILLLVTCLNWVAWF  310



>ref|XP_007151903.1| hypothetical protein PHAVU_004G085500g [Phaseolus vulgaris]
 gb|ESW23897.1| hypothetical protein PHAVU_004G085500g [Phaseolus vulgaris]
Length=444

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PH  +S IWLCGPISGL+VQP+
Sbjct  28   EPSPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAAASFIWLCGPISGLVVQPI  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD  T+R+GRRRPFI  GA+ V  AV LIG+AADIG+S GD + K T+PRA  +F+
Sbjct  88   VGYYSDRSTSRYGRRRPFILGGAVAVAIAVFLIGYAADIGYSAGDDITKKTRPRAVAVFV  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANNMLQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ GYAAG+ S L+
Sbjct  148  IGFWILDVANNMLQGPCRAFLADLAAGDQRKTRIANGFFSFFMAVGNVLGYAAGSFSGLH  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT T ACDV+CANLKSCF  S +LLL ++ VA+  V +     +AV+ E+ +    
Sbjct  208  KIFPFTQTKACDVFCANLKSCFFFSILLLLFLSTVALIYVKDKPVAARAVQ-EDAQPSCF  266

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +L GA K L RPM +L++VTA+NWI WF
Sbjct  267  FQLFGALKELKRPMWMLMLVTAVNWIGWF  295



>ref|XP_006286640.1| hypothetical protein CARUB_v10002510mg [Capsella rubella]
 gb|EOA19538.1| hypothetical protein CARUB_v10002510mg [Capsella rubella]
Length=490

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/281 (63%), Positives = 211/281 (75%), Gaps = 0/281 (0%)
 Frame = +1

Query  46   AFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWL  225
            A E +     +   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+SS IWL
Sbjct  12   AVEKQSSSSDVDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWL  71

Query  226  CGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG  405
            CGP+SGL+VQP VGYYSD C +RFGRRRPFI +GA LV  AV LIG+AADIGH  GD L 
Sbjct  72   CGPVSGLLVQPTVGYYSDRCRSRFGRRRPFIATGAFLVAIAVFLIGYAADIGHILGDKLD  131

Query  406  KVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNI  585
               K +A VIF +GFWILDVANN LQGPCRA L DL+ GD  KTR AN  FSFFMAVGN+
Sbjct  132  DHVKGKAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDARKTRTANAAFSFFMAVGNV  191

Query  586  GGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK  765
             GYAAG+ + L+K F FT+T ACD+YCANLKSCF +S  LLL+ T +++  V E Q++  
Sbjct  192  LGYAAGSYTHLHKIFPFTITKACDLYCANLKSCFFLSITLLLVFTIISLWYVEEKQWSPN  251

Query  766  AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                E  K PF GE+ GAFK + RPM +LLIVT+LNWIAWF
Sbjct  252  EDSEEGKKTPFFGEIFGAFKVMKRPMWMLLIVTSLNWIAWF  292



>gb|KFK32062.1| hypothetical protein AALP_AA6G194700 [Arabis alpina]
Length=526

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/277 (62%), Positives = 204/277 (74%), Gaps = 18/277 (6%)
 Frame = +1

Query  112  VSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTN  291
            V++IAAG+QFGWALQLSLLTPYVQLLGIPHK++SLIWLCGPISG++VQP+VGY+SD C +
Sbjct  29   VASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCVS  88

Query  292  RFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVAN  471
            RFGRRRPFI +GA+LV  AV LIG+AADIG   GD +    K  A VIF +GFWILDVAN
Sbjct  89   RFGRRRPFIAAGAVLVAIAVFLIGYAADIGEILGDRVDSTPKSNAIVIFAIGFWILDVAN  148

Query  472  NMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDA  651
            NMLQGPCRALLADLSG    KTR AN+ FSFFMAVGN+ G+AAGA + L+ +F FT+T A
Sbjct  149  NMLQGPCRALLADLSGTSSKKTRTANSFFSFFMAVGNVLGFAAGAFTHLHDAFPFTMTKA  208

Query  652  CDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK------------------AVEG  777
            CDVYCANLKSCF  S  LL+ +T  A+  V E Q++                        
Sbjct  209  CDVYCANLKSCFFFSIFLLVTLTVFALWYVDEKQWSPPPETETEVEGEEKEITEEVTATS  268

Query  778  EEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               KVP +GELL A K++ RPM++LL+VT LNWIAWF
Sbjct  269  RVVKVPLIGELLSALKDMERPMVMLLVVTCLNWIAWF  305



>ref|XP_003548077.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=494

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/279 (62%), Positives = 211/279 (76%), Gaps = 7/279 (3%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            E  P  +PL K+ +VS++AAG+QFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+
Sbjct  3    EPQPGPSPLRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWLCGPISGLL  62

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP+VGY SD C +RFGRRRPFI +G+L V  AV LIG+AADIGH+ GD L + T+PRA 
Sbjct  63   VQPIVGYSSDRCQSRFGRRRPFILAGSLAVAIAVFLIGYAADIGHAAGDNLTQKTRPRAV  122

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
             IF++GFWILDVANNMLQGPCRA L DL+ GD  KT+ AN  FSFFMAVGNI GYAAG+ 
Sbjct  123  AIFVIGFWILDVANNMLQGPCRAFLGDLAAGDEKKTKAANAFFSFFMAVGNILGYAAGSY  182

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK  789
              L++ F FT T+AC+V+CANLKSCF  + +LL+++T + +  V E  YT KA E E   
Sbjct  183  DGLHRLFPFTETEACNVFCANLKSCFFFAIVLLVVLTTLVLITVKETPYTPKA-EKETKD  241

Query  790  VP------FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                    F GEL  AFK L RPM +L++VTA+NWIAWF
Sbjct  242  AEKTHFSCFCGELCLAFKGLKRPMWMLMLVTAVNWIAWF  280



>ref|XP_006599449.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=494

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 172/279 (62%), Positives = 210/279 (75%), Gaps = 7/279 (3%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            E  P   PL K+ +VS++AAG+QFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+
Sbjct  3    EPQPGPNPLRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWLCGPISGLL  62

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP+VGY SD C +RFGRRRPFI +G+L V  AV LIG+AADIGH+ GD L + T+PRA 
Sbjct  63   VQPIVGYSSDRCQSRFGRRRPFILAGSLAVAIAVFLIGYAADIGHAAGDNLTQKTRPRAV  122

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
             IF++GFWILDVANNMLQGPCRA L DL+ GD  KT+ AN  FSFFMAVGNI GYAAG+ 
Sbjct  123  AIFVIGFWILDVANNMLQGPCRAFLGDLAAGDEKKTKAANAFFSFFMAVGNILGYAAGSY  182

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK  789
              L++ F FT T+AC+V+CANLKSCF  + +LL+++T + +  V E  YT KA E E   
Sbjct  183  DGLHRLFPFTETEACNVFCANLKSCFFFAIVLLVVLTTLVLITVKETPYTPKA-EKETKD  241

Query  790  VP------FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                    F GEL  AFK L RPM +L++VTA+NWIAWF
Sbjct  242  AEKTHFSCFCGELCLAFKGLKRPMWMLMLVTAVNWIAWF  280



>gb|ABB30165.1| sucrose transport protein SUF1 [Phaseolus vulgaris]
Length=509

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PH  +S IWLCGPISGL+VQP+
Sbjct  28   EPSPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAAASFIWLCGPISGLVVQPI  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD  T+R+GRRRPFI  GA+ V  AV LIG+AADIG+S GD + K T+PRA  +F+
Sbjct  88   VGYYSDRSTSRYGRRRPFILGGAVAVAIAVFLIGYAADIGYSAGDDITKKTRPRAVAVFV  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANNMLQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ GYAAG+ S L+
Sbjct  148  IGFWILDVANNMLQGPCRAFLADLAAGDQRKTRIANGFFSFFMAVGNVLGYAAGSFSGLH  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT T ACDV+CANLKSCF  S +LLL ++ VA+  V +     +AV+ E+ +    
Sbjct  208  KIFPFTQTKACDVFCANLKSCFFFSILLLLFLSTVALIYVKDKPVAARAVQ-EDAQPSCF  266

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +L GA K L RPM +L++VTA+NWI WF
Sbjct  267  FQLFGALKELKRPMWMLMLVTAVNWIGWF  295



>ref|XP_007151902.1| hypothetical protein PHAVU_004G085500g [Phaseolus vulgaris]
 gb|ESW23896.1| hypothetical protein PHAVU_004G085500g [Phaseolus vulgaris]
Length=509

 Score =   342 bits (877),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            E +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PH  +S IWLCGPISGL+VQP+
Sbjct  28   EPSPLRKMFAVASIAAGIQFGWALQLSLLTPYVQLLGVPHAAASFIWLCGPISGLVVQPI  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD  T+R+GRRRPFI  GA+ V  AV LIG+AADIG+S GD + K T+PRA  +F+
Sbjct  88   VGYYSDRSTSRYGRRRPFILGGAVAVAIAVFLIGYAADIGYSAGDDITKKTRPRAVAVFV  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            +GFWILDVANNMLQGPCRA LADL+ GD  KTR+AN  FSFFMAVGN+ GYAAG+ S L+
Sbjct  148  IGFWILDVANNMLQGPCRAFLADLAAGDQRKTRIANGFFSFFMAVGNVLGYAAGSFSGLH  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFV  801
            K F FT T ACDV+CANLKSCF  S +LLL ++ VA+  V +     +AV+ E+ +    
Sbjct  208  KIFPFTQTKACDVFCANLKSCFFFSILLLLFLSTVALIYVKDKPVAARAVQ-EDAQPSCF  266

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +L GA K L RPM +L++VTA+NWI WF
Sbjct  267  FQLFGALKELKRPMWMLMLVTAVNWIGWF  295



>gb|ADW78350.1| sucrose proton symporter 2 [Rosa hybrid cultivar]
Length=513

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 213/280 (76%), Gaps = 10/280 (4%)
 Frame = +1

Query  79   PEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQP  258
            P+ +P+ K+ +V++IAAG+QFGWA+QLSLLTPYVQLLGI H ++  IWLCGPISG++VQP
Sbjct  14   PQSSPMRKIILVASIAAGIQFGWAIQLSLLTPYVQLLGISHTWAPFIWLCGPISGMLVQP  73

Query  259  LVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIF  438
            +VGY+SD CT+RFGRRRPFI +G+ LV  AV LIG+AAD+GH  GD L K TKPRA  IF
Sbjct  74   IVGYHSDRCTSRFGRRRPFIAAGSSLVAIAVFLIGYAADLGHLFGDSLDKPTKPRAIAIF  133

Query  439  IVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTL  618
            +VGFWILDVANNMLQGPCRALLAD+SG D  K R AN  +SFFMA+GN+ G++AG+ + L
Sbjct  134  VVGFWILDVANNMLQGPCRALLADISGSDTKKMRTANGFYSFFMAIGNVLGFSAGSYTHL  193

Query  619  YKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYT----------RKA  768
            +K   FT++ ACDVYCANLK+CF +S  LL+ +T +A+  V+E   T           + 
Sbjct  194  HKMLPFTMSKACDVYCANLKTCFFLSIALLIALTILALVSVTEPTPTPEMVEAVEEIEEE  253

Query  769  VEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E +   VPF  E+LGAFK L RPM ILL+VT LNW+AWF
Sbjct  254  EEEKVAPVPFFSEILGAFKELQRPMRILLVVTCLNWVAWF  293



>gb|AHB33871.1| sucrose transporter [Quercus robur]
Length=500

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/281 (64%), Positives = 214/281 (76%), Gaps = 3/281 (1%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            EVE+   +  + +P+  + +VS+IAAGVQFGWALQLSLLTPYVQLLGIPHK+++ IWLCG
Sbjct  2    EVERA-SSESKASPVRNIFLVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWAAFIWLCG  60

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG++VQP+VGYYSD  T+RFGRRRPFI +GA LV  AV LIG+AAD GH +GD L K 
Sbjct  61   PISGMLVQPIVGYYSDRSTSRFGRRRPFIAAGAALVAAAVFLIGYAADFGHLSGDSLNKT  120

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            +KPRA V+F+VGFWILDVANNMLQGPCRA LADLS  D  + R+AN LFSFFMAVGN+ G
Sbjct  121  SKPRAIVVFVVGFWILDVANNMLQGPCRAFLADLSSNDQKRMRIANNLFSFFMAVGNVLG  180

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            Y AG+   LY    FT T ACD YCANLK+CF IS  LLL +T +A+T V E  ++   V
Sbjct  181  YTAGSLKKLYTILPFTHTKACDEYCANLKTCFFISIALLLTLTTLALTLVKEKTFSEPEV  240

Query  772  EGEEG--KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  E   KVP  GE+ GAFK L RPM ILL+VT  NWIAWF
Sbjct  241  DSAEEVVKVPCFGEMAGAFKELKRPMRILLLVTCFNWIAWF  281



>gb|KHN32799.1| Sucrose transport protein SUC2 [Glycine soja]
Length=494

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 209/278 (75%), Gaps = 5/278 (2%)
 Frame = +1

Query  70   EALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLI  249
            E  P   PL K+ +VS++AAG+QFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+
Sbjct  3    EPQPGPNPLRKMILVSSMAAGIQFGWALQLSLLTPYVQTLGVPHAWASFIWLCGPISGLL  62

Query  250  VQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRAT  429
            VQP+VGY SD C +RFGRRRPFI +G+L V  AV LI +AADIGH+ GD L + T+PRA 
Sbjct  63   VQPIVGYSSDRCQSRFGRRRPFILAGSLAVAIAVFLIAYAADIGHAAGDNLTQKTRPRAV  122

Query  430  VIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQ  609
             IF++GFWILDVANNMLQGPCRA L DL+ GD  KT+ AN  FSFFMAVGNI GYAAG+ 
Sbjct  123  AIFVIGFWILDVANNMLQGPCRAFLGDLAAGDEKKTKAANAFFSFFMAVGNILGYAAGSY  182

Query  610  STLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK  789
              L++ F FT T+AC+V+CANLKSCF  + +LL+++T + +  V E  YT KA +  E  
Sbjct  183  DGLHRLFPFTETEACNVFCANLKSCFFFAIVLLVVLTTLVLITVKETPYTPKAEKETEDA  242

Query  790  VP-----FVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                   F GEL  AFK L RPM +L++VTA+NWIAWF
Sbjct  243  EKTHFSCFCGELCLAFKGLKRPMWMLMLVTAVNWIAWF  280



>ref|XP_004291895.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 214/279 (77%), Gaps = 0/279 (0%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            EVE  + +    +P+ K+ +V++IAAG+QFGWALQLSLLTPYVQ LG+PHK+++++WLCG
Sbjct  3    EVENMVSSPEPSSPISKIIMVASIAAGIQFGWALQLSLLTPYVQQLGVPHKWAAVVWLCG  62

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISGL+VQP+VGYYSD  T+RFGRRRPFI +GA LV  AV +IG+AADIG   GD   K 
Sbjct  63   PISGLLVQPIVGYYSDRNTSRFGRRRPFIAAGAGLVAIAVFMIGYAADIGVRVGDSWEKS  122

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKPRA  +F+VGFWILDVANNMLQGPCRA LAD+SG D  K R AN LFSFFMAVGN+ G
Sbjct  123  TKPRAVAVFVVGFWILDVANNMLQGPCRAFLADISGSDMKKMRTANALFSFFMAVGNVLG  182

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+  +LYK F FT T ACDVYCANLKSCF IS  LLL++T +A+T V E  Y + A+
Sbjct  183  YAAGSLKSLYKIFPFTTTKACDVYCANLKSCFFISICLLLVLTILALTAVKEKPYDKNAM  242

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                     +GE+  +F+ L +PM ILL+VT LNW+AWF
Sbjct  243  GTGAAGGAMLGEIFRSFQQLKKPMWILLLVTCLNWVAWF  281



>ref|XP_004298889.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61913.1| sucrose transporter 7 [Fragaria x ananassa]
Length=491

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 214/282 (76%), Gaps = 6/282 (2%)
 Frame = +1

Query  61   QDLEALPEETPL---WKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
             D+E++    P+    K+ +VS+IAAGVQFGWALQLSLLTPYVQ LG+PHK+SS +WLCG
Sbjct  1    MDIESMNSSRPVSSKMKMILVSSIAAGVQFGWALQLSLLTPYVQQLGVPHKWSSAVWLCG  60

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISGL+VQP+VGYYSD C +RFGRRRPFI +G  LV  AV LIG+AADIG + GD L K+
Sbjct  61   PISGLVVQPIVGYYSDRCKSRFGRRRPFIVAGVALVAIAVFLIGYAADIGVACGDSLDKL  120

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKPRA  +F+VGFW+LDVANNMLQGPCRALLAD+SG D  K   A   FSFFMAVGN+ G
Sbjct  121  TKPRAVAVFVVGFWMLDVANNMLQGPCRALLADMSGSDNKKMSTAMAWFSFFMAVGNVLG  180

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSE---VQYTR  762
            YAAG+  +L+K F FT+T ACD+YCANLKSCF I+  LL ++T +A+  V E     +  
Sbjct  181  YAAGSLKSLHKMFPFTVTKACDIYCANLKSCFFIAIALLALLTVLAMVFVREDTMEDHRE  240

Query  763  KAVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +   GE G V F+ E+ GAFK L +PM ILL+VT LNWIAWF
Sbjct  241  EEKAGEGGGVAFLREIKGAFKELKKPMWILLLVTCLNWIAWF  282



>gb|AFM28285.1| SUT1-2 [Medicago truncatula]
 gb|KEH26077.1| sucrose transporter [Medicago truncatula]
Length=508

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 204/270 (76%), Gaps = 1/270 (0%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
            + TPL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PH++++ IWLCGPISG+I+QPL
Sbjct  28   KATPLRKMAAVASIAAGIQFGWALQLSLLTPYVQLLGVPHQWAANIWLCGPISGMIIQPL  87

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGYYSD   +RFGRRRPFIF GA+ V  AV LIG+AAD+GHS GD L K T+PRA VIF+
Sbjct  88   VGYYSDRSHSRFGRRRPFIFFGAIAVAIAVFLIGYAADLGHSMGDDLTKKTRPRAVVIFV  147

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
             GFWILDVANNMLQGPCRA + DL+GGD  + R+ N +FSFFMAVGN+ GYAAG+   LY
Sbjct  148  FGFWILDVANNMLQGPCRAFIGDLAGGDHRRMRIGNGMFSFFMAVGNVLGYAAGSYDKLY  207

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPF-  798
              F FT T AC+ +CANLK+CF  S  LL +V+  A+  V ++  T    + E       
Sbjct  208  TKFPFTKTLACNEFCANLKTCFFFSIFLLALVSTCALLYVEDIPITSSESQSESESQVSC  267

Query  799  VGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             G ++GAF  + RPM +L++VTA+NW+AWF
Sbjct  268  FGNMMGAFNGIQRPMWMLMLVTAINWVAWF  297



>gb|AFU61910.1| sucrose transporter 4 [Fragaria x ananassa]
Length=492

 Score =   340 bits (871),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 206/263 (78%), Gaps = 0/263 (0%)
 Frame = +1

Query  100  KLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSD  279
            K+ +V++IAAG+QFGWALQLSLLTPYVQ LG+PHK+++++WLCGPISGL+VQP+VGYYSD
Sbjct  13   KIIMVASIAAGIQFGWALQLSLLTPYVQQLGVPHKWAAVVWLCGPISGLLVQPIVGYYSD  72

Query  280  NCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWIL  459
              T+RFGRRRPFI +GA LV  AV +IG+AADIG   GD   K TKPRA  +F+VGFWIL
Sbjct  73   RNTSRFGRRRPFIAAGAGLVAIAVFMIGYAADIGVRVGDSWEKSTKPRAVAVFVVGFWIL  132

Query  460  DVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFT  639
            DVANNMLQGPCRA LAD+SG D  K R AN LFSFFMAVGN+ GYAAG+  +LYK F FT
Sbjct  133  DVANNMLQGPCRAFLADISGSDMKKMRTANALFSFFMAVGNVLGYAAGSLKSLYKIFPFT  192

Query  640  LTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGA  819
             T ACDVYCANLKSCF IS  LLL++T +A+T V E  Y + A+         +GE+  +
Sbjct  193  TTKACDVYCANLKSCFFISICLLLVLTILALTAVKEKPYDKNAMGTGAAGGAMLGEIFRS  252

Query  820  FKNLPRPMLILLIVTALNWIAWF  888
            F+ L +PM ILL+VT LNW+AWF
Sbjct  253  FQQLKKPMWILLLVTCLNWVAWF  275



>ref|XP_010421870.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=523

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 211/290 (73%), Gaps = 21/290 (7%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
              +PL +   V++IAAG+QFGWALQLSLLTPYVQLLGIPHK++SLIWLCGPISG++VQP+
Sbjct  11   SSSPLKQTIAVASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPI  70

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VGY+SD C +RFGRRRPFI +GALLV  AV+LIG+AADIG   GD +    K  A  +F 
Sbjct  71   VGYHSDRCESRFGRRRPFIAAGALLVAIAVVLIGYAADIGEFLGDRVDSTPKSHAIAVFA  130

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
            VGFWILDVANNMLQGPCRALLADLSG    KTR AN+LFSFFMAVGN+ G+AAGA + L+
Sbjct  131  VGFWILDVANNMLQGPCRALLADLSGNSAKKTRTANSLFSFFMAVGNVLGFAAGAFAHLH  190

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTR-----------KA  768
             +F FT+T+ACDVYCANLKSCF  S ++L+ +T  A+  V E +++              
Sbjct  191  DAFPFTVTEACDVYCANLKSCFFFSILILMSLTTFALWYVDEKRWSSTETETETEVTDGE  250

Query  769  VEGEEG----------KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +GE            +VP  GEL  A K++  PM++LL+VT L+WIAWF
Sbjct  251  EDGEIKEEVTVPLKVVRVPLFGELFSAVKDIKTPMVMLLLVTCLSWIAWF  300



>ref|XP_011001730.1| PREDICTED: sucrose transport protein SUC8-like [Populus euphratica]
 ref|XP_011002494.1| PREDICTED: sucrose transport protein SUC8-like [Populus euphratica]
Length=532

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 218/296 (74%), Gaps = 19/296 (6%)
 Frame = +1

Query  58   EQDLEALPEET---PLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLC  228
              +L+ LP      PL K+ +V++IAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWLC
Sbjct  15   SSNLQQLPSSVKPGPLRKIIMVASIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWLC  74

Query  229  GPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGK  408
            GPISG++VQP+VGY+SD CT+RFGRRRPFI +GA+ V  AV LIG+AADIGH +GD L K
Sbjct  75   GPISGMLVQPVVGYHSDRCTSRFGRRRPFIAAGAVFVTIAVFLIGYAADIGHLSGDSLTK  134

Query  409  VTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIG  588
              KPRA  +F+VGFWILDVANNMLQGPCRA LADLSG +  KTR +N  FSFFMAVGN+ 
Sbjct  135  TAKPRAIAVFVVGFWILDVANNMLQGPCRAFLADLSGTNQKKTRTSNAFFSFFMAVGNVL  194

Query  589  GYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKA  768
            GYAAG+ + LYK F F+ T ACDVYCANLKSCF IS  LLLI+T +A++ V E  ++ + 
Sbjct  195  GYAAGSYTHLYKLFPFSRTKACDVYCANLKSCFFISIALLLILTILALSYVREKPWSPEG  254

Query  769  VEGEEG----------------KVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              GE G                 +PF GE+  A K L RPM ILL+VT LNW+AWF
Sbjct  255  SPGEGGDEEEEEEAIGEAKVSVPLPFFGEIFAALKTLQRPMWILLLVTCLNWVAWF  310



>gb|KHF99226.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=499

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/277 (64%), Positives = 210/277 (76%), Gaps = 20/277 (7%)
 Frame = +1

Query  112  VSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTN  291
            V++IAAG+QFGWALQLSLLTPYVQLLGIPHK++SLIWLCGPISG++VQP+VGY+SD CT+
Sbjct  40   VASIAAGIQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTS  99

Query  292  RFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVAN  471
            RFGRRRPFI +GA+LV  AV+LIGFAAD+G+  GD L   TKPRA V+F++GFWILDVAN
Sbjct  100  RFGRRRPFIAAGAVLVATAVVLIGFAADLGYLFGDNLATETKPRAIVVFVIGFWILDVAN  159

Query  472  NMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDA  651
            NMLQGPCRALLAD+SG    KTR AN  FSFFMAVGN+ G+A+G+ + L+  F FT T A
Sbjct  160  NMLQGPCRALLADISGNSQKKTRTANAFFSFFMAVGNVLGFASGSYTRLHNIFPFTTTKA  219

Query  652  CDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGK--------------  789
            CDVYCANLKSCF  S +LLL +T +A+T V E  ++ +   G  G               
Sbjct  220  CDVYCANLKSCFFFSILLLLTLTTIALTYVHEKPWSPE--PGNAGNLGGCEIEDEEAAAA  277

Query  790  ----VPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                VPF GE+ GA K+L RPM ILL VT LNWIAWF
Sbjct  278  ETAPVPFFGEIFGALKDLKRPMWILLAVTCLNWIAWF  314



>gb|ADL29729.1| sugar transporter [Galega orientalis]
Length=514

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/284 (58%), Positives = 210/284 (74%), Gaps = 9/284 (3%)
 Frame = +1

Query  64   DLEALPEE--TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPI  237
             +EA P+   +PL K+  V++IAAG+QFGWALQLSLLTPYVQLLG+PHK+++ IWLCGPI
Sbjct  19   HVEAPPQRKPSPLRKMMAVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWAANIWLCGPI  78

Query  238  SGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLG--KV  411
            SG+IVQP+VGYYSD   +RFGRRRPFIF GAL V  AV LIG+AAD+GHS GD +   K 
Sbjct  79   SGIIVQPIVGYYSDRNHSRFGRRRPFIFFGALSVAIAVFLIGYAADLGHSLGDDITEMKK  138

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            T+PRA VIF++GFWILDVANNMLQGPCRA + DL+ GD  + R+ N  FSFFMAVGN+ G
Sbjct  139  TRPRAVVIFVLGFWILDVANNMLQGPCRAFIGDLAAGDHRRMRMGNGFFSFFMAVGNVLG  198

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+   LY  F FT T+ACD +CANLK+CF  S  LL +++  A+  V ++  ++   
Sbjct  199  YAAGSYRELYHMFPFTKTNACDEFCANLKTCFFFSIFLLAVLSIFALLYVEDIPLSKLES  258

Query  772  EGE-----EGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + E     + +    GE+LGAF  L R M +L+ VTA+NW+AWF
Sbjct  259  QSELQKESQQQPSCFGEVLGAFNGLERSMWMLMCVTAINWVAWF  302



>emb|CDP19968.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/288 (57%), Positives = 211/288 (73%), Gaps = 10/288 (3%)
 Frame = +1

Query  55   VEQDLEALPEE----TPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIW  222
            V Q+ E L  +    + + KL +V++IAA V +GWALQLSLLTPY+QLLG+PHK+++ +W
Sbjct  2    VFQEFEDLNPQYDTSSSIKKLALVASIAAAVHYGWALQLSLLTPYIQLLGVPHKWAAFVW  61

Query  223  LCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPL  402
            LCGPISGL++QP +G+YSD CT+RFGRRRPFI  GA+L+  AV LIGFAADIGH  GD L
Sbjct  62   LCGPISGLLIQPTIGHYSDCCTSRFGRRRPFIVVGAILLCIAVFLIGFAADIGHMFGDSL  121

Query  403  GKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGN  582
            G  TKPRA  +F++GFWILD++NN++QGPCRALLADL G + +K  + N+LF+FFMAVGN
Sbjct  122  GTRTKPRAVALFVLGFWILDISNNLIQGPCRALLADLCGHNEAKLTIGNSLFAFFMAVGN  181

Query  583  IGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQ---  753
            + GYA G+  + Y  F FT T ACD+YCANLK+CFI     ++I T + VT V E     
Sbjct  182  MIGYALGSYVSFYHLFPFTKTQACDIYCANLKTCFICGVFFVIITTTLVVTFVREEALDP  241

Query  754  --YTRKAV-EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              + +K V   EE ++ F G+LL    NLP+PM  LLIVTALNWI WF
Sbjct  242  SIFPKKGVFHDEEAQLSFFGQLLLVIGNLPKPMKNLLIVTALNWIGWF  289



>dbj|BAI23067.1| sucrose transporter [Plantago trinitatis]
Length=276

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPYVQ+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYVQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHSTGD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAVAVVLIGFAADIGHSTGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM VGN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGVGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHVCLLMCLTITALSIVKEPLVNVVDDELKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23066.1| sucrose transporter [Plantago trinitatis]
Length=276

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHSTGD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSTGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDEHKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23071.1| sucrose transporter [Plantago debilis]
 dbj|BAI23079.1| sucrose transporter [Plantago stauntonii]
Length=276

 Score =   329 bits (843),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 191/249 (77%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E +      E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSVVKEPRVNVVDDERKGGSLMVFIELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23077.1| sucrose transporter [Plantago spathulata]
Length=276

 Score =   329 bits (843),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPHVNVVDDERKGGSLMVFIELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23090.1| sucrose transporter [Plantago spathulata]
 dbj|BAI23092.1| sucrose transporter [Plantago spathulata]
Length=276

 Score =   329 bits (843),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>gb|ABB30166.1| putative sucrose transport protein SUT3 [Phaseolus vulgaris]
Length=476

 Score =   336 bits (861),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 198/260 (76%), Gaps = 6/260 (2%)
 Frame = +1

Query  127  AGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRR  306
            +GVQFGWALQLSLLTPYVQ LG+PH ++S IWLCGPISGL+VQP+VGY SD C + FGRR
Sbjct  3    SGVQFGWALQLSLLTPYVQTLGVPHAWASFIWLCGPISGLLVQPIVGYSSDRCQSAFGRR  62

Query  307  RPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQG  486
            RPFI +GAL V  A+ILIG+AADIG   GD + + T+PRA  IF+VGFWILDVANNMLQG
Sbjct  63   RPFILAGALAVAIAIILIGYAADIGQLAGDDITQKTRPRAVAIFVVGFWILDVANNMLQG  122

Query  487  PCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYC  666
            PCRA L DL+ GD  KTR AN+ FSFFMAVGN+ GYAAG+   L+K F FT T+AC+V+C
Sbjct  123  PCRAFLGDLAAGDQKKTRTANSFFSFFMAVGNVLGYAAGSYDGLHKIFPFTETEACNVFC  182

Query  667  ANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEG---EEGKVP---FVGELLGAFKN  828
            ANLKSCF  S +LLL +  + +TCV++ QY     E    EEGK     F+GE   AFK 
Sbjct  183  ANLKSCFFFSIVLLLALCIIVLTCVNDPQYIPSNPEKEAEEEGKTQVSCFLGECCVAFKG  242

Query  829  LPRPMLILLIVTALNWIAWF  888
            L RPM +L++VTA+NWIA F
Sbjct  243  LQRPMWMLMLVTAINWIACF  262



>dbj|BAI23096.1| sucrose transporter [Plantago raoulii]
Length=276

 Score =   329 bits (843),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPHVNVVDDERKGGSLMVFIELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>ref|XP_004291896.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61911.1| sucrose transporter 5 [Fragaria x ananassa]
Length=496

 Score =   337 bits (863),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 180/279 (65%), Positives = 220/279 (79%), Gaps = 1/279 (0%)
 Frame = +1

Query  55   VEQDLEALPEETP-LWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            +E +    PE++  + K+T+V++IAAGVQFGWALQLSLLTPYVQ LG+PHK+++++WLCG
Sbjct  1    MEVEAANSPEKSSSISKITLVASIAAGVQFGWALQLSLLTPYVQQLGVPHKWAAVVWLCG  60

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISGL+VQP+VGYYSD C +RFGRRRPFI +GA LV  AV LIG+AADIG  +GD L K 
Sbjct  61   PISGLLVQPIVGYYSDRCRSRFGRRRPFIAAGAALVAIAVFLIGYAADIGVRSGDSLHKS  120

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKPRA ++F+VGFWILDVANNMLQGPCRALLAD+SG D  K R AN L+SFFMAVGN+ G
Sbjct  121  TKPRAVLVFVVGFWILDVANNMLQGPCRALLADISGSDTKKMRTANALYSFFMAVGNVLG  180

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+   L+K F FT+T ACD+YCANLKSCF IS  LL ++T + +  V E     +  
Sbjct  181  YAAGSLKNLHKVFPFTVTKACDMYCANLKSCFFISIALLAVLTVMVMVSVREKTMPSRDD  240

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            E  EG V FVGE++GAFK L +PM ILL+VT LNWIAWF
Sbjct  241  EKGEGGVRFVGEIIGAFKELKKPMWILLLVTCLNWIAWF  279



>dbj|BAI23098.1| sucrose transporter [Plantago hakusanensis]
Length=276

 Score =   329 bits (843),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDACD++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACDIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23078.1| sucrose transporter [Plantago spathulata]
 dbj|BAI23080.1| sucrose transporter [Plantago stauntonii]
Length=276

 Score =   329 bits (843),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 191/249 (77%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E +      E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPRVNVVDDERKGGSLMVFIELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23088.1| sucrose transporter [Plantago uniglumis]
 dbj|BAI23095.1| sucrose transporter [Plantago uniglumis]
Length=276

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH+ +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHEAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23074.1| sucrose transporter [Plantago raoulii]
Length=276

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA ++F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVIVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVFDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23065.1| sucrose transporter [Plantago tomentosa]
Length=276

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPYVQ+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYVQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHSTGD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAVAVVLIGFAADIGHSTGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM VGN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGVGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    +L GA KNL +PM IL++V
Sbjct  181  CFLIHVCLLMCLTITALSIVKEPLVNVVDDELKGGSLMVFVKLFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23047.1| sucrose transporter [Plantago asiatica]
Length=276

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMNKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSVVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23060.1| sucrose transporter [Plantago australis]
 dbj|BAI23064.1| sucrose transporter [Plantago tomentosa]
 dbj|BAI23068.1| sucrose transporter [Plantago virginica]
Length=276

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDEHKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23083.1| sucrose transporter [Plantago rigida]
 dbj|BAI23084.1| sucrose transporter [Plantago rigida]
Length=276

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDKCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNAVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23073.1| sucrose transporter [Plantago raoulii]
Length=276

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 191/249 (77%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVDAAVVLIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E +      E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPRVNVVDDELKGGSLMVFIELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23075.1| sucrose transporter [Plantago raoulii]
 dbj|BAI23076.1| sucrose transporter [Plantago spathulata]
 dbj|BAI23093.1| sucrose transporter [Plantago spathulata]
Length=276

 Score =   327 bits (839),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 190/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD +K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDENKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23042.1| sucrose transporter [Plantago cornuti]
Length=276

 Score =   327 bits (839),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23038.1| sucrose transporter [Plantago asiatica var. densiuscula]
 dbj|BAI23040.1| sucrose transporter [Plantago asiatica f. yakusimensis]
 dbj|BAI23044.1| sucrose transporter [Plantago formosana]
 dbj|BAI23046.1| sucrose transporter [Plantago asiatica]
 dbj|BAI23049.1| sucrose transporter [Plantago major]
 dbj|BAI23050.1| sucrose transporter [Plantago major var. japonica]
Length=276

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSVVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23039.1| sucrose transporter [Plantago asiatica var. densiuscula]
 dbj|BAI23041.1| sucrose transporter [Plantago asiatica f. yakusimensis]
 dbj|BAI23045.1| sucrose transporter [Plantago formosana]
 dbj|BAI23048.1| sucrose transporter [Plantago asiatica]
 dbj|BAI23070.1| sucrose transporter [Plantago camtschatica]
 dbj|BAI23072.1| sucrose transporter [Plantago depressa]
 dbj|BAI23086.1| sucrose transporter [Plantago uniglumis]
 dbj|BAI23087.1| sucrose transporter [Plantago uniglumis]
 dbj|BAI23094.1| sucrose transporter [Plantago uniglumis]
Length=276

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23069.1| sucrose transporter [Plantago virginica]
Length=276

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMSKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDELKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>ref|XP_010673573.1| PREDICTED: sucrose transport protein SUC2-like [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   334 bits (857),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 206/279 (74%), Gaps = 4/279 (1%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            E+ Q  E     +P WKL  V++IAAGVQFGWALQLSLLTPYVQLLG+PH ++S IWLCG
Sbjct  2    EIIQLEEQNGPGSPYWKLFSVASIAAGVQFGWALQLSLLTPYVQLLGVPHTWASFIWLCG  61

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG++VQP+VGY SD  T++FGRR+PFIF+G  L+  A++LIGFAADIG   GD L + 
Sbjct  62   PISGMVVQPIVGYSSDRLTSKFGRRKPFIFAGTALICVAILLIGFAADIGLKLGDSLNQA  121

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKPRA   F+ GFWILD+ANNM+Q P RA LADLS  +  K R+AN  FSFFMA+GNI G
Sbjct  122  TKPRAVAFFVAGFWILDIANNMVQDPARAFLADLSNHNHRKMRVANAFFSFFMAIGNILG  181

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+ + LYK   FTL+  CD+YCANLK+CF+I  I L+++ + A+  V E ++ +K+ 
Sbjct  182  YAAGSYNRLYKFLPFTLSHGCDIYCANLKTCFLIDIIFLIVLVSFALIFVPEPRFEKKS-  240

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               + + PF  ++    +NL +PM +L +VTA+NW+AWF
Sbjct  241  ---DHEDPFFVQVKSTVRNLGKPMWLLFLVTAMNWVAWF  276



>dbj|BAI23063.1| sucrose transporter [Plantago australis]
Length=276

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPYVQ+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYVQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHVCLLMCLTITALSIVKEPLVNVVDDELKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23089.1| sucrose transporter [Plantago rugelii]
Length=276

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23062.1| sucrose transporter [Plantago australis]
Length=277

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 192/251 (76%), Gaps = 3/251 (1%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPYVQ+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYVQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGFAAD+GHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFAADMGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSE--VQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILL  855
            CF+I   LL+ +T  A++ V E  V      ++G    + FV EL GA KNL +PM IL+
Sbjct  181  CFLIHVCLLMCLTITALSIVKEPLVNVVDDELKGSGSLMVFV-ELFGALKNLSKPMWILM  239

Query  856  IVTALNWIAWF  888
            +VT LNWIAWF
Sbjct  240  LVTCLNWIAWF  250



>dbj|BAI23099.1| sucrose transporter [Plantago hakusanensis]
Length=276

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 188/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDACD++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACDIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL  A KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFAALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23091.1| sucrose transporter [Plantago spathulata]
Length=276

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AV+LIGF ADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVVLIGFPADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLSGGD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSGGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPHVNVVDDERKGGSLMVFIELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23057.1| sucrose transporter [Plantago palmata]
Length=276

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSTGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>ref|XP_006599448.1| PREDICTED: sucrose transport protein SUC8-like isoform X2 [Glycine 
max]
Length=446

 Score =   332 bits (852),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 221/297 (74%), Gaps = 11/297 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME   SSS      +VE   +  P  +PL K+  VS+IAAG+QFGWALQLSLLTPYVQ L
Sbjct  1    MEQPPSSS-----LQVETAQQ--PGPSPLRKMFAVSSIAAGIQFGWALQLSLLTPYVQTL  53

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            G+PH ++S IWLCGPISGL+VQP+VGY SD C +RFGRRRPFIF GA+ V  AV LIG+A
Sbjct  54   GVPHAWASFIWLCGPISGLLVQPIVGYSSDRCRSRFGRRRPFIFVGAIAVAIAVFLIGYA  113

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIGH+ GD L K T+PRA V+F+VGFWILDVANNMLQGPCRA L DL+ GD  KTR AN
Sbjct  114  ADIGHAAGDDLTKKTRPRAVVVFVVGFWILDVANNMLQGPCRAFLGDLAAGDHRKTRTAN  173

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMA+GN+ GYAAG+   L+++F FT T+ACDV+CANLKSCF  S +LLL++  V 
Sbjct  174  AFFSFFMAIGNVLGYAAGSYDKLHRAFKFTQTEACDVFCANLKSCFFFSIVLLLVLCFVV  233

Query  730  VTCVSEVQYTRKAVE--GEEGKV--PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + CV + Q+T +  +  GE   V     GEL  AFK L RPM +L++VTA+NW+AWF
Sbjct  234  LICVDDPQFTPRGDDNNGENDGVSGSCFGELWAAFKGLKRPMWLLMVVTAINWVAWF  290



>dbj|BAI23043.1| sucrose transporter [Plantago formosana]
Length=276

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSVGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSVVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>ref|XP_004289897.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61912.1| sucrose transporter 6 [Fragaria x ananassa]
Length=498

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/279 (63%), Positives = 214/279 (77%), Gaps = 0/279 (0%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            EVE  + +    +P+ K+ +V++IAAG+QFGWALQLSLLTPYVQ LG+PHK+++++WLCG
Sbjct  3    EVENMVSSPEPSSPISKIVMVASIAAGIQFGWALQLSLLTPYVQQLGVPHKWAAVVWLCG  62

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISGL+VQP+VGYYSD  T+RFGRRRPFI +GA LV  AV +IG+AADIG   GD   K 
Sbjct  63   PISGLLVQPIVGYYSDRNTSRFGRRRPFIAAGAGLVAVAVFMIGYAADIGVKAGDSWEKS  122

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKPRA  +F+VGFWILDVANNMLQGPCRALLAD+SG D  K R AN LFSFFMAVGN+ G
Sbjct  123  TKPRAVAVFVVGFWILDVANNMLQGPCRALLADISGSDMKKMRTANALFSFFMAVGNVLG  182

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAV  771
            YAAG+   L+K F FT T ACD+YCANLKSCF IS  LLLI+T +A+T V E  Y + A+
Sbjct  183  YAAGSLKGLHKIFPFTTTKACDIYCANLKSCFFISICLLLILTVLALTAVKEKPYDKNAL  242

Query  772  EGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
              E       GE+  +F+ L +PM ILL+VT LNW+AWF
Sbjct  243  GTEAAGGTMFGEIFRSFQQLKKPMWILLLVTCLNWVAWF  281



>dbj|BAI23097.1| sucrose transporter [Plantago hakusanensis]
Length=276

 Score =   325 bits (834),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 188/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL  A KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSVVKEPLVNVVDDERKGGSLMVFVELFAALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>ref|XP_004290438.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61909.1| sucrose transporter 3 [Fragaria x ananassa]
Length=504

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 7/269 (3%)
 Frame = +1

Query  85   ETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLV  264
             TPL K+ +V++IAAG+QFGWALQLSLLTPYVQLLGIPH +++ IWLCGP+SG++VQP+V
Sbjct  22   STPLRKIILVASIAAGIQFGWALQLSLLTPYVQLLGIPHTWAAFIWLCGPVSGMLVQPIV  81

Query  265  GYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIV  444
            GY+SD C    GRRRPFI +G+ LV  AV LIG+AAD+GH  GD L K TKPRA  +F+V
Sbjct  82   GYHSDRC----GRRRPFIVAGSSLVAIAVFLIGYAADLGHLFGDSLDKPTKPRAIAVFVV  137

Query  445  GFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYK  624
            GFWILDVANNMLQGPCRALLAD+SG D  K R AN  +SFFMAVGN+ G++AG+ + L+K
Sbjct  138  GFWILDVANNMLQGPCRALLADISGSDTRKMRTANGFYSFFMAVGNVLGFSAGSYTHLHK  197

Query  625  SFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRKAVEGE-EGKVPFV  801
               FT+T ACDVYCANLK+CF +S  LL+ +T +A+T V E   T + V+ E    VPF 
Sbjct  198  MLPFTMTKACDVYCANLKTCFFLSIALLIALTILALTSVPEP--TPEVVDEEIAPAVPFF  255

Query  802  GELLGAFKNLPRPMLILLIVTALNWIAWF  888
             E++ AFK L RPM ILL+VT LNWIAWF
Sbjct  256  TEIVAAFKELQRPMWILLVVTCLNWIAWF  284



>dbj|BAI23059.1| sucrose transporter [Plantago rugelii]
Length=276

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 188/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL  A KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSVVKEPLVNVVDDERKGGSLMVFVELFSALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23037.1| sucrose transporter [Plantago tenuiflora]
Length=276

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 187/249 (75%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVTVAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L+    FT TDAC+V+CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHTFLPFTRTDACEVFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L+L +T  A++ V E        + + G      EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLILSLTITALSIVKEPDVNIVDDDRKGGSFMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23061.1| sucrose transporter [Plantago australis]
Length=276

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIG+S GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGYSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDEHKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>ref|XP_006599447.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Glycine 
max]
Length=504

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/297 (61%), Positives = 221/297 (74%), Gaps = 11/297 (4%)
 Frame = +1

Query  10   MEVGTSSSSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            ME   SSS      +VE   +  P  +PL K+  VS+IAAG+QFGWALQLSLLTPYVQ L
Sbjct  1    MEQPPSSS-----LQVETAQQ--PGPSPLRKMFAVSSIAAGIQFGWALQLSLLTPYVQTL  53

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            G+PH ++S IWLCGPISGL+VQP+VGY SD C +RFGRRRPFIF GA+ V  AV LIG+A
Sbjct  54   GVPHAWASFIWLCGPISGLLVQPIVGYSSDRCRSRFGRRRPFIFVGAIAVAIAVFLIGYA  113

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            ADIGH+ GD L K T+PRA V+F+VGFWILDVANNMLQGPCRA L DL+ GD  KTR AN
Sbjct  114  ADIGHAAGDDLTKKTRPRAVVVFVVGFWILDVANNMLQGPCRAFLGDLAAGDHRKTRTAN  173

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMA+GN+ GYAAG+   L+++F FT T+ACDV+CANLKSCF  S +LLL++  V 
Sbjct  174  AFFSFFMAIGNVLGYAAGSYDKLHRAFKFTQTEACDVFCANLKSCFFFSIVLLLVLCFVV  233

Query  730  VTCVSEVQYTRKAVE--GEEGKV--PFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            + CV + Q+T +  +  GE   V     GEL  AFK L RPM +L++VTA+NW+AWF
Sbjct  234  LICVDDPQFTPRGDDNNGENDGVSGSCFGELWAAFKGLKRPMWLLMVVTAINWVAWF  290



>dbj|BAO02526.1| predicted sucrose transporter-like protein ortholog [Nicotiana 
alata]
Length=457

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 213/287 (74%), Gaps = 8/287 (3%)
 Frame = +1

Query  52   EVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCG  231
            +V+Q   A+P     WK+ +V++IAAGVQFGWALQLSLLTPY+QLLGIPH+++S+IWLCG
Sbjct  4    KVQQPHSAVPVLPARWKIVMVASIAAGVQFGWALQLSLLTPYLQLLGIPHRYASIIWLCG  63

Query  232  PISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKV  411
            PISG+IVQP+VGY SDN ++ FGRRRPFI +G+ LV  AVI IGFAADIGH+ GDPL   
Sbjct  64   PISGMIVQPVVGYLSDNLSSTFGRRRPFIAAGSCLVAVAVIFIGFAADIGHAFGDPLDSK  123

Query  412  TKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGG  591
            TKP   + FIVGFW LDVANNMLQGPCRA LADLSGG   + R   + ++FFMAVG+I G
Sbjct  124  TKPLGIITFIVGFWYLDVANNMLQGPCRAFLADLSGGKAGRIRTGQSCYAFFMAVGSILG  183

Query  592  YAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQYTRK--  765
             AAG+ S LY  F FT T AC V CANLKSCF+IS +L+L +T +A+T V E    +K  
Sbjct  184  NAAGSYSHLYTIFPFTKTVACGVQCANLKSCFLISVVLVLTLTTLALTTVDEKGLPQKDF  243

Query  766  ------AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
                     G++G + F GE+  A KNLPR + ILL+VTA+NWIAWF
Sbjct  244  TNSVYLGSSGKKGGLWFFGEMFEALKNLPRSVWILLMVTAVNWIAWF  290



>gb|AAD34610.1|AF149981_1 sucrose transporter-like protein [Nicotiana tabacum]
Length=521

 Score =   333 bits (854),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 216/295 (73%), Gaps = 9/295 (3%)
 Frame = +1

Query  31   SSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFS  210
             SG    +V+Q   A+P   P WK+ +V++IAAGVQFGWALQLSLLTPY+QLLGIPH+++
Sbjct  2    ESGSMEMKVQQPYLAVPVLPPRWKIVMVASIAAGVQFGWALQLSLLTPYLQLLGIPHRYA  61

Query  211  SLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHST  390
            S+IWLCGPISG+IVQP VGY SDN ++ FGRRRPFI +G+ LV  AVI IGFAADIGH+ 
Sbjct  62   SIIWLCGPISGMIVQPAVGYLSDNLSSTFGRRRPFIAAGSSLVAVAVIFIGFAADIGHAF  121

Query  391  GDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFM  570
            GDPL   TKP   + FIVGFW LDVANNMLQGPCRA LADLSGG   + R   + ++FFM
Sbjct  122  GDPLDTKTKPLGIITFIVGFWYLDVANNMLQGPCRAFLADLSGGKACRIRTGQSCYAFFM  181

Query  571  AVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEV  750
            AVG+I G AAG+ S LY  F FT T+AC V CANLKSCF+IS +LLL +T +A+T V E 
Sbjct  182  AVGSILGNAAGSYSHLYTIFPFTKTEACGVQCANLKSCFLISVVLLLTLTTLALTAVDEK  241

Query  751  QYTRK---------AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               +K            G++G + F GE+  A K+LPR + ILL+VTA+NWIAWF
Sbjct  242  VLPQKDHFINSEYLGSSGKKGGLLFFGEMFEALKHLPRSVWILLMVTAVNWIAWF  296



>ref|XP_009779331.1| PREDICTED: sucrose transport protein SUC8-like [Nicotiana sylvestris]
Length=521

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 216/295 (73%), Gaps = 9/295 (3%)
 Frame = +1

Query  31   SSGGGAFEVEQDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFS  210
             SG    +V+Q   A+P   P WK+ +V++IAAGVQFGWALQLSLLTPY+QLLGIPH+++
Sbjct  2    ESGSMEMKVQQPYLAVPVLPPRWKIVMVASIAAGVQFGWALQLSLLTPYLQLLGIPHRYA  61

Query  211  SLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHST  390
            S+IWLCGPISG+IVQP VGY SDN ++ FGRRRPFI +G+ LV  AVI IGFAADIGH+ 
Sbjct  62   SIIWLCGPISGMIVQPAVGYLSDNLSSTFGRRRPFIAAGSSLVAVAVIFIGFAADIGHAF  121

Query  391  GDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFM  570
            GDPL   TKP   + FIVGFW LDVANNMLQGPCRA LADLSGG   + R   + ++FFM
Sbjct  122  GDPLDTKTKPLGIITFIVGFWYLDVANNMLQGPCRAFLADLSGGKACRIRTGQSCYAFFM  181

Query  571  AVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEV  750
            AVG+I G AAG+ S LY  F FT T+AC V CANLKSCF+IS +LLL +T +A+T V E 
Sbjct  182  AVGSILGNAAGSYSHLYTIFPFTKTEACGVQCANLKSCFLISVVLLLTLTTLALTAVDEK  241

Query  751  QYTRK---------AVEGEEGKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
               +K            G++G + F GE+  A K+LPR + ILL+VTA+NWIAWF
Sbjct  242  VLPQKDHFINSEYLGSSGKKGGLLFFGEMFEALKHLPRSVWILLMVTAVNWIAWF  296



>dbj|BAI23081.1| sucrose transporter [Plantago rigida]
 dbj|BAI23082.1| sucrose transporter [Plantago rigida]
Length=276

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIG+S GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGYSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDERKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23054.1| sucrose transporter [Plantago media]
Length=277

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 189/250 (76%), Gaps = 1/250 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SG  LV  AV+LIGFAADIGHS GD + K TKPRA ++F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGTCLVAVAVVLIGFAADIGHSAGDDMTKKTKPRAVIVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM VGN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGVGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVG-ELLGAFKNLPRPMLILLI  858
            CF+I   L++ +T  A++ V E  +     +  +G    V  EL GA KNL +PM IL++
Sbjct  181  CFLIHICLIMCLTITALSIVKEPPHVNAVDDDRKGGSLMVFVELFGALKNLSKPMWILML  240

Query  859  VTALNWIAWF  888
            VT LNWIAWF
Sbjct  241  VTCLNWIAWF  250



>dbj|BAI23051.1| sucrose transporter [Plantago maxima]
 dbj|BAI23052.1| sucrose transporter [Plantago maxima]
Length=276

 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SG+ LV  AVILIGFAADIGHS GD + K TKPRA ++F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGSCLVAIAVILIGFAADIGHSAGDDMTKKTKPRAVIVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E        + + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPPVNVVDDDRKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23058.1| sucrose transporter [Plantago reniformis]
Length=276

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 189/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIG+S GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAVAVILIGFAADIGYSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        + + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNVVDDDRKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23100.1| sucrose transporter [Plantago media]
Length=277

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 188/250 (75%), Gaps = 1/250 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SG  LV  AV+LIGFAADIGHS GD + K TKPRA ++F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGTCLVAVAVVLIGFAADIGHSAGDDMTKKTKPRAVIVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM VGN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGVGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVG-ELLGAFKNLPRPMLILLI  858
            CF+I   L++ +T  A++ V E        +  +G    V  EL GA KNL +PM IL++
Sbjct  181  CFLIHICLIMCLTITALSIVKEPPLVNAVDDDRKGGSLMVFVELFGALKNLSKPMWILML  240

Query  859  VTALNWIAWF  888
            VT LNWIAWF
Sbjct  241  VTCLNWIAWF  250



>ref|XP_002887396.1| sucrose-proton symporter 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63655.1| sucrose-proton symporter 1 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 182/297 (61%), Positives = 222/297 (75%), Gaps = 15/297 (5%)
 Frame = +1

Query  43   GAFEVE-----------QDLEALPEETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLL  189
            GAFE E           Q  E   + +PL K+  V++IAAGVQFGWALQLSLLTPYVQLL
Sbjct  2    GAFETEKPTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLL  61

Query  190  GIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFA  369
            GIPHK+SSLIWLCGP+SG+IVQP+VG++SD C +RFGRRRPFI SGA LV  AV+LIG+A
Sbjct  62   GIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSRFGRRRPFIASGAALVAVAVLLIGYA  121

Query  370  ADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRALLADLSGGDGSKTRLAN  549
            AD G+  GD L +  K RA  IF +GFWILDVANN LQGPCRA LADL+ GD  +TR+AN
Sbjct  122  ADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVAN  181

Query  550  TLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVA  729
              FSFFMAVGN+ GYAAG+ + L+K F FT+T ACD+YCANLK+CF +S  LLLIVT  +
Sbjct  182  AFFSFFMAVGNVLGYAAGSYTHLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTS  241

Query  730  VTCVSEVQYT---RKAVEGEE-GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
            +  V + Q++   R + + E+   VP  GE+ GAF+ + RPM +LLIVTALNWIAWF
Sbjct  242  LWYVKDKQWSPPPRNSDDDEKTSSVPLFGEIFGAFRVMKRPMWMLLIVTALNWIAWF  298



>dbj|BAI23053.1| sucrose transporter [Plantago media]
Length=277

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 188/250 (75%), Gaps = 1/250 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SG  LV  AV+LIGFAADIGHS GD + K TKPRA ++F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGTCLVAVAVVLIGFAADIGHSAGDDMTKKTKPRAVIVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVG-ELLGAFKNLPRPMLILLI  858
            CF+I   L++ +T  A++ V E        +  +G    V  EL GA KNL +PM IL++
Sbjct  181  CFLIHICLIMCLTITALSIVKEPPAVNAVDDDRKGGSLMVFVELFGALKNLSKPMWILML  240

Query  859  VTALNWIAWF  888
            VT LNWIAWF
Sbjct  241  VTCLNWIAWF  250



>dbj|BAI23055.1| sucrose transporter [Plantago media]
Length=277

 Score =   322 bits (824),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 188/250 (75%), Gaps = 1/250 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SG  LV  AV+LIGFAADIGHS GD + K TKPRA ++F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGTCLVAVAVVLIGFAADIGHSAGDDMTKKTKPRAVIVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L++   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGLGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVG-ELLGAFKNLPRPMLILLI  858
            CF+I    ++ +T  A++ V E  +     +  +G    V  EL GA KNL +PM IL++
Sbjct  181  CFLIHICFIMCLTITALSIVKEPPHVNAVDDDRKGGSLMVFVELFGALKNLSKPMWILML  240

Query  859  VTALNWIAWF  888
            VT LNWIAWF
Sbjct  241  VTCLNWIAWF  250



>ref|XP_001768298.1| predicted protein [Physcomitrella patens]
 gb|EDQ66912.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   329 bits (844),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 202/275 (73%), Gaps = 7/275 (3%)
 Frame = +1

Query  82   EETPLWKLTVVSAIAAGVQFGWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPL  261
               P+  L  V+++AAGVQFGWALQLSLLTPYVQ LGIPH ++S IWLCGPISG+IVQP+
Sbjct  10   NRVPIRALIQVASVAAGVQFGWALQLSLLTPYVQELGIPHAWASFIWLCGPISGMIVQPI  69

Query  262  VGYYSDNCTNRFGRRRPFIFSGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFI  441
            VG+YSD+CT+ +GRRRPFI SGA LV+ AV++IG++AD+G+  GD L   T+PRA +IF+
Sbjct  70   VGHYSDSCTSSYGRRRPFILSGAALVVVAVLIIGYSADLGYLLGDELMGATRPRAVLIFV  129

Query  442  VGFWILDVANNMLQGPCRALLADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLY  621
             GFW+LD+ANN LQGPCRALLAD +G D  + R AN  FS FMA+GNI G+A GA    Y
Sbjct  130  FGFWVLDMANNTLQGPCRALLADFTGKDQKRNRRANAFFSLFMALGNILGFATGAYDGWY  189

Query  622  KSFSFTLTDACDVYCANLKSCFIISAILLLIVTAVAVTCVSEVQY------TRKAVEGEE  783
            K F FT T ACD+ CANLKS F++   +LLI T ++VT  SE+ +       R A +  E
Sbjct  190  KVFKFTHTKACDIACANLKSAFLLGVTILLITTFLSVTAASEIPFDPKNAVKRTASKSHE  249

Query  784  GKVPFVGELLGAFKNLPRPMLILLIVTALNWIAWF  888
             +  F  EL+GA ++LPRPM  +L VTAL WIAWF
Sbjct  250  SEALF-WELMGALRDLPRPMWCILFVTALTWIAWF  283



>dbj|BAI23056.1| sucrose transporter [Plantago palmata]
Length=276

 Score =   321 bits (823),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 188/249 (76%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIG S GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGASLVAVAVILIGFAADIGLSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L+K   FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHKLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L++ +T  A++ V E        + + G +    EL GA KNL +PM IL++V
Sbjct  181  CFLIHICLIMCLTITALSIVKEPLVNVVDDDRKGGSLMVFVELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23085.1| sucrose transporter [Plantago rigida]
Length=276

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 187/249 (75%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDKCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TK RA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKTRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L+    FT TDAC+++CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNMLGYAAGSYNNLHMLLPFTRTDACEIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   LL+ +T  A++ V E        E + G +   GEL GA KNL +PM IL++V
Sbjct  181  CFLIHICLLMCLTITALSIVKEPLVNAVDDERKGGSLMVFGELFGALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LN IAWF
Sbjct  241  TCLNGIAWF  249



>dbj|BAI23036.1| sucrose transporter [Plantago tenuiflora]
Length=276

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 185/249 (74%), Gaps = 0/249 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPY+Q+LG+PH  +S IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGA LV  AVILIGFAADIGHS GD + K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGACLVAAAVILIGFAADIGHSAGDDMTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM +GN+ GYAAG+ + L+    FT TDAC  +CANLK+
Sbjct  121  LADLSAGDEKKMTHAMSFFAFFMGIGNVLGYAAGSYNNLHTFLPFTRTDACQTFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEGKVPFVGELLGAFKNLPRPMLILLIV  861
            CF+I   L+L +T  A++ V E        + + G +    EL  A KNL +PM IL++V
Sbjct  181  CFLIHICLILCLTITALSIVKEPVVNVVDDDRKGGSLMVFVELFSALKNLSKPMWILMLV  240

Query  862  TALNWIAWF  888
            T LNWIAWF
Sbjct  241  TCLNWIAWF  249



>dbj|BAI23030.1| sucrose transporter [Plantago alpina]
 dbj|BAI23034.1| sucrose transporter [Plantago maritima]
 dbj|BAI23035.1| sucrose transporter [Plantago maritima]
Length=277

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 192/250 (77%), Gaps = 1/250 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPYVQ+LG+PH  SS IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYVQMLGLPHGASSFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGALLV  AV+LIGFAADIG+S GD L K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGALLVAVAVVLIGFAADIGYSGGDDLTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM  GN+ GYAAG+ S LYK   FT TDACD++CANLK+
Sbjct  121  LADLSAGDEKKLTHAMSFFAFFMGAGNVLGYAAGSYSQLYKFLPFTRTDACDIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-KVPFVGELLGAFKNLPRPMLILLI  858
            CF+I   LL+ +T VA++ V E        +G++G  +    EL GA KNL RPM IL++
Sbjct  181  CFLIHICLLMSLTCVAMSLVKEGPVNAVDDDGDKGSSLRVFVELFGALKNLSRPMWILMM  240

Query  859  VTALNWIAWF  888
            V ALNWIAWF
Sbjct  241  VNALNWIAWF  250



>dbj|BAI23032.1| sucrose transporter [Plantago maritima]
 dbj|BAI23033.1| sucrose transporter [Plantago maritima]
Length=277

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 192/250 (77%), Gaps = 1/250 (0%)
 Frame = +1

Query  142  GWALQLSLLTPYVQLLGIPHKFSSLIWLCGPISGLIVQPLVGYYSDNCTNRFGRRRPFIF  321
            GWALQLSLLTPYVQ+LG+PH  SS IWLCGP+SGL+VQPL GY+SD C +RFGRRRPFI 
Sbjct  1    GWALQLSLLTPYVQMLGLPHGASSFIWLCGPVSGLLVQPLAGYFSDRCKSRFGRRRPFIM  60

Query  322  SGALLVIFAVILIGFAADIGHSTGDPLGKVTKPRATVIFIVGFWILDVANNMLQGPCRAL  501
            SGALLV  AV+LIGFAADIG+S GD L K TKPRA V+F+VGFWILDVANNMLQGPCRA 
Sbjct  61   SGALLVAVAVVLIGFAADIGYSGGDDLTKKTKPRAVVVFVVGFWILDVANNMLQGPCRAF  120

Query  502  LADLSGGDGSKTRLANTLFSFFMAVGNIGGYAAGAQSTLYKSFSFTLTDACDVYCANLKS  681
            LADLS GD  K   A + F+FFM  GN+ GYAAG+ S LYK   FT TDACD++CANLK+
Sbjct  121  LADLSAGDEKKLTHAMSFFAFFMGAGNVLGYAAGSYSQLYKFLPFTRTDACDIFCANLKT  180

Query  682  CFIISAILLLIVTAVAVTCVSEVQYTRKAVEGEEG-KVPFVGELLGAFKNLPRPMLILLI  858
            CF+I   LL+ +T VA++ V E        +G++G  +    EL GA KNL RPM IL++
Sbjct  181  CFLIHICLLMSLTCVAMSLVKEGPVNAVDDDGDKGSSLRVFVELFGALKNLSRPMWILMM  240

Query  859  VTALNWIAWF  888
            V ALNWIAWF
Sbjct  241  VNALNWIAWF  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1802351708432