BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25072_g1_i2 len=937 path=[3045:0-53 8511:54-84 8550:85-110
3156:111-126 8585:127-176 5744:177-178 3224:179-214 5890:215-284
5959:285-315 3361:316-317 3363:318-353 3399:354-361 3407:362-392
8773:393-393 4005:394-411 3457:412-529 3575:530-570 3616:571-606
7070:607-721 3723:722-754 5309:755-866 3892:867-890 3916:891-936]

Length=937
                                                                      Score     E

gb|ADK62516.1|  sucrose transporter 1y                                  388   2e-128   
gb|ADL63119.1|  sucrose transporter 1x                                  387   3e-128   
gb|ADL63118.1|  sucrose transporter 1x                                  387   3e-128   
gb|ABB89051.1|  putative sucrose transporter SUT3                       291   7e-91    Apium graveolens Dulce Group [celery]
emb|CAD31122.1|  putative sucrose-H+ symporter                          281   6e-90    Medicago truncatula
gb|ADL63117.1|  sucrose transporter 2y                                  289   6e-90    
gb|ADL63120.1|  sucrose transporter 2x                                  289   9e-90    
ref|XP_009630281.1|  PREDICTED: sucrose transport protein-like          288   1e-89    
emb|CAQ58422.1|  sucrose transporter                                    288   1e-89    Nicotiana tabacum [American tobacco]
emb|CAQ58420.1|  sucrose transporter                                    288   1e-89    Nicotiana tabacum [American tobacco]
emb|CAQ58421.1|  sucrose transporter                                    288   1e-89    Nicotiana tabacum [American tobacco]
ref|XP_009777676.1|  PREDICTED: sucrose transport protein-like          287   3e-89    
ref|XP_004496382.1|  PREDICTED: sucrose transport protein-like          288   3e-89    
emb|CAA76369.1|  sucrose/H+ symporter                                   286   1e-88    Daucus carota [carrots]
emb|CAC19689.1|  sucrose/proton symporter                               286   1e-88    Daucus carota [carrots]
dbj|BAA89458.1|  sucrose transporter protein                            285   3e-88    Daucus carota [carrots]
emb|CAA57727.1|  sucrose transporter                                    283   1e-87    Nicotiana tabacum [American tobacco]
gb|AAF04295.2|AF191025_1  sucrose transporter 1                         282   2e-87    Alonsoa meridionalis
gb|AAD45390.1|AF167415_1  sucrose transporter SUT2A                     283   2e-87    Apium graveolens
emb|CAB07811.1|  sucrose transport protein                              283   2e-87    Vicia faba [broad bean]
gb|AFM28284.1|  SUT1-1                                                  283   2e-87    
gb|AAC99332.1|  sucrose transporter                                     281   5e-87    Apium graveolens
gb|AAD41024.1|  sucrose transport protein SUT1                          279   7e-86    Pisum sativum [garden pea]
gb|AHA80795.2|  sucrose transport protein 1                             277   3e-85    
ref|NP_001290021.1|  sucrose transport protein                          276   1e-84    
ref|XP_006589462.1|  PREDICTED: sucrose transport protein               274   6e-84    
gb|AAD53000.1|U64967_1  sucrose-proton symporter                        274   1e-83    Beta vulgaris subsp. vulgaris [field beet]
emb|CAA83436.1|  sucrose carrier                                        273   3e-83    Ricinus communis
ref|XP_008381009.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    271   3e-83    
gb|ABK60190.2|  sucrose transporter 3                                   271   8e-83    Hevea brasiliensis [jebe]
ref|XP_002526849.1|  sucrose transport protein, putative                271   9e-83    Ricinus communis
emb|CAM34330.1|  sucrose transporter 6                                  270   2e-82    Hevea brasiliensis [jebe]
ref|NP_001236298.1|  sucrose transporter                                270   2e-82    
sp|Q03411.1|SUT_SPIOL  RecName: Full=Sucrose transport protein; A...    270   3e-82    Spinacia oleracea
gb|ACX33146.1|  sucrose transporter 1                                   268   9e-82    Verbascum phoeniceum [purple mullein]
ref|XP_007201709.1|  hypothetical protein PRUPE_ppa004033mg             268   2e-81    
ref|XP_009348838.1|  PREDICTED: sucrose transport protein-like          266   3e-81    
ref|XP_007143634.1|  hypothetical protein PHAVU_007G088200g             266   4e-81    
ref|XP_011097249.1|  PREDICTED: sucrose transport protein SUC2-like     266   5e-81    
ref|NP_001289830.1|  sucrose transport protein                          266   6e-81    
ref|XP_010063792.1|  PREDICTED: putative sucrose transport protei...    265   1e-80    
ref|XP_009339088.1|  PREDICTED: sucrose transport protein-like          264   2e-80    
gb|AHB33871.1|  sucrose transporter                                     263   4e-80    
gb|ADW78350.1|  sucrose proton symporter 2                              263   6e-80    
gb|AAF04294.1|AF191024_1  sucrose transporter 1                         263   1e-79    Maurandya barclayana
ref|NP_177334.1|  sucrose transport protein SUC5                        262   1e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CAC19851.1|  sucrose trasporter                                     262   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006351170.1|  PREDICTED: sucrose transport protein-like          262   2e-79    
gb|EYU22864.1|  hypothetical protein MIMGU_mgv1a004602mg                262   2e-79    
ref|XP_010471204.1|  PREDICTED: sucrose transport protein SUC1          261   2e-79    
ref|XP_006302149.1|  hypothetical protein CARUB_v10020153mg             261   2e-79    
ref|XP_007020260.1|  Sucrose-proton symporter 2 isoform 2               263   2e-79    
ref|XP_010415904.1|  PREDICTED: sucrose transport protein SUC1-like     261   3e-79    
ref|XP_002862880.1|  hypothetical protein ARALYDRAFT_497263             261   4e-79    
ref|XP_002887397.1|  hypothetical protein ARALYDRAFT_476315             261   4e-79    
ref|XP_009127880.1|  PREDICTED: sucrose transport protein SUC1          261   6e-79    
gb|AAL58071.1|  sucrose transporter SUC1                                261   6e-79    Brassica oleracea
emb|CAA48915.1|  sucrose transport protein                              261   7e-79    Solanum tuberosum [potatoes]
emb|CDY03675.1|  BnaA02g15620D                                          260   7e-79    
ref|XP_010428037.1|  PREDICTED: sucrose transport protein SUC1-like     260   1e-78    
ref|XP_010521130.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    258   5e-78    
ref|XP_011038161.1|  PREDICTED: sucrose transport protein SUC8-like     259   5e-78    
ref|XP_002893246.1|  sucrose-proton symporter 2                         258   7e-78    
emb|CDY36675.1|  BnaCnng07770D                                          257   1e-77    
ref|XP_006301807.1|  hypothetical protein CARUB_v10022273mg             257   1e-77    
ref|XP_009104886.1|  PREDICTED: sucrose transport protein SUC1-like     257   2e-77    
gb|ADW94613.1|  sucrose transporter 1                                   258   2e-77    
ref|NP_173685.1|  sucrose transport protein SUC2                        256   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAM10322.1|  At1g22710/T22J18_12                                     256   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307270.1|  hypothetical protein CARUB_v10008884mg             256   2e-77    
ref|XP_006416169.1|  hypothetical protein EUTSA_v10009321mg             256   2e-77    
gb|AAL58072.1|  sucrose transporter SUC2                                256   2e-77    Brassica oleracea
emb|CDY12517.1|  BnaC07g13570D                                          256   2e-77    
ref|XP_009103222.1|  PREDICTED: sucrose transport protein SUC2          256   3e-77    
gb|ADW94615.1|  sucrose transporter 1                                   257   3e-77    
ref|XP_009115609.1|  PREDICTED: sucrose transport protein SUC2          256   3e-77    
ref|XP_010477533.1|  PREDICTED: sucrose transport protein SUC2          256   5e-77    
ref|XP_010460033.1|  PREDICTED: sucrose transport protein SUC2-like     256   6e-77    
emb|CAA53150.1|  sucrose-proton symporter                               255   8e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44362.1|  hypothetical protein AALP_AA1G247500                    255   1e-76    
ref|XP_006392340.1|  hypothetical protein EUTSA_v10023916mg             254   1e-76    
gb|AAU11810.1|  sucrose transporter                                     254   1e-76    Juglans regia
ref|XP_006390730.1|  hypothetical protein EUTSA_v10018412mg             254   1e-76    
ref|XP_006376318.1|  putative sucrose-H+ symporter family protein       255   2e-76    
gb|ADW94614.1|  sucrose transporter 1                                   255   2e-76    
ref|XP_007020259.1|  Sucrose-proton symporter 2 isoform 1               255   2e-76    
gb|ADL29729.1|  sugar transporter                                       253   5e-76    
ref|XP_006392336.1|  hypothetical protein EUTSA_v10023799mg             252   7e-76    
gb|AET08927.1|  sucrose transporter                                     253   7e-76    
emb|CAA53390.2|  sucrose transporter                                    252   1e-75    Plantago major [cart-track plant]
ref|XP_006399085.1|  hypothetical protein EUTSA_v10015600mg             251   1e-75    
ref|XP_007020265.1|  Sucrose transport protein SUC2                     248   2e-75    
ref|XP_009348390.1|  PREDICTED: sucrose transport protein-like          251   3e-75    
ref|XP_009375259.1|  PREDICTED: sucrose transport protein-like          251   3e-75    
gb|KHN32802.1|  Sucrose transport protein SUC2                          244   4e-75    
ref|XP_008245088.1|  PREDICTED: sucrose transport protein               250   5e-75    
emb|CAJ33718.1|  sucrose transporter 1                                  251   7e-75    Populus tremula x Populus tremuloides
gb|KDP34602.1|  hypothetical protein JCGZ_11979                         250   8e-75    
ref|XP_002326003.2|  sucrose transporter family protein                 250   9e-75    Populus trichocarpa [western balsam poplar]
gb|AHB33870.1|  sucrose transporter                                     249   1e-74    
ref|XP_006473215.1|  PREDICTED: sucrose transport protein SUC2 is...    250   1e-74    
ref|XP_011001730.1|  PREDICTED: sucrose transport protein SUC8-like     250   1e-74    
ref|NP_001275850.1|  citrus sucrose transporter 1                       250   1e-74    
gb|ACB47398.1|  sucrose transporter                                     249   2e-74    Brassica napus [oilseed rape]
ref|XP_009105851.1|  PREDICTED: sucrose transport protein SUC1-like     249   2e-74    
emb|CDX72840.1|  BnaC06g32880D                                          248   3e-74    
ref|XP_007020266.1|  Sucrose transport protein SUC2 isoform 1           248   3e-74    
gb|KHN32801.1|  Sucrose transport protein                               244   4e-74    
gb|ADW94616.1|  sucrose transporter 3                                   248   4e-74    
gb|AHH34928.1|  sucrose transporter 5                                   247   4e-74    
ref|XP_007020267.1|  Sucrose transport protein SUC2 isoform 2           247   5e-74    
ref|XP_006434633.1|  hypothetical protein CICLE_v10000828mg             248   5e-74    
gb|ABA08446.1|  sucrose transporter type 1                              245   6e-74    Manihot esculenta [manioc]
ref|XP_004290438.1|  PREDICTED: sucrose transport protein SUC2-like     247   7e-74    
emb|CDP20704.1|  unnamed protein product                                246   2e-73    
gb|ABB30163.2|  sucrose transport protein SUF1                          246   2e-73    Pisum sativum [garden pea]
ref|XP_007151866.1|  hypothetical protein PHAVU_004G082200g             245   3e-73    
ref|XP_010425915.1|  PREDICTED: putative sucrose transport protei...    245   4e-73    
gb|KHN00702.1|  Sucrose transport protein SUC2                          241   4e-73    
ref|XP_010503136.1|  PREDICTED: sucrose transport protein SUC8-li...    245   4e-73    
gb|ABO31372.1|  sucrose transporter 1                                   239   5e-73    Gossypium hirsutum [American cotton]
gb|AIU94753.1|  sucrose proton symporter                                245   5e-73    
ref|XP_007151902.1|  hypothetical protein PHAVU_004G085500g             245   6e-73    
ref|XP_009130919.1|  PREDICTED: putative sucrose transport protei...    243   1e-72    
gb|ABB30165.1|  sucrose transport protein SUF1                          244   1e-72    Phaseolus vulgaris [French bean]
gb|AAF65765.1|AF242307_1  sucrose transport protein                     244   1e-72    Euphorbia esula [wolf's milk]
emb|CDX80991.1|  BnaC03g02450D                                          243   2e-72    
ref|XP_006285493.1|  hypothetical protein CARUB_v10006922mg             243   2e-72    
ref|XP_003548078.1|  PREDICTED: sucrose transport protein SUC1-like     244   2e-72    
gb|KFK41606.1|  hypothetical protein AALP_AA2G150200                    243   2e-72    
ref|XP_003548077.1|  PREDICTED: sucrose transport protein SUC8-like     243   2e-72    
ref|XP_010471205.1|  PREDICTED: sucrose transport protein SUC5-like     243   2e-72    
ref|XP_004515134.1|  PREDICTED: sucrose transport protein SUC5-like     244   2e-72    
gb|KHN32799.1|  Sucrose transport protein SUC2                          243   3e-72    
ref|XP_007009466.1|  Sucrose transport protein SUC2                     243   3e-72    
ref|XP_010419159.1|  PREDICTED: sucrose transport protein SUC5-like     243   3e-72    
ref|XP_006599449.1|  PREDICTED: sucrose transport protein SUC8-like     242   4e-72    
ref|XP_004291896.1|  PREDICTED: sucrose transport protein SUC2-like     242   4e-72    
ref|NP_177333.1|  sucrose transport protein SUC1                        242   7e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887396.1|  sucrose-proton symporter 1                         242   9e-72    
gb|AAY87138.1|  putative sucrose transporter                            241   2e-71    Vitis vinifera
emb|CAN67869.1|  hypothetical protein VITISV_020809                     241   2e-71    Vitis vinifera
ref|XP_003518348.1|  PREDICTED: sucrose transport protein SUC1-like     241   2e-71    
ref|XP_010673573.1|  PREDICTED: sucrose transport protein SUC2-like     240   2e-71    
emb|CAA59113.1|  SUC1-sucrose proton symporter                          240   3e-71    Plantago major [cart-track plant]
gb|ABJ51933.1|  sucrose transporter 1                                   241   3e-71    Hevea brasiliensis [jebe]
ref|XP_010428038.1|  PREDICTED: sucrose transport protein SUC5-like     241   3e-71    
ref|NP_001268070.1|  sucrose transporter-like                           239   6e-71    
gb|KHG14831.1|  Sucrose transport SUC2 -like protein                    239   6e-71    
ref|XP_007151897.1|  hypothetical protein PHAVU_004G085100g             239   1e-70    
ref|XP_007020263.1|  Sucrose-proton symporter 2 isoform 1               239   1e-70    
ref|XP_006286640.1|  hypothetical protein CARUB_v10002510mg             238   1e-70    
gb|AHH34929.1|  sucrose transporter 6                                   238   2e-70    
gb|AHH34922.1|  sucrose transporter 1 isoform 2                         238   4e-70    
gb|ABF06447.1|  putative sucrose transport protein SUT1                 231   5e-70    Nicotiana langsdorffii x Nicotiana sanderae
gb|ABF06446.1|  putative sucrose transport protein SUT1                 231   7e-70    Nicotiana langsdorffii x Nicotiana sanderae
emb|CAE53179.1|  sucrose transporter                                    236   8e-70    Arabidopsis thaliana [mouse-ear cress]
gb|KHG00539.1|  Sucrose transport SUC2 -like protein                    236   1e-69    
gb|ABB30164.1|  sucrose transport protein SUT1                          236   2e-69    Phaseolus vulgaris [French bean]
ref|XP_003610412.1|  Sucrose transport protein                          235   2e-69    
gb|KCW71037.1|  hypothetical protein EUGRSUZ_F04137                     234   3e-69    
gb|KHG01351.1|  Sucrose transport SUC2 -like protein                    235   3e-69    
ref|XP_010063779.1|  PREDICTED: sucrose transport protein SUC2-like     234   3e-69    
ref|XP_010540294.1|  PREDICTED: sucrose transport protein SUC2-like     234   6e-69    
gb|AFM28285.1|  SUT1-2                                                  234   9e-69    
emb|CBI18537.3|  unnamed protein product                                229   2e-68    
ref|XP_004515590.1|  PREDICTED: sucrose transport protein SUC2-like     233   2e-68    
emb|CDX98907.1|  BnaC09g49280D                                          232   3e-68    
ref|XP_004289897.1|  PREDICTED: sucrose transport protein SUC2-like     232   3e-68    
gb|KEH25698.1|  sucrose proton symporter 2                              233   3e-68    
gb|AFU61910.1|  sucrose transporter 4                                   232   3e-68    
ref|XP_002871200.1|  sucrose-proton symporter 6                         232   4e-68    
ref|XP_004291895.1|  PREDICTED: sucrose transport protein SUC2-like     232   4e-68    
emb|CDY60441.1|  BnaA10g30480D                                          228   9e-67    
gb|AHH34921.1|  sucrose transporter 1 isoform 1                         229   1e-66    
ref|XP_009122220.1|  PREDICTED: putative sucrose transport protei...    228   1e-66    
ref|NP_199174.1|  putative sucrose transport protein SUC6               228   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298889.1|  PREDICTED: sucrose transport protein SUC2-like     228   2e-66    
ref|XP_007151901.1|  hypothetical protein PHAVU_004G085400g             228   2e-66    
emb|CDY45308.1|  BnaA03g52810D                                          227   2e-66    
ref|XP_002266122.1|  PREDICTED: sucrose transport protein SUC2          227   3e-66    Vitis vinifera
ref|XP_009138292.1|  PREDICTED: sucrose transport protein SUC1-like     227   3e-66    
ref|XP_004300865.1|  PREDICTED: sucrose transport protein SUC2-like     223   3e-66    
ref|NP_179074.1|  sucrose transport protein SUC8                        226   4e-66    Arabidopsis thaliana [mouse-ear cress]
gb|KCW71038.1|  hypothetical protein EUGRSUZ_F04138                     226   5e-66    
dbj|BAD44273.1|  hypothetical protein                                   226   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176830.1|  putative sucrose transport protein SUC7               226   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010063780.1|  PREDICTED: sucrose transport protein SUC8-like     226   6e-66    
ref|XP_009779331.1|  PREDICTED: sucrose transport protein SUC8-like     226   7e-66    
ref|XP_002874582.1|  hypothetical protein ARALYDRAFT_911231             225   2e-65    
ref|XP_002887046.1|  predicted protein                                  223   7e-65    
gb|ABB30166.1|  putative sucrose transport protein SUT3                 223   1e-64    Phaseolus vulgaris [French bean]
gb|AAD34610.1|AF149981_1  sucrose transporter-like protein              223   3e-64    Nicotiana tabacum [American tobacco]
ref|XP_010455355.1|  PREDICTED: sucrose transport protein SUC8-like     222   5e-64    
ref|XP_003518345.1|  PREDICTED: sucrose transport protein SUC8-like     221   6e-64    
ref|XP_010421870.1|  PREDICTED: sucrose transport protein SUC8-like     221   7e-64    
ref|XP_010491171.1|  PREDICTED: sucrose transport protein SUC8-like     220   9e-64    
ref|XP_010438237.1|  PREDICTED: sucrose transport protein SUC8-like     221   1e-63    
ref|XP_006599447.1|  PREDICTED: sucrose transport protein SUC8-li...    220   1e-63    
ref|XP_004138988.1|  PREDICTED: sucrose transport protein SUC2-like     212   3e-63    
ref|NP_196235.1|  sucrose transport protein SUC9                        218   5e-63    Arabidopsis thaliana [mouse-ear cress]
gb|KFK32062.1|  hypothetical protein AALP_AA6G194700                    214   4e-61    
ref|XP_008465545.1|  PREDICTED: sucrose transport protein SUC8-li...    213   8e-61    
ref|XP_004138920.1|  PREDICTED: sucrose transport protein SUC2-like     212   1e-60    
ref|XP_004159998.1|  PREDICTED: sucrose transport protein SUC2-like     212   1e-60    
ref|XP_008465544.1|  PREDICTED: sucrose transport protein SUC8-li...    213   1e-60    
ref|XP_010543261.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    209   3e-59    
ref|XP_010675270.1|  PREDICTED: sucrose transport protein SUC2-like     208   3e-59    
ref|XP_010094855.1|  Sucrose transport protein SUC2                     207   9e-59    
ref|XP_006371473.1|  hypothetical protein POPTR_0019s11560g             203   2e-57    
gb|KHN32800.1|  Sucrose transport protein                               197   6e-56    
gb|ADE77095.1|  unknown                                                 192   4e-55    
emb|CDP19968.1|  unnamed protein product                                197   5e-55    
ref|XP_001766981.1|  predicted protein                                  194   1e-53    
gb|KHN08210.1|  Sucrose transport protein SUC4-like protein             190   1e-53    
ref|XP_009759497.1|  PREDICTED: sucrose transport protein SUC3 is...    193   2e-53    
gb|KHF99226.1|  Sucrose transport SUC2 -like protein                    193   2e-53    
ref|XP_003523764.1|  PREDICTED: sucrose transport protein SUC4-li...    192   7e-53    
ref|XP_009593382.1|  PREDICTED: sucrose transport protein SUC3 is...    191   1e-52    
ref|XP_002978870.1|  hypothetical protein SELMODRAFT_177267             192   1e-52    
gb|AAQ84310.1|  fiber sucrose transporter                               186   1e-52    Gossypium barbadense [Egyptian cotton]
ref|XP_009129115.1|  PREDICTED: sucrose transport protein SUC3-li...    190   1e-52    
ref|XP_008778269.1|  PREDICTED: sucrose transport protein SUT4-li...    192   2e-52    
ref|XP_009759496.1|  PREDICTED: sucrose transport protein SUC3 is...    192   2e-52    
ref|XP_002988479.1|  hypothetical protein SELMODRAFT_269407             191   2e-52    
ref|XP_002311596.1|  sucrose transporter family protein                 192   3e-52    Populus trichocarpa [western balsam poplar]
gb|KDO82867.1|  hypothetical protein CISIN_1g012185mg                   189   3e-52    
ref|XP_010271544.1|  PREDICTED: sucrose transport protein SUC4          190   3e-52    
gb|KDO82870.1|  hypothetical protein CISIN_1g012185mg                   189   4e-52    
ref|XP_001777456.1|  predicted protein                                  189   5e-52    
ref|XP_006434634.1|  hypothetical protein CICLE_v10000828mg             189   5e-52    
ref|XP_006438653.1|  hypothetical protein CICLE_v10030996mg             189   5e-52    
ref|XP_006483200.1|  PREDICTED: sucrose transport protein SUC3 is...    189   5e-52    
ref|XP_010096375.1|  Sucrose transport protein SUC3                     191   5e-52    
ref|XP_008465743.1|  PREDICTED: sucrose transport protein SUC3          191   6e-52    
gb|EYU28727.1|  hypothetical protein MIMGU_mgv1a006020mg                188   6e-52    
emb|CDY41670.1|  BnaC02g34840D                                          189   7e-52    
ref|XP_006363242.1|  PREDICTED: sucrose transport protein SUC3 is...    189   7e-52    
emb|CAA76367.1|  sucrose/H+ symporter                                   189   7e-52    Daucus carota [carrots]
gb|AIU94754.1|  sucrose transporter 2a                                  189   7e-52    
ref|XP_009593381.1|  PREDICTED: sucrose transport protein SUC3 is...    191   8e-52    
ref|XP_002983014.1|  hypothetical protein SELMODRAFT_234154             189   8e-52    
ref|XP_009593380.1|  PREDICTED: sucrose transport protein SUC3 is...    191   9e-52    
ref|XP_009129114.1|  PREDICTED: sucrose transport protein SUC3-li...    190   1e-51    
gb|KHN00701.1|  Sucrose transport protein SUC2                          187   1e-51    
gb|ADW94618.1|  sucrose transporter 5                                   190   1e-51    
gb|KHG09278.1|  Sucrose transport SUC4 -like protein                    188   1e-51    
ref|XP_010695439.1|  PREDICTED: sucrose transport protein SUC4          189   1e-51    
gb|KDP41540.1|  hypothetical protein JCGZ_15947                         188   1e-51    
gb|AHH34924.1|  sucrose transporter 2 isoform 8                         186   1e-51    
ref|XP_010940402.1|  PREDICTED: sucrose transport protein SUT4-li...    190   2e-51    
ref|XP_002965535.1|  hypothetical protein SELMODRAFT_266927             188   2e-51    
ref|XP_011025861.1|  PREDICTED: sucrose transport protein SUC3-li...    187   2e-51    
ref|XP_004143775.1|  PREDICTED: sucrose transport protein SUC3-like     189   3e-51    
gb|ADK46943.1|  sucrose transporter                                     189   3e-51    
ref|NP_973404.1|  sucrose transport protein SUC3                        187   3e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001768298.1|  predicted protein                                  187   3e-51    
ref|XP_007046166.1|  Sucrose transporter 2 isoform 6                    186   3e-51    
ref|XP_006438655.1|  hypothetical protein CICLE_v10030996mg             189   4e-51    
gb|KHN39985.1|  Sucrose transport protein SUC4                          183   5e-51    
ref|XP_008221654.1|  PREDICTED: sucrose transport protein SUC3 is...    186   6e-51    
ref|XP_007046164.1|  Sucrose transporter 2 isoform 4                    186   6e-51    
ref|XP_010935629.1|  PREDICTED: sucrose transport protein SUT4-li...    186   6e-51    
ref|XP_004297321.1|  PREDICTED: sucrose transport protein SUC3-li...    188   7e-51    
gb|KHN19254.1|  Sucrose transport protein SUC4                          182   7e-51    
ref|NP_001275773.1|  sucrose transporter 2                              188   7e-51    
ref|XP_011021611.1|  PREDICTED: sucrose transport protein SUC3 is...    186   7e-51    
ref|XP_004297320.1|  PREDICTED: sucrose transport protein SUC3-li...    188   8e-51    
ref|XP_006602307.1|  PREDICTED: sucrose transport protein SUC3-like     188   8e-51    
ref|XP_006395753.1|  hypothetical protein EUTSA_v10003879mg             187   8e-51    
gb|AHG94616.1|  sucrose transporter                                     188   8e-51    
gb|KHN32884.1|  Sucrose transport protein SUC3                          187   9e-51    
ref|XP_009335489.1|  PREDICTED: sucrose transport protein SUC4-like     186   1e-50    
ref|XP_011025852.1|  PREDICTED: sucrose transport protein SUC3-li...    187   1e-50    
ref|XP_009152234.1|  PREDICTED: sucrose transport protein SUC3 is...    185   1e-50    
ref|XP_010256873.1|  PREDICTED: sucrose transport protein SUC3 is...    185   1e-50    
ref|NP_178389.1|  sucrose transport protein SUC3                        187   1e-50    Arabidopsis thaliana [mouse-ear cress]
emb|CAA57726.1|  sucrose transporter                                    184   1e-50    Solanum lycopersicum
gb|AAT40489.1|  putative sucrose transporter-like protein               187   1e-50    Solanum demissum
ref|XP_004511224.1|  PREDICTED: sucrose transport protein SUC3-like     187   2e-50    
dbj|BAO02526.1|  predicted sucrose transporter-like protein ortholog    184   2e-50    
ref|XP_002315798.1|  sucrose transporter family protein                 186   2e-50    
ref|XP_002520110.1|  sucrose transport protein, putative                187   3e-50    
gb|ABJ51934.1|  sucrose transporter 2A                                  186   3e-50    
ref|XP_002978868.1|  hypothetical protein SELMODRAFT_109895             184   3e-50    
ref|XP_003530692.2|  PREDICTED: sucrose transport protein SUC3-like     186   3e-50    
ref|XP_007046163.1|  Sucrose transporter 2 isoform 3                    186   3e-50    
ref|XP_002988481.1|  hypothetical protein SELMODRAFT_183916             184   3e-50    
gb|KHG16131.1|  Sucrose transport SUC3 -like protein                    186   3e-50    
ref|XP_007046161.1|  Sucrose transporter 2 isoform 1                    186   4e-50    
gb|AFM28287.1|  SUT2                                                    186   4e-50    
ref|XP_011021610.1|  PREDICTED: sucrose transport protein SUC3 is...    186   4e-50    
ref|XP_008221653.1|  PREDICTED: sucrose transport protein SUC3 is...    186   4e-50    
ref|XP_009629206.1|  PREDICTED: sucrose transport protein SUC4-li...    184   5e-50    
ref|XP_010935627.1|  PREDICTED: sucrose transport protein SUT4-li...    186   6e-50    
gb|AAX49396.1|  sucrose transporter 2                                   186   6e-50    
ref|XP_006433713.1|  hypothetical protein CICLE_v100009411mg            179   7e-50    
ref|XP_007222035.1|  hypothetical protein PRUPE_ppa003041mg             185   7e-50    
gb|AHN92214.1|  sucrose transporter 2                                   185   8e-50    
ref|XP_009152233.1|  PREDICTED: sucrose transport protein SUC3 is...    185   8e-50    
ref|XP_010664062.1|  PREDICTED: sucrose transporter-like isoform X1     183   8e-50    
gb|ABI34279.1|  sucrose transporter-like protein, putative              184   8e-50    
ref|NP_001275438.1|  sucrose transporter-like protein                   185   8e-50    
gb|AAD55269.1|AF182445_1  sucrose transporter                           183   9e-50    
ref|XP_010502297.1|  PREDICTED: sucrose transport protein SUC3 is...    182   9e-50    
ref|XP_010256864.1|  PREDICTED: sucrose transport protein SUC3 is...    184   1e-49    
gb|ADW94619.1|  sucrose transporter 6                                   185   1e-49    
ref|XP_010425057.1|  PREDICTED: sucrose transport protein SUC3-li...    182   1e-49    
gb|ABI34288.1|  sucrose transporter-like protein, putative              184   1e-49    
ref|XP_003519216.1|  PREDICTED: sucrose transport protein SUC4-li...    183   1e-49    
gb|KHG28870.1|  Sucrose transport SUC4 -like protein                    183   1e-49    
ref|XP_002876843.1|  hypothetical protein ARALYDRAFT_484195             184   1e-49    
ref|NP_001234344.1|  sucrose transporter                                183   1e-49    
gb|ABK60191.1|  sucrose transporter 4                                   182   2e-49    
gb|AHA80796.2|  sucrose transport protein 2                             184   2e-49    
dbj|BAI60050.1|  sucrose transporter                                    182   2e-49    
dbj|BAO96215.1|  sucrose transporter 4                                  182   2e-49    
ref|XP_006852724.1|  hypothetical protein AMTR_s00033p00073720          182   2e-49    
emb|CAG70682.1|  putative sucrose-H+ symporter                          182   2e-49    
ref|XP_009615002.1|  PREDICTED: sucrose transport protein SUC4-li...    182   3e-49    
gb|ABK60189.1|  sucrose transporter 5                                   182   3e-49    
ref|NP_001275070.1|  sucrose transporter 4                              182   3e-49    
gb|AEZ00892.1|  putative sucrose transporter protein                    174   3e-49    
ref|XP_006290789.1|  hypothetical protein CARUB_v10016892mg             183   4e-49    
gb|KHN06837.1|  Sucrose transport protein SUC3                          186   4e-49    
gb|KDP41167.1|  hypothetical protein JCGZ_15574                         183   4e-49    
ref|XP_011075472.1|  PREDICTED: sucrose transport protein SUC3 is...    182   5e-49    
gb|KFK33468.1|  hypothetical protein AALP_AA5G017000                    182   5e-49    
ref|XP_009394464.1|  PREDICTED: sucrose transport protein SUT4 is...    181   5e-49    
ref|XP_009765485.1|  PREDICTED: sucrose transport protein SUC4-li...    181   5e-49    
gb|AFM28289.1|  SUT4-2                                                  181   6e-49    
ref|XP_010502296.1|  PREDICTED: sucrose transport protein SUC3 is...    182   6e-49    
ref|XP_010425056.1|  PREDICTED: sucrose transport protein SUC3-li...    182   6e-49    
ref|XP_011075471.1|  PREDICTED: sucrose transport protein SUC3 is...    182   7e-49    
ref|XP_011074299.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose tran...    182   7e-49    
ref|XP_007141313.1|  hypothetical protein PHAVU_008G185300g             181   8e-49    
gb|ABO21770.1|  sucrose transporter protein                             182   1e-48    
ref|XP_010917012.1|  PREDICTED: sucrose transport protein SUT1 is...    181   1e-48    
ref|NP_001146651.1|  sucrose transporter2                               182   1e-48    
ref|XP_010917011.1|  PREDICTED: sucrose transport protein SUT3 is...    181   1e-48    
ref|XP_010683228.1|  PREDICTED: sucrose transport protein SUC3          181   2e-48    
ref|XP_002453083.1|  hypothetical protein SORBIDRAFT_04g038030          181   2e-48    
ref|XP_006827165.1|  hypothetical protein AMTR_s00010p00254010          181   2e-48    
ref|XP_002971245.1|  hypothetical protein SELMODRAFT_94770              180   2e-48    
ref|XP_007153820.1|  hypothetical protein PHAVU_003G067600g             181   2e-48    
ref|XP_006472375.1|  PREDICTED: sucrose transport protein SUC4-li...    180   2e-48    
gb|KDO81341.1|  hypothetical protein CISIN_1g010639mg                   179   2e-48    
gb|KDO81342.1|  hypothetical protein CISIN_1g010639mg                   180   2e-48    
ref|XP_009394456.1|  PREDICTED: sucrose transport protein SUT4 is...    181   3e-48    
ref|XP_002961568.1|  hypothetical protein SELMODRAFT_76990              179   3e-48    
emb|CAD58887.1|  sucrose transporter                                    181   3e-48    
ref|XP_007018362.1|  Sucrose proton symporter                           179   4e-48    
ref|NP_001234321.1|  sucrose transporter-like protein                   181   4e-48    
gb|KHG22972.1|  Sucrose transport SUC3 -like protein                    180   4e-48    
ref|XP_010044720.1|  PREDICTED: sucrose transport protein SUC3          181   4e-48    
dbj|BAC67164.1|  sucrose transporter                                    180   4e-48    
gb|ABJ51932.1|  sucrose transporter 2B                                  180   6e-48    
emb|CDP00304.1|  unnamed protein product                                180   7e-48    
ref|XP_004954470.1|  PREDICTED: sucrose transport protein SUT4-like     180   7e-48    
ref|XP_011097239.1|  PREDICTED: sucrose transport protein SUC2-like     178   1e-47    
ref|XP_004490500.1|  PREDICTED: sucrose transport protein SUC4-li...    178   1e-47    
gb|AAU21439.1|  putative sucrose carrier                                178   1e-47    
ref|XP_008389500.1|  PREDICTED: sucrose transport protein SUC3-li...    179   2e-47    
gb|AFO84088.1|  sucrose transport protein                               179   2e-47    
gb|ACR35754.1|  unknown                                                 172   3e-47    
ref|XP_009405154.1|  PREDICTED: sucrose transport protein SUT3-like     177   3e-47    
ref|NP_001268066.1|  sucrose transporter-like                           176   3e-47    
emb|CDP00966.1|  unnamed protein product                                176   3e-47    
ref|XP_006648160.1|  PREDICTED: sucrose transport protein SUT4-like     177   4e-47    
ref|XP_010236020.1|  PREDICTED: sucrose transport protein SUT4 is...    176   4e-47    
ref|NP_001048591.1|  Os02g0827200                                       177   4e-47    
ref|XP_004299838.1|  PREDICTED: sucrose transport protein SUC4-li...    176   6e-47    
gb|ACU87542.1|  sucrose transporter 4                                   177   6e-47    
gb|ACR36968.1|  unknown                                                 172   7e-47    
gb|AAM13408.1|AF408842_1  sucrose transporter SUT1A                     176   7e-47    
emb|CDY09350.1|  BnaA02g26600D                                          176   7e-47    
ref|XP_008802446.1|  PREDICTED: sucrose transport protein SUT4-li...    174   8e-47    
ref|XP_006390731.1|  hypothetical protein EUTSA_v10018412mg             174   9e-47    
emb|CAB75882.1|  sucrose transporter 1                                  176   9e-47    
emb|CAJ20123.1|  sucrose transporter 1                                  176   1e-46    
ref|XP_004501070.1|  PREDICTED: sucrose transport protein SUC4-like     175   1e-46    
gb|KEH32639.1|  sucrose transporter 2                                   174   1e-46    
gb|AFS33111.1|  SUF4b                                                   175   1e-46    
gb|ACR36697.1|  unknown                                                 171   1e-46    
ref|XP_009360368.1|  PREDICTED: sucrose transport protein SUC3 is...    176   1e-46    
ref|XP_001777654.1|  predicted protein                                  174   1e-46    
gb|AFO84089.1|  sucrose transport protein                               174   2e-46    
gb|AIE90172.1|  sucrose transporter 2A                                  174   2e-46    
gb|AIE90174.1|  sucrose transporter 2D                                  174   2e-46    
emb|CBI31990.3|  unnamed protein product                                175   2e-46    
ref|NP_001280809.1|  sucrose transport protein SUC4-like                174   2e-46    
gb|AAM13409.1|AF408843_1  sucrose transporter SUT1B                     174   2e-46    
ref|XP_010236019.1|  PREDICTED: sucrose transport protein SUT4 is...    176   3e-46    
ref|XP_009392956.1|  PREDICTED: sucrose transport protein SUT2          174   3e-46    
ref|XP_008802422.1|  PREDICTED: sucrose transport protein SUT4-li...    173   3e-46    
gb|AAL90455.1|AF408845_1  sucrose transporter SUT1D                     174   3e-46    
ref|XP_006417508.1|  hypothetical protein EUTSA_v10007390mg             174   3e-46    
gb|ACV95498.1|  sucrose transporter                                     173   4e-46    
gb|ABA08444.1|  sucrose transporter type 4                              170   4e-46    
gb|EYU34230.1|  hypothetical protein MIMGU_mgv1a005175mg                173   5e-46    
ref|XP_010651816.1|  PREDICTED: sucrose transporter-like isoform X1     175   5e-46    
gb|AAL84308.1|AC073556_25  sucrose transporter, 5'-partial              169   5e-46    
ref|XP_008797155.1|  PREDICTED: sucrose transport protein SUT1-like     174   5e-46    
dbj|BAJ93580.1|  predicted protein                                      173   5e-46    
ref|XP_007151903.1|  hypothetical protein PHAVU_004G085500g             172   5e-46    
ref|XP_008339011.1|  PREDICTED: sucrose transport protein SUC4-like     173   6e-46    
gb|KFK25021.1|  hypothetical protein AALP_AA8G056600                    175   8e-46    
ref|XP_008660500.1|  PREDICTED: sucrose transport protein SUT1-like     173   8e-46    
gb|KFK25020.1|  hypothetical protein AALP_AA8G056600                    175   8e-46    
dbj|BAK01156.1|  predicted protein                                      174   9e-46    
ref|XP_002885931.1|  hypothetical protein ARALYDRAFT_319456             171   1e-45    
ref|XP_008802408.1|  PREDICTED: sucrose transport protein SUT4-li...    173   1e-45    
tpg|DAA43615.1|  TPA: hypothetical protein ZEAMMB73_332694              171   1e-45    
ref|XP_010475856.1|  PREDICTED: sucrose transport protein SUC4-like     172   1e-45    
ref|XP_003558709.1|  PREDICTED: sucrose transport protein SUT1          172   2e-45    
ref|XP_008802401.1|  PREDICTED: sucrose transport protein SUT4-li...    173   2e-45    
ref|XP_010553671.1|  PREDICTED: sucrose transport protein SUC4-like     172   2e-45    
ref|XP_010458319.1|  PREDICTED: sucrose transport protein SUC4-like     172   2e-45    
emb|CDY22612.1|  BnaC08g42460D                                          172   2e-45    
ref|XP_010490497.1|  PREDICTED: sucrose transport protein SUC4          172   2e-45    
gb|ACX71839.1|  sucrose transporter 4                                   171   3e-45    
ref|XP_002443677.1|  hypothetical protein SORBIDRAFT_08g023310          171   3e-45    
gb|ADF28098.1|  sucrose transporter                                     171   3e-45    
emb|CAN62386.1|  hypothetical protein VITISV_011127                     172   4e-45    
gb|ADB04246.1|  sucrose transporter                                     171   4e-45    
ref|XP_004148402.1|  PREDICTED: sucrose transport protein SUC4-like     171   4e-45    
gb|AAV41028.1|  sucrose transporter                                     171   4e-45    
emb|CDY45192.1|  BnaA06g33960D                                          171   4e-45    
gb|ADL14375.1|  sucrose transporter 1                                   171   4e-45    
gb|ADE22272.1|  sucrose transporter protein                             171   4e-45    
ref|XP_009148315.1|  PREDICTED: sucrose transport protein SUC4          171   4e-45    
tpg|DAA43619.1|  TPA: hypothetical protein ZEAMMB73_332694              171   5e-45    
ref|XP_008648004.1|  PREDICTED: sucrose transporter1 isoform X1         171   5e-45    
gb|ABA08443.1|  sucrose transporter type 4                              170   5e-45    
ref|NP_001104840.1|  sucrose transporter1                               171   5e-45    
emb|CDX93458.1|  BnaA06g05900D                                          170   6e-45    
gb|EMT22591.1|  hypothetical protein F775_13030                         170   6e-45    
emb|CDY62732.1|  BnaC05g49240D                                          170   7e-45    
gb|ABB30162.2|  sucrose transport protein SUF4                          170   8e-45    
emb|CDY36888.1|  BnaC08g09590D                                          171   8e-45    
gb|ACO55747.1|  sucrose transporter                                     170   8e-45    
ref|XP_001752965.1|  predicted protein                                  170   8e-45    
gb|ACY69230.1|  sucrose transporter 1                                   170   1e-44    
gb|AFW89525.1|  hypothetical protein ZEAMMB73_311282                    170   1e-44    
ref|XP_010060140.1|  PREDICTED: sucrose transport protein SUC4          170   1e-44    
ref|XP_006473216.1|  PREDICTED: sucrose transport protein SUC2 is...    169   1e-44    
emb|CDY03029.1|  BnaC07g21980D                                          170   1e-44    
ref|NP_001268068.1|  sucrose transporter-like                           171   1e-44    
ref|XP_003615400.1|  Sucrose transport protein                          169   1e-44    
emb|CAB75881.1|  sucrose transporter 2                                  169   2e-44    
ref|NP_172467.1|  sucrose transporter 4                                 169   2e-44    
gb|AAG09191.1|AF175321_1  sucrose transporter SUT4                      169   2e-44    
ref|XP_006649472.1|  PREDICTED: sucrose transport protein SUT1-like     168   2e-44    
ref|XP_002889777.1|  sucrose transporter SUT4                           169   2e-44    
ref|XP_009357240.1|  PREDICTED: sucrose transport protein SUC4-like     169   2e-44    
gb|AGO64129.1|  sucrose transporter                                     169   2e-44    
emb|CDY53828.1|  BnaA09g57200D                                          169   3e-44    
ref|XP_004985542.1|  PREDICTED: sucrose transport protein SUT1-like     169   3e-44    
ref|XP_009118285.1|  PREDICTED: sucrose transport protein SUC4-like     168   3e-44    
gb|EEE58406.1|  hypothetical protein OsJ_09584                          168   3e-44    
ref|XP_006307275.1|  hypothetical protein CARUB_v10008890mg             168   4e-44    
ref|XP_002465781.1|  hypothetical protein SORBIDRAFT_01g045720          168   4e-44    
ref|NP_001284446.1|  sucrose transport protein SUC4                     168   4e-44    
ref|XP_010527887.1|  PREDICTED: sucrose transport protein SUC3 is...    167   4e-44    
ref|XP_010936248.1|  PREDICTED: sucrose transport protein SUT2-like     168   5e-44    
emb|CAD61275.1|  sucrose transporter 4 protein                          168   5e-44    
ref|XP_008790392.1|  PREDICTED: sucrose transport protein SUT2-li...    168   6e-44    
ref|NP_001049111.1|  Os03g0170900                                       168   6e-44    
dbj|BAA24071.1|  sucrose transporter                                    168   7e-44    
ref|XP_010527885.1|  PREDICTED: sucrose transport protein SUC3 is...    168   1e-43    
ref|XP_008219162.1|  PREDICTED: sucrose transport protein SUC4          167   1e-43    
ref|XP_010256856.1|  PREDICTED: sucrose transport protein SUC3 is...    168   2e-43    
gb|KDO82869.1|  hypothetical protein CISIN_1g012185mg                   165   2e-43    
ref|XP_008357583.1|  PREDICTED: sucrose transport protein SUC4-like     166   2e-43    
ref|XP_011016949.1|  PREDICTED: sucrose transport protein SUC4          166   4e-43    
ref|XP_007020264.1|  Sucrose-proton symporter 2 isoform 2               164   4e-43    
ref|XP_010939304.1|  PREDICTED: sucrose transport protein SUT2-like     165   5e-43    
gb|ADW94617.1|  sucrose transporter 4                                   165   5e-43    
ref|XP_006827162.1|  hypothetical protein AMTR_s00010p00253720          166   5e-43    
gb|ABG22115.1|  sucrose/H+ symporter family protein, expressed          162   5e-43    
ref|XP_008378695.1|  PREDICTED: sucrose transport protein SUC4-like     166   7e-43    
ref|XP_002510005.1|  sucrose transport protein, putative                164   8e-43    
ref|XP_008382139.1|  PREDICTED: sucrose transport protein-like          163   8e-43    
ref|XP_001778997.1|  predicted protein                                  166   8e-43    
gb|EPS65755.1|  sucrose transporter                                     164   1e-42    
gb|KFK43298.1|  hypothetical protein AALP_AA1G105900                    164   2e-42    
ref|XP_007223388.1|  hypothetical protein PRUPE_ppa004620mg             164   2e-42    
emb|CAM33449.1|  Sucrose Transporter 2C                                 164   3e-42    
ref|XP_008444969.1|  PREDICTED: sucrose transport protein SUC4 is...    163   3e-42    
gb|ABX10015.1|  sucrose transporter                                     163   3e-42    
dbj|BAC67163.1|  sucrose transporter                                    162   7e-42    
sp|A2ZN77.2|SUT2_ORYSI  RecName: Full=Sucrose transport protein S...    162   7e-42    
sp|Q0ILJ3.2|SUT2_ORYSJ  RecName: Full=Sucrose transport protein S...    162   7e-42    
gb|ADY11193.1|  sucrose transporter                                     162   7e-42    
ref|XP_010544043.1|  PREDICTED: sucrose transport protein SUC4-like     162   8e-42    
ref|XP_008785754.1|  PREDICTED: sucrose transport protein SUT2-like     160   8e-42    
gb|AHG94615.1|  sucrose transporter                                     162   9e-42    
gb|ACO87669.1|  sucrose transport protein                               161   9e-42    
gb|KHG07692.1|  Sucrose transport SUC3 -like protein                    160   2e-41    
ref|XP_004986599.1|  PREDICTED: sucrose transport protein SUT3-like     160   3e-41    



>gb|ADK62516.1| sucrose transporter 1y [Ipomoea batatas]
Length=503

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/216 (90%), Positives = 207/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLLYDTDWMAREVYGGEVND+GLYDKGVRAGALGLMLQS+VLGFMSIGVELL
Sbjct  289  LNWIAWFPFLLYDTDWMAREVYGGEVNDSGLYDKGVRAGALGLMLQSIVLGFMSIGVELL  348

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            ARQLGDVK LW GVNFILAIGLALTVAVTK A+HSR++DA GH L+PNS+VKA ALAIFC
Sbjct  349  ARQLGDVKTLWGGVNFILAIGLALTVAVTKTATHSRRFDAQGHTLMPNSNVKAFALAIFC  408

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPLAVTFS+PFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG
Sbjct  409  ILGIPLAVTFSIPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            GNLPAFIVGA+SAA SGILAITLLPKP+SD K+ IP
Sbjct  469  GNLPAFIVGAISAALSGILAITLLPKPQSD-KLAIP  503



>gb|ADL63119.1| sucrose transporter 1x [Ipomoea batatas]
Length=503

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/216 (90%), Positives = 207/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLLYDTDWMAREVYGGEVND+GLYDKGVRAGALGLMLQS+VLGFMSIGVELL
Sbjct  289  LNWIAWFPFLLYDTDWMAREVYGGEVNDSGLYDKGVRAGALGLMLQSIVLGFMSIGVELL  348

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            ARQLGDVK LW GVNFILAIGLALTVAVTK A+HSR++DA GH L+PNS+VKA ALAIFC
Sbjct  349  ARQLGDVKTLWGGVNFILAIGLALTVAVTKTATHSRRFDAQGHTLMPNSNVKAFALAIFC  408

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPLAVTFS+PFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG
Sbjct  409  ILGIPLAVTFSIPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            GNLPAFIVGA+SAA SGILAITLLPKP+SD K+ IP
Sbjct  469  GNLPAFIVGAISAALSGILAITLLPKPQSD-KLAIP  503



>gb|ADL63118.1| sucrose transporter 1x [Ipomoea batatas]
Length=503

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/216 (90%), Positives = 207/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLLYDTDWMAREVYGGEVND+GLYDKGVRAGALGLMLQS+VLGFMSIGVELL
Sbjct  289  LNWIAWFPFLLYDTDWMAREVYGGEVNDSGLYDKGVRAGALGLMLQSIVLGFMSIGVELL  348

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            ARQLGDVK LW GVNFILAIGLALTVAVTK A+HSR++DA GH L+PNS+VKA ALAIFC
Sbjct  349  ARQLGDVKTLWGGVNFILAIGLALTVAVTKTATHSRRFDAQGHTLMPNSNVKAFALAIFC  408

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPLAVTFS+PFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG
Sbjct  409  ILGIPLAVTFSIPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            GNLPAFIVGA+SAA SGILAITLLPKP+SD K+ IP
Sbjct  469  GNLPAFIVGAISAALSGILAITLLPKPQSD-KLAIP  503



>gb|ABB89051.1| putative sucrose transporter SUT3 [Apium graveolens Dulce Group]
Length=515

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 176/210 (84%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF+L+DTDWM RE+YGG+ N   LYD+GVRAG+LGL+L SVVLG  SI VE L
Sbjct  295  LNWIAWFPFILFDTDWMGREIYGGDANTGKLYDQGVRAGSLGLLLNSVVLGLTSIAVEYL  354

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK+LW  VNF+L+IGL +TV V+K A H R+Y ++G  L P++ VKAGAL++F 
Sbjct  355  VRGVGGVKVLWGVVNFVLSIGLVMTVVVSKVAEHQRRYGSNGQVLPPSAGVKAGALSLFS  414

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPL++T+S+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VSFL+GP+D+LFGG
Sbjct  415  VLGIPLSITYSIPFALASIYSSGSGAGQ-GLSLGVLNLAIVVPQMIVSFLAGPFDSLFGG  473

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAFIVGAVSAA SG+LAI +LPKP  D
Sbjct  474  GNLPAFIVGAVSAAVSGVLAIVMLPKPSKD  503



>emb|CAD31122.1| putative sucrose-H+ symporter [Medicago truncatula]
Length=286

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 173/212 (82%), Gaps = 3/212 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +E YGG V +   YDKGVRAGALGLML SVVLG  S+GV++L
Sbjct  63   LNWIAWFPFLLFDTDWMEKEEYGGTVGEGHAYDKGVRAGALGLMLNSVVLGAASLGVDVL  122

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY-DA-HGHPLLPNSSVKAGALAI  355
            AR +G VK LW  VNF+LAI LA+TV VTK A HSR Y DA H  PL P+  + AGALA+
Sbjct  123  ARGVGGVKRLWGIVNFLLAICLAMTVLVTKLAQHSRVYADASHTDPLPPSGGITAGALAL  182

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLGIPLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS LSGPWDALF
Sbjct  183  FSVLGIPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSVLSGPWDALF  241

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GGGNLPAF+VGAV+A ASGIL++ LLP P  D
Sbjct  242  GGGNLPAFVVGAVAALASGILSVVLLPSPPPD  273



>gb|ADL63117.1| sucrose transporter 2y [Ipomoea batatas]
 gb|ADL63121.1| sucrose transporter 2y [Ipomoea batatas]
Length=521

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPF L+DTDWM +EVYGG      NDN LY++GV+AG+LGLML SVVLG MS+G
Sbjct  298  LNWIAWFPFFLFDTDWMGKEVYGGNPEGSANDNRLYEQGVQAGSLGLMLNSVVLGVMSLG  357

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VEL+AR+ G VK LW GVNFILA  LALT+ V+K A  SR++  +G  + P++  +AGAL
Sbjct  358  VELIARRFGGVKKLWAGVNFILAACLALTIMVSKMADKSRRFAPNGDLMPPSAGARAGAL  417

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F VLGIPLAVT+S+PFALA I+SS  GSGQ GLSLGVLNL IVVPQMFVS + GPWD 
Sbjct  418  TLFSVLGIPLAVTYSIPFALASIFSSSTGSGQ-GLSLGVLNLGIVVPQMFVSLVGGPWDQ  476

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            LFGGGNLPAFIVGA+SAA SGI AITLLP P  D K  +P
Sbjct  477  LFGGGNLPAFIVGAISAALSGIFAITLLPSPPPDAKAGVP  516



>gb|ADL63120.1| sucrose transporter 2x [Ipomoea batatas]
Length=520

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPF L+DTDWM +EVYGG      NDN LY++GV+AG+LGLML SVVLG MS+G
Sbjct  297  LNWIAWFPFFLFDTDWMGKEVYGGNPEGSANDNRLYEQGVQAGSLGLMLNSVVLGVMSLG  356

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VEL+AR+ G VK LW GVNFILA  LALT+ V+K A  SR++  +G  + P++  +AGAL
Sbjct  357  VELIARRFGGVKKLWAGVNFILAACLALTIMVSKMADKSRRFAPNGDLMPPSAGARAGAL  416

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F VLGIPLAVT+S+PFALA I+SS  GSGQ GLSLGVLNL IVVPQMFVS + GPWD 
Sbjct  417  TLFSVLGIPLAVTYSIPFALASIFSSSTGSGQ-GLSLGVLNLGIVVPQMFVSLVGGPWDQ  475

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            LFGGGNLPAFIVGA+SAA SGI AITLLP P  D K  +P
Sbjct  476  LFGGGNLPAFIVGAISAALSGIFAITLLPSPPPDAKAGVP  515



>ref|XP_009630281.1| PREDICTED: sucrose transport protein-like [Nicotiana tomentosiformis]
 emb|CAM33257.1| sucrose transporter [Nicotiana tabacum]
 dbj|BAO47333.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  290  LNWIAWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  350  GKKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  409

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS + GPWD LFGG
Sbjct  410  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSIVGGPWDDLFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLP FIVGAV+AAASGILA+T+LP P +D K
Sbjct  469  GNLPGFIVGAVAAAASGILALTMLPSPPADAK  500



>emb|CAQ58422.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  290  LNWIAWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  350  GKKIGGVKRLWGILNFVLAVCMALTVLVTKVAEKSRQYDAHGTLMAPTSGVKIGALTLFA  409

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS   GPWD LFGG
Sbjct  410  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSIAGGPWDDLFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            GNLP FIVGAV+AAASGILA+T+LP P +D K+
Sbjct  469  GNLPGFIVGAVAAAASGILALTMLPSPPADAKL  501



>emb|CAQ58420.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  290  LNWIAWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  350  GKKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  409

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS   GPWD LFGG
Sbjct  410  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSIAGGPWDDLFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            GNLP FIVGAV+AAASGILA+T+LP P +D K+
Sbjct  469  GNLPGFIVGAVAAAASGILALTMLPSPPADAKL  501



>emb|CAQ58421.1| sucrose transporter [Nicotiana tabacum]
Length=509

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  290  LNWIAWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  350  GKKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  409

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS   GPWD LFGG
Sbjct  410  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSIAGGPWDDLFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            GNLP FIVGAV+AAASGILA+T+LP P +D K+
Sbjct  469  GNLPGFIVGAVAAAASGILALTMLPSPPADAKL  501



>ref|XP_009777676.1| PREDICTED: sucrose transport protein-like [Nicotiana sylvestris]
 dbj|BAO47334.1| sucrose transporter [Nicotiana tabacum]
Length=510

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  291  LNWIAWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  350

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  351  GKKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  410

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS   GPWD LFGG
Sbjct  411  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSIAGGPWDDLFGG  469

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLP FIVGAV+AAASGILA+T+LP P +D K
Sbjct  470  GNLPGFIVGAVAAAASGILALTMLPSPPADAK  501



>ref|XP_004496382.1| PREDICTED: sucrose transport protein-like [Cicer arietinum]
Length=523

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 174/210 (83%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +   YD GVRAGALGLML S+VLG  S+GV+++
Sbjct  303  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGRAYDMGVRAGALGLMLNSIVLGATSLGVDVM  362

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            AR +G VK LW  VNF+LAI LA+TV VTK A HSR+Y A G PL P   +KAGALA+F 
Sbjct  363  ARFVGGVKRLWGIVNFLLAICLAMTVLVTKLAEHSRQY-ADGQPLPPTGGIKAGALALFS  421

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQMFVS LSGPWDALFGG
Sbjct  422  VLGIPLAITYSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMFVSVLSGPWDALFGG  480

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGAV+A ASGIL+I LLP P  D
Sbjct  481  GNLPAFVVGAVAALASGILSIILLPSPPPD  510



>emb|CAA76369.1| sucrose/H+ symporter [Daucus carota]
Length=515

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF+L+DTDWM RE+YGG      LYD+GVRAGALGL+L SVVLG  SI VE L
Sbjct  295  LNWIAWFPFILFDTDWMGREIYGGTAGQGKLYDQGVRAGALGLLLNSVVLGLTSIAVEYL  354

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK+LW  VNFILAIGL +TV V+K A H R++ A+G  L P++ VKAGAL++F 
Sbjct  355  VRGVGGVKILWGFVNFILAIGLVMTVVVSKVAQHQREHSANGQLLPPSAGVKAGALSLFS  414

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPL++T+S+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS L+GP+D+LFGG
Sbjct  415  ILGIPLSITYSIPFALASIYSSGSGAGQ-GLSLGVLNLAIVVPQMIVSVLAGPFDSLFGG  473

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGA+SAA SG+LAI LLPKP  D
Sbjct  474  GNLPAFVVGAISAAISGVLAIVLLPKPSKD  503



>emb|CAC19689.1| sucrose/proton symporter [Daucus carota]
Length=515

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF+L+DTDWM RE+YGG      LYD+GVRAGALGL+L SVVLG  SI VE L
Sbjct  295  LNWIAWFPFILFDTDWMGREIYGGTAGKGKLYDQGVRAGALGLLLNSVVLGLTSIAVEYL  354

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK+LW  VNFILAIGL +TV V+K A H R++ A+G  L P++ VKAGAL++F 
Sbjct  355  VRGVGGVKILWGFVNFILAIGLVMTVVVSKVAQHQREHSANGQLLPPSAGVKAGALSLFS  414

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPL++T+S+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS L+GP+D+LFGG
Sbjct  415  ILGIPLSITYSIPFALASIYSSGSGAGQ-GLSLGVLNLAIVVPQMIVSVLAGPFDSLFGG  473

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGA+SAA SG+LAI LLPKP  D
Sbjct  474  GNLPAFVVGAISAAISGVLAIVLLPKPSKD  503



>dbj|BAA89458.1| sucrose transporter protein [Daucus carota]
Length=515

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF+L+DTDWM RE+YGG      LYD+GVRAG+LGL+L SVVLG  SI VE L
Sbjct  295  LNWIAWFPFILFDTDWMGREIYGGTAGKGKLYDQGVRAGSLGLLLNSVVLGLTSIAVEYL  354

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK+LW  VNFILAIGL +TV V+K A H R++ A+G  L P++ VKAGAL++F 
Sbjct  355  VRGVGGVKILWGVVNFILAIGLVMTVVVSKVAQHQREHSANGQLLPPSAGVKAGALSLFS  414

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPL++T+S+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS L+GP+D+LFGG
Sbjct  415  ILGIPLSITYSIPFALASIYSSGSGAGQ-GLSLGVLNLAIVVPQMIVSVLAGPFDSLFGG  473

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGA+SAA SG+LAI LLPKP  D
Sbjct  474  GNLPAFVVGAISAAISGVLAIVLLPKPSKD  503



>emb|CAA57727.1| sucrose transporter [Nicotiana tabacum]
Length=507

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIA FPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  288  LNWIARFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  347

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  348  GKKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  407

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS   GPWD LFGG
Sbjct  408  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSIAGGPWDDLFGG  466

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLP FIVGAV+AAASGILA+T+LP P +D K
Sbjct  467  GNLPGFIVGAVAAAASGILALTMLPSPPADAK  498



>gb|AAF04295.2|AF191025_1 sucrose transporter 1 [Alonsoa meridionalis]
Length=502

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWFPFLL+DTDWM +EVYGG+V +  LYDKGVR GALGLML SVVLG  S+GV++ 
Sbjct  281  LNWVAWFPFLLFDTDWMGKEVYGGKVGEGSLYDKGVRVGALGLMLNSVVLGVASLGVQVT  340

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG--HPLL--PNSSVKAGAL  349
            AR LG VK LW  VN +LAI LA+TV +TK A H R+Y + G   P L  P   VK GAL
Sbjct  341  ARGLGGVKRLWGSVNLLLAICLAMTVLITKMAQHHREYASVGGAAPTLQPPVHGVKIGAL  400

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F VLGIPLA TFS+PFALA IYSS++G+GQ GLSLGVLNLAIV+PQMFVS  SGPWDA
Sbjct  401  ALFSVLGIPLAATFSIPFALASIYSSNSGAGQ-GLSLGVLNLAIVIPQMFVSVASGPWDA  459

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            LFGGGNLPAF+VGAV+A  SGI+A+T LP P SD KI+
Sbjct  460  LFGGGNLPAFVVGAVAATVSGIIALTALPSPPSDVKIL  497



>gb|AAD45390.1|AF167415_1 sucrose transporter SUT2A [Apium graveolens]
 gb|AAD45391.1|AF167416_1 sucrose transporter SUT2B [Apium graveolens]
Length=512

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 172/210 (82%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF+L+DTDWM RE+YGG      LYD+GVR G+LGL+L SVVLG  SI VE L
Sbjct  292  LNWIAWFPFILFDTDWMGREIYGGTAGQGKLYDQGVRVGSLGLLLNSVVLGLTSIAVEYL  351

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK+LW  VNF+LAIGL +TV V+K A H R++ A+G  L P++ VKAGAL++F 
Sbjct  352  VRGVGGVKILWGLVNFLLAIGLVMTVVVSKVAQHQRQHGANGQLLPPSAGVKAGALSLFS  411

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPL++TFS+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS L+GP+D+LFGG
Sbjct  412  ILGIPLSITFSIPFALASIYSSGSGAGQ-GLSLGVLNLAIVVPQMIVSVLAGPFDSLFGG  470

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGA+SAA SG+LAI LLPKP  D
Sbjct  471  GNLPAFVVGAISAAISGVLAIVLLPKPSKD  500



>emb|CAB07811.1| sucrose transport protein [Vicia faba]
Length=523

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 172/214 (80%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +   YD GVR GALGLML SVVLG  S+GV++L
Sbjct  298  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGHAYDMGVREGALGLMLNSVVLGATSLGVDIL  357

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY----DAHGHPLLPNSSVKAGAL  349
            AR +G VK LW  VNF+LAI L LTV VTK A HSR+Y     A G PL P+  +KAGAL
Sbjct  358  ARGVGGVKRLWGIVNFLLAICLGLTVLVTKLAQHSRQYAPGTGALGDPLPPSEGIKAGAL  417

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F VLG+PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQMFVS LSGPWDA
Sbjct  418  TLFSVLGVPLAITYSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMFVSVLSGPWDA  476

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+A ASGIL+I LLP P  D
Sbjct  477  LFGGGNLPAFVVGAVAALASGILSIILLPSPPPD  510



>gb|AFM28284.1| SUT1-1 [Medicago truncatula]
 gb|KEH43584.1| sucrose proton symporter, putative [Medicago truncatula]
Length=525

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 174/212 (82%), Gaps = 3/212 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +   YDKGVRAGALGLML SVVLG  S+GV++L
Sbjct  302  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGHAYDKGVRAGALGLMLNSVVLGATSLGVDVL  361

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY-DA-HGHPLLPNSSVKAGALAI  355
            AR +G VK LW  VNF+LAI LA+TV VTK A HSR Y DA H  PL P+  + AGALA+
Sbjct  362  ARGVGGVKRLWGIVNFLLAICLAMTVLVTKLAQHSRVYADASHTDPLPPSGGITAGALAL  421

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLGIPLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS LSGPWDALF
Sbjct  422  FSVLGIPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSVLSGPWDALF  480

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GGGNLPAF+VGAV+A ASGIL++ LLP P  D
Sbjct  481  GGGNLPAFVVGAVAALASGILSVVLLPSPPPD  512



>gb|AAC99332.1| sucrose transporter [Apium graveolens]
Length=512

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 172/210 (82%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF+L+DTDWM RE+YGG      LYD+GVR G+LGL+L SVVLG  SI VE L
Sbjct  292  LNWIAWFPFILFDTDWMGREIYGGTAGQGKLYDQGVRVGSLGLLLNSVVLGLTSIAVEYL  351

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK+LW  VNF+LAIGL +TV V+K A H R++ A+G  L P++ VKAGAL++F 
Sbjct  352  VRGVGGVKILWGLVNFLLAIGLVMTVVVSKVAQHQRQHGANGQLLPPSAGVKAGALSLFS  411

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPL++TFS+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS L+GP+D+LFGG
Sbjct  412  ILGIPLSITFSIPFALASIYSSGSGAGQ-GLSLGVLNLAIVVPQMIVSVLAGPFDSLFGG  470

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGA+SAA SG+LAI LLPKP  D
Sbjct  471  GNLPAFVVGAISAAISGVLAIVLLPKPCKD  500



>gb|AAD41024.1| sucrose transport protein SUT1 [Pisum sativum]
Length=524

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +   YD GVRAGALGLML SVVLG  S+GV++L
Sbjct  299  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGHAYDMGVRAGALGLMLNSVVLGATSLGVDIL  358

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY----DAHGHPLLPNSSVKAGAL  349
            AR +G VK LW  VNF+LAI L LTV VTK A HSR+Y         PL P+  +KAGAL
Sbjct  359  ARGVGGVKRLWGIVNFLLAICLGLTVLVTKLAQHSRQYAPGTGGLQDPLPPSGGIKAGAL  418

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F VLGIPLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQMFVS LSGPWDA
Sbjct  419  TLFSVLGIPLAITYSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMFVSVLSGPWDA  477

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+A ASGIL++ LLP P  D
Sbjct  478  LFGGGNLPAFVVGAVAALASGILSMILLPSPPPD  511



>gb|AHA80795.2| sucrose transport protein 1 [Paeonia suffruticosa]
Length=519

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG---LYDKGVRAGALGLMLQSVVLGFMSIGV  172
            LNWIAWFPFLL+DTDWM REVYGG+V +     +YD GVRAG+LGLML SVVLGFMS+ V
Sbjct  297  LNWIAWFPFLLFDTDWMGREVYGGKVGEGSQGKMYDLGVRAGSLGLMLNSVVLGFMSLAV  356

Query  173  ELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALA  352
            E LAR+LG VK LW GVNF+LA+ LALTV +TK A   R+ +     L P + +KAGAL 
Sbjct  357  EFLARRLGGVKKLWGGVNFLLAVCLALTVLITKLAEAHRRLNGT-EALTPPAGIKAGALT  415

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF VLGIPLAVT+S+PFALA I+S+D+G+GQ GLSLGVLNL+IV+PQM VS  SGP+D +
Sbjct  416  IFSVLGIPLAVTYSIPFALASIFSNDSGAGQ-GLSLGVLNLSIVIPQMVVSVASGPFDQI  474

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGNLPAFIVGA+SAAASG+LAIT+LP P  +
Sbjct  475  FGGGNLPAFIVGAISAAASGVLAITMLPSPPPE  507



>ref|NP_001290021.1| sucrose transport protein [Beta vulgaris subsp. vulgaris]
 emb|CAA58730.1| sucrose/proton-symporter [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 169/219 (77%), Gaps = 10/219 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +   YD GV AGALGLM+ SVVLG MS+G+E L
Sbjct  302  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGKAYDMGVHAGALGLMINSVVLGIMSLGIEKL  361

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH------PLLPNSSVKAG  343
            AR +G VK LW  VN ILA+ LA+T+ VTK+A H   Y A  H      P LP   VK G
Sbjct  362  ARLVGGVKRLWGIVNLILAVCLAMTILVTKSAEH---YRATHHVPGAIGPPLPPPGVKGG  418

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALAIF VLGIPLA+TFS+PFALA I+S+ +GSGQ GLSLGVLNLAIVVPQMFVS  SGPW
Sbjct  419  ALAIFAVLGIPLAITFSIPFALASIFSASSGSGQ-GLSLGVLNLAIVVPQMFVSVTSGPW  477

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            DALFGGGNLPAF+VGAV+A AS IL+ TLLP P  + KI
Sbjct  478  DALFGGGNLPAFVVGAVAATASAILSFTLLPPPPPEAKI  516



>ref|XP_006589462.1| PREDICTED: sucrose transport protein [Glycine max]
Length=521

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 178/214 (83%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM REVYGG V +   YD+GVRAGALGLML SVVLG  S+GVE+L
Sbjct  296  LNWIAWFPFLLFDTDWMGREVYGGTVGEGKAYDRGVRAGALGLMLNSVVLGATSLGVEVL  355

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY----DAHGHPLLPNSSVKAGAL  349
            AR +G VK LW  VNF+LA+ LA+TV VTK A HSR+Y    +AH  PL P ++VKAGAL
Sbjct  356  ARGVGGVKRLWGIVNFLLAVCLAMTVLVTKMAQHSRQYTLLPNAHQEPLPPPAAVKAGAL  415

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS +SGPWDA
Sbjct  416  ALFSLLGIPLAITYSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMVVSVISGPWDA  474

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+AAASGIL+I LLP P  D
Sbjct  475  LFGGGNLPAFVVGAVAAAASGILSIILLPSPPPD  508



>gb|AAD53000.1|U64967_1 sucrose-proton symporter [Beta vulgaris]
Length=539

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 172/224 (77%), Gaps = 14/224 (6%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +   YD GV AGALGLM+ SVVLG MS+G+E L
Sbjct  303  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGKAYDMGVHAGALGLMINSVVLGIMSLGIEKL  362

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH------PLLPNSSVKAG  343
            AR +G VK LW  VN ILA+ LA+T+ VTK+A H   Y A  H      P LP    K G
Sbjct  363  ARLVGGVKRLWGIVNLILAVCLAMTILVTKSAEH---YRATHHVPGAIGPPLPPPGFKGG  419

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALAIF VLGIPLA+TFS+PFALA I+S+ +GSGQ GLSLGVLNLAIVVPQMFVS  SGPW
Sbjct  420  ALAIFSVLGIPLAITFSIPFALASIFSASSGSGQ-GLSLGVLNLAIVVPQMFVSVTSGPW  478

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLP----KPRSDGKIV  643
            DALFGGGNLPAF+VGAV+A AS IL+ TLLP    KP+S+G+ V
Sbjct  479  DALFGGGNLPAFVVGAVAATASAILSFTLLPSPHRKPKSEGQWV  522



>emb|CAA83436.1| sucrose carrier [Ricinus communis]
Length=533

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + +     LYD+GVRAGALGLML SVVLGF S+G
Sbjct  305  LNWIAWFPFLLFDTDWMGREVYGGDSSGSAEQLKLYDRGVRAGALGLMLNSVVLGFTSLG  364

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVK  337
            VE+LAR +G VK LW  VNF+LA+ LA+TV VTK A  +R++         PL P S VK
Sbjct  365  VEVLARGVGGVKRLWGIVNFVLAVCLAMTVLVTKQAESTRRFATVSGGAKVPLPPPSGVK  424

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGALA+F V+G+P A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  +G
Sbjct  425  AGALALFAVMGVPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMIVSVAAG  483

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            PWDALFGGGNLPAF+VGAV+A ASGI A+T+LP P+ D
Sbjct  484  PWDALFGGGNLPAFVVGAVAALASGIFALTMLPSPQPD  521



>ref|XP_008381009.1| PREDICTED: LOW QUALITY PROTEIN: sucrose transport protein-like 
[Malus domestica]
Length=508

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 168/205 (82%), Gaps = 9/205 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V    LYD GVR G+LGL+L SVVLGFMS+G+ELL
Sbjct  285  LNWIAWFPFLLFDTDWMGKEVYGGQVGKGQLYDLGVRVGSLGLLLNSVVLGFMSLGIELL  344

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVKAGAL  349
             R +G VK LW  VNF+LA+ LA+TV +TK A  SR    HGH    P  P +SVKAGAL
Sbjct  345  GRWVGGVKRLWAIVNFLLAVCLAMTVLITKLAEASR----HGHGGVEPPPPPASVKAGAL  400

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLAVT+S+PFALA I+SSD+G+GQ GLSLGVLNLAIV+PQMFVS +SGPWDA
Sbjct  401  SLFAVLGIPLAVTYSIPFALASIFSSDSGAGQ-GLSLGVLNLAIVLPQMFVSVVSGPWDA  459

Query  530  LFGGGNLPAFIVGAVSAAASGILAI  604
            LFGGGNLPAF+ GAV+A  SGILA+
Sbjct  460  LFGGGNLPAFVAGAVAAIVSGILAL  484



>gb|ABK60190.2| sucrose transporter 3 [Hevea brasiliensis]
Length=535

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 170/218 (78%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ N N     LYD+GVRAGALGLML SVVLGF S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSNGNPVQVRLYDRGVRAGALGLMLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVK  337
            VE+LAR +G VK LW  VNFIL+  L +T+ +TK A   R++   G     PL P   VK
Sbjct  364  VEVLARAVGGVKRLWGIVNFILSFCLFMTILITKMAESHRRFATVGGGATVPLPPPGDVK  423

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGALA+F V+G+P A+T+S+PFALA I+ + AG+GQ GLSLGVLNL+IV+PQM VS +SG
Sbjct  424  AGALALFAVMGVPQAITYSIPFALASIFCNTAGAGQ-GLSLGVLNLSIVIPQMVVSVVSG  482

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            PWDALFGGGNLPAF+VG V+AAASGI A TLLP P+ D
Sbjct  483  PWDALFGGGNLPAFVVGGVAAAASGIFAFTLLPSPQPD  520



>ref|XP_002526849.1| sucrose transport protein, putative [Ricinus communis]
 gb|EEF35584.1| sucrose transport protein, putative [Ricinus communis]
Length=533

 Score =   271 bits (693),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + +     LYD+GVRAGALGLML SVVLGF S+G
Sbjct  305  LNWIAWFPFLLFDTDWMGREVYGGDSSGSAEQLKLYDRGVRAGALGLMLNSVVLGFTSLG  364

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVK  337
            VE+LAR +G VK LW  VNF+LA+ LA+TV VTK A  ++++         PL P S VK
Sbjct  365  VEVLARGVGGVKRLWGIVNFVLAVCLAMTVLVTKQAESTKRFATVSGGAKVPLPPPSGVK  424

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGALA+F V+G+P A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  +G
Sbjct  425  AGALALFAVMGVPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMIVSVAAG  483

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            PWDALFGGGNLPAF+VGAV+A ASGI A+T+LP P+ D
Sbjct  484  PWDALFGGGNLPAFVVGAVAALASGIFALTMLPSPQPD  521



>emb|CAM34330.1| sucrose transporter 6 [Hevea brasiliensis]
Length=535

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 169/218 (78%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ N N     LYD+GVRAGALGLML SVVLGF S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSNGNPDQVRLYDRGVRAGALGLMLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVK  337
            VE+LAR +G VK LW  VNFIL+  L +T+ +TK A   R++   G     PL P   VK
Sbjct  364  VEVLARAVGGVKRLWGIVNFILSFCLFMTILITKMAESHRRFATVGGGATVPLPPPGDVK  423

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGALA+F V+G+P A+T+S+PFALA I+ + AG+GQ GLSLGVLNL+IV+PQM VS  SG
Sbjct  424  AGALALFAVMGVPQAITYSIPFALASIFCNTAGAGQ-GLSLGVLNLSIVIPQMVVSVASG  482

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            PWDALFGGGNLPAF+VG V+AAASGI A TLLP P+ D
Sbjct  483  PWDALFGGGNLPAFVVGGVAAAASGIFAFTLLPSPQPD  520



>ref|NP_001236298.1| sucrose transporter [Glycine max]
 emb|CAD91334.1| sucrose transporter [Glycine max]
Length=520

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM REVY G V +   YD+GVRAGALGLML SVVLG  S+GVE+L
Sbjct  295  LNWIAWFPFLLFDTDWMGREVYEGTVGEGKAYDRGVRAGALGLMLNSVVLGATSLGVEVL  354

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY----DAHGHPLLPNSSVKAGAL  349
            AR +G VK LW  VNF+LA+ LA+TV VTK A HSR+Y    +AH  PL P ++VKAGAL
Sbjct  355  ARGVGGVKRLWGIVNFLLAVCLAMTVLVTKMAQHSRQYTLLPNAHQEPLPPPAAVKAGAL  414

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS +SGPWDA
Sbjct  415  ALFSLLGIPLAITYSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMVVSVISGPWDA  473

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+AAASGIL+I LLP P  D
Sbjct  474  LFGGGNLPAFVVGAVAAAASGILSIILLPSPPPD  507



>sp|Q03411.1|SUT_SPIOL RecName: Full=Sucrose transport protein; AltName: Full=Sucrose 
permease; AltName: Full=Sucrose-proton symporter [Spinacia 
oleracea]
 emb|CAA47604.1| sucrose permease [Spinacia oleracea]
Length=525

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 171/219 (78%), Gaps = 10/219 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +  LYD+GV AGALGLM+ SVVLG MS+ +E L
Sbjct  304  LNWIAWFPFLLFDTDWMGKEVYGGTVGEGKLYDQGVHAGALGLMINSVVLGVMSLSIEGL  363

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPL------LPNSSVKAG  343
            AR +G  K LW  VN ILA+ LA+TV VTK+A H R  D+H H +       P + VK G
Sbjct  364  ARMVGGAKRLWGIVNIILAVCLAMTVLVTKSAEHFR--DSH-HIMGSAVPPPPPAGVKGG  420

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALAIF VLGIPLA+TFS+PFALA I+S+ +GSGQ GLSLGVLNLAIVVPQMFVS  SGPW
Sbjct  421  ALAIFAVLGIPLAITFSIPFALASIFSASSGSGQ-GLSLGVLNLAIVVPQMFVSVTSGPW  479

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            DA+FGGGNLPAF+VGAV+A AS +L+ TLLP P  + KI
Sbjct  480  DAMFGGGNLPAFVVGAVAATASAVLSFTLLPSPPPEAKI  518



>gb|ACX33146.1| sucrose transporter 1 [Verbascum phoeniceum]
Length=511

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 175/218 (80%), Gaps = 4/218 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM REVYGG+V +  LYD GVRAGALGLML SVVLG  S+GV+ +
Sbjct  290  LNWIAWFPFLLFDTDWMGREVYGGKVGEGSLYDHGVRAGALGLMLNSVVLGAASLGVQFV  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG---HPLLPNSSVKAGALA  352
            AR +G VK LW GVNF+LAI LA+TV +TK A ++R+Y   G     L P S VK GALA
Sbjct  350  ARSVGGVKKLWGGVNFLLAICLAMTVLITKLAENNRRYAVVGGVTTLLAPVSGVKIGALA  409

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            +F VLGIPLA TFS+PFALA IYSS++G+GQ GLSLGVLNLAIVVPQM VS  SGPWD L
Sbjct  410  LFAVLGIPLAATFSIPFALASIYSSNSGAGQ-GLSLGVLNLAIVVPQMIVSVASGPWDDL  468

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVI  646
            FGGGNLPAF+VGAV+AAASGI A T+LP P SD K V+
Sbjct  469  FGGGNLPAFVVGAVAAAASGIFAFTMLPSPPSDAKPVV  506



>ref|XP_007201709.1| hypothetical protein PRUPE_ppa004033mg [Prunus persica]
 gb|EMJ02908.1| hypothetical protein PRUPE_ppa004033mg [Prunus persica]
Length=534

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 165/215 (77%), Gaps = 6/215 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWFPFLL+DTDWM REVYGG+V    LYD GVRAGALGLML +VVLGFMS+ +E L
Sbjct  306  LNWVAWFPFLLFDTDWMGREVYGGQVGKGRLYDLGVRAGALGLMLNAVVLGFMSLAIEPL  365

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSR-----KYDAHGHPLLPNSSVKAGA  346
             R +G VK LW  VNF+LAI LA+TV +TK A  SR            P  P + VKAGA
Sbjct  366  GRWVGGVKRLWGIVNFLLAICLAMTVLITKLAQSSRHAAIAAGHGGAEPPPPTAGVKAGA  425

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F VLGIP AVTFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQMFVS  SGPWD
Sbjct  426  LTLFAVLGIPQAVTFSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMFVSVTSGPWD  484

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             LFGGGNLPAFI GA++A ASG+LA+ +LP P +D
Sbjct  485  DLFGGGNLPAFIAGAIAAVASGVLALFMLPSPPAD  519



>ref|XP_009348838.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=508

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V    LYD GVR G+LGL+L SVVLGFMS+G+ELL
Sbjct  285  LNWIAWFPFLLFDTDWMGKEVYGGQVGKGRLYDLGVRVGSLGLLLNSVVLGFMSLGIELL  344

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK LW  VNF+LA+ LA+TV +TK A  SR     G P  P +SVKAGAL++F 
Sbjct  345  GRWVGGVKRLWAIVNFLLAVCLAMTVLITKLAEASRHGHGGGEPPPPPASVKAGALSLFA  404

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVT+S+PFALA I+SSD+G+GQ GLSLGVLNLAIV+PQMFVS +SGPWDALFGG
Sbjct  405  VLGIPLAVTYSIPFALASIFSSDSGAGQ-GLSLGVLNLAIVLPQMFVSVVSGPWDALFGG  463

Query  542  GNLPAFIVGAVSAAASGILAI  604
            GNLPAF+ GAV+A  SGILA+
Sbjct  464  GNLPAFVAGAVAAIVSGILAL  484



>ref|XP_007143634.1| hypothetical protein PHAVU_007G088200g [Phaseolus vulgaris]
 gb|ESW15628.1| hypothetical protein PHAVU_007G088200g [Phaseolus vulgaris]
Length=521

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM  EVYGG V +   YD+GVRAGALGLML S+VLG  S+GV++L
Sbjct  296  LNWIAWFPFLLFDTDWMGHEVYGGTVGEGNAYDRGVRAGALGLMLNSLVLGATSLGVDVL  355

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY----DAHGHPLLPNSSVKAGAL  349
            AR +G VK LW  VNF+LAI LA+TV +TK A HSR+Y    + H  PL P S VKAGAL
Sbjct  356  ARGVGGVKRLWGIVNFLLAICLAMTVLITKMAQHSRQYTVLPNGHQEPLPPPSGVKAGAL  415

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F VLG+PLA+T+S+PFALA I+S+ +G+GQ GLSLGVLNLAIV+PQM VS +SGPWDA
Sbjct  416  ALFSVLGVPLAITYSIPFALASIFSTTSGAGQ-GLSLGVLNLAIVIPQMVVSVISGPWDA  474

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+AAASGIL+I LLP P  D
Sbjct  475  LFGGGNLPAFVVGAVAAAASGILSIILLPSPPPD  508



>ref|XP_011097249.1| PREDICTED: sucrose transport protein SUC2-like [Sesamum indicum]
Length=506

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWFPFLL+DTDWM REVYGGEV    LYD GVRAGALGLM+ S+VLG  S+GV+ L
Sbjct  288  LNWVAWFPFLLFDTDWMGREVYGGEVGTK-LYDHGVRAGALGLMINSIVLGLASLGVQFL  346

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            AR+   VK LW  VNF+LAI LA+TV +TK A   R       P  P   +K GALA+F 
Sbjct  347  ARRPRRVKKLWGAVNFLLAICLAMTVLITKLAERGRPASGATAP--PAVGIKVGALALFA  404

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAVT+S+PFALA I+SS++GSGQ GLSLGVLNLAIV+PQM VS  SGPWD LFGG
Sbjct  405  VLGIPLAVTYSIPFALASIFSSNSGSGQ-GLSLGVLNLAIVIPQMVVSVASGPWDELFGG  463

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGA++AA SGIL++ +LP P  D
Sbjct  464  GNLPAFVVGAIAAAVSGILSLVMLPSPPDD  493



>ref|NP_001289830.1| sucrose transport protein [Solanum lycopersicum]
 dbj|BAO96213.1| sucrose transporter 1 [Solanum lycopersicum]
Length=511

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EV+GG+V D  LYD GVRAGALGL+LQSVVLGFMS+GVE L
Sbjct  292  LNWIAWFPFFLYDTDWMAKEVFGGQVGDAKLYDLGVRAGALGLLLQSVVLGFMSLGVEFL  351

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G  K LW  +NF+LAI LA+T+ VTK A  SR++DA G  + P   VK GAL +F 
Sbjct  352  GKKIGGAKRLWGILNFVLAICLAMTILVTKMAEKSRRHDAAGTLMGPTPGVKIGALLLFA  411

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
             LGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS + GPWD LFGG
Sbjct  412  ALGIPLAVTFSIPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSLVGGPWDDLFGG  470

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLP F+VGAV+AAASG+LA+T+LP P +D K
Sbjct  471  GNLPGFVVGAVAAAASGVLALTMLPSPPADAK  502



>ref|XP_010063792.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 ref|XP_010063793.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 ref|XP_010063795.1| PREDICTED: putative sucrose transport protein SUC6 [Eucalyptus 
grandis]
 gb|KCW71043.1| hypothetical protein EUGRSUZ_F04144 [Eucalyptus grandis]
Length=513

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM RE+YGG+VN   LY  GVRAG+LGLML SVV GFMS+ +E L
Sbjct  287  LNWIAWFPFLLFDTDWMGREIYGGKVNKGRLYAMGVRAGSLGLMLNSVVSGFMSLALEYL  346

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY----DAHGHPLLPNSSVKAGAL  349
             R  G VK LW  VNF+LA+ L LTV VTK A   R +      +G  L P++ +KAGAL
Sbjct  347  VRGPGGVKRLWGAVNFLLALCLGLTVLVTKLAQSERTFATATPGNGEALPPSAGIKAGAL  406

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F VLGIPLAVT+S+PFALA I+S+ AG+GQ GLSLGVLNLAIVVPQM +S  SGP+D 
Sbjct  407  LLFAVLGIPLAVTYSVPFALASIFSNTAGAGQ-GLSLGVLNLAIVVPQMVISVTSGPFDD  465

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGAV+AA SGILA+TLLP P  +
Sbjct  466  LFGGGNLPAFIVGAVAAAVSGILALTLLPSPAPE  499



>ref|XP_009339088.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=512

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 168/209 (80%), Gaps = 13/209 (6%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V    LYD GVR G+LGL+L SVVLGFMS+G+ELL
Sbjct  285  LNWIAWFPFLLFDTDWMGKEVYGGQVGKGRLYDLGVRVGSLGLLLNSVVLGFMSLGIELL  344

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH--------PLLPNSSVK  337
             R +G VK LW  VNF+LA+ LA+TV +TK A  SR    HGH        P  P +SVK
Sbjct  345  GRWVGGVKRLWAIVNFLLAVCLAMTVLITKLAEASR----HGHGAGPGGAAPPPPPASVK  400

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGAL++F VLGIPLAVT+S+PFALA I+SSD+G+GQ GLSLGVLNLAIV+PQMFVS +SG
Sbjct  401  AGALSLFAVLGIPLAVTYSIPFALASIFSSDSGAGQ-GLSLGVLNLAIVLPQMFVSVVSG  459

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAI  604
            PWDALFGGGNLPAF+ GAV+A  SGILA+
Sbjct  460  PWDALFGGGNLPAFVAGAVAAIVSGILAL  488



>gb|AHB33871.1| sucrose transporter [Quercus robur]
Length=500

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 167/216 (77%), Gaps = 11/216 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
             NWIAWFPFLL+DTDWM REV+GG+    G    LY+ GVR GALGLML SVVLGF S+G
Sbjct  275  FNWIAWFPFLLFDTDWMGREVFGGDATAKGKLLDLYNVGVRTGALGLMLNSVVLGFTSLG  334

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPL--LPNSSVKAG  343
            VE LAR +G VK LW   NF+LA  LA+TV VTK A  +R    +GHP+   P   +KAG
Sbjct  335  VEHLARGVGGVKRLWAIANFLLAACLAMTVLVTKLAEKAR----NGHPVATTPPGGIKAG  390

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALA+F VLG+P AVT+S+PFALA I+SS +G+GQ GLSLGVLNL+IVVPQM VS  SGPW
Sbjct  391  ALALFAVLGVPQAVTYSIPFALASIFSSTSGAGQ-GLSLGVLNLSIVVPQMIVSVTSGPW  449

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D+LFGGGNLPAF+VGA++AA SGILA+T+LP P  D
Sbjct  450  DSLFGGGNLPAFVVGAIAAAISGILALTMLPSPPPD  485



>gb|ADW78350.1| sucrose proton symporter 2 [Rosa hybrid cultivar]
Length=513

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 167/213 (78%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWFPFLL+DTDWM REVYGGEV    LY  GVRAGALGLML SVVLG +S+G+E+L
Sbjct  287  LNWVAWFPFLLFDTDWMGREVYGGEVGKGRLYALGVRAGALGLMLNSVVLGCVSLGIEIL  346

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKAGALA  352
            AR LG VK LW  VNF+LAI LA+TV +TK A  +R +        P  P + +KAGALA
Sbjct  347  ARALGGVKRLWGVVNFLLAICLAMTVLITKLAQSTRHHAVVSTGAEPPPPPAGIKAGALA  406

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF VLGIP A+T+S+PFALA I+ S++G+GQ GLSLGVLNLAIVVPQM VS  SGPWDAL
Sbjct  407  IFAVLGIPQAITYSVPFALASIFCSNSGAGQ-GLSLGVLNLAIVVPQMVVSVASGPWDAL  465

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGNLPAF+VGA++A  SGILA+ +LP P  D
Sbjct  466  FGGGNLPAFVVGAIAAVFSGILALFMLPSPPPD  498



>gb|AAF04294.1|AF191024_1 sucrose transporter 1 [Asarina barclaiana]
Length=510

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 168/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG V +  +YD+GVRAGALGLML  VVLGF S+G++ +
Sbjct  286  LNWIAWFPFLLFDTDWMGKEVYGGTVAEGKMYDRGVRAGALGLMLNPVVLGFSSLGIQAI  345

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLL--PNSSVKAGAL  349
            AR +G  K LW GVNF+LA+ LALTV +TK A HSR Y   A G  +L  P   VK  AL
Sbjct  346  ARGVGGPKRLWGGVNFLLAVCLALTVVITKQAEHSRLYTVGADGVQILLPPVPGVKISAL  405

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+  VLGIPLAVTFS+PFALA IYSS+ G+GQ GLSLGVLNLAIV+PQM VS  SGP DA
Sbjct  406  ALSGVLGIPLAVTFSIPFALASIYSSNYGAGQ-GLSLGVLNLAIVIPQMVVSVASGPLDA  464

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGN+PAF++GAV+AA SGI A+T+LP   +D
Sbjct  465  LFGGGNIPAFVMGAVAAAVSGIFAVTMLPALPAD  498



>ref|NP_177334.1| sucrose transport protein SUC5 [Arabidopsis thaliana]
 sp|Q9C8X2.1|SUC5_ARATH RecName: Full=Sucrose transport protein SUC5; AltName: Full=Sucrose 
permease 5; AltName: Full=Sucrose-proton symporter 5 
[Arabidopsis thaliana]
 gb|AAG52226.1|AC021665_9 putative sucrose transport protein; 30830-32911 [Arabidopsis 
thaliana]
 gb|AEE35248.1| sucrose transport protein SUC5 [Arabidopsis thaliana]
Length=512

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 170/215 (79%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG----EVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            +NWIAWFPF+LYDTDWM REVYGG    +     LYD+GV+AGALGLM  S++LGF+S+G
Sbjct  291  INWIAWFPFILYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL-PNSSVKAGA  346
            VE + R++G  K LW  VNFILAIGLA+TV VTK+A H R+      PL  P+S +KAG 
Sbjct  351  VESIGRKMGGAKRLWGCVNFILAIGLAMTVLVTKSAEHHREIAG---PLAGPSSGIKAGV  407

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
             ++F VLGIPLA+T+S+PFALA I+S+++G+GQ GLSLGVLN+AI +PQM VSF SGP D
Sbjct  408  FSLFTVLGIPLAITYSIPFALASIFSTNSGAGQ-GLSLGVLNIAICIPQMIVSFSSGPLD  466

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            A FGGGNLP+F+VGA++AA SG+LA+T+LP P  D
Sbjct  467  AQFGGGNLPSFVVGAIAAAVSGVLALTVLPSPPPD  501



>emb|CAC19851.1| sucrose trasporter [Arabidopsis thaliana]
Length=509

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 170/215 (79%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG----EVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            +NWIAWFPF+LYDTDWM REVYGG    +     LYD+GV+AGALGLM  S++LGF+S+G
Sbjct  291  INWIAWFPFILYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL-PNSSVKAGA  346
            VE + R++G  K LW  VNFILAIGLA+TV VTK+A H R+      PL  P+S +KAG 
Sbjct  351  VESIGRKMGGAKRLWGCVNFILAIGLAMTVLVTKSAEHHREIAG---PLAGPSSGIKAGV  407

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
             ++F VLGIPLA+T+S+PFALA I+S+++G+GQ GLSLGVLN+AI +PQM VSF SGP D
Sbjct  408  FSLFTVLGIPLAITYSIPFALASIFSTNSGAGQ-GLSLGVLNIAICIPQMIVSFSSGPLD  466

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            A FGGGNLP+F+VGA++AA SG+LA+T+LP P  D
Sbjct  467  AQFGGGNLPSFVVGAIAAAISGVLALTVLPSPPPD  501



>ref|XP_006351170.1| PREDICTED: sucrose transport protein-like [Solanum tuberosum]
Length=515

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 172/212 (81%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EV+GG+V D  LYD GVRAGA+GL+LQSVVLGFMS+GVE L
Sbjct  296  LNWIAWFPFFLYDTDWMAKEVFGGQVGDARLYDLGVRAGAMGLLLQSVVLGFMSLGVEFL  355

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G  K LW  +NF+LAI LALT+ VTK A  SR++D  G  + P   VK GAL +F 
Sbjct  356  GKKIGGAKRLWGILNFVLAICLALTILVTKMAEKSRQHDPSGTLMGPTPGVKIGALLLFA  415

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
             LGIPLA TFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM VS + GPWD LFGG
Sbjct  416  ALGIPLAATFSIPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQMLVSLVGGPWDDLFGG  474

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLP F+VGAV+AAASG+LA+T+LP P +D K
Sbjct  475  GNLPGFVVGAVAAAASGVLALTMLPSPPADAK  506



>gb|EYU22864.1| hypothetical protein MIMGU_mgv1a004602mg [Erythranthe guttata]
Length=518

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V +  LYDKGVRAGALGLML SVVLG  S+ V+ L
Sbjct  292  LNWIAWFPFLLFDTDWMGKEVYGGKVGEGNLYDKGVRAGALGLMLNSVVLGLASLSVQFL  351

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLL-PNSSVKAGAL  349
            AR LG VK LW  VNF+LA+ LA+TV VTK A H+R+Y   +A    L+ P + V+ GAL
Sbjct  352  ARGLGGVKRLWGLVNFLLAVCLAMTVLVTKMAQHTRRYVGDEATAATLMQPVAGVRIGAL  411

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F VLGIPLA+T+S+PFALA I+SS++G+GQ GLSLGVLNLAIV+PQM VS  SGPWD 
Sbjct  412  ALFAVLGIPLAITYSIPFALASIFSSNSGAGQ-GLSLGVLNLAIVIPQMVVSVASGPWDD  470

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+AAASGI A+T+LP P SD
Sbjct  471  LFGGGNLPAFVVGAVAAAASGIFALTMLPSPPSD  504



>ref|XP_010471204.1| PREDICTED: sucrose transport protein SUC1 [Camelina sativa]
Length=514

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY  GV++GA+GLM  S+VLGFMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILA GLA+TV VTK A   RK    G    P+S +KAGAL
Sbjct  352  VEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKLADDHRK--TAGQLAGPSSGIKAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  410  SLFAVLGIPLAITFSTPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPAFIVGAIAAAISGVLALTVLPSPPPD  502



>ref|XP_006302149.1| hypothetical protein CARUB_v10020153mg [Capsella rubella]
 gb|EOA35047.1| hypothetical protein CARUB_v10020153mg [Capsella rubella]
Length=514

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY  GV++GA+GLM  S+VLGFMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILA GLA+TV VTK A   RK    G    P+SS+KAGAL
Sbjct  352  VEWIGRKLGGAKRLWGLVNFILAAGLAMTVLVTKYAEDHRK--VAGELAGPSSSIKAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS PFALA I+SS  G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  410  SLFAVLGIPLAITFSTPFALASIFSSCTGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPAFIVGAIAAAISGVLALTVLPSPPPD  502



>ref|XP_007020260.1| Sucrose-proton symporter 2 isoform 2 [Theobroma cacao]
 gb|EOY17485.1| Sucrose-proton symporter 2 isoform 2 [Theobroma cacao]
Length=566

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 170/217 (78%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   N L    Y++GVRAGALGLML SVVLGF S+G
Sbjct  339  LNWIAWFPFLLFDTDWMGREVYGGDSQGNNLVLRLYNRGVRAGALGLMLNSVVLGFTSLG  398

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VELLAR +G VK LW  +NF+ A  LA+TV VTK A  +R++   D    PL P + VKA
Sbjct  399  VELLARGVGGVKRLWGIINFLHAFCLAMTVLVTKLAKSNRRFATMDGVTVPLPPGAGVKA  458

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GAL++F  LGIPLAVT+S+PFALA I+SS +G+GQ GLSLGVLNL IV+PQ+ VS  SGP
Sbjct  459  GALSLFAALGIPLAVTYSIPFALASIFSSSSGAGQ-GLSLGVLNLGIVMPQILVSLGSGP  517

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            +DA+FGGGNLPAF++GA +AAASGI A+T+LP P  D
Sbjct  518  FDAIFGGGNLPAFVLGAFAAAASGIFALTMLPSPPPD  554



>ref|XP_010415904.1| PREDICTED: sucrose transport protein SUC1-like [Camelina sativa]
Length=515

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY  GV++GA+GLM  S+VLGFMS+G
Sbjct  293  LNWIAWFPFLLFDTDWMGREVYGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLG  352

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILA GLA+TV VTK A   RK    G    P+S +KAGAL
Sbjct  353  VEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKLADDHRK--TAGQLAGPSSGIKAGAL  410

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  411  SLFAVLGIPLAITFSTPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  469

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LA+T+LP P  D
Sbjct  470  LFGGGNLPAFIVGAIAAAISGVLALTVLPSPPPD  503



>ref|XP_002862880.1| hypothetical protein ARALYDRAFT_497263 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39139.1| hypothetical protein ARALYDRAFT_497263 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            +NWIAWFPFLLYDTDWM REVYGG  + N     LYD+GV+AGALGLM  S++LGF+S+G
Sbjct  290  INWIAWFPFLLYDTDWMGREVYGGNSDGNEQAKKLYDQGVQAGALGLMFNSILLGFVSLG  349

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILAIGLA+TV VT++A + RK    G    P+S +KAG  
Sbjct  350  VESIGRKMGGAKRLWGCVNFILAIGLAMTVLVTQSADNHRK--TAGALSGPSSGIKAGVF  407

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+T+S+PFALA I+S+++G+GQ GLSLGVLN+AI +PQM VSF SGP DA
Sbjct  408  SLFTVLGIPLAITYSVPFALASIFSTNSGAGQ-GLSLGVLNIAICIPQMIVSFSSGPLDA  466

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             FGGGNLP+F+VGA++AA SG+LA+T+LP P +D
Sbjct  467  HFGGGNLPSFVVGAIAAAISGVLALTVLPSPPAD  500



>ref|XP_002887397.1| hypothetical protein ARALYDRAFT_476315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63656.1| hypothetical protein ARALYDRAFT_476315 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            +NWIAWFPFLLYDTDWM REVYGG  + N     LYD+GV+AGALGLM  S++LGF+S+G
Sbjct  290  INWIAWFPFLLYDTDWMGREVYGGNSDGNEQAKKLYDQGVQAGALGLMFNSILLGFVSLG  349

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILAIGLA+TV VT++A + RK    G    P+S +KAG  
Sbjct  350  VESIGRKMGGAKRLWGCVNFILAIGLAMTVLVTQSADNHRK--TAGALSGPSSGIKAGVF  407

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+T+S+PFALA I+S+++G+GQ GLSLGVLN+AI +PQM VSF SGP DA
Sbjct  408  SLFTVLGIPLAITYSVPFALASIFSTNSGAGQ-GLSLGVLNIAICIPQMIVSFSSGPLDA  466

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             FGGGNLP+F+VGA++AA SG+LA+T+LP P +D
Sbjct  467  HFGGGNLPSFVVGAIAAAISGVLALTVLPSPPAD  500



>ref|XP_009127880.1| PREDICTED: sucrose transport protein SUC1 [Brassica rapa]
Length=513

 Score =   261 bits (666),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 170/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +     +Y+KGV++GALGLM  S+VLGFMS+G
Sbjct  291  LNWIAWFPFLLFDTDWMGREVYGGDSEGDARLKQIYNKGVQSGALGLMFNSIVLGFMSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + +++G  K LW  VNFILAIGLA+TV VTK A+  RK    G    P+  ++AGAL
Sbjct  351  VEWIGKKVGGAKRLWGIVNFILAIGLAMTVLVTKLAADYRK--GAGPYAGPSPGIRAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  409  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LAIT+LP P  D
Sbjct  468  LFGGGNLPAFIVGAIAAAISGVLAITVLPSPPPD  501



>gb|AAL58071.1| sucrose transporter SUC1 [Brassica oleracea]
 gb|AEG89530.1| sucrose transporter [Brassica napus]
 emb|CDX82207.1| BnaC02g20830D [Brassica napus]
Length=513

 Score =   261 bits (666),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 170/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +     +Y+KGV++GALGLM  S+VLGFMS+G
Sbjct  291  LNWIAWFPFLLFDTDWMGREVYGGDSEGDARLKQIYNKGVQSGALGLMFNSIVLGFMSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + +++G  K LW  VNFILAIGLA+TV VTK A+  RK    G    P+  ++AGAL
Sbjct  351  VEWIGKKVGGAKRLWGIVNFILAIGLAMTVLVTKLAADYRK--VAGPYAGPSPGIRAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  409  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LAIT+LP P  D
Sbjct  468  LFGGGNLPAFIVGAIAAAISGVLAITVLPSPPPD  501



>emb|CAA48915.1| sucrose transport protein [Solanum tuberosum]
Length=516

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 170/212 (80%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPF LYDTDWMA+EV+GG+V D  LYD GVRAGA+GL+LQSVVLGFMS+GVE L
Sbjct  296  LNWIAWFPFFLYDTDWMAKEVFGGQVGDARLYDLGVRAGAMGLLLQSVVLGFMSLGVEFL  355

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G  K LW  +NF+LAI LA+T+ VTK A  SR++D  G  + P   VK GAL +F 
Sbjct  356  GKKIGGAKRLWGILNFVLAICLAMTILVTKMAEKSRQHDPAGTLMGPTPGVKIGALLLFA  415

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
             LGIPLA TFS+PFALA I+SS+ GSGQ GLSLGVLNLAIVVPQM VS + GPWD LFGG
Sbjct  416  ALGIPLAATFSIPFALASIFSSNRGSGQ-GLSLGVLNLAIVVPQMLVSLVGGPWDDLFGG  474

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLP F+VGAV+AAAS +LA+T+LP P +D K
Sbjct  475  GNLPGFVVGAVAAAASAVLALTMLPSPPADAK  506



>emb|CDY03675.1| BnaA02g15620D [Brassica napus]
Length=513

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 170/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +     +Y+KGV++GALGLM  S+VLGFMS+G
Sbjct  291  LNWIAWFPFLLFDTDWMGREVYGGDSEGDARLKQIYNKGVQSGALGLMFNSIVLGFMSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + +++G  K LW  VNFILAIGLA+TV VTK A+  RK    G    P+  ++AGAL
Sbjct  351  VEWIGKKVGGAKRLWGIVNFILAIGLAMTVLVTKLAADYRK--VAGPYAGPSPGIRAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  409  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LAIT+LP P  D
Sbjct  468  LFGGGNLPAFIVGAIAAAISGVLAITVLPSPPPD  501



>ref|XP_010428037.1| PREDICTED: sucrose transport protein SUC1-like [Camelina sativa]
Length=515

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 168/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY  GV++GA+GLM  S+VLGFMS+G
Sbjct  293  LNWIAWFPFLLFDTDWMGREVYGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLG  352

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA GLA+TV VTK A+  R  +  G    P+S +KAGAL
Sbjct  353  VEWIGRKIGGAKRLWGIVNFILAAGLAMTVLVTKLANDHR--ETAGQLAGPSSGIKAGAL  410

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  411  SLFAVLGIPLAITFSTPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  469

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIVGA++AA SG+LA+T+LP P  D
Sbjct  470  LFGGGNLPAFIVGAIAAAISGVLALTVLPSPPPD  503



>ref|XP_010521130.1| PREDICTED: LOW QUALITY PROTEIN: sucrose transport protein SUC2-like 
[Tarenaya hassleriana]
Length=508

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 164/216 (76%), Gaps = 9/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG+ + N       LY+ GVR GALGLML ++VLGFMS
Sbjct  284  LNWIAWFPFLLFDTDWMGREVYGGDSDANADAVSKKLYNAGVRMGALGLMLNAIVLGFMS  343

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A   R+  A G  + P   V+AG
Sbjct  344  LGVEWVGRKMGGAKRLWGVVNFILAICLAMTVLVTKQAEAHRR--AVGEDVPPTGDVRAG  401

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL IF VLGIP A+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+
Sbjct  402  ALTIFAVLGIPQAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMVVSLGGGPF  460

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D +FGGGNLP F+VGA++AA SG+LA T+LP P  D
Sbjct  461  DEMFGGGNLPGFVVGAIAAAGSGVLAFTVLPSPPPD  496



>ref|XP_011038161.1| PREDICTED: sucrose transport protein SUC8-like [Populus euphratica]
Length=531

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 176/217 (81%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GVRAGALGL+L SVVLGF S+G
Sbjct  301  LNWVAWFPFLLFDTDWMGREVYGGDSSRNADKLKMYDRGVRAGALGLLLNSVVLGFTSLG  360

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE+LAR +G VK LW  VNFILAI LA+T+ +TK A  +R+Y   +   H L P+S VKA
Sbjct  361  VEVLARGVGGVKRLWGIVNFILAICLAMTILITKVAQSNRRYTTVNGGTHLLPPSSGVKA  420

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFA+A I+SS +G+GQ GLSLGVLNL++V+PQM VS  +GP
Sbjct  421  GALALFAVMGIPQAITYSIPFAMASIFSSTSGAGQ-GLSLGVLNLSVVIPQMVVSVAAGP  479

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+VGAV+AAASGILA T+LP P  D
Sbjct  480  WDALFGGGNLPAFVVGAVAAAASGILAFTMLPSPPPD  516



>ref|XP_002893246.1| sucrose-proton symporter 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69505.1| sucrose-proton symporter 2 [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 167/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG+ +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  283  LNWIAWFPFLLFDTDWMGREVYGGDSDAKATAVAKKLYNDGVRAGALGLMLNAIVLGFMS  342

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  343  LGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRR-DHGGAKTGPPGNVTAG  401

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  402  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  460

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SG+LA+T+LP P  D
Sbjct  461  DELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPD  496



>emb|CDY36675.1| BnaCnng07770D [Brassica napus]
Length=514

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +     LY+KGV AGALGLMLQS+VL FMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGDSGGDDRMVKLYNKGVHAGALGLMLQSIVLLFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE   R++G  K LW  VNFILAIGLA+TV ++K A   RK    G    P+S V+AGAL
Sbjct  352  VEWTGRKVGGAKRLWGIVNFILAIGLAMTVLISKQAEEHRK--TAGEFARPSSGVRAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLS+GVLNLAIV+PQM VS   G +DA
Sbjct  410  SLFAVLGIPLAITFSIPFALASIFSNSSGAGQ-GLSIGVLNLAIVIPQMIVSLGGGSFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLP F+VGA++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPVFVVGAIAAAISGVLALTVLPSPPPD  502



>ref|XP_006301807.1| hypothetical protein CARUB_v10022273mg [Capsella rubella]
 gb|EOA34705.1| hypothetical protein CARUB_v10022273mg [Capsella rubella]
Length=513

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 170/215 (79%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            +NWIAWFPF+LYDTDWM REV+GG  N N     LY++GV +GALGLM  S++LGF+S+G
Sbjct  292  INWIAWFPFILYDTDWMGREVFGGNSNGNERLKDLYNQGVHSGALGLMFNSILLGFVSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL-PNSSVKAGA  346
            VE + R++G  K LW  VNFILAI LA+TV VTK+A H RK      PL  P  +++AGA
Sbjct  352  VEWIGRKMGGAKRLWGLVNFILAIALAMTVLVTKSAEHHRKIAG---PLAGPTPAIRAGA  408

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLSLGVLN+AIV+PQM VSFLSGP+D
Sbjct  409  LSLFTVLGIPLAITFSVPFALASIFSNSSGAGQ-GLSLGVLNIAIVIPQMIVSFLSGPFD  467

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            A FGGGNLPAF+VGA++AA S +LA+T++P    D
Sbjct  468  AQFGGGNLPAFVVGAIAAAISAVLALTVIPSLPPD  502



>ref|XP_009104886.1| PREDICTED: sucrose transport protein SUC1-like [Brassica rapa]
 gb|AET08928.1| sucrose transporter [Brassica napus]
Length=514

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE-VNDN---GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG  V D+    LY+KGV AGALGLMLQS+VL FMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGNSVGDDRMLKLYNKGVHAGALGLMLQSIVLLFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILAIGLA+TV ++K A   RK    G    P+S VKAGAL
Sbjct  352  VEWIGRKVGGAKRLWGIVNFILAIGLAMTVLISKQAEEHRK--TAGDFAGPSSGVKAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLS+GVLNLAIV+PQM VS   G +DA
Sbjct  410  SLFAVLGIPLAITFSIPFALASIFSNSSGAGQ-GLSIGVLNLAIVIPQMIVSLGGGSFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLP F+VGA++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPVFVVGAIAAAISGVLALTVLPSPPPD  502



>gb|ADW94613.1| sucrose transporter 1 [Populus trichocarpa]
Length=535

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 175/217 (81%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GVRAGALGL+L SVVLGF S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSSRNADQLRMYDRGVRAGALGLLLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE+LAR +G VK LW  VNFILAI LA+T+ +TK A  +R+Y   +   H L P S VKA
Sbjct  364  VEVLARGVGGVKRLWGIVNFILAICLAMTILITKVAQSNRRYTTVNGGTHLLPPPSGVKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  +GP
Sbjct  424  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMVVSVAAGP  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+VGAV+AAASGILA T+LP P  D
Sbjct  483  WDALFGGGNLPAFVVGAVAAAASGILAFTMLPSPPPD  519



>ref|NP_173685.1| sucrose transport protein SUC2 [Arabidopsis thaliana]
 sp|Q39231.2|SUC2_ARATH RecName: Full=Sucrose transport protein SUC2; AltName: Full=Sucrose 
permease 2; AltName: Full=Sucrose transporter 1; AltName: 
Full=Sucrose-proton symporter 2 [Arabidopsis thaliana]
 gb|AAC25515.1| Match to sucrose-proton symporter (SUC2) gene gb|X75382 from 
A. thaliana [Arabidopsis thaliana]
 gb|AAK82518.1| At1g22710/T22J18_12 [Arabidopsis thaliana]
 gb|AAK93663.1| putative sucrose transport protein SUC2 [Arabidopsis thaliana]
 gb|AAM44994.1| putative sucrose transport protein SUC2 [Arabidopsis thaliana]
 gb|AAM66097.1| putative sucrose transport protein SUC2 [Arabidopsis thaliana]
 gb|AAN31829.1| putative sucrose transport protein, SUC2 [Arabidopsis thaliana]
 gb|AEE30276.1| sucrose transport protein SUC2 [Arabidopsis thaliana]
Length=512

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  348  LGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRR-DHGGAKTGPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F +LGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM +S   GP+
Sbjct  407  ALTLFAILGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVISVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SG+LA+T+LP P  D
Sbjct  466  DELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPD  501



>gb|AAM10322.1| At1g22710/T22J18_12 [Arabidopsis thaliana]
Length=512

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  348  LGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRR-DHGGAKTGPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F +LGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM +S   GP+
Sbjct  407  ALTLFAILGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVISVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SG+LA+T+LP P  D
Sbjct  466  DELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPD  501



>ref|XP_006307270.1| hypothetical protein CARUB_v10008884mg [Capsella rubella]
 gb|EOA40168.1| hypothetical protein CARUB_v10008884mg [Capsella rubella]
Length=512

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGNSDATASAASKKLYNDGVRAGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  348  LGVEWVGRKLGGAKRLWGIVNFILAICLAMTVLVTKQAENHRR-DHGGAKTGPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F +LGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  407  ALTLFAILGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  466  DELFGGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  501



>ref|XP_006416169.1| hypothetical protein EUTSA_v10009321mg [Eutrema salsugineum]
 gb|ESQ34522.1| hypothetical protein EUTSA_v10009321mg [Eutrema salsugineum]
Length=503

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 167/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVND------NGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG+ +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  278  LNWIAWFPFLLFDTDWMGREVYGGDSDAAATNAAKKLYNDGVRAGALGLMLNAIVLGFMS  337

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  338  LGVEWVGRKLGGAKRLWGVVNFILAICLAMTVLVTKQAENHRR-DHGGAKTGPPGNVTAG  396

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  397  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  455

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SG+LA+T+LP P  D
Sbjct  456  DELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPD  491



>gb|AAL58072.1| sucrose transporter SUC2 [Brassica oleracea]
 emb|CDY04792.1| BnaC05g17970D [Brassica napus]
Length=508

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 165/216 (76%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE------VNDNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG       V    LY+ GVRAGALGLML ++VLGFMS
Sbjct  283  LNWIAWFPFLLFDTDWMGREVYGGNSDATASVASKKLYNDGVRAGALGLMLNAIVLGFMS  342

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  343  LGVEWVGRKMGGAKRLWGAVNFILAICLAMTVVVTKQAENHRR-DHGGAKTGPPGNVTAG  401

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  402  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  460

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LF GGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  461  DELFHGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  496



>emb|CDY12517.1| BnaC07g13570D [Brassica napus]
Length=508

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  283  LNWIAWFPFLLFDTDWMGREVYGGNSDATASATAKKLYNDGVRAGALGLMLNAIVLGFMS  342

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  343  LGVEWVGRKMGGAKRLWGVVNFILAICLAMTVLVTKQAENHRR-DHGGAKTGPPGNVTAG  401

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+SS++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  402  ALTLFAVLGIPQAITFSIPFALASIFSSNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  460

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D +FGGGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  461  DEIFGGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  496



>ref|XP_009103222.1| PREDICTED: sucrose transport protein SUC2 [Brassica rapa]
 emb|CDY25750.1| BnaA07g10320D [Brassica napus]
Length=513

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGNSDATASATAKKLYNDGVRAGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  348  LGVEWVGRKMGGAKRLWGVVNFILAICLAMTVLVTKQAENHRR-DHGGAKTGPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+SS++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  407  ALTLFAVLGIPQAITFSIPFALASIFSSNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D +FGGGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  466  DEIFGGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  501



>gb|ADW94615.1| sucrose transporter 1 [Populus tremula x Populus alba]
Length=535

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 177/217 (82%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GVRAGALGL+L SVVLGF S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSSGNADQLKMYDRGVRAGALGLLLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD-AHG--HPLLPNSSVKA  340
            VE+LAR +G VK LW  VNFILAI LA+T+ +TK A  +R+Y  A+G  H L P S VKA
Sbjct  364  VEVLARGVGGVKRLWGIVNFILAICLAMTILITKVAKSNRRYTTANGGTHLLPPPSGVKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  +GP
Sbjct  424  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMVVSVAAGP  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+VGAV+AAASGILA T+LP P  D
Sbjct  483  WDALFGGGNLPAFVVGAVAAAASGILAFTMLPSPPPD  519



>ref|XP_009115609.1| PREDICTED: sucrose transport protein SUC2 [Brassica rapa]
 emb|CDY21384.1| BnaA09g30430D [Brassica napus]
Length=508

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 165/216 (76%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  283  LNWIAWFPFLLFDTDWMGREVYGGNSDATASDASKKLYNDGVRAGALGLMLNAIVLGFMS  342

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  343  LGVEWVGRKMGGAKRLWGAVNFILAICLAMTVVVTKQAENHRR-DHGGAKTGPPGNVTAG  401

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  402  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  460

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LF GGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  461  DELFHGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  496



>ref|XP_010477533.1| PREDICTED: sucrose transport protein SUC2 [Camelina sativa]
Length=512

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 165/216 (76%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVR GALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGNSDATASAASKKLYNDGVRTGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  348  LGVEWIGRKLGGAKRLWGIVNFILAICLAMTVLVTKQAENYRR-DHGGAHEKPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  407  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  466  DELFGGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  501



>ref|XP_010460033.1| PREDICTED: sucrose transport protein SUC2-like [Camelina sativa]
Length=516

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 165/216 (76%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVR GALGLML ++VLGFMS
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGNSDATASAASKKLYNDGVRTGALGLMLNAIVLGFMS  351

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  352  LGVEWIGRKLGGAKRLWGIVNFILAICLAMTVLVTKQAENYRR-DHGGAHEKPPGNVTAG  410

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  411  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  469

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  470  DELFGGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  505



>emb|CAA53150.1| sucrose-proton symporter [Arabidopsis thaliana]
Length=512

 Score =   255 bits (651),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 165/216 (76%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R+LG  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  348  LGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRR-DHGGAKTGPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F +LGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM +S   GP+
Sbjct  407  ALTLFAILGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVISVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D LFGGGN+PAF++GA++AA SG+L +T+LP P  D
Sbjct  466  DELFGGGNIPAFVLGAIAAAVSGVLGLTVLPSPPPD  501



>gb|KFK44362.1| hypothetical protein AALP_AA1G247500 [Arabis alpina]
Length=513

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 168/219 (77%), Gaps = 8/219 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG+ +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  288  LNWIAWFPFLLFDTDWMGREVYGGDSDATASPALKKLYNDGVRAGALGLMLNAIVLGFMS  347

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VT+ A + R++   G    P  +V AG
Sbjct  348  LGVEWVGRKIGGAKRLWGAVNFILAICLAMTVLVTRQADNHRRHHG-GAGTGPPGNVTAG  406

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+S+++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  407  ALTLFAVLGIPQAITFSIPFALASIFSTNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  465

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            D LFGGGN+PAF++GA++AA SG+LA+T+LP P  D  +
Sbjct  466  DELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPDAPV  504



>ref|XP_006392340.1| hypothetical protein EUTSA_v10023916mg [Eutrema salsugineum]
 gb|ESQ29626.1| hypothetical protein EUTSA_v10023916mg [Eutrema salsugineum]
Length=496

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +G    LY++GV  GALGLM+ ++VLGFMS+G
Sbjct  291  LNWIAWFPFLLFDTDWMGREVYGGDSAGDGKLKNLYNQGVHVGALGLMINAIVLGFMSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA+ LA+TV VTK A   RK    G    P   ++AGAL
Sbjct  351  VEWIGRKMGGAKRLWGVVNFILAVCLAMTVLVTKLAEAHRK--TAGAYAGPTEGIRAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I SSD+G+GQ GLSLGVLNLAIV+PQMFVS   GP+DA
Sbjct  409  TLFAILGIPLAVTFSIPFALASIISSDSGAGQ-GLSLGVLNLAIVIPQMFVSLGGGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA SG++A+T+LP
Sbjct  468  LFGGGNLPGFVVGAIAAAVSGVVALTVLP  496



>gb|AAU11810.1| sucrose transporter [Juglans regia]
Length=516

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 170/215 (79%), Gaps = 6/215 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG--LYDKGVRAGALGLMLQSVVLGFMSIGVE  175
            LNWIAWFPFLL+DTDWM +EVYGG V  +G  +   GVRAGALGLML SVV GF S+GV 
Sbjct  287  LNWIAWFPFLLFDTDWMGKEVYGGTVERSGGKIVRSGVRAGALGLMLNSVVWGFTSLGVN  346

Query  176  LLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDA-HGHPLL--PNSSVKAGA  346
            +++R +G VK LW  VNF+LA+ +A+TV +TK A  +R   A +G   L  P + VKAGA
Sbjct  347  VISRGIGGVKRLWGIVNFLLALCMAMTVLITKLAESARHTAAANGGATLSPPPAGVKAGA  406

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            LA+F VLGIPLAVT+S+PFALA I+S  +G+GQ GLSLGVLNLAIV PQM VS  SGP+D
Sbjct  407  LALFAVLGIPLAVTYSIPFALASIFSHASGAGQ-GLSLGVLNLAIVFPQMLVSVASGPFD  465

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            ALFGGGNLPAF+VGA+SAAASGIL++T+LP P +D
Sbjct  466  ALFGGGNLPAFVVGAISAAASGILSLTMLPFPTTD  500



>ref|XP_006390730.1| hypothetical protein EUTSA_v10018412mg [Eutrema salsugineum]
 gb|ESQ28016.1| hypothetical protein EUTSA_v10018412mg [Eutrema salsugineum]
Length=514

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 168/218 (77%), Gaps = 7/218 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +     LY++GV  GALGLM  ++VLGFMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGDSEGDDSLKKLYNQGVHQGALGLMFNAIVLGFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + +++G  K LW  VNFILA+GLA+TV VTK A   RK    G    P+  ++AGAL
Sbjct  352  VEWIGKKVGGAKRLWGIVNFILAVGLAMTVLVTKFAEDHRK--TAGALAGPSPGIRAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  410  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            LFGGGNLPAF++GA++AA SG+LA+T+LP P  D   V
Sbjct  469  LFGGGNLPAFVLGAIAAAISGVLALTVLPSPPPDAPAV  506



>ref|XP_006376318.1| putative sucrose-H+ symporter family protein [Populus trichocarpa]
 gb|ERP54115.1| putative sucrose-H+ symporter family protein [Populus trichocarpa]
Length=535

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 174/217 (80%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GV AGALGL+L SVVLGF S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSSRNADQLKMYDRGVHAGALGLLLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE+LAR +G VK LW  VNFILAI LA+T+ +TK A  +R+Y   +   H L P S VKA
Sbjct  364  VEVLARGVGGVKRLWGIVNFILAICLAMTILITKVAQSNRRYTTVNGGTHLLPPPSGVKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  +GP
Sbjct  424  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMVVSVAAGP  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+VGAV+AAASGILA T+LP P  D
Sbjct  483  WDALFGGGNLPAFVVGAVAAAASGILAFTMLPSPPPD  519



>gb|ADW94614.1| sucrose transporter 1 [Populus trichocarpa]
Length=535

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 174/217 (80%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GV AGALGL+L SVVLGF S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSSRNADQLKMYDRGVHAGALGLLLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE+LAR +G VK LW  VNFILAI LA+T+ +TK A  +R+Y   +   H L P S VKA
Sbjct  364  VEVLARGVGGVKRLWGIVNFILAICLAMTILITKVAQSNRRYTTVNGGTHLLPPPSGVKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  +GP
Sbjct  424  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMVVSVAAGP  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+VGAV+AAASGILA T+LP P  D
Sbjct  483  WDALFGGGNLPAFVVGAVAAAASGILAFTMLPSPPPD  519



>ref|XP_007020259.1| Sucrose-proton symporter 2 isoform 1 [Theobroma cacao]
 gb|EOY17484.1| Sucrose-proton symporter 2 isoform 1 [Theobroma cacao]
Length=575

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 170/226 (75%), Gaps = 17/226 (8%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   N L    Y++GVRAGALGLML SVVLGF S+G
Sbjct  339  LNWIAWFPFLLFDTDWMGREVYGGDSQGNNLVLRLYNRGVRAGALGLMLNSVVLGFTSLG  398

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VELLAR +G VK LW  +NF+ A  LA+TV VTK A  +R++   D    PL P + VKA
Sbjct  399  VELLARGVGGVKRLWGIINFLHAFCLAMTVLVTKLAKSNRRFATMDGVTVPLPPGAGVKA  458

Query  341  GALAIFCVLGIPLA---------VTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQ  493
            GAL++F  LGIPLA         VT+S+PFALA I+SS +G+GQ GLSLGVLNL IV+PQ
Sbjct  459  GALSLFAALGIPLAGNPIQKIEKVTYSIPFALASIFSSSSGAGQ-GLSLGVLNLGIVMPQ  517

Query  494  MFVSFLSGPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            + VS  SGP+DA+FGGGNLPAF++GA +AAASGI A+T+LP P  D
Sbjct  518  ILVSLGSGPFDAIFGGGNLPAFVLGAFAAAASGIFALTMLPSPPPD  563



>gb|ADL29729.1| sugar transporter [Galega orientalis]
Length=514

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 164/210 (78%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFPF L+DTDWM REVYGG+  ++  Y+KGVRAGALGLM+ + VLG MS+ VE L
Sbjct  296  INWVAWFPFFLFDTDWMGREVYGGKTGESA-YNKGVRAGALGLMINAFVLGLMSLAVEPL  354

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G  K LW  VN ILAIGLA+TV +TKAA H  ++ ++ +P  P++ +KA A + F 
Sbjct  355  GRFVGGAKRLWGIVNIILAIGLAMTVVITKAAKH--QHVSNTNP--PSTGIKAAAFSFFA  410

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAV FS+PFALA IYSS +G+GQ GLSLGVLN++IVVPQM VS LSGPWD LFGG
Sbjct  411  VLGIPLAVNFSVPFALASIYSSASGAGQ-GLSLGVLNISIVVPQMIVSALSGPWDDLFGG  469

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             NLPAF+VG V+A  SG+LAI LLP P+ +
Sbjct  470  SNLPAFLVGTVAAVVSGVLAIVLLPTPKPE  499



>ref|XP_006392336.1| hypothetical protein EUTSA_v10023799mg [Eutrema salsugineum]
 gb|ESQ29622.1| hypothetical protein EUTSA_v10023799mg [Eutrema salsugineum]
Length=495

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 166/210 (79%), Gaps = 9/210 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   +G    LY++GV  GALGLM+ ++VLGFMS+G
Sbjct  290  LNWIAWFPFLLFDTDWMGREVYGGDSAGDGKLKSLYNQGVHVGALGLMINAIVLGFMSLG  349

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTK-AASHSRKYDAHGHPLLPNSSVKAGA  346
            +E + R++G  K LW  VNFILA+ LA+TV VTK A +H +   A+  P   N   +AGA
Sbjct  350  IEWIGRKMGGAKRLWGVVNFILAVCLAMTVLVTKLAEAHRKTAGAYAGPTEGN---RAGA  406

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LGIPLAVTFS+PFALA I SSD+G+GQ GLSLGVLNLAIV+PQMFVS   GP+D
Sbjct  407  LTLFAILGIPLAVTFSIPFALASIISSDSGAGQ-GLSLGVLNLAIVIPQMFVSLGGGPFD  465

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLP  616
            ALFGGGNLP F+VGA++AA SG++A+T+LP
Sbjct  466  ALFGGGNLPGFVVGAIAAAVSGVVALTVLP  495



>gb|AET08927.1| sucrose transporter [Brassica napus]
 emb|CDX68295.1| BnaA07g23350D [Brassica napus]
Length=514

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE-VNDN---GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ V D+    LY++GV AGALGLMLQS+VL FMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGDSVGDDRMLKLYNRGVHAGALGLMLQSIVLLFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILAIGLA+TV ++K A   RK    G    P+S V+AGAL
Sbjct  352  VEWIGRKVGGAKRLWGIVNFILAIGLAMTVLISKQAEGHRK--TAGDFAGPSSGVRAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLS+GVLNLAIV+PQM VS   G +D 
Sbjct  410  SLFAVLGIPLAITFSIPFALASIFSNSSGAGQ-GLSIGVLNLAIVIPQMIVSLGGGYFDT  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLP F+VGA++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPVFVVGAIAAAISGVLALTVLPSPPPD  502



>emb|CAA53390.2| sucrose transporter [Plantago major]
Length=511

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 167/216 (77%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWF FLL+DTDWM REVYGG     G      +Y+KGV AGALGLML S+VLGF S
Sbjct  287  LNWIAWFGFLLFDTDWMGREVYGGNPTAQGHPELAVIYNKGVSAGALGLMLNSIVLGFAS  346

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GV+ +AR LG VK LW  VNFILAI L +T+ +TK ASH R Y ++G    P SSVK G
Sbjct  347  LGVQYMARALGGVKRLWGVVNFILAICLCMTIVITKVASHHRPY-SNGVLQTPESSVKIG  405

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F  LGIPLA+TFS+PFALA IYS+  GSGQ GLSLGVLNLAIV+PQM VS  SGPW
Sbjct  406  ALVVFSALGIPLAITFSVPFALASIYSTTTGSGQ-GLSLGVLNLAIVIPQMIVSVASGPW  464

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            DA+FGGGNLPAF+VGAV+AAASGI A T+LP P ++
Sbjct  465  DAMFGGGNLPAFVVGAVAAAASGIFAFTMLPSPPAE  500



>ref|XP_006399085.1| hypothetical protein EUTSA_v10015600mg [Eutrema salsugineum]
 gb|ESQ40538.1| hypothetical protein EUTSA_v10015600mg [Eutrema salsugineum]
Length=496

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + +     LY++GV  GALGLM+ ++VLGFMS+G
Sbjct  291  LNWIAWFPFLLFDTDWMGREVYGGDSSGDAKLKSLYNQGVHNGALGLMINAIVLGFMSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA+ LA+TV VTK A   RK    G    P   ++AGAL
Sbjct  351  VEWIGRKMGGAKRLWGVVNFILAVCLAMTVLVTKLAEAHRK--TAGPYAGPTEGIRAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I SSD+G+GQ GLSLGVLNLAIV+PQMFVS   GP+DA
Sbjct  409  TLFGILGIPLAVTFSIPFALASIISSDSGAGQ-GLSLGVLNLAIVIPQMFVSLGGGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA SG++A+T+LP
Sbjct  468  LFGGGNLPGFVVGAIAAAVSGVVALTVLP  496



>ref|XP_007020265.1| Sucrose transport protein SUC2 [Theobroma cacao]
 gb|EOY17490.1| Sucrose transport protein SUC2 [Theobroma cacao]
Length=411

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV--NDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM RE+YGG V  NDN   LYD GVRAGALGLM+ S+VLGF S+G
Sbjct  191  LNWIAWFPFLLYDTDWMGREIYGGHVDGNDNQQKLYDNGVRAGALGLMINSIVLGFASLG  250

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R +G VK LW GVNFILA  LA TV +TK     R  D HG  L P S++K  AL
Sbjct  251  LENIGRLVGGVKNLWGGVNFILAACLASTVWITKVVEAWR--DTHGL-LAPPSNIKGSAL  307

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPL+VTFS+PFALA IY S +G GQ GL+LGVLN+AIV+PQMF+S +SGP D 
Sbjct  308  AVFGLLGIPLSVTFSIPFALASIYCSASGGGQ-GLALGVLNMAIVIPQMFISVVSGPLDE  366

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G++ AA S +LAI  LP P
Sbjct  367  AFGGGNLPAFVLGSIVAAISAVLAIVALPNP  397



>ref|XP_009348390.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=507

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 9/205 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V    LYD GVRAG+LGL+L SVVLGFMS+GVE L
Sbjct  284  LNWIAWFPFLLFDTDWMGKEVYGGQVGKGRLYDLGVRAGSLGLLLNSVVLGFMSLGVEHL  343

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVKAGAL  349
             R +G VK LW  VNF+LA+ +ALTV +TK A  SR    HGH    P  P + +KAGAL
Sbjct  344  GRWVGGVKRLWAIVNFLLAVCMALTVLITKLAEASR----HGHIGVEPPPPPAGIKAGAL  399

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLAVT+S+PFALA I+SS++G+GQ GLSLGVLNLAIVVPQMFVS +SGPWD 
Sbjct  400  SLFAVLGIPLAVTYSIPFALASIFSSNSGAGQ-GLSLGVLNLAIVVPQMFVSVVSGPWDD  458

Query  530  LFGGGNLPAFIVGAVSAAASGILAI  604
            LFGGGNLPAF+ GAV+A ASG+LA+
Sbjct  459  LFGGGNLPAFVAGAVAAVASGMLAL  483



>ref|XP_009375259.1| PREDICTED: sucrose transport protein-like [Pyrus x bretschneideri]
Length=507

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 9/205 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V    LYD GVRAG+LGL+L SVVLGFMS+GVE L
Sbjct  284  LNWIAWFPFLLFDTDWMGKEVYGGQVGKGRLYDLGVRAGSLGLLLNSVVLGFMSLGVEHL  343

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGH----PLLPNSSVKAGAL  349
             R +G VK LW  VNF+LA+ +ALTV +TK A  SR    HGH    P  P + +KAGAL
Sbjct  344  GRWVGGVKRLWAIVNFLLAVCMALTVLITKLAEASR----HGHIGVEPPPPPAGIKAGAL  399

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLAVT+S+PFALA I+SS++G+GQ GLSLGVLNLAIVVPQMFVS +SGPWD 
Sbjct  400  SLFAVLGIPLAVTYSIPFALASIFSSNSGAGQ-GLSLGVLNLAIVVPQMFVSVVSGPWDD  458

Query  530  LFGGGNLPAFIVGAVSAAASGILAI  604
            LFGGGNLPAF+ GAV+A ASG+LA+
Sbjct  459  LFGGGNLPAFVAGAVAAVASGMLAL  483



>gb|KHN32802.1| Sucrose transport protein SUC2 [Glycine soja]
Length=295

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 161/210 (77%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+ WFP+ L+DTDWM REVYGG+V ++  Y  GVR G+LGLM+ +VVLGFMS+ VE L
Sbjct  75   VNWVGWFPYFLFDTDWMGREVYGGQVGEDA-YANGVRVGSLGLMVNAVVLGFMSLAVEPL  133

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLLPNSSVKAGALAI  355
             + +G VK LW  VNFILAIG  +TV +TK A H RK +  A GHP   +  V  G++  
Sbjct  134  GKMVGGVKRLWAIVNFILAIGFGMTVVITKVAEHQRKMNPAAVGHP---SEGVVVGSMVF  190

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLG+PLA+TFS+PFALA IY S +G+GQ GLSLGVLNLAIVVPQM VS LSGPWDALF
Sbjct  191  FGVLGVPLAITFSVPFALASIYCSASGAGQ-GLSLGVLNLAIVVPQMVVSTLSGPWDALF  249

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF+VGA +AA S I+AI LLP P+
Sbjct  250  GGGNLPAFMVGAAAAALSAIMAIVLLPTPK  279



>ref|XP_008245088.1| PREDICTED: sucrose transport protein [Prunus mume]
Length=511

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 165/215 (77%), Gaps = 6/215 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM REVYGG+V    LYD GVRAGALGLML +VVLGFMS+ +E L
Sbjct  283  LNWIAWFPFLLFDTDWMGREVYGGQVGKGRLYDLGVRAGALGLMLNAVVLGFMSLAIEPL  342

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSR-----KYDAHGHPLLPNSSVKAGA  346
             R +G VK LW  VNF+LAI LA+TV +TK A  SR            P  P + VKAGA
Sbjct  343  GRWVGGVKRLWGIVNFLLAICLAMTVLITKLAQSSRHAAIAAGHGGAEPPPPTAGVKAGA  402

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F VLGIP AVTFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQMFVS  SGPWD
Sbjct  403  LTLFAVLGIPQAVTFSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMFVSVTSGPWD  461

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             LFGGGNLPAFI GAV+A ASG+LA+ +LP P +D
Sbjct  462  DLFGGGNLPAFIAGAVAAVASGVLALFMLPSPPAD  496



>emb|CAJ33718.1| sucrose transporter 1 [Populus tremula x Populus tremuloides]
Length=534

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 172/217 (79%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     +YD+GVRAGALGL+L SVVLGF S+G
Sbjct  304  LNWIAWFPFLLFDTDWMGREVYGGDSSRNTDQLKMYDRGVRAGALGLLLNSVVLGFTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE+LAR +G VK LW  VNFILAI LA+T+ +TK A  +R+Y   +   H L P S VKA
Sbjct  364  VEVLARGVGGVKRLWGIVNFILAICLAMTILITKVAQSNRRYTTVNGGTHLLPPPSGVKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+ QM VS  +G 
Sbjct  424  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVISQMEVSVAAGS  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+V AV+AAASGILA T+LP P  D
Sbjct  483  WDALFGGGNLPAFVVRAVAAAASGILAFTMLPSPAPD  519



>gb|KDP34602.1| hypothetical protein JCGZ_11979 [Jatropha curcas]
Length=529

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 167/210 (80%), Gaps = 9/210 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REV+GG+ N N     LYD+GVRAGALGLML SVVLGF S+G
Sbjct  301  LNWIAWFPFLLFDTDWMGREVFGGDSNGNAEELKLYDRGVRAGALGLMLNSVVLGFTSLG  360

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDA----HGHPLLPNSSVK  337
            VE LAR +G VK LW  VNFILAI LALT+ +TK A   R++         PL P+ SVK
Sbjct  361  VEFLARGVGGVKRLWGIVNFILAICLALTILITKVAESHRRFTTVPGGDKVPLPPDGSVK  420

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
             GALA+F V+G+P A+T+S+PFALA I+ +DAG+GQ GLSLGVLNL+IV+PQM VS  SG
Sbjct  421  GGALALFAVMGVPQAITYSIPFALASIFCNDAGAGQ-GLSLGVLNLSIVIPQMVVSVASG  479

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAIT  607
            PWDALFGGGNLPAF+VGAV+AAASGI A+T
Sbjct  480  PWDALFGGGNLPAFVVGAVAAAASGIFALT  509



>ref|XP_002326003.2| sucrose transporter family protein [Populus trichocarpa]
 gb|EEF00385.2| sucrose transporter family protein [Populus trichocarpa]
Length=535

 Score =   250 bits (639),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GVRAGALGLML SVVLG  S+G
Sbjct  307  LNWVAWFPFLLFDTDWMGREVYGGDSSGNADQLKMYDRGVRAGALGLMLNSVVLGVTSLG  366

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE LAR +G VK LW  VNF+LAI LA+T+ +TK A  +R+Y   +   H L P   +KA
Sbjct  367  VEALARGVGGVKRLWGIVNFVLAICLAMTILITKLAQSNRRYTTVNGGTHLLTPPPGIKA  426

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  SGP
Sbjct  427  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMLVSVASGP  485

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGN PAF+VGAV+AA SGILA T+LP P  D
Sbjct  486  WDALFGGGNPPAFVVGAVAAAVSGILAFTMLPSPPPD  522



>gb|AHB33870.1| sucrose transporter [Fraxinus excelsior]
Length=517

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 171/213 (80%), Gaps = 5/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM +EVYGG+V    LY++GVRAGALGLML +VVLG  S+ +ELL
Sbjct  294  LNWIAWFPFLLFDTDWMGKEVYGGKVGVGKLYNQGVRAGALGLMLSAVVLGCASLALELL  353

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG---HPLLPNSSVKAGALA  352
            AR LG VK LW   NF+LAI LA+TV +TK A  +R++  H    +P  P + VK GALA
Sbjct  354  ARGLGGVKRLWGVANFLLAICLAMTVLITKLAQSTRRHAIHNGDANP-PPATGVKVGALA  412

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            +F +LGIP AVTFS+PFALA I+SSD+G+GQ GLSLGVLNLAIVVPQM VS LSGPWDAL
Sbjct  413  LFAILGIPQAVTFSIPFALASIFSSDSGAGQ-GLSLGVLNLAIVVPQMVVSVLSGPWDAL  471

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FG GNLPAF+VGAV+AAASGI A+TLLP   SD
Sbjct  472  FGDGNLPAFVVGAVAAAASGIFALTLLPSLPSD  504



>ref|XP_006473215.1| PREDICTED: sucrose transport protein SUC2 isoform X1 [Citrus 
sinensis]
Length=528

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 164/218 (75%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     +Y+ GVRAG+LGLML ++VLGF S+G
Sbjct  293  LNWIAWFPFLLFDTDWMGREVYGGNSKGSAEELRVYNNGVRAGSLGLMLNAIVLGFTSLG  352

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG----HPLLPNSSVK  337
            VE+LA+ +G VK LW  VNF+LA+ LA T  +TK A  +R+         H L P   VK
Sbjct  353  VEVLAKLIGGVKRLWGVVNFLLAVSLAFTFLITKLAESNRRSVTTAGGATHILPPPVGVK  412

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
             GALAIF VLGIP A+TFS+PFA+A I+S  + +GQ GLSLGVLNLAIVVPQM VS LSG
Sbjct  413  VGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQ-GLSLGVLNLAIVVPQMLVSLLSG  471

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            P+DA+ GGGN+PAF+VGAV+AA SGI+A+TLLP   +D
Sbjct  472  PFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTAD  509



>ref|XP_011001730.1| PREDICTED: sucrose transport protein SUC8-like [Populus euphratica]
 ref|XP_011002494.1| PREDICTED: sucrose transport protein SUC8-like [Populus euphratica]
Length=532

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 169/217 (78%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD GVRAGALGLML SVVLG  S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSSGNADQLKMYDHGVRAGALGLMLNSVVLGVTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE LAR +G VK LW  VNF+LAI LA+T+ +TK A  +R+Y   +   H L P   +KA
Sbjct  364  VEALARGVGGVKRLWGIVNFVLAICLAMTILITKLAQSNRRYTTVNGGTHLLPPPPGIKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIPLA+T+S+PFALA I+S+ +GSGQ GLSLGVLNL+IV+PQM VS  SGP
Sbjct  424  GALALFAVMGIPLAITYSIPFALASIFSNTSGSGQ-GLSLGVLNLSIVIPQMVVSVASGP  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WD LFGGGN PAF+VGAV+AA SGILA T+LP P  D
Sbjct  483  WDDLFGGGNPPAFVVGAVAAAVSGILAFTMLPSPNPD  519



>ref|NP_001275850.1| citrus sucrose transporter 1 [Citrus sinensis]
 gb|AAM29150.1| citrus sucrose transporter 1 [Citrus sinensis]
Length=528

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 164/218 (75%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     +Y+ GVRAG+LGLML ++VLGF S+G
Sbjct  293  LNWIAWFPFLLFDTDWMGREVYGGNSKGSAEELRVYNNGVRAGSLGLMLNAIVLGFTSLG  352

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG----HPLLPNSSVK  337
            VE+LA+ +G VK LW  VNF+LA+ LA T  +TK A  +R+         H L P   VK
Sbjct  353  VEVLAKLIGGVKRLWGVVNFLLAVSLAFTFLITKLAESNRRSVTTAGGATHILPPPVGVK  412

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
             GALAIF VLGIP A+TFS+PFA+A I+S  + +GQ GLSLGVLNLAIVVPQM VS LSG
Sbjct  413  VGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQ-GLSLGVLNLAIVVPQMLVSLLSG  471

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            P+DA+ GGGN+PAF+VGAV+AA SGI+A+TLLP   +D
Sbjct  472  PFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTAD  509



>gb|ACB47398.1| sucrose transporter [Brassica napus]
Length=508

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 164/216 (76%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            L  IAWFPFLL+DTDWM REVYGG  +         LY+ GVRAGALGLML ++VLGFMS
Sbjct  283  LRGIAWFPFLLFDTDWMGREVYGGNSDATASATAKKLYNDGVRAGALGLMLNAIVLGFMS  342

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A + R+ D  G    P  +V AG
Sbjct  343  LGVEWVGRKMGGAKRLWGVVNFILAICLAMTVLVTKQAENHRR-DHGGAKTGPPGNVTAG  401

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL +F VLGIP A+TFS+PFALA I+SS++G+GQ GLSLGVLNLAIVVPQM VS   GP+
Sbjct  402  ALTLFAVLGIPQAITFSIPFALASIFSSNSGAGQ-GLSLGVLNLAIVVPQMVVSVGGGPF  460

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            D +FGGGN+PAF++GA++AA SGILA+T+LP P  D
Sbjct  461  DEIFGGGNIPAFVLGAIAAAVSGILALTVLPSPPPD  496



>ref|XP_009105851.1| PREDICTED: sucrose transport protein SUC1-like [Brassica rapa]
 emb|CDX96357.1| BnaA07g29680D [Brassica napus]
Length=508

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 164/208 (79%), Gaps = 7/208 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     LY++GV +GALGLM  S+VLGFMS+G
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGSSQGDDRMKKLYNEGVHSGALGLMFNSIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA+GLA+TV VTK A+  RK    G    P+  ++AGAL
Sbjct  347  VEWIGRKVGGAKRLWGIVNFILAVGLAMTVLVTKLAADYRKI--AGPYAGPSPGIRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  405  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLL  613
            LFGGGNLPAFI+GA++AA SG+LA T+L
Sbjct  464  LFGGGNLPAFILGAIAAAISGVLAFTVL  491



>emb|CDX72840.1| BnaC06g32880D [Brassica napus]
Length=508

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 164/208 (79%), Gaps = 7/208 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     LY++GV +GALGLM  S+VLGFMS+G
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGSSQGDDRMKKLYNEGVHSGALGLMFNSIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA+GLA+TV VTK A+  RK    G    P+  ++AGAL
Sbjct  347  VEWIGRKVGGAKRLWGIVNFILAVGLAMTVLVTKLAADYRKI--AGPYAGPSPGIRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  405  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLL  613
            LFGGGNLPAF++GA++AA SG+LA T+L
Sbjct  464  LFGGGNLPAFVLGAIAAAISGVLAFTVL  491



>ref|XP_007020266.1| Sucrose transport protein SUC2 isoform 1 [Theobroma cacao]
 gb|EOY17491.1| Sucrose transport protein SUC2 isoform 1 [Theobroma cacao]
Length=491

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV--NDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM RE+YGG V  NDN   LYD GVRAGALGLM+ S+VLGF S+G
Sbjct  271  LNWIAWFPFLLYDTDWMGREIYGGHVDGNDNQQKLYDNGVRAGALGLMINSIVLGFASLG  330

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R +G VK LW GVNFILA  LA TV +TK     R  D HG  L P S++K  AL
Sbjct  331  LENIGRLVGGVKNLWGGVNFILAACLASTVWITKVVEAWR--DTHGL-LAPPSNIKGSAL  387

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPL+VTFS+PFALA IY S +G GQ GL+LGVLN+AIV+PQMF+S +SGP D 
Sbjct  388  AVFGLLGIPLSVTFSIPFALASIYCSASGGGQ-GLALGVLNMAIVIPQMFISVVSGPLDE  446

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G++ AA S +LAI  LP P
Sbjct  447  AFGGGNLPAFVLGSIVAAISAVLAIVALPNP  477



>gb|KHN32801.1| Sucrose transport protein [Glycine soja]
Length=372

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 160/216 (74%), Gaps = 9/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFP+ L+DTDWM REVYGG+V     YD GV AG+LGLML +VVL  MS+ +E L
Sbjct  152  VNWIAWFPYFLFDTDWMGREVYGGDVGQKA-YDSGVHAGSLGLMLNAVVLAVMSLAIEPL  210

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL---PNSSVKAGALA  352
             R +G +K LW  VN +LAI L +TV +TK A H R  +    P L   P+  +K G++ 
Sbjct  211  GRVVGGIKWLWGIVNILLAICLGMTVLITKIAEHERLLN----PALVGNPSLGIKVGSMV  266

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
             F VLGIPLA+TFS+PFALA IYSS +G+GQ GLSLGVLN+AIVVPQM VS +SGPWDAL
Sbjct  267  FFSVLGIPLAITFSVPFALASIYSSTSGAGQ-GLSLGVLNIAIVVPQMIVSTISGPWDAL  325

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            FGGGNLPAF++GAV+A  S ILA+ LLP P+   ++
Sbjct  326  FGGGNLPAFVLGAVAAVVSAILAVLLLPTPKKADEV  361



>gb|ADW94616.1| sucrose transporter 3 [Populus tremula x Populus alba]
Length=532

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 170/217 (78%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + +     +YD+GVRAGALGLML SVVLG  S+G
Sbjct  304  LNWVAWFPFLLFDTDWMGREVYGGDSSGSADQLKMYDRGVRAGALGLMLNSVVLGVTSLG  363

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE LAR +G VK LW  VNF+LAI LA+T+ +TK A  +R+Y   +   H L P   +KA
Sbjct  364  VEALARGVGGVKRLWGIVNFVLAICLAMTILITKLAQSNRRYTTVNGGTHLLTPPPGIKA  423

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQM VS  SGP
Sbjct  424  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQMLVSVASGP  482

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGN PAF+VGAV+AA SGILA T+LP P  D
Sbjct  483  WDALFGGGNPPAFVVGAVAAAVSGILAFTMLPSPTPD  519



>gb|AHH34928.1| sucrose transporter 5 [Theobroma cacao]
Length=491

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV--NDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM RE+YGG V  NDN   LYD GVRAGALGLM+ S+VLGF S+G
Sbjct  271  LNWIAWFPFLLYDTDWMGREIYGGHVDGNDNQQKLYDNGVRAGALGLMINSIVLGFASLG  330

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R +G VK LW GVNFILA  LA TV +TK     R  D HG  L P S++K  AL
Sbjct  331  LENIGRLVGGVKNLWGGVNFILAACLASTVWITKVVEAWR--DTHGL-LAPPSNIKGSAL  387

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPL+VTFS+PFALA IY S +G GQ GL+LGVLN+AIV+PQMF+S +SGP D 
Sbjct  388  AVFGLLGIPLSVTFSIPFALASIYCSASGGGQ-GLALGVLNMAIVIPQMFISVVSGPLDE  446

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G++ AA S +LAI  LP P
Sbjct  447  AFGGGNLPAFVLGSIVAAISAVLAIVALPNP  477



>ref|XP_007020267.1| Sucrose transport protein SUC2 isoform 2 [Theobroma cacao]
 gb|EOY17492.1| Sucrose transport protein SUC2 isoform 2 [Theobroma cacao]
Length=491

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV--NDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM RE+YGG V  NDN   LYD GVRAGALGLM+ S+VLGF S+G
Sbjct  271  LNWIAWFPFLLYDTDWMGREIYGGHVDGNDNQQKLYDNGVRAGALGLMINSIVLGFASLG  330

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R +G VK LW GVNFILA  LA TV +TK     R  D HG  L P S++K  AL
Sbjct  331  LENIGRLVGGVKNLWGGVNFILAACLASTVWITKVVEAWR--DTHGL-LAPPSNIKGSAL  387

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPL+VTFS+PFALA IY S +G GQ GL+LGVLN+AIV+PQMF+S +SGP D 
Sbjct  388  AVFGLLGIPLSVTFSIPFALASIYCSASGGGQ-GLALGVLNMAIVIPQMFISVVSGPLDE  446

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G++ AA S +LAI  LP P
Sbjct  447  AFGGGNLPAFVLGSIVAAISAVLAIVALPNP  477



>ref|XP_006434633.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
 gb|ESR47873.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
Length=531

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 163/218 (75%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     +Y+ GVRAG+LGLML ++VLGF S+G
Sbjct  296  LNWIAWFPFLLFDTDWMGREVYGGSSKGSAEELRVYNNGVRAGSLGLMLNAIVLGFTSLG  355

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG----HPLLPNSSVK  337
            VE+LA+ +G VK LW  VNF+LA+ L  T  +TK A  +R+         H L P   VK
Sbjct  356  VEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVK  415

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
             GALAIF VLGIP A+TFS+PFA+A I+S  + +GQ GLSLGVLNLAIVVPQM VS LSG
Sbjct  416  VGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQ-GLSLGVLNLAIVVPQMLVSLLSG  474

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            P+DA+ GGGN+PAF+VGAV+AA SGI+A+TLLP   +D
Sbjct  475  PFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTAD  512



>gb|ABA08446.1| sucrose transporter type 1 [Manihot esculenta]
Length=436

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 169/218 (78%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ +       LYD+GVRAGALGLML SVVLGF S+G
Sbjct  207  LNWIAWFPFLLFDTDWMGREVYGGDSSGTAYQLKLYDRGVRAGALGLMLNSVVLGFTSLG  266

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTK-AASHSRKYDAHGH---PLLPNSSVK  337
            VE LAR +G VK LW  VNF+LA  L +T+ +TK A SH R     G    PL P   +K
Sbjct  267  VEALARGVGGVKRLWGIVNFVLAFCLCMTILITKLAESHRRFATVAGGATIPLPPPGGIK  326

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGALA+F V+G+P A+T+S+PFA+A I+ + AG+GQ GLSLGVLNL+IV+PQM VS  SG
Sbjct  327  AGALALFAVMGVPQAITYSIPFAMASIFCNTAGAGQ-GLSLGVLNLSIVIPQMVVSVASG  385

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            PWDALFGGGNLPAF+VGAV+AAASGI A+TLLP P+ D
Sbjct  386  PWDALFGGGNLPAFVVGAVAAAASGIFALTLLPFPQGD  423



>ref|XP_004290438.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61909.1| sucrose transporter 3 [Fragaria x ananassa]
Length=504

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 171/217 (79%), Gaps = 12/217 (6%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLL+DTDWM REVYGGEV +  LYD GVRAGALGLML SVVLG +S+G+E+L
Sbjct  278  LNWIAWFPFLLFDTDWMGREVYGGEVGNGRLYDLGVRAGALGLMLNSVVLGCVSLGIEIL  337

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG-------HPLLPNSSVKA  340
            AR LG VK LW  VNF+LAI LA+TV +TK A  +R    HG        P  P + +KA
Sbjct  338  ARALGGVKRLWGLVNFLLAICLAMTVLITKLAQSAR----HGAVSVSGAQPPPPPAGIKA  393

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GALA+F +LGIP A+T+S+PFALA I+ S++G+GQ GLSLGVLNLAIVVPQM VS  SGP
Sbjct  394  GALALFALLGIPQAITYSVPFALASIFCSNSGAGQ-GLSLGVLNLAIVVPQMVVSVASGP  452

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            WDALFGGGNLPAF+VGA++A  SGILA+T+LP P  D
Sbjct  453  WDALFGGGNLPAFVVGAIAAVLSGILALTMLPSPPPD  489



>emb|CDP20704.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 165/210 (79%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPF L+DTDWM REVYGG+V D+ LYD+GV AGALGLML SVVLGF S+GVE  
Sbjct  305  LNWIGWFPFFLFDTDWMGREVYGGKVGDS-LYDRGVHAGALGLMLNSVVLGFASVGVEHS  363

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            AR +G VK LW  VNFILA  LA TV +TK A  +R+ +       P   VK G+LA+F 
Sbjct  364  ARVIGGVKRLWGVVNFILAACLAFTVLITKLADSTRRANGS-----PAEGVKVGSLALFS  418

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLG+PLAVT+S+PFALA I+S+D GSGQ GLSLGVLNLAIVVPQM VS LSG +DALFGG
Sbjct  419  VLGVPLAVTYSIPFALASIFSTDVGSGQ-GLSLGVLNLAIVVPQMLVSLLSGQFDALFGG  477

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF+VGAV+AA SGI+A+T LP P +D
Sbjct  478  GNLPAFVVGAVAAAISGIIALTKLPSPPAD  507



>gb|ABB30163.2| sucrose transport protein SUF1 [Pisum sativum]
Length=511

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 164/216 (76%), Gaps = 5/216 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFPF L+DTDWM  EVYGG   D+  Y++GVRAGA+GLM+ +VVL  MS+ VE L
Sbjct  295  INWIAWFPFFLFDTDWMGHEVYGGNPGDDA-YNRGVRAGAMGLMINAVVLALMSLAVEPL  353

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G  K LW  VN ILA+GLA+T+ +TKAA H R + ++G+   P++ + A + A F 
Sbjct  354  GRFVGGAKRLWGIVNIILAVGLAMTIVITKAAQHER-HVSNGN--TPSAGISAASFAFFA  410

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPLA+ FS+PFALA IYSS +G+GQ GLSLGVLN+AIVVPQM VS LSGPWD+LFGG
Sbjct  411  LLGIPLAINFSVPFALASIYSSASGAGQ-GLSLGVLNIAIVVPQMIVSALSGPWDSLFGG  469

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            GNLPAF+VG  +A  SG+LAI +LP P++     +P
Sbjct  470  GNLPAFVVGIGAAVISGVLAIIILPTPKATDVAKVP  505



>ref|XP_007151866.1| hypothetical protein PHAVU_004G082200g [Phaseolus vulgaris]
 gb|ESW23860.1| hypothetical protein PHAVU_004G082200g [Phaseolus vulgaris]
Length=494

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 163/218 (75%), Gaps = 10/218 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFP++L+DTDWM REVYGG+V     YD GV AG+LGLML SVVL  MS+GVE L
Sbjct  275  INWLAWFPYVLFDTDWMGREVYGGDVGQKA-YDAGVHAGSLGLMLNSVVLAVMSLGVEPL  333

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL---PNSSVKAGALA  352
             R +G VK LW  VN ILA  LALTV +TK A   R  +    P L   P+  VK GA+A
Sbjct  334  GRLVG-VKWLWAMVNVILAACLALTVLITKIAEQQRALN----PALIGDPSMDVKGGAMA  388

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
             F VLGIPLAVT+S+PFALA IYSS +G+GQ GLSLG+LN+AIV+PQM +S +SGPWDA 
Sbjct  389  FFSVLGIPLAVTYSVPFALASIYSSSSGAGQ-GLSLGLLNVAIVIPQMIISAISGPWDAW  447

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVI  646
            FGGGNLPAF++GAV+AA S ILA+ LLP P+ + +  I
Sbjct  448  FGGGNLPAFVLGAVAAAVSAILAVVLLPTPKKEDEAKI  485



>ref|XP_010425915.1| PREDICTED: putative sucrose transport protein SUC6 isoform X1 
[Camelina sativa]
Length=493

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 162/209 (78%), Gaps = 8/209 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG--EVNDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG  E +DN   LY++GV  GALGLML S+VLGF S+G
Sbjct  289  LNWIAWFPFLLFDTDWMGREVYGGSSEGDDNMKRLYNQGVTVGALGLMLNSIVLGFFSLG  348

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV V+K A   RK    G   LP  S+K GAL
Sbjct  349  IEGISRKIG-AKRLWGAVNIILAVCLAMTVLVSKKAEEHRK--TAGALALPTDSIKGGAL  405

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPLA+TFS+PFALA I SS  G+GQ GLSLGVLN+AIV+PQM VSF +GP DA
Sbjct  406  ALFAILGIPLAITFSIPFALASIISSSTGAGQ-GLSLGVLNMAIVIPQMIVSFGAGPVDA  464

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  465  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  493



>gb|KHN00702.1| Sucrose transport protein SUC2 [Glycine soja]
Length=351

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+ WFP+ L+DTDWM REVYGG   ++  Y KGVR G+LGLM+ +VVLGFMS+ VE L
Sbjct  131  VNWVGWFPYFLFDTDWMGREVYGGTAGEDA-YAKGVRVGSLGLMVNAVVLGFMSLAVEPL  189

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLLPNSSVKAGALAI  355
             + +G VK LW  VNFILAIG  +TV +TK A H R+ +  A GHP   +  V  G++  
Sbjct  190  GKMVGGVKRLWAIVNFILAIGFGMTVVITKVAEHQRRMNPAAVGHP---SEGVVVGSMVF  246

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLG+PLA+TFS+PFALA IY S +G+GQ GLSLGVLNLAIVVPQM VS LSGPWD+LF
Sbjct  247  FGVLGVPLAITFSVPFALASIYCSASGAGQ-GLSLGVLNLAIVVPQMVVSALSGPWDSLF  305

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF+VGA +AA S I+AI LLP P+
Sbjct  306  GGGNLPAFMVGAAAAALSAIMAIVLLPTPK  335



>ref|XP_010503136.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Camelina 
sativa]
Length=491

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 162/209 (78%), Gaps = 8/209 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG--EVNDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG  E +DN   LY++GV  GALGLML S+VLGF S+G
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGSSEGDDNMKRLYNQGVTVGALGLMLNSIVLGFFSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV V+K A   RK    G   LP  S+K GAL
Sbjct  347  IEGISRKIG-AKRLWGAVNIILAVCLAMTVLVSKKAEEHRK--TAGALALPTDSIKGGAL  403

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPLA+TFS+PFALA I SS  G+GQ GLSLGVLN+AIV+PQM VSF +GP DA
Sbjct  404  ALFAILGIPLAITFSIPFALASIISSSTGAGQ-GLSLGVLNMAIVIPQMIVSFGAGPVDA  462

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  463  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  491



>gb|ABO31372.1| sucrose transporter 1 [Gossypium hirsutum]
Length=321

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 161/216 (75%), Gaps = 9/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLLYDTDWM  EVYGG+V    +   LYD+GVRAGALGLM+ S+VL F S+G
Sbjct  97   LNWMAWFPFLLYDTDWMGAEVYGGKVKGSASQQKLYDEGVRAGALGLMINSIVLAFASLG  156

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL--PNSSVKAG  343
            +E ++R +G VK +W  VN ILA  LA TV VTK A   R    HG  +L  P +S+K  
Sbjct  157  LEPVSRLIGGVKNMWGVVNLILAACLAATVWVTKVAEAWR--GEHGPQILTPPPTSIKTS  214

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALA+F +LGIPLAVTFS+PFALA IY S+ G GQ GLSLGVLNL+IV+PQM +S +SGP 
Sbjct  215  ALALFGLLGIPLAVTFSIPFALASIYCSEEGGGQ-GLSLGVLNLSIVIPQMIISVISGPI  273

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            DA FGGGNLPAF++G++ AA S +LAI  LP P++ 
Sbjct  274  DAAFGGGNLPAFVLGSILAAISALLAIFALPNPKTQ  309



>gb|AIU94753.1| sucrose proton symporter [Morus alba var. multicaulis]
Length=519

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 167/215 (78%), Gaps = 8/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN-----DNGLYDKGVRAGALGLMLQSVVLGFMSI  166
            LNW+AWFPFLL+DTDWM +EVYGG+V         +YD+GV AGALGLML SVVLGFMS+
Sbjct  293  LNWVAWFPFLLFDTDWMGKEVYGGKVTAAEEGPRRMYDRGVHAGALGLMLNSVVLGFMSL  352

Query  167  GVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGA  346
            GVE +AR LG VK LW  VNFILA+ LALTV +TK A  SR   A      P   V+AGA
Sbjct  353  GVEPVARLLGGVKRLWGVVNFILAVCLALTVLITKMAEASRSGTAAVA--APPVGVRAGA  410

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            LA+F  LG+PLAVT+S+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS  SGPWD
Sbjct  411  LALFAALGVPLAVTYSVPFALASIFSSTSGAGQ-GLSLGVLNLAIVIPQMVVSVASGPWD  469

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            ALFGG NLPAF+VGA+SAA SG+LA+T+LP P  D
Sbjct  470  ALFGGSNLPAFVVGAISAAVSGLLALTMLPSPPPD  504



>ref|XP_007151902.1| hypothetical protein PHAVU_004G085500g [Phaseolus vulgaris]
 gb|ESW23896.1| hypothetical protein PHAVU_004G085500g [Phaseolus vulgaris]
Length=509

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWI WFP+ L+DTDWM REVYGG   ++  Y +GVR G+LGLM+ +VVLGFMS+ VE L
Sbjct  289  VNWIGWFPYFLFDTDWMGREVYGGTAGEDA-YAEGVRVGSLGLMINAVVLGFMSLAVEPL  347

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLLPNSSVKAGALAI  355
             R +G VK LW  VNFILAIG  +TV +TK A H R  +  A GHP   +  VK G++  
Sbjct  348  GRMVGGVKRLWGIVNFILAIGFGMTVVITKMAEHQRHLNPAAVGHP---SDGVKIGSMVF  404

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLG+PLA+TFS+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS LSGPWDALF
Sbjct  405  FAVLGVPLAITFSVPFALASIYSSASGAGQ-GLSLGVLNLAIVVPQMVVSALSGPWDALF  463

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF+VGA +AA S I+AI LLP P+
Sbjct  464  GGGNLPAFMVGAAAAALSAIMAIVLLPTPK  493



>ref|XP_009130919.1| PREDICTED: putative sucrose transport protein SUC6 [Brassica 
rapa]
 emb|CDY11357.1| BnaA03g01930D [Brassica napus]
Length=477

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 163/209 (78%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY++GV AGALGLM+ ++VLGFMS+G
Sbjct  272  LNWIAWFPFLLFDTDWMGREVYGGDSSGNESSKRLYNQGVHAGALGLMINAIVLGFMSLG  331

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA+ LA+TV VTK A   RK    G    P   ++AGAL
Sbjct  332  VEWIGRKMGGAKRLWGVVNFILAVCLAMTVLVTKLADAHRK--TAGVLAGPTDGIRAGAL  389

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I SS++G+GQ GLSLGVLNLAIV+PQM VS  +G +D+
Sbjct  390  TLFGILGIPLAVTFSIPFALASIISSNSGAGQ-GLSLGVLNLAIVIPQMVVSLGAGQFDS  448

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
             FGGGNLP F+VGA++AA SG++AIT+LP
Sbjct  449  WFGGGNLPGFVVGAIAAAISGVVAITVLP  477



>gb|ABB30165.1| sucrose transport protein SUF1 [Phaseolus vulgaris]
Length=509

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWI WFP+ L+DTDWM REVYGG   ++  Y +GVR G+LGLM+ +VVLGFMS+ VE L
Sbjct  289  VNWIGWFPYFLFDTDWMGREVYGGTAGEDA-YAEGVRVGSLGLMINAVVLGFMSLAVEPL  347

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLLPNSSVKAGALAI  355
             R +G VK LW  VNFILAIG  +TV +TK A H R  +  A GHP   +  VK G++  
Sbjct  348  DRMVGGVKRLWGIVNFILAIGFGMTVVITKMAEHQRHLNPAAVGHP---SDGVKIGSMVF  404

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLG+PLA+TFS+PFALA IYSS +G+GQ GLSLGVLNLAIVVPQM VS LSGPWDALF
Sbjct  405  FAVLGVPLAITFSVPFALASIYSSASGAGQ-GLSLGVLNLAIVVPQMVVSALSGPWDALF  463

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF+VGA +AA S I+AI LLP P+
Sbjct  464  GGGNLPAFMVGAAAAALSAIMAIVLLPTPK  493



>gb|AAF65765.1|AF242307_1 sucrose transport protein [Euphorbia esula]
Length=530

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 173/221 (78%), Gaps = 12/221 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN------DNGLYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG  +      ++ LYD+GVRAGALGLML SVVLGF S
Sbjct  300  LNWIAWFPFLLFDTDWMGREVYGGSSDSSATAGESKLYDRGVRAGALGLMLNSVVLGFTS  359

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDA-----HGHPLLPNS  328
            +GVEL+AR+LG VK LW  VNF+LAI LALT+ +TK A   R Y          P  P+S
Sbjct  360  LGVELMARKLGKVKRLWGIVNFLLAICLALTILITKLAESGRHYPTVNGVVSTTPSPPSS  419

Query  329  SVKAGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSF  508
             +KAGAL +F V+GIP A+T+S+PFALA I+S+D+G+GQ GLSLGVLNL+IV+PQM VS 
Sbjct  420  GIKAGALTLFAVMGIPQAITYSVPFALASIFSNDSGAGQ-GLSLGVLNLSIVIPQMLVSV  478

Query  509  LSGPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             SGP+DALFGGGNLPAF+VGAV+AAASG+LA+T LP P  D
Sbjct  479  ASGPFDALFGGGNLPAFVVGAVAAAASGVLALTYLPSPPPD  519



>emb|CDX80991.1| BnaC03g02450D [Brassica napus]
Length=477

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 163/209 (78%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY++GV AGALGLM+ ++VLGFMS+G
Sbjct  272  LNWIAWFPFLLFDTDWMGREVYGGDSSGNESSKRLYNQGVHAGALGLMINAIVLGFMSLG  331

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILA+ LA+TV VTK A   RK    G    P   ++AGAL
Sbjct  332  VEWIGRKMGGAKRLWGVVNFILAVCLAMTVLVTKLADAHRK--TAGVLAGPTDGIRAGAL  389

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I S+++G+GQ GLSLGVLNLAIV+PQM VS  +G +D+
Sbjct  390  TLFAILGIPLAVTFSIPFALASIISNNSGAGQ-GLSLGVLNLAIVIPQMVVSLGAGQFDS  448

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
             FGGGNLP F+VGA++AA SG++AIT+LP
Sbjct  449  WFGGGNLPGFVVGAIAAAISGVVAITVLP  477



>ref|XP_006285493.1| hypothetical protein CARUB_v10006922mg [Capsella rubella]
 gb|EOA18391.1| hypothetical protein CARUB_v10006922mg [Capsella rubella]
Length=494

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 161/209 (77%), Gaps = 8/209 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG--EVNDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG  E +DN   LY++G+  GALGLML S+VLGF S+G
Sbjct  290  LNWIAWFPFLLFDTDWMGREVYGGSSEGDDNMKRLYNQGIHVGALGLMLNSIVLGFFSLG  349

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV VTK A   R+    G   LP   +KAGAL
Sbjct  350  IEGISRKIG-AKRLWGAVNIILAVCLAMTVLVTKKAEEHRR--TAGPMALPTDDIKAGAL  406

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS  G+GQ GLSLGVLN+AIV+PQM VSF +GP DA
Sbjct  407  TLFALLGIPLAITFSIPFALASIISSSTGAGQ-GLSLGVLNMAIVIPQMIVSFGAGPVDA  465

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  466  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  494



>ref|XP_003548078.1| PREDICTED: sucrose transport protein SUC1-like [Glycine max]
Length=511

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 161/210 (77%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+ WFP+ L+DTDWM REVYGG+V ++  Y  GVR G+LGLM+ +VVLGFMS+ VE L
Sbjct  291  VNWVGWFPYFLFDTDWMGREVYGGQVGEDA-YANGVRVGSLGLMVNAVVLGFMSLAVEPL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLLPNSSVKAGALAI  355
             + +G VK LW  VNFILAIG  +TV +TK A H RK +  A GHP   +  V  G++  
Sbjct  350  GKMVGGVKRLWAIVNFILAIGFGMTVVITKVAEHQRKMNPAAVGHP---SEGVVVGSMVF  406

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLG+PLA+TFS+PFALA IY S +G+GQ GLSLGVLNLAIVVPQM VS LSGPWDALF
Sbjct  407  FGVLGVPLAITFSVPFALASIYCSASGAGQ-GLSLGVLNLAIVVPQMVVSTLSGPWDALF  465

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF+VGA +AA S I+AI LLP P+
Sbjct  466  GGGNLPAFMVGAAAAALSAIMAIVLLPTPK  495



>gb|KFK41606.1| hypothetical protein AALP_AA2G150200 [Arabis alpina]
Length=512

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 168/220 (76%), Gaps = 7/220 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG----EVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     LY+KGV +GALGLM  ++VLGFMS+G
Sbjct  291  LNWIAWFPFLLFDTDWMGREVYGGSSEGDERAKKLYNKGVHSGALGLMFNAIVLGFMSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  K LW  VNFILA GLA+TV VTK A   RK    G    P+S V+AGAL
Sbjct  351  IEWIGKKVGGAKRLWGMVNFILAAGLAMTVLVTKFAEDHRK--VAGEFAGPSSGVRAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  409  SLFAVLGIPLAITFSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            LFGGGNLPAFI+ A++AA SG+LA+T+LP P  D   V P
Sbjct  468  LFGGGNLPAFILAAIAAAISGVLALTVLPSPPPDAPAVKP  507



>ref|XP_003548077.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=494

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFP+ L+DTDWM REVYGG+V     YD GV AG+LGLML +VVL  MS+ +E L
Sbjct  274  VNWIAWFPYFLFDTDWMGREVYGGDVGQKA-YDSGVHAGSLGLMLNAVVLAVMSLAIEPL  332

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH--GHPLLPNSSVKAGALAI  355
             R +G +K LW  VN +LAI L +TV +TK A H R  +    G+P L    +K G++  
Sbjct  333  GRVVGGIKWLWGIVNILLAICLGMTVLITKIAEHERLLNPALVGNPSL---GIKVGSMVF  389

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLGIPLA+TFS+PFALA IYSS +G+GQ GLSLGVLN+AIVVPQM VS +SGPWDALF
Sbjct  390  FSVLGIPLAITFSVPFALASIYSSTSGAGQ-GLSLGVLNIAIVVPQMIVSTISGPWDALF  448

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPRS  628
            GGGNLPAF++GAV+A  S ILA+ LLP P+ 
Sbjct  449  GGGNLPAFVLGAVAAVVSAILAVLLLPTPKK  479



>ref|XP_010471205.1| PREDICTED: sucrose transport protein SUC5-like [Camelina sativa]
Length=512

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
             NWIAWFPF+LYDTDWM REVYGG+ + N     LY++GV AGALGLM  S++LGF+S+G
Sbjct  291  FNWIAWFPFILYDTDWMGREVYGGKSDGNEKSKSLYNQGVHAGALGLMFNSILLGFVSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILAI LA+TV VTKAA H RK    G    P+  +KAGAL
Sbjct  351  VEKIGRKLGGAKRLWGLVNFILAIALAMTVLVTKAAEHHRKIA--GPFAGPSPGIKAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLSLGVLN+AIV+PQM +SF SGP+DA
Sbjct  409  SLFTVLGIPLAITFSVPFALASIFSNSSGAGQ-GLSLGVLNIAIVLPQMIISFGSGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+A  SG+LA+T++P    D
Sbjct  468  LFGGGNLPAFVVGAVAAVFSGVLALTVIPSLPPD  501



>ref|XP_004515134.1| PREDICTED: sucrose transport protein SUC5-like [Cicer arietinum]
Length=568

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFPF L+DTDWM REVYGGE  +   Y+ GVRAGALGLML + VL  +S+ VE +
Sbjct  352  INWVAWFPFFLFDTDWMGREVYGGETGEKS-YNDGVRAGALGLMLNAFVLAIVSLVVEPM  410

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G  K LW  VNFILAIGLA+T+ +TKAA H R+   H     P++ VKA A + F 
Sbjct  411  GRLVGGAKRLWGIVNFILAIGLAMTILITKAAEHDRRLTGH---TAPSTGVKAAAFSFFG  467

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLAV FS+PFALA IYSS +G+GQ GLSLGVLN++IVVPQM +S LSGPWDALFGG
Sbjct  468  VLGIPLAVNFSVPFALASIYSSSSGAGQ-GLSLGVLNISIVVPQMIISSLSGPWDALFGG  526

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLPAF+VGAV+A  SGILAI +LP P+ + +
Sbjct  527  GNLPAFVVGAVAAVISGILAIIVLPTPKPEDE  558



>gb|KHN32799.1| Sucrose transport protein SUC2 [Glycine soja]
Length=494

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFP+ L+DTDWM REVYGG+V     YD GV AG+LGLML +VVL  MS+ +E L
Sbjct  274  VNWIAWFPYFLFDTDWMGREVYGGDVGQKA-YDSGVHAGSLGLMLNAVVLAVMSLAIEPL  332

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH--GHPLLPNSSVKAGALAI  355
             R +G +K LW  VN +LAI L +TV +TK A H R  +    G+P L    +K G++  
Sbjct  333  GRVVGGIKWLWGIVNILLAICLGMTVLITKIAEHERLLNPALVGNPSL---GIKVGSMVF  389

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLGIPLA+TFS+PFALA IYSS +G+GQ GLSLGVLN+AIVVPQM VS +SGPWDALF
Sbjct  390  FSVLGIPLAITFSVPFALASIYSSTSGAGQ-GLSLGVLNIAIVVPQMIVSTISGPWDALF  448

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPRS  628
            GGGNLPAF++GAV+A  S ILA+ LLP P+ 
Sbjct  449  GGGNLPAFVLGAVAAVVSAILAVLLLPTPKK  479



>ref|XP_007009466.1| Sucrose transport protein SUC2 [Theobroma cacao]
 gb|EOY18276.1| Sucrose transport protein SUC2 [Theobroma cacao]
Length=488

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 159/211 (75%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM RE+YGG V+ N     LYD GVRAGALGLM+ S+VLGF S+G
Sbjct  268  LNWIAWFPFLLYDTDWMGREIYGGFVDGNATQQKLYDDGVRAGALGLMINSIVLGFTSLG  327

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R +G V  LW GVNFILA  LA TV +TK     R  D HGH L P +++K  AL
Sbjct  328  LENVGRLVGGVTNLWGGVNFILAACLASTVWITKIVEAWR--DKHGH-LAPPNNIKGPAL  384

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            AIF +LGIP AVT+S+PFAL  IY S +G GQ GL+LGVLN++IV+PQMF+S +SGP DA
Sbjct  385  AIFGLLGIPQAVTYSIPFALTSIYCSTSGGGQ-GLALGVLNMSIVIPQMFISVVSGPLDA  443

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G++ AA S +LAI  LP P
Sbjct  444  AFGGGNLPAFVLGSIVAAVSALLAIFALPNP  474



>ref|XP_010419159.1| PREDICTED: sucrose transport protein SUC5-like, partial [Camelina 
sativa]
Length=500

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
             NWIAWFPF+LYDTDWM REVYGG+ + N     LY++GV AGALGLM  S++LGF+S+G
Sbjct  279  FNWIAWFPFILYDTDWMGREVYGGKSDGNEKSKSLYNQGVHAGALGLMFNSILLGFVSVG  338

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILAI LA+TV VTK+A H RK    G    P+  +KAGAL
Sbjct  339  VEWIGRKLGGAKRLWGLVNFILAIALAMTVLVTKSAEHHRKIA--GPFAGPSPGIKAGAL  396

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLSLGVLN+AIV+PQM +SF SGP+DA
Sbjct  397  SLFTVLGIPLAITFSVPFALASIFSNSSGAGQ-GLSLGVLNIAIVIPQMIISFGSGPFDA  455

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+A  SG+LA+T++P    D
Sbjct  456  LFGGGNLPAFVVGAVAAVISGVLALTVIPSLPPD  489



>ref|XP_006599449.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=494

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 160/216 (74%), Gaps = 9/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFP+ L+DTDWM REVYGG+V     YD GV AG+LGLML ++VL  MS+ +E L
Sbjct  274  VNWIAWFPYFLFDTDWMGREVYGGDVGQKA-YDSGVHAGSLGLMLNAMVLAVMSLAIEPL  332

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL---PNSSVKAGALA  352
             R +G +K LW  VN +LAI L +TV +TK A H R  +    P L   P+  +K G++ 
Sbjct  333  GRVVGGIKWLWGIVNILLAICLGMTVLITKIAEHERLLN----PALVGNPSLGIKVGSMV  388

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
             F VLGIPLA+TFS+PFALA IYSS +G+GQ GLSLGVLN+AIVVPQM VS +SGPWDAL
Sbjct  389  FFSVLGIPLAITFSVPFALASIYSSTSGAGQ-GLSLGVLNIAIVVPQMIVSTISGPWDAL  447

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
            FGGGNLPAF++GAV+A  S ILA+ LLP P+   ++
Sbjct  448  FGGGNLPAFVLGAVAAVVSAILAVLLLPTPKKADEV  483



>ref|XP_004291896.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61911.1| sucrose transporter 5 [Fragaria x ananassa]
Length=496

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 161/213 (76%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWF FLL+DTDWM +EVYGG V    LYD GVRAG+LGLML +VVLG MS+G+  L
Sbjct  273  LNWIAWFGFLLFDTDWMGKEVYGGAVGKGRLYDMGVRAGSLGLMLNAVVLGVMSLGIVYL  332

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAAS---HSRKYDAHGHPLLPNSSVKAGALA  352
            AR +   + LW  VNF+LA+ L +T+ VTK A    H+    A   P  P + +KAGAL 
Sbjct  333  ARGVNSARQLWGVVNFLLALCLLMTILVTKLAEKHRHASHVVAGAEPPPPPAGIKAGALL  392

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF +LGIP AVTFS+PFA+A I+ S++G+GQ GLSLGVLN++IVVPQMFVS +SGP D+ 
Sbjct  393  IFAILGIPQAVTFSIPFAMASIFCSNSGAGQ-GLSLGVLNISIVVPQMFVSLVSGPLDSA  451

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGNLPAF++GA++A  SG+LA+TLLP P  D
Sbjct  452  FGGGNLPAFVLGAIAAVVSGVLALTLLPSPPPD  484



>ref|NP_177333.1| sucrose transport protein SUC1 [Arabidopsis thaliana]
 sp|Q39232.1|SUC1_ARATH RecName: Full=Sucrose transport protein SUC1; AltName: Full=Sucrose 
permease 1; AltName: Full=Sucrose-proton symporter 1 
[Arabidopsis thaliana]
 gb|AAG52225.1|AC021665_8 sucrose transport protein SUC1; 26672-28438 [Arabidopsis thaliana]
 emb|CAA53147.1| sucrose-proton symporter [Arabidopsis thaliana]
 gb|AAK83617.1| At1g71880/F17M19_3 [Arabidopsis thaliana]
 gb|AAV97807.1| At1g71880 [Arabidopsis thaliana]
 gb|AEE35247.1| sucrose transport protein SUC1 [Arabidopsis thaliana]
Length=513

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REV+GG+ + N     LY  GV++GA+GLM  S+VLGFMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILA GLA+TV VTK A   RK    G    P++SVKAGAL
Sbjct  352  VEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKFAEDHRK--TAGDLAGPSASVKAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  410  SLFAVLGIPLAITFSTPFALASIFSSCSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIV A++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPAFIVAAIAAAISGVLALTVLPSPPPD  502



>ref|XP_002887396.1| sucrose-proton symporter 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63655.1| sucrose-proton symporter 1 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   242 bits (617),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 166/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ + N     LY  GV++GA+GLM  S+VLGFMS+G
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLG  351

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILA GLA+TV VTK A   RK    G    P+S +KAGAL
Sbjct  352  VEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKLAEDHRK--TAGALAGPSSGIKAGAL  409

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   GP+DA
Sbjct  410  SLFAVLGIPLAITFSTPFALASIFSSCSGAGQ-GLSLGVLNLAIVIPQMIVSLGGGPFDA  468

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAFIV A++AA SG+LA+T+LP P  D
Sbjct  469  LFGGGNLPAFIVAAIAAAISGVLALTVLPSPPPD  502



>gb|AAY87138.1| putative sucrose transporter [Vitis vinifera]
 gb|ADP37123.1| sucrose transporter [Vitis vinifera]
Length=505

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 163/214 (76%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN---GLYDKGVRAGALGLMLQSVVLGFMSIGV  172
            LNWI WFPFLL+DTDWM REVYGG V +     LYD GVRAG+LGLML SVVLG MS+GV
Sbjct  282  LNWIGWFPFLLFDTDWMGREVYGGTVGEGPRGRLYDLGVRAGSLGLMLNSVVLGLMSLGV  341

Query  173  ELLARQLGDVKMLWVGVNFILAIGLALTVAVTK-AASHSRKYDAHGHPLLPNSSVKAGAL  349
            E   R +G VK LW GVNF+LA+ LALTV V+K AAS         HP  P   +KAGAL
Sbjct  342  EFFGRGVGGVKRLWGGVNFLLALCLALTVLVSKLAASWRHSLGGELHP--PPIGIKAGAL  399

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F V+G+PLA+T+S+PFALA I+   +G+GQ GLSLGVLNLAIVVPQM VS  SGPWDA
Sbjct  400  SLFAVMGVPLAITYSIPFALASIFCHSSGAGQ-GLSLGVLNLAIVVPQMMVSVASGPWDA  458

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             FGGGNLPAF+VGA +AA SG+LA+T+LP P  D
Sbjct  459  RFGGGNLPAFVVGAFAAALSGVLALTMLPAPPPD  492



>emb|CAN67869.1| hypothetical protein VITISV_020809 [Vitis vinifera]
Length=505

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 163/214 (76%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN---GLYDKGVRAGALGLMLQSVVLGFMSIGV  172
            LNWI WFPFLL+DTDWM REVYGG V +     LYD GVRAG+LGLML SVVLG MS+GV
Sbjct  282  LNWIGWFPFLLFDTDWMGREVYGGTVGEGPRGRLYDLGVRAGSLGLMLNSVVLGLMSLGV  341

Query  173  ELLARQLGDVKMLWVGVNFILAIGLALTVAVTK-AASHSRKYDAHGHPLLPNSSVKAGAL  349
            E   R +G VK LW GVNF+LA+ LALTV V+K AAS         HP  P   +KAGAL
Sbjct  342  EFFGRGVGGVKRLWGGVNFLLALCLALTVLVSKLAASWRHSLXGELHP--PPIGIKAGAL  399

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F V+G+PLA+T+S+PFALA I+   +G+GQ GLSLGVLNLAIVVPQM VS  SGPWDA
Sbjct  400  SLFAVMGVPLAITYSIPFALASIFCHSSGAGQ-GLSLGVLNLAIVVPQMMVSVASGPWDA  458

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             FGGGNLPAF+VGA +AA SG+LA+T+LP P  D
Sbjct  459  RFGGGNLPAFVVGAFAAALSGVLALTMLPAPPPD  492



>ref|XP_003518348.1| PREDICTED: sucrose transport protein SUC1-like [Glycine max]
Length=511

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+ WFP+ L+DTDWM REVYGG   ++  Y KGVR G+LGLM+ +VVLGFMS+ VE L
Sbjct  291  VNWVGWFPYFLFDTDWMGREVYGGTAGEDA-YAKGVRVGSLGLMVNAVVLGFMSLAVEPL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYD--AHGHPLLPNSSVKAGALAI  355
             + +G VK LW  VNFILAIG  +TV +TK A H R+ +  A GHP   +  V  G++  
Sbjct  350  GKMVGGVKRLWAIVNFILAIGFGMTVVITKVAEHQRRMNPAAVGHP---SEGVVVGSMVF  406

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLG+PLA+TFS+PFALA IY S +G+GQ GLSLGVLNLAIVVPQM VS LSGPWD+LF
Sbjct  407  FGVLGVPLAITFSVPFALASIYCSASGAGQ-GLSLGVLNLAIVVPQMVVSALSGPWDSLF  465

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF+VGA +AA S I+AI LLP P+
Sbjct  466  GGGNLPAFMVGAAAAALSAIMAIVLLPTPK  495



>ref|XP_010673573.1| PREDICTED: sucrose transport protein SUC2-like [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 161/214 (75%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            +NW+AWFPFLL++TDW+ +E+YGG+         +YD GV  G+LGLML ++ LG MSI 
Sbjct  270  MNWVAWFPFLLFNTDWVGKEIYGGDPAGSEAQKVVYDHGVGVGSLGLMLTALTLGLMSIA  329

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            ++ L++ LG  + LW  VNFILA  LALTV VTK+A H+RK    G P  P  +VKAG L
Sbjct  330  IDPLSKVLGGARRLWGVVNFILAAALALTVVVTKSAEHARKLAPPGTP--PPKNVKAGIL  387

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F  +GIP AVTFS+PFALA ++SSD+G+G  GLSLGVLNLAIV+PQMFVS +SGP D 
Sbjct  388  TLFASMGIPQAVTFSIPFALASMFSSDSGAGH-GLSLGVLNLAIVIPQMFVSLISGPLDK  446

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF++GAV+A   GILA+T+LP P S+
Sbjct  447  LFGGGNLPAFMLGAVAAFIDGILALTVLPPPSSN  480



>emb|CAA59113.1| SUC1-sucrose proton symporter [Plantago major]
 emb|CAI59556.1| sucrose transporter [Plantago major]
Length=503

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 157/217 (72%), Gaps = 6/217 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWFPFLLYDTDWM REVYGG+VN + +YD GVRAGA+GLML SVVLG  SI +   
Sbjct  279  LNWIAWFPFLLYDTDWMGREVYGGKVNQS-VYDMGVRAGAIGLMLNSVVLGITSILLYFF  337

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
            ++     K  W+GVN +LA+GLA TV V+  A   R+  A G  L P+  VKA ALAIF 
Sbjct  338  SKGAKAAKTWWLGVNIVLAVGLAGTVWVSYHAKSVRQLGASGEALPPSFEVKASALAIFA  397

Query  362  VLGIPLAVTFSLPFALACIYSS----DAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            +LGIPLAVTFS+PFALA IY S      G+GQ GLSLGV+NL+IV+PQ+ VS  SGP D 
Sbjct  398  ILGIPLAVTFSVPFALAAIYCSRNTNTGGAGQ-GLSLGVMNLSIVIPQIIVSLSSGPLDK  456

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
             FGGGNLPAFI+GAV A  SG+LA  LLP P+ D  +
Sbjct  457  AFGGGNLPAFIMGAVGAVFSGVLAFILLPAPKVDNGV  493



>gb|ABJ51933.1| sucrose transporter 1 [Hevea brasiliensis]
Length=531

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 168/218 (77%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+ N       LYD GVRAGALGLML SVVLGF S+G
Sbjct  300  LNWIAWFPFLLFDTDWMGREVYGGDSNGTAEQVRLYDHGVRAGALGLMLNSVVLGFTSLG  359

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDA----HGHPLLPNSSVK  337
            VE+LAR +G VK LW  VNFILA+ L +T+ +TK A  +R++         PL P   VK
Sbjct  360  VEVLARAVGGVKRLWGIVNFILALCLFMTILITKMAESNRRFTTVRGGATVPLPPPGGVK  419

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
            AGALA+F V+G+P A+T+S+PFALA I+ + AG+GQ GLSLGVLNL+IV+PQM VS  SG
Sbjct  420  AGALALFAVMGVPQAITYSIPFALASIFCNTAGAGQ-GLSLGVLNLSIVIPQMLVSVASG  478

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            PWDALFGGGNLPAF+VGA++AAASGI A TLLP P  D
Sbjct  479  PWDALFGGGNLPAFVVGAIAAAASGIFAFTLLPSPPPD  516



>ref|XP_010428038.1| PREDICTED: sucrose transport protein SUC5-like [Camelina sativa]
Length=512

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 168/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
             NWIAWFPF+LYDTDWM REVYGG+ + N     LY++GV AGALGLM  S++LGF+S+G
Sbjct  291  FNWIAWFPFILYDTDWMGREVYGGKSDGNEKSKSLYNQGVHAGALGLMFNSILLGFVSLG  350

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R+LG  K LW  VNFILAI LA+TV VTKAA   RK    G    P+  +KAGAL
Sbjct  351  VEWIGRKLGGAKRLWGLVNFILAIALAMTVLVTKAAEQHRKI--AGPFAGPSPGIKAGAL  408

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I+S+ +G+GQ GLSLGVLN+AIV+PQM +SF SGP+DA
Sbjct  409  SLFTVLGIPLAITFSVPFALASIFSNSSGAGQ-GLSLGVLNIAIVIPQMIISFGSGPFDA  467

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            LFGGGNLPAF+VGAV+A  SG+LA+T++P    D
Sbjct  468  LFGGGNLPAFVVGAVAAVISGVLALTVIPSLPPD  501



>ref|NP_001268070.1| sucrose transporter-like [Vitis vinifera]
 gb|AAF08331.1|AF021810_1 putative sucrose transporter [Vitis vinifera]
Length=505

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 163/214 (76%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN---GLYDKGVRAGALGLMLQSVVLGFMSIGV  172
            LNWI WFPFLL+DTDWM REVYGG V +     LYD GVRAG+LGLML SVVLG MS+GV
Sbjct  282  LNWIGWFPFLLFDTDWMGREVYGGTVGEGPRGRLYDLGVRAGSLGLMLNSVVLGLMSLGV  341

Query  173  ELLARQLGDVKMLWVGVNFILAIGLALTVAVTK-AASHSRKYDAHGHPLLPNSSVKAGAL  349
            E   R +G VK LW GVNF+LA+ LALTV V+K AAS         HP  P   +KAGAL
Sbjct  342  EFFGRGVGGVKRLWGGVNFLLALCLALTVLVSKLAASWRHSLGGELHP--PPIGIKAGAL  399

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F V+G+PLA+T+S+PFALA I+   +G+GQ GLSLGVLNLAIVVPQM VS  SGPWDA
Sbjct  400  SLFAVMGVPLAITYSIPFALASIFCHSSGAGQ-GLSLGVLNLAIVVPQMMVSVASGPWDA  458

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
             FGGGNLPAF+VGA +AA +G+LA+T+LP P  D
Sbjct  459  RFGGGNLPAFVVGAFAAALNGVLALTMLPAPPPD  492



>gb|KHG14831.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=494

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 161/213 (76%), Gaps = 5/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM  EV+GG+V    ++  LYD GVRAGALGLM+ S+VL   S+G
Sbjct  275  LNWIAWFPFLLYDTDWMGVEVFGGKVKGSSSEQKLYDDGVRAGALGLMINSIVLAVTSLG  334

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R +G VK LW  VNFILA GLA TV +TK A   R          P S+VK+ AL
Sbjct  335  LEPVSRFVGGVKNLWGVVNFILAAGLAGTVWITKVAEAWRAKQGLQILTSPPSNVKSFAL  394

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LGIPL+VTFS+PFALA IY +DAG GQ GLSLGVLNL+IV+PQMFVS +SGP DA
Sbjct  395  AVFGLLGIPLSVTFSIPFALASIYCADAGGGQ-GLSLGVLNLSIVIPQMFVSVISGPLDA  453

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRS  628
             FGGGNLPAF++G++ AA S +LAI  LP P++
Sbjct  454  AFGGGNLPAFLLGSIVAAISALLAIFALPNPKN  486



>ref|XP_007151897.1| hypothetical protein PHAVU_004G085100g [Phaseolus vulgaris]
 gb|ESW23891.1| hypothetical protein PHAVU_004G085100g [Phaseolus vulgaris]
Length=503

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 165/210 (79%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFP++LYDTDWM REVYGGEV  N  YD GV AG+LGLML SVVL  MS+ VE L
Sbjct  283  INWVAWFPYVLYDTDWMGREVYGGEVGSNA-YDNGVHAGSLGLMLNSVVLAVMSLVVEPL  341

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH--GHPLLPNSSVKAGALAI  355
             R +G VK LW  VN ILA+ +A+TV +TKAA H R +D    GHP   +  VKAGA++ 
Sbjct  342  GRIVGGVKWLWAAVNVILAVCMAMTVVITKAARHERNHDGVLVGHP---SFGVKAGAMSF  398

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F +LGIPLA+T+S+PFALA IYSS +G+GQ GLSLG+LN+AIVVPQM VS +SGPWD+ F
Sbjct  399  FSILGIPLAITYSVPFALASIYSSTSGAGQ-GLSLGLLNVAIVVPQMIVSAISGPWDSWF  457

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF++GAV+AA S +LA+ +LP P+
Sbjct  458  GGGNLPAFVLGAVAAAVSAVLAVVMLPSPK  487



>ref|XP_007020263.1| Sucrose-proton symporter 2 isoform 1 [Theobroma cacao]
 gb|EOY17488.1| Sucrose-proton symporter 2 isoform 1 [Theobroma cacao]
 gb|AHH34925.1| sucrose transporter 3 isoform 1 [Theobroma cacao]
Length=494

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 159/213 (75%), Gaps = 10/213 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM  EVYGG+V  N     +Y  GVRAGALGLM+ S+VLG  S+ 
Sbjct  272  LNWIAWFPFLLFDTDWMGTEVYGGKVKGNANQVKMYSDGVRAGALGLMINSIVLGLTSLA  331

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG--HPLLPNSSVKAG  343
            +E + R +G VK LW  VNFIL   LA TV +TK A   RK++     HP L   ++K  
Sbjct  332  LEPVGRLIGGVKNLWAIVNFILCACLASTVLITKIAEAWRKHNGADLVHPPL---NIKGS  388

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALA+F +LGIPLAVTFS+PFALA IY S+AG GQ GLSLGVLN++IV+PQMFVS +SGP 
Sbjct  389  ALAVFGLLGIPLAVTFSIPFALASIYCSNAGGGQ-GLSLGVLNMSIVIPQMFVSVVSGPL  447

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
            DA FGGGNLPAF++G+++AA S +LAI  LPKP
Sbjct  448  DAAFGGGNLPAFVLGSMAAAVSALLAILALPKP  480



>ref|XP_006286640.1| hypothetical protein CARUB_v10002510mg [Capsella rubella]
 gb|EOA19538.1| hypothetical protein CARUB_v10002510mg [Capsella rubella]
Length=490

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 158/209 (76%), Gaps = 8/209 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG--EVNDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM RE+YGG  E +D    LY++GV  GALGLML S+VLGF S+G
Sbjct  286  LNWIAWFPFLLFDTDWMGREIYGGSSEGDDKMKKLYNQGVHVGALGLMLNSIVLGFFSLG  345

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E  +R++G  K LW  VN ILA+ LA+TV VTK A   R+    G   LP   +KAGAL
Sbjct  346  IEGTSRKIG-AKRLWGAVNIILAVCLAMTVLVTKKAEEHRR--NVGAMALPTDDIKAGAL  402

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS  G+GQ GLSLGVLN+AIV+PQM VSF  GP DA
Sbjct  403  TLFALLGIPLAITFSIPFALASIISSSTGAGQ-GLSLGVLNMAIVIPQMIVSFGVGPIDA  461

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  462  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  490



>gb|AHH34929.1| sucrose transporter 6 [Theobroma cacao]
Length=488

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 157/211 (74%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM RE+YGG V+ N     LYD GVRAGALGLM+ S+VLGF S+G
Sbjct  268  LNWIAWFPFLLYDTDWMGREIYGGYVDGNATQQKLYDDGVRAGALGLMINSIVLGFTSLG  327

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R +G V  LW GVNFILA  LA TV +TK     R  D HG  L P +++K  AL
Sbjct  328  LENVGRLVGGVTNLWGGVNFILAACLASTVWITKIVEAWR--DKHGL-LAPPNNIKGPAL  384

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             IF +LGIP AVT+S+PFAL  IY S +G GQ GL+LGVLN++IV+PQMF+S +SGP DA
Sbjct  385  TIFGLLGIPQAVTYSIPFALTSIYCSTSGGGQ-GLALGVLNMSIVIPQMFISVVSGPLDA  443

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G++ AA S +LAI  LP P
Sbjct  444  AFGGGNLPAFVLGSIVAAVSALLAIFALPNP  474



>gb|AHH34922.1| sucrose transporter 1 isoform 2 [Theobroma cacao]
Length=527

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 169/217 (78%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   N L    Y++GVRAGALGLML SVVLGF S+G
Sbjct  300  LNWIAWFPFLLFDTDWMGREVYGGDSQGNNLVLRLYNRGVRAGALGLMLNSVVLGFTSLG  359

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VELLAR +G VK LW  +NF+ A  LA+TV VTK A  +R++   D    PL P + VKA
Sbjct  360  VELLARGVGGVKRLWGIINFLHAFCLAMTVLVTKLAKSNRRFATMDGVTVPLPPGAGVKA  419

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GAL++F  LGIPLAVT+S+PFALA I+SS +G+GQ GLSLGVLNL IV+PQ+ VS  SGP
Sbjct  420  GALSLFAALGIPLAVTYSIPFALASIFSSSSGAGQ-GLSLGVLNLGIVMPQILVSLGSGP  478

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            +DA+FGGGNLPAF +GA +AAASGI A+T+LP P  D
Sbjct  479  FDAIFGGGNLPAFGLGAFAAAASGIFALTMLPSPPPD  515



>gb|ABF06447.1| putative sucrose transport protein SUT1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=304

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+GVE L
Sbjct  139  LNWIEWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLGVEFL  198

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
              ++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  199  GXKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  258

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFV  502
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLA+VVPQM V
Sbjct  259  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAMVVPQMLV  304



>gb|ABF06446.1| putative sucrose transport protein SUT1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=303

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPF LYDTDWMA+EVYGG+V D  LYD GV AGALGL+L SVVLGFMS+ VE L
Sbjct  139  LNWITWFPFFLYDTDWMAKEVYGGKVGDGRLYDLGVHAGALGLLLNSVVLGFMSLSVEFL  198

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             +++G VK LW  +NF+LA+ +ALTV VTK A  SR+YDAHG  + P S VK GAL +F 
Sbjct  199  GKKIGGVKRLWGILNFVLAVCMALTVLVTKMAEKSRQYDAHGTLMAPTSGVKIGALTLFA  258

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQM  496
            VLGIPLAVTFS+PFALA I+SS+AGSGQ GLSLGVLNLAIVVPQM
Sbjct  259  VLGIPLAVTFSVPFALASIFSSNAGSGQ-GLSLGVLNLAIVVPQM  302



>emb|CAE53179.1| sucrose transporter [Arabidopsis thaliana]
Length=492

 Score =   236 bits (602),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 155/209 (74%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM REVYGG+   +     LY++G+  G LGLML S+VLG MS+G
Sbjct  287  LNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGGLGLMLNSIVLGCMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV VTK A   RK    G   LP   ++AGAL
Sbjct  347  IEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAGEHRKI--AGPMALPTDGIRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F  LGIPL +TFS+PF LA I SS +G+GQ GLSLGVLN+AIV+PQM VSF  GP DA
Sbjct  405  TLFAFLGIPLVITFSIPFVLAFINSSSSGAGQ-GLSLGVLNMAIVIPQMVVSFGVGPIDA  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A ++LP
Sbjct  464  LFGGGNLPGFVVGAITAAISSVVAFSVLP  492



>gb|KHG00539.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=494

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 155/212 (73%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM +E+YGGE   +     LY  GVRAGALGLM+ S+VLG  S+G
Sbjct  272  LNWIAWFPFLLFDTDWMGKEIYGGEAKGDAHKIKLYGDGVRAGALGLMINSIVLGLTSLG  331

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL-PNSSVKAGA  346
            +E   R +G VK LW  VNFIL   LA TV +TK A   R++  HG PL  P  ++   A
Sbjct  332  LEPAGRLIGGVKNLWAIVNFILCACLASTVLITKMAEAWRQH--HGSPLTHPPLNITGSA  389

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            LA+F VLGIPLAVT+S+PFALA IY S  G GQ GLSLGVLNL+IV+PQMFVS +SGP D
Sbjct  390  LAVFGVLGIPLAVTYSIPFALASIYCSSTGGGQ-GLSLGVLNLSIVIPQMFVSVISGPLD  448

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
              FGGGNLPAF++G+++AA S +LAI  LP P
Sbjct  449  DAFGGGNLPAFVLGSIAAAVSALLAILALPNP  480



>gb|ABB30164.1| sucrose transport protein SUT1 [Phaseolus vulgaris]
Length=503

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 164/210 (78%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFP++LYDTDWM REVYGGEV  N  YD GV AG+LGLML SVVL  MS+ VE L
Sbjct  283  INWVAWFPYVLYDTDWMGREVYGGEVGSNA-YDNGVHAGSLGLMLNSVVLAVMSLVVEPL  341

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH--GHPLLPNSSVKAGALAI  355
             R +G VK LW  VN ILA+ +A+TV +TKAA H R +D    GHP   +  VKAGA++ 
Sbjct  342  GRVVGGVKWLWAAVNVILAVCMAMTVVITKAARHERNHDGVLVGHP---SFGVKAGAMSF  398

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F +LGIPLA+T+S+PFALA IYSS +G+GQ GLSLG+LN+AIVVPQM VS +SGPW + F
Sbjct  399  FSILGIPLAITYSVPFALASIYSSTSGAGQ-GLSLGLLNVAIVVPQMIVSAISGPWGSWF  457

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF++GAV+AA S +LA+ +LP P+
Sbjct  458  GGGNLPAFVLGAVAAAVSAVLAVVMLPSPK  487



>ref|XP_003610412.1| Sucrose transport protein [Medicago truncatula]
 gb|AES92609.1| sucrose transporter 2 [Medicago truncatula]
 gb|AFK47244.1| unknown [Medicago truncatula]
 gb|AFM28286.1| SUT1-3 [Medicago truncatula]
Length=511

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFPF L+DTDWM REVYGG V DN  Y  GVRAGALGLM+ + VL  MS+GVE L
Sbjct  291  INWVAWFPFFLFDTDWMGREVYGGNVGDN-TYAAGVRAGALGLMINAFVLAIMSLGVEPL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G  K LW  VN ILAI LA+TV +TKAA H R+    G   LP+  VKA A + F 
Sbjct  350  GRFIGGAKRLWGIVNIILAIALAMTVVITKAAEHERRVSPGG-TTLPSGHVKAAAFSFFG  408

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIPLA+ FS+PFALA IYS+ +G+GQ GLSLGVLN+AIVVPQM VS LSGPWDALFGG
Sbjct  409  VLGIPLAINFSVPFALASIYSTSSGAGQ-GLSLGVLNIAIVVPQMIVSSLSGPWDALFGG  467

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRS  628
            GNLPAF+V AV+A  S +LA+ +LP P+S
Sbjct  468  GNLPAFVVDAVAAVISAVLAVIILPTPKS  496



>gb|KCW71037.1| hypothetical protein EUGRSUZ_F04137 [Eucalyptus grandis]
Length=485

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 161/217 (74%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPF+LYDTDWM  EV+GG+         LYD GVRAG++GL++ SVVLGF S+ 
Sbjct  264  LNWIAWFPFILYDTDWMGLEVWGGKAQGTPEQKRLYDLGVRAGSMGLLINSVVLGFGSLV  323

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + + +G VK  W  VNFILA+GLA TV VT+AA   R+   HG  + P S++KAGA 
Sbjct  324  VEPVGKLVGGVKRWWAIVNFILAVGLACTVPVTRAAEAYRRI--HGL-VPPPSNIKAGAF  380

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             IF VLGIPL+VT+S+PFALA IYSS  G+GQ GLSLGVLN+AIV+PQM VS +SG  D 
Sbjct  381  GIFSVLGIPLSVTYSIPFALASIYSSSGGAGQ-GLSLGVLNMAIVIPQMIVSVVSGKIDQ  439

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
             FGGGNLPAFI+GA++A  S ++A+ +LP P +D  I
Sbjct  440  AFGGGNLPAFIMGAIAAVISSLMALFVLPNPPADASI  476



>gb|KHG01351.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=500

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 160/216 (74%), Gaps = 9/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLLYDTDWM  EVYGG+V    +   LYD+GVRAGALGLM+ S+VL F S+G
Sbjct  276  LNWMAWFPFLLYDTDWMGAEVYGGKVKGSASQQKLYDEGVRAGALGLMINSIVLAFASLG  335

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL--PNSSVKAG  343
            +E ++R +G VK +W  VN ILA  LA TV +TK A   R    HG  +L  P + +K  
Sbjct  336  LEPVSRLIGGVKNMWGVVNLILAACLAGTVWITKVAEAWR--GEHGPQILTPPPTRIKTS  393

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            ALA+F +LGIPLAVTFS+PFALA IY S+ G GQ GLSLGVLNL+IV+PQM +S +SGP 
Sbjct  394  ALALFGLLGIPLAVTFSIPFALASIYCSEEGGGQ-GLSLGVLNLSIVIPQMIISVISGPI  452

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            DA FGGGNLPAF++G++ AA S +LAI  LP P++ 
Sbjct  453  DAAFGGGNLPAFVLGSILAAISALLAIFALPNPKTQ  488



>ref|XP_010063779.1| PREDICTED: sucrose transport protein SUC2-like [Eucalyptus grandis]
Length=494

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 161/217 (74%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPF+LYDTDWM  EV+GG+         LYD GVRAG++GL++ SVVLGF S+ 
Sbjct  273  LNWIAWFPFILYDTDWMGLEVWGGKAQGTPEQKRLYDLGVRAGSMGLLINSVVLGFGSLV  332

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + + +G VK  W  VNFILA+GLA TV VT+AA   R+   HG  + P S++KAGA 
Sbjct  333  VEPVGKLVGGVKRWWAIVNFILAVGLACTVPVTRAAEAYRRI--HGL-VPPPSNIKAGAF  389

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             IF VLGIPL+VT+S+PFALA IYSS  G+GQ GLSLGVLN+AIV+PQM VS +SG  D 
Sbjct  390  GIFSVLGIPLSVTYSIPFALASIYSSSGGAGQ-GLSLGVLNMAIVIPQMIVSVVSGKIDQ  448

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
             FGGGNLPAFI+GA++A  S ++A+ +LP P +D  I
Sbjct  449  AFGGGNLPAFIMGAIAAVISSLMALFVLPNPPADASI  485



>ref|XP_010540294.1| PREDICTED: sucrose transport protein SUC2-like [Tarenaya hassleriana]
Length=516

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 157/211 (74%), Gaps = 10/211 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG------LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG ++ N       LY  GVR G LGLML ++VLGF+S
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGNLDANADAVSKKLYYAGVRMGTLGLMLNAIVLGFIS  346

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +GVE + R++G  K LW  VNFILAI LA+TV VTK A     + A G  + P + VKAG
Sbjct  347  LGVEWVGRKMGGAKRLWGVVNFILAICLAMTVLVTKQAEA--HWRAVGEKVPPTADVKAG  404

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            AL IF VLGIP A+TFS PFALA I+SS +G+GQ GLSLGVLNLAIV+PQM VS   G +
Sbjct  405  ALTIFAVLGIPQAITFSTPFALASIFSSSSGAGQ-GLSLGVLNLAIVIPQMVVSLGGGLF  463

Query  524  DALF-GGGNLPAFIVGAVSAAASGILAITLL  613
            D +F GGGNLP F+VGA++AA SG+LA T+L
Sbjct  464  DEMFGGGGNLPGFVVGAIAAALSGVLAFTVL  494



>gb|AFM28285.1| SUT1-2 [Medicago truncatula]
 gb|KEH26077.1| sucrose transporter [Medicago truncatula]
Length=508

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 159/212 (75%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFPF L+DTDWM +EVYGG+  DN  Y KGVR GALGLML + VL FMS+ VE L
Sbjct  291  INWVAWFPFFLFDTDWMGQEVYGGKPGDNA-YSKGVRVGALGLMLNAFVLAFMSLAVEPL  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL--PNSSVKAGALAI  355
             R +G  K LW  VN ILAIGLA+TV +TK A H R    H   L+  P++ VKA AL  
Sbjct  350  GRLVGGAKRLWGIVNIILAIGLAMTVLITKMAEHER----HISNLVGKPSNGVKAAALGF  405

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F VLGIPLA+ FS+PFALA IYSS +G+GQ GLSLGVLN++IVVPQM VS LSG WD+LF
Sbjct  406  FGVLGIPLAINFSVPFALASIYSSSSGAGQ-GLSLGVLNISIVVPQMIVSALSGQWDSLF  464

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GGGNLPAF+VGAV+A  S  LAI LLP P+ D
Sbjct  465  GGGNLPAFVVGAVAAVISATLAIILLPTPKPD  496



>emb|CBI18537.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN--DNGLYDKGVRAGALGLMLQSVVLGFMSIGVE  175
            LNW+AWF FLL+DTDWM +EVYGG V   ++ LYD+GV AG+LGLML S+VLG MS+ +E
Sbjct  139  LNWLAWFGFLLFDTDWMGKEVYGGTVKGKESKLYDRGVHAGSLGLMLNSLVLGLMSLAIE  198

Query  176  LLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSR-KYDAHGHPLLPNSSVKAGALA  352
              AR +G VK +W   NFILAI L LTVAVTK A  SR +  A G  L+P ++VK  AL 
Sbjct  199  PAARLMGGVKRVWGIGNFILAICLGLTVAVTKMAQSSRHEAAAEGRSLMPPANVKIFALT  258

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF +LGIP A+T+S+PFALA IYS+ +G+GQ GLSLGVLN+AIV+PQ+ VS +SG  D L
Sbjct  259  IFALLGIPQAITYSIPFALASIYSNASGAGQ-GLSLGVLNMAIVLPQILVSAVSGLLDDL  317

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKP  622
            FGGGNLP F+ GA++AAASG+ A+T+LP P
Sbjct  318  FGGGNLPVFVAGAIAAAASGVFALTILPSP  347



>ref|XP_004515590.1| PREDICTED: sucrose transport protein SUC2-like [Cicer arietinum]
Length=509

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 157/212 (74%), Gaps = 2/212 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFPF L+DTDWM REVYGG+  +   YD GVR G+LGLML +VVL  MS+ VE L
Sbjct  289  VNWIAWFPFFLFDTDWMGREVYGGDAGEKA-YDTGVRFGSLGLMLNAVVLALMSLAVEPL  347

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             + +G +K LW  VN ILAIGLA+TV +TK A   R+         P+  VKAGA+  F 
Sbjct  348  GKMVGGIKRLWGIVNIILAIGLAMTVLITKMAEQERQLSGGATVGNPSKGVKAGAILFFA  407

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIP A+TFS+PFALA IY S +G+GQ GLSLGVLNLAIVVPQM VS LSGPWDALFGG
Sbjct  408  VLGIPCAITFSVPFALASIYCSASGAGQ-GLSLGVLNLAIVVPQMVVSTLSGPWDALFGG  466

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLPAF+ GAV+A  S ILAI LLP P+ D +
Sbjct  467  GNLPAFVAGAVAAVVSAILAIVLLPTPKPDDE  498



>emb|CDX98907.1| BnaC09g49280D [Brassica napus]
Length=492

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   N     LY++GV  GALGLML ++VLGFMS+G
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGDSGGNEISKRLYNQGVHVGALGLMLNAIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE ++R++G  K LW  VNFILA+ L +TV VTK A   RK    G    P   V+AGAL
Sbjct  347  VEWISRKMGGAKRLWGVVNFILAVCLGMTVLVTKLADDHRK--TAGEFAGPTGGVRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I SS +G+GQ GLSLGVLNLAIV+PQM VS  SGP+D+
Sbjct  405  TLFALLGIPLAVTFSIPFALASIISSSSGAGQ-GLSLGVLNLAIVIPQMVVSLGSGPFDS  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
             FGGGNLP F+VGA++AA SG++AIT+LP
Sbjct  464  WFGGGNLPGFVVGAIAAALSGVVAITVLP  492



>ref|XP_004289897.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61912.1| sucrose transporter 6 [Fragaria x ananassa]
Length=498

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 154/213 (72%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWF FLL+DTDWM +EVYGG V    LY+ GVRAG+LGLML + VLG MS+ +   
Sbjct  275  LNWVAWFGFLLFDTDWMGKEVYGGVVGKGRLYEMGVRAGSLGLMLNAFVLGAMSLAIVYF  334

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH---GHPLLPNSSVKAGALA  352
            +R +   K +W   NF LAI L +T+ VTK A + R  +       P  P + VKAGAL 
Sbjct  335  SRGVNGPKRIWGVANFFLAICLLMTIVVTKMAENYRHANPAVGGAEPSPPPAGVKAGALL  394

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF  LGIP AVTFS+PFA+A I+ S++G+GQ GLSLGVLN+AIVVPQMFVS +SGP DA 
Sbjct  395  IFAALGIPQAVTFSIPFAMASIFCSNSGAGQ-GLSLGVLNIAIVVPQMFVSVISGPLDAS  453

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGNLPAF++GAV+A  SGILA+ +LP P  D
Sbjct  454  FGGGNLPAFVLGAVAAVISGILALIVLPSPPPD  486



>gb|KEH25698.1| sucrose proton symporter 2 [Medicago truncatula]
Length=511

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 164/215 (76%), Gaps = 4/215 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFPF L+DTDWM REVYGG V+    YD GVR G+LGLML +VVLG MS+ VE L
Sbjct  292  VNWIAWFPFFLFDTDWMGREVYGG-VSGEKAYDTGVRVGSLGLMLNAVVLGLMSLAVEPL  350

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             + +G +K LW  VNFILAI LA+TV +TK A H R+         P+  +K GA+  F 
Sbjct  351  GKLVGGIKRLWGIVNFILAICLAMTVLITKIAEHERQTSGGATIGHPSDGIKVGAMLFFA  410

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIP+A+TFS+PFALA IYSS +G+GQ GLS+GVLNLAIVVPQMFVS LSGPWDA+FGG
Sbjct  411  ILGIPMAITFSVPFALASIYSSASGAGQ-GLSIGVLNLAIVVPQMFVSALSGPWDAIFGG  469

Query  542  GNLPAFIVGAVSAAASGILAITLLP--KPRSDGKI  640
            GNLPAF+VGAV+AA S +LA+ LLP  KP  + K+
Sbjct  470  GNLPAFVVGAVAAAVSAVLAMVLLPSVKPADEAKV  504



>gb|AFU61910.1| sucrose transporter 4 [Fragaria x ananassa]
Length=492

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 154/213 (72%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWF FLL+DTDWM +EVYGG V    LY+ GVRAG+LGLML + VLG MS+ +   
Sbjct  269  LNWVAWFGFLLFDTDWMGKEVYGGIVGKGRLYEMGVRAGSLGLMLNAFVLGAMSLAIVYF  328

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH---GHPLLPNSSVKAGALA  352
            ++ +   K +W   NF LAI L +T+ VTK A + R  +       PL P + VKAGAL 
Sbjct  329  SKGVNGPKRIWGVANFFLAICLLMTIVVTKMAENYRHANPTVGGAEPLPPPAGVKAGALL  388

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF  LGIP AVTFS+PFA+A I+ S++G+GQ GLSLGVLN+AIVVPQMFVS +SGP D  
Sbjct  389  IFAALGIPQAVTFSIPFAMASIFCSNSGAGQ-GLSLGVLNIAIVVPQMFVSVISGPLDGS  447

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGNLPAF++GAV+A  SGILA+ +LP P  D
Sbjct  448  FGGGNLPAFVLGAVAAVISGILALVVLPSPPPD  480



>ref|XP_002871200.1| sucrose-proton symporter 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47459.1| sucrose-proton symporter 6 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDW+ REVYGG+   +     LY++G++ G+LGLML S+VLGFMS+G
Sbjct  287  LNWIAWFPFLLYDTDWVGREVYGGDSKGDDKMKKLYNQGIQVGSLGLMLNSIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV VTK A   RK    G   LP   ++AGAL
Sbjct  347  IEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRKI--AGPMALPTDGIRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS +G+GQ GLSLGVLN+AIV+PQM VSF  GP DA
Sbjct  405  TLFALLGIPLAITFSIPFALASIISSSSGAGQ-GLSLGVLNMAIVIPQMVVSFAVGPIDA  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  464  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  492



>ref|XP_004291895.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 154/213 (72%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNW+AWF FLL+DTDWM +EVYGG V    LY+ GVRAG+LGLML + VLG MS+ +   
Sbjct  275  LNWVAWFGFLLFDTDWMGKEVYGGIVGKGRLYEMGVRAGSLGLMLNAFVLGAMSLAIVYF  334

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH---GHPLLPNSSVKAGALA  352
            ++ +   K +W   NF LAI L +T+ VTK A + R  +       PL P + VKAGAL 
Sbjct  335  SKGVNGPKRIWGVANFFLAICLLMTIVVTKMAENYRHANPTVGGAEPLPPPAGVKAGALL  394

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF  LGIP AVTFS+PFA+A I+ S++G+GQ GLSLGVLN+AIVVPQMFVS +SGP D  
Sbjct  395  IFAALGIPQAVTFSIPFAMASIFCSNSGAGQ-GLSLGVLNIAIVVPQMFVSVISGPLDGS  453

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGNLPAF++GAV+A  SGILA+ +LP P  D
Sbjct  454  FGGGNLPAFVLGAVAAVISGILALVVLPSPPPD  486



>emb|CDY60441.1| BnaA10g30480D [Brassica napus]
Length=492

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+         LY++GV  GALGLML ++VLGFMS+G
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGDSGGSEITKKLYNQGVHVGALGLMLNAIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE ++R++G  K LW  VNFILA+ L +TV VTK A   RK    G    P + V+AGAL
Sbjct  347  VEWISRKMGGAKRLWGVVNFILAMCLGMTVLVTKLADDHRK--TAGEFAGPTNGVRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I SS +G+GQ GLSLGVLNLAIV+PQ+ VS  SGP+D+
Sbjct  405  TLFALLGIPLAVTFSIPFALASIISSSSGAGQ-GLSLGVLNLAIVIPQLVVSLGSGPFDS  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
             FGGGNLP F+VGA++AA SG++A+T+LP
Sbjct  464  WFGGGNLPGFVVGAIAAALSGVVALTVLP  492



>gb|AHH34921.1| sucrose transporter 1 isoform 1 [Theobroma cacao]
Length=536

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 169/226 (75%), Gaps = 17/226 (8%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   N L    Y++GVRAGALGLML SVVLGF S+G
Sbjct  300  LNWIAWFPFLLFDTDWMGREVYGGDSQGNNLVLRLYNRGVRAGALGLMLNSVVLGFTSLG  359

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VELLAR +G VK LW  +NF+ A  LA+TV VTK A  +R++   D    PL P + VKA
Sbjct  360  VELLARGVGGVKRLWGIINFLHAFCLAMTVLVTKLAKSNRRFATMDGVTVPLPPGAGVKA  419

Query  341  GALAIFCVLGIPLA---------VTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQ  493
            GAL++F  LGIPLA         VT+S+PFALA I+SS +G+GQ GLSLGVLNL IV+PQ
Sbjct  420  GALSLFAALGIPLAGNPIQKIEKVTYSIPFALASIFSSSSGAGQ-GLSLGVLNLGIVMPQ  478

Query  494  MFVSFLSGPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            + VS  SGP+DA+FGGGNLPAF +GA +AAASGI A+T+LP P  D
Sbjct  479  IPVSLGSGPFDAIFGGGNLPAFGLGAFAAAASGIFALTMLPSPPPD  524



>ref|XP_009122220.1| PREDICTED: putative sucrose transport protein SUC6 [Brassica 
rapa]
Length=492

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+         LY++GV  GALGLML ++VLGFMS+G
Sbjct  287  LNWIAWFPFLLFDTDWMGREVYGGDSGGSEITKKLYNQGVHVGALGLMLNAIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE ++R++G  K LW  VNFILA+ L +TV VTK A   R+    G    P + V+AGAL
Sbjct  347  VEWISRKMGGAKRLWGVVNFILAVCLGMTVLVTKLAEDHRR--TAGEFAGPTNGVRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVTFS+PFALA I SS +G+GQ GLSLGVLNLAIV+PQ+ VS  SGP+D+
Sbjct  405  TLFALLGIPLAVTFSIPFALASIISSSSGAGQ-GLSLGVLNLAIVIPQLVVSLGSGPFDS  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
             FGGGNLP F+VGA++AA SG++A+T+LP
Sbjct  464  WFGGGNLPGFVVGAIAAALSGVVALTVLP  492



>ref|NP_199174.1| putative sucrose transport protein SUC6 [Arabidopsis thaliana]
 sp|Q6A329.2|SUC6_ARATH RecName: Full=Putative sucrose transport protein SUC6; AltName: 
Full=Sucrose permease 6; AltName: Full=Sucrose-proton symporter 
6 [Arabidopsis thaliana]
 dbj|BAB11624.1| sucrose transporter protein [Arabidopsis thaliana]
 gb|AED94987.1| putative sucrose transport protein SUC6 [Arabidopsis thaliana]
Length=492

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 158/209 (76%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM REVYGG+   +     LY++G+  G LGLML S+VLGFMS+G
Sbjct  287  LNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGGLGLMLNSIVLGFMSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV VTK A   R+    G   LP   ++AGAL
Sbjct  347  IEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI--AGPMALPTDGIRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS +G+GQ GLSLGVLN+ IV+PQM VSF  GP DA
Sbjct  405  TLFALLGIPLAITFSIPFALASIISSSSGAGQ-GLSLGVLNMTIVIPQMVVSFGVGPIDA  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A ++LP
Sbjct  464  LFGGGNLPGFVVGAIAAAISSVVAFSVLP  492



>ref|XP_004298889.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
 gb|AFU61913.1| sucrose transporter 7 [Fragaria x ananassa]
Length=491

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 156/212 (74%), Gaps = 7/212 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWF FLL+DTDWM +EVYGGEV    LYD GVRAG+LGLML S+VLG MS+G+  L
Sbjct  276  LNWIAWFGFLLFDTDWMGKEVYGGEVGKGHLYDMGVRAGSLGLMLNSIVLGLMSLGIVYL  335

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R+ G   +LW  VNF+LAI L +TV VTK A   R        L P + VKAGAL IF 
Sbjct  336  VRRDG-ANLLWGVVNFLLAICLVMTVLVTKLAQKHRHAS-----LPPPAGVKAGALLIFA  389

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIP AVTFS+PF +A I+ SD+  G  GLSLGVLN+AI +PQMFVS +SGP DA FGG
Sbjct  390  VLGIPQAVTFSIPFTMASIFCSDS-GGGQGLSLGVLNVAIALPQMFVSLVSGPLDAAFGG  448

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            GNLPAF++GAV+A  SGILA+T LP P+ D +
Sbjct  449  GNLPAFVLGAVAAVISGILALTYLPSPQPDDR  480



>ref|XP_007151901.1| hypothetical protein PHAVU_004G085400g [Phaseolus vulgaris]
 gb|ESW23895.1| hypothetical protein PHAVU_004G085400g [Phaseolus vulgaris]
Length=496

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 160/218 (73%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFP++L+DTDWM REVYGG+V     YD GV AG+LGLML SVVL  MS+ VE L
Sbjct  276  INWIAWFPYVLFDTDWMGREVYGGDVGQKA-YDAGVHAGSLGLMLNSVVLAVMSLAVEPL  334

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL---PNSSVKAGALA  352
             R +G VK LW  VN ILA  +ALTV +TK A   R  +    P L   P+  VK GA+A
Sbjct  335  GRLVGGVKWLWAIVNVILAACMALTVLITKVAEQQRALN----PALIGNPSMEVKGGAMA  390

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
             F VLGIPLA+T+S+PFALA IYSS +G+GQ GLSLG+LN+AIV+PQM VS +SGPWD  
Sbjct  391  FFSVLGIPLAITYSVPFALASIYSSTSGAGQ-GLSLGLLNVAIVIPQMIVSAISGPWDDW  449

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVI  646
            FGGGNLPAF++GA +AA S ILA+ LLP P+ + +  I
Sbjct  450  FGGGNLPAFVLGAGAAAISAILAVILLPSPKKEDEAKI  487



>emb|CDY45308.1| BnaA03g52810D [Brassica napus]
Length=487

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 155/216 (72%), Gaps = 10/216 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG--EVND--NGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFL  DTDWM REVYGG  E +D    LY +GV +GALGLM  S+V+ FMS+G
Sbjct  273  LNWIAWFPFLFLDTDWMGREVYGGSSEGDDRMKKLYSQGVHSGALGLMFNSIVVAFMSLG  332

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILAIGL +TV VTK A+  RK    G    P+  ++AGAL
Sbjct  333  VEWIGRKVGGAKRLWGIVNFILAIGLVMTVLVTKLAADYRK--TAGPYAEPSPGIRAGAL  390

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TF +PFALA    S +    +G   G+LNLAIV+PQM VS   GP+DA
Sbjct  391  SLFAVLGIPLAITFRIPFALASSTISSS----SGAGRGILNLAIVIPQMIVSLGGGPFDA  446

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            LFGGGNLPAFIVGA++AA SG+LA+T+LP P S   
Sbjct  447  LFGGGNLPAFIVGAIAAATSGVLALTVLPSPPSSNN  482



>ref|XP_002266122.1| PREDICTED: sucrose transport protein SUC2 [Vitis vinifera]
 gb|ADP37124.1| putative sucrose transporter [Vitis vinifera]
Length=506

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN--DNGLYDKGVRAGALGLMLQSVVLGFMSIGVE  175
            LNW+AWF FLL+DTDWM +EVYGG V   ++ LYD+GV AG+LGLML S+VLG MS+ +E
Sbjct  291  LNWLAWFGFLLFDTDWMGKEVYGGTVKGKESKLYDRGVHAGSLGLMLNSLVLGLMSLAIE  350

Query  176  LLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSR-KYDAHGHPLLPNSSVKAGALA  352
              AR +G VK +W   NFILAI L LTVAVTK A  SR +  A G  L+P ++VK  AL 
Sbjct  351  PAARLMGGVKRVWGIGNFILAICLGLTVAVTKMAQSSRHEAAAEGRSLMPPANVKIFALT  410

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF +LGIP A+T+S+PFALA IYS+ +G+GQ GLSLGVLN+AIV+PQ+ VS +SG  D L
Sbjct  411  IFALLGIPQAITYSIPFALASIYSNASGAGQ-GLSLGVLNMAIVLPQILVSAVSGLLDDL  469

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKP  622
            FGGGNLP F+ GA++AAASG+ A+T+LP P
Sbjct  470  FGGGNLPVFVAGAIAAAASGVFALTILPSP  499



>ref|XP_009138292.1| PREDICTED: sucrose transport protein SUC1-like [Brassica rapa]
Length=493

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 155/216 (72%), Gaps = 10/216 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGG--EVND--NGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFL  DTDWM REVYGG  E +D    LY +GV +GALGLM  S+V+ FMS+G
Sbjct  279  LNWIAWFPFLFLDTDWMGREVYGGSSEGDDRMKKLYSQGVHSGALGLMFNSIVVAFMSLG  338

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + R++G  K LW  VNFILAIGL +TV VTK A+  RK    G    P+  ++AGAL
Sbjct  339  VEWIGRKVGGAKRLWGIVNFILAIGLVMTVLVTKLAADYRK--TAGPYAEPSPGIRAGAL  396

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TF +PFALA    S +    +G   G+LNLAIV+PQM VS   GP+DA
Sbjct  397  SLFAVLGIPLAITFRIPFALASSTISSS----SGAGRGILNLAIVIPQMIVSLGGGPFDA  452

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            LFGGGNLPAFIVGA++AA SG+LA+T+LP P S   
Sbjct  453  LFGGGNLPAFIVGAIAAATSGVLALTVLPSPPSSNN  488



>ref|XP_004300865.1| PREDICTED: sucrose transport protein SUC2-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 154/210 (73%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWIAWF FLL+DTDWM +EVYGGEV    LYD GVRAG+LGLML S+VLG MS+G+  L
Sbjct  140  LNWIAWFGFLLFDTDWMGKEVYGGEVGKGHLYDMGVRAGSLGLMLNSIVLGLMSLGIVYL  199

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R+ G   +LW  VNF+LAI L +T+ VTK A   R        L P + +KAGAL IF 
Sbjct  200  VRRDG-ANLLWGVVNFLLAICLVMTLLVTKLAQKHRLAS-----LPPPAGIKAGALLIFA  253

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLGIP AVTFS+PF +A I+ SD+  G  GLSLGVLN+AI +PQMFVS +SGP DA FGG
Sbjct  254  VLGIPQAVTFSIPFTMASIFCSDS-GGGQGLSLGVLNVAIALPQMFVSLVSGPLDAAFGG  312

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GNLPAF++GAV+A  SGILA T LP P+ D
Sbjct  313  GNLPAFVMGAVAAVISGILAFTYLPSPQPD  342



>ref|NP_179074.1| sucrose transport protein SUC8 [Arabidopsis thaliana]
 sp|Q9ZVK6.1|SUC8_ARATH RecName: Full=Sucrose transport protein SUC8; AltName: Full=Sucrose 
permease 8; AltName: Full=Sucrose-proton symporter 8 
[Arabidopsis thaliana]
 gb|AAC69375.1| putative sucrose-proton symporter [Arabidopsis thaliana]
 gb|AEC06318.1| sucrose transport protein SUC8 [Arabidopsis thaliana]
Length=492

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM REVYGG+   +     LY++G+  GALGLML S+VLG +S+G
Sbjct  287  LNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGIVSLG  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E +++++G  K LW  VN ILA+ LA+TV VTK A   R+    G   LP   ++AGAL
Sbjct  347  IEGISKKIGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI--AGPMALPTDGIRAGAL  404

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS +G+GQ GLSLGVLN+AIV+PQM VSF  GP DA
Sbjct  405  TLFALLGIPLAITFSIPFALASIISSSSGAGQ-GLSLGVLNMAIVIPQMIVSFGVGPIDA  463

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  464  LFGGGNLPRFVVGAIAAAISSVVAFTVLP  492



>gb|KCW71038.1| hypothetical protein EUGRSUZ_F04138 [Eucalyptus grandis]
Length=486

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 156/217 (72%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPF+LYDTDW+  EVYGG+      +  LYD GV  G+LGLML SVVLGF S+ 
Sbjct  265  LNWVAWFPFILYDTDWVGLEVYGGKAKGTPAEKRLYDLGVHTGSLGLMLNSVVLGFASLV  324

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + + +G VK  W  VNF+LAIGLA T+ VTK A   R    HG  + P ++VK GAL
Sbjct  325  VEPMGKVVGGVKRYWAIVNFMLAIGLAGTIPVTKMAKAYRA--VHGL-VPPPTNVKGGAL  381

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             IF  LGIPL+VT+S+PFALA IYSS AG+GQ GLSLGVLN+AIV+PQM VS +SG  D 
Sbjct  382  GIFSALGIPLSVTYSIPFALASIYSSSAGAGQ-GLSLGVLNMAIVIPQMIVSVVSGKLDD  440

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
              GGGNLPAF++GA++A  S ++A+ +LP P S   +
Sbjct  441  ALGGGNLPAFVMGAIAAIVSALMALFVLPNPPSQASM  477



>dbj|BAD44273.1| hypothetical protein [Arabidopsis thaliana]
Length=491

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 157/209 (75%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM REVYGG+   +     LY++G+  GALGLML S+VLG MS+G
Sbjct  286  LNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGVMSLG  345

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV VTK A   R+    G   LP   ++AGAL
Sbjct  346  IEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI--AGPMALPTDGIRAGAL  403

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS +G+GQ  LSLGVLN+AIV+PQM VSF  GP DA
Sbjct  404  TLFALLGIPLAITFSIPFALASIISSSSGAGQR-LSLGVLNMAIVIPQMIVSFGVGPIDA  462

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFG GNLP F+VGA++AA S I+A T+LP
Sbjct  463  LFGDGNLPGFVVGAIAAAVSSIVAFTVLP  491



>ref|NP_176830.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
 sp|Q67YF8.2|SUC7_ARATH RecName: Full=Sucrose transport protein SUC7; AltName: Full=Sucrose 
permease 7; AltName: Full=Sucrose-proton symporter 7 
[Arabidopsis thaliana]
 gb|AAG51172.1|AC079285_5 sucrose-proton symporter, putative [Arabidopsis thaliana]
 gb|ABJ17121.1| At1g66570 [Arabidopsis thaliana]
 gb|AEE34528.1| putative sucrose transport protein SUC7 [Arabidopsis thaliana]
Length=491

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 157/209 (75%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM REVYGG+   +     LY++G+  GALGLML S+VLG MS+G
Sbjct  286  LNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGVMSLG  345

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R++G  K LW  VN ILA+ LA+TV VTK A   R+    G   LP   ++AGAL
Sbjct  346  IEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI--AGPMALPTDGIRAGAL  403

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS +G+GQ  LSLGVLN+AIV+PQM VSF  GP DA
Sbjct  404  TLFALLGIPLAITFSIPFALASIISSSSGAGQR-LSLGVLNMAIVIPQMIVSFGVGPIDA  462

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFG GNLP F+VGA++AA S I+A T+LP
Sbjct  463  LFGDGNLPGFVVGAIAAAVSSIVAFTVLP  491



>ref|XP_010063780.1| PREDICTED: sucrose transport protein SUC8-like [Eucalyptus grandis]
Length=499

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 156/217 (72%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPF+LYDTDW+  EVYGG+      +  LYD GV  G+LGLML SVVLGF S+ 
Sbjct  278  LNWVAWFPFILYDTDWVGLEVYGGKAKGTPAEKRLYDLGVHTGSLGLMLNSVVLGFASLV  337

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            VE + + +G VK  W  VNF+LAIGLA T+ VTK A   R    HG  + P ++VK GAL
Sbjct  338  VEPMGKVVGGVKRYWAIVNFMLAIGLAGTIPVTKMAKAYRA--VHGL-VPPPTNVKGGAL  394

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             IF  LGIPL+VT+S+PFALA IYSS AG+GQ GLSLGVLN+AIV+PQM VS +SG  D 
Sbjct  395  GIFSALGIPLSVTYSIPFALASIYSSSAGAGQ-GLSLGVLNMAIVIPQMIVSVVSGKLDD  453

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
              GGGNLPAF++GA++A  S ++A+ +LP P S   +
Sbjct  454  ALGGGNLPAFVMGAIAAIVSALMALFVLPNPPSQASM  490



>ref|XP_009779331.1| PREDICTED: sucrose transport protein SUC8-like [Nicotiana sylvestris]
Length=521

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 156/207 (75%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFPF LY TDWM +EVYGG V D  LY+KGV AG  GL+L SVVL  MS+GVE +
Sbjct  290  VNWIAWFPFTLYGTDWMGKEVYGGRVRDGNLYNKGVHAGVFGLLLSSVVLCLMSLGVECV  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             + LG  K LW  VNFILAI LA+TV VTK A  SR+YD  G  L P+  VK  AL +  
Sbjct  350  GKWLGGAKRLWGIVNFILAICLAMTVFVTKMADKSRRYDGDGELLPPDQGVKISALLLNA  409

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            V GIPLAV +S+PFA+A IYSS+ G+GQ GLS GV+NLAIVVPQ  VS + GP+DALFGG
Sbjct  410  VTGIPLAVLYSIPFAMASIYSSNVGAGQ-GLSQGVINLAIVVPQTLVSLVGGPFDALFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKP  622
            GNLPAF+ GAV+AA SGILA+TLLP P
Sbjct  469  GNLPAFVAGAVAAAVSGILALTLLPSP  495



>ref|XP_002874582.1| hypothetical protein ARALYDRAFT_911231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50841.1| hypothetical protein ARALYDRAFT_911231 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 167/222 (75%), Gaps = 9/222 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNG--LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG+    VNDN   +Y+ GV AGALGLML SV+LGF S
Sbjct  295  LNWIAWFPFLLFDTDWMGREVYGGDSGGNVNDNARRVYNTGVHAGALGLMLNSVMLGFTS  354

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDA--HGHPLLPNSSVK  337
            +G+E LAR +G VK LW  VNFILA  L +TV +TK A  SR+  A      + P   VK
Sbjct  355  LGLEWLARGVGGVKRLWGIVNFILAFCLGMTVLITKMAESSRRDSAVLGVVAISPPVGVK  414

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSG  517
             GAL++F +LG+PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIVVPQM VS  +G
Sbjct  415  IGALSLFALLGVPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVVPQMVVSVGAG  473

Query  518  PWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            P+D +FGGGN+P F++ AV AA SG+LA+T+LP P  +  ++
Sbjct  474  PFDEMFGGGNIPGFVLAAVVAAVSGVLALTVLPSPPPEADVL  515



>ref|XP_002887046.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63305.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 159/209 (76%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDW+  EVYGG+   +     LY++G++ G+LGLML S+VLGFMS+G
Sbjct  289  LNWIAWFPFLLYDTDWVGGEVYGGDSKGDDKMKKLYNQGIQVGSLGLMLNSIVLGFMSLG  348

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E +++++G  K LW  VN ILA+ LA+TV +TK     R+    G   LP   ++AGAL
Sbjct  349  IEGISKKMGGAKRLWGAVNIILAVCLAMTVLITKKEEEHRRI--AGPMALPTDGIRAGAL  406

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLA+TFS+PFALA I SS +G+GQ GLSLGVLN+AIV+PQM VSF  GP DA
Sbjct  407  TLFALLGIPLAITFSIPFALASIISSSSGAGQ-GLSLGVLNMAIVIPQMIVSFGVGPIDA  465

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  466  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  494



>gb|ABB30166.1| putative sucrose transport protein SUT3 [Phaseolus vulgaris]
Length=476

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 159/218 (73%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIA FP++L+DTDWM REVYGG+V     YD GV AG+LGLML SVVL  MS+ VE L
Sbjct  256  INWIACFPYVLFDTDWMGREVYGGDVGQKA-YDAGVHAGSLGLMLNSVVLAVMSLAVEPL  314

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLL---PNSSVKAGALA  352
             R +G VK LW  VN ILA  +ALTV +TK A   R  +    P L   P+  VK GA+A
Sbjct  315  GRLVGGVKWLWAIVNVILAACMALTVLITKVAEQQRALN----PALIGNPSMEVKGGAMA  370

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
             F VLGIPLA+T+S+PFALA IYSS +G+GQ GLSLG+LN+AIV+PQM VS +SGPWD  
Sbjct  371  FFSVLGIPLAITYSVPFALASIYSSTSGAGQ-GLSLGLLNVAIVIPQMIVSAISGPWDDW  429

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVI  646
            FGGGNLPAF++GA +AA S ILA+ LLP P+ + +  I
Sbjct  430  FGGGNLPAFVLGAGAAAISAILAVILLPSPKKEDEAKI  467



>gb|AAD34610.1|AF149981_1 sucrose transporter-like protein [Nicotiana tabacum]
Length=521

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 154/207 (74%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NWIAWFPF LY TDWM +EVYGG V D  LY+KGV AG  GL+L SVVL  MS+GVE +
Sbjct  290  VNWIAWFPFTLYGTDWMGKEVYGGRVRDGNLYNKGVHAGVFGLLLSSVVLCLMSLGVECV  349

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             + LG  K LW  VNFILAI LA+TV VTK A  SR+YD  G  L P+  VK  AL +  
Sbjct  350  GKWLGGAKRLWGIVNFILAICLAMTVFVTKMADKSRRYDGDGELLPPDQGVKISALLLNA  409

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            V GIPLAV +S+PFA+A IYSS+ G+GQ GLS GV+NLAIVVPQ  VS    P+DALFGG
Sbjct  410  VTGIPLAVLYSIPFAMASIYSSNVGAGQ-GLSQGVINLAIVVPQTLVSISGRPFDALFGG  468

Query  542  GNLPAFIVGAVSAAASGILAITLLPKP  622
            GNLPAF+ GAV+AA SGILA+TLLP P
Sbjct  469  GNLPAFVAGAVAAAVSGILALTLLPSP  495



>ref|XP_010455355.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=521

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 169/223 (76%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNG--LYDKGVRAGALGLMLQSVVLGFMS  163
            L+WIAWFPFLL+DTDWM REVYGG+    V+D    +Y+KGV AGALGLML SVVLG  S
Sbjct  292  LSWIAWFPFLLFDTDWMGREVYGGDSVGNVDDKARRVYNKGVHAGALGLMLNSVVLGVTS  351

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNS---SV  334
            +G+E LAR +G VK LW  VNFILA  L +TV +TK A  +R+  A    ++ +S    V
Sbjct  352  LGLEWLARGVGGVKRLWGIVNFILAFCLGMTVLITKVAESNRRGSAVLETVVSSSPPVGV  411

Query  335  KAGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLS  514
            K GALA+F +LG+PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIVVPQM VS  +
Sbjct  412  KIGALALFALLGVPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVVPQMVVSVGA  470

Query  515  GPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            GP+D +FGGGN+P F++ AV+AA SG+LA+T+LP P  +  ++
Sbjct  471  GPFDEMFGGGNIPGFVLAAVAAAVSGVLALTVLPSPPPEADVL  513



>ref|XP_003518345.1| PREDICTED: sucrose transport protein SUC8-like [Glycine max]
Length=507

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFP++L+DTDWM REVYGG+V D   YD GV  GALGLML SVVL  MS+ VE L
Sbjct  287  INWVAWFPYVLFDTDWMGREVYGGKVGDKA-YDSGVHVGALGLMLNSVVLALMSLAVEPL  345

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK LW  VN ILA+ +A+TV +TKAA H R  +A      P+  VKA AL  F 
Sbjct  346  GRLVGGVKWLWGIVNVILAVCMAMTVLITKAAEHER-LNAVSLVGYPSLGVKAAALTFFS  404

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLG+PLA+T+S+PFALA IYS+ +G+GQ GLSLGVLN+AIVVPQM VS +SG WD  FGG
Sbjct  405  VLGVPLAITYSVPFALASIYSTTSGAGQ-GLSLGVLNVAIVVPQMIVSAISGQWDKWFGG  463

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPR  625
            GNLPAF++GAV+AA S +LA+ LLPKP+
Sbjct  464  GNLPAFVLGAVAAAVSAVLAVVLLPKPK  491



>ref|XP_010421870.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=523

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 169/223 (76%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNG--LYDKGVRAGALGLMLQSVVLGFMS  163
            L+WIAWFPFLL+DTDWM REVYGG+    V+D    +Y+KGV AGALGLML SVVLG  S
Sbjct  294  LSWIAWFPFLLFDTDWMGREVYGGDSVGNVDDKARRVYNKGVHAGALGLMLNSVVLGVTS  353

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSS---V  334
            +G+E LAR +G VK LW  VNFILA  L +TV +TK A  +R+  A    ++ +S    V
Sbjct  354  LGLEWLARGVGGVKRLWGIVNFILAFCLGMTVLITKVAESNRRGSAVLETVVSSSPPVGV  413

Query  335  KAGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLS  514
            K GALA+F +LG+PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIVVPQM VS  +
Sbjct  414  KIGALALFALLGVPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVVPQMVVSVGA  472

Query  515  GPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            GP+D +FGGGN+P F++ AV+AA SG+LA+T+LP P  +  ++
Sbjct  473  GPFDEMFGGGNIPGFVLAAVAAAVSGVLALTVLPSPPPEADVL  515



>ref|XP_010491171.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=494

 Score =   220 bits (561),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 159/209 (76%), Gaps = 8/209 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM RE+YGG  + +     LY+KGV  GALGLML SVVLG +S+G
Sbjct  290  LNWIAWFPFLLFDTDWMGREIYGGISDGDDKMKRLYNKGVHVGALGLMLNSVVLGVVSLG  349

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E +++++G  K LW GVN ILA  LA+TV  TK A   R     G   LP   +KAGAL
Sbjct  350  IEAVSKKIG-AKRLWGGVNIILAGCLAMTVFFTKKAEEHR--SNFGAMALPTEGIKAGAL  406

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F VLGIPLA+TFS+PFALA I SS +G+GQ GLSLGVLN++IV+PQM VSF +GP DA
Sbjct  407  SLFAVLGIPLAITFSIPFALASIISSSSGAGQ-GLSLGVLNMSIVIPQMIVSFGAGPVDA  465

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++AA S ++A T+LP
Sbjct  466  LFGGGNLPGFVVGAIAAAISSVVAFTVLP  494



>ref|XP_010438237.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
 ref|XP_010438245.1| PREDICTED: sucrose transport protein SUC8-like [Camelina sativa]
Length=521

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 166/223 (74%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNG--LYDKGVRAGALGLMLQSVVLGFMS  163
            LNWIAWFPFLL+DTDWM REVYGG     V+D    +Y+KGV  GA GLML SVVLG  S
Sbjct  292  LNWIAWFPFLLFDTDWMGREVYGGNSVGNVDDKARRVYNKGVHTGAFGLMLNSVVLGVTS  351

Query  164  IGVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSS---V  334
            +G+E LAR +G VK LW  VNFILA  L +TV +TK A  +R+  A    ++ +S    V
Sbjct  352  LGLEWLARGVGGVKRLWGVVNFILAFCLGMTVLITKVAESNRRGSAVLETVVSSSPPVGV  411

Query  335  KAGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLS  514
            K GALA+F +LG+PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIVVPQM VS  +
Sbjct  412  KIGALALFALLGVPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVVPQMVVSVGA  470

Query  515  GPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            GP+D +FGGGN+P F++ AV+AA SG+LA+T+LP P  +  ++
Sbjct  471  GPFDEMFGGGNIPGFVLAAVAAAVSGVLALTVLPSPPPEADVL  513



>ref|XP_006599447.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Glycine 
max]
Length=504

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 158/210 (75%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFP++L+DTDWM REVYGG+V +   YD GV  GALGLML SVVL  MS+ VE L
Sbjct  284  INWVAWFPYMLFDTDWMGREVYGGKVGEKA-YDSGVHKGALGLMLNSVVLALMSLTVEPL  342

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRK--YDAHGHPLLPNSSVKAGALAI  355
             R +G VK LW  VN ILA+ +A+TV +T+AA H RK    A GHP   +  V+  AL  
Sbjct  343  GRFVGGVKWLWGIVNVILAVCMAMTVVITRAAEHERKNGVSAVGHP---SVGVQVAALTF  399

Query  356  FCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALF  535
            F  LG+PLA+TFS+PFALA IYSS +G+GQ GLSLGVLN+AIVVPQM VS +SG WD  F
Sbjct  400  FSALGVPLAITFSVPFALASIYSSTSGAGQ-GLSLGVLNVAIVVPQMIVSAISGQWDKWF  458

Query  536  GGGNLPAFIVGAVSAAASGILAITLLPKPR  625
            GGGNLPAF++GAV+AA S +LA+ LLP P+
Sbjct  459  GGGNLPAFVLGAVAAAVSAVLAVVLLPTPK  488



>ref|XP_004138988.1| PREDICTED: sucrose transport protein SUC2-like [Cucumis sativus]
Length=263

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 151/217 (70%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWI WFPF++YDTDWM  EVYGG+      +   YD GVRAGALGLM+ S VLGF ++G
Sbjct  43   LNWIGWFPFIMYDTDWMGLEVYGGKPKGSPEEVKFYDLGVRAGALGLMVNSFVLGFSALG  102

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R LG ++  W  VN I  + +  TV VTK A   R  +    P L   +V+AGA 
Sbjct  103  IEPISRILGGLRWWWGIVNIIFTVCMGSTVVVTKVAERWRSVNGLRPPPL---NVRAGAF  159

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            +IF +LGIPL+VTFS+PFALA I+SS++ +GQ GLSLG+LNL IV+PQ  VS +SGP DA
Sbjct  160  SIFAILGIPLSVTFSVPFALASIFSSESDAGQ-GLSLGILNLFIVIPQFIVSAVSGPLDA  218

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
             FGGGNLPAF++G +++ AS + A+ +LP P     +
Sbjct  219  AFGGGNLPAFVMGGIASFASAMCAMFVLPDPPPQSDV  255



>ref|NP_196235.1| sucrose transport protein SUC9 [Arabidopsis thaliana]
 sp|Q9FG00.1|SUC9_ARATH RecName: Full=Sucrose transport protein SUC9; AltName: Full=Sucrose 
permease 9; AltName: Full=Sucrose-proton symporter 9 
[Arabidopsis thaliana]
 dbj|BAB09682.1| sucrose transporter protein [Arabidopsis thaliana]
 gb|AED90978.1| sucrose transport protein SUC9 [Arabidopsis thaliana]
Length=491

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 8/209 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV--NDN--GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLLYDTDWM REVYGG+   +D    LY+ G++ G+LGLML S+VLG MS+ 
Sbjct  287  LNWIAWFPFLLYDTDWMGREVYGGDSAGDDKMKKLYNHGIQVGSLGLMLNSIVLGVMSLV  346

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            + ++++++G  K LW  VN ILA+ LA+TV VTK A   RK    G   LP ++++ GAL
Sbjct  347  IGVISKKIG-AKRLWGAVNIILAVCLAMTVLVTKKAEEHRKI--AGRMALPTNAIRDGAL  403

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            ++F +LGIPLA+TFS+PFALA I SS +G+GQ GLSLGVLN+AIV+PQM VSF  GP DA
Sbjct  404  SLFAILGIPLAITFSIPFALASIISSSSGAGQ-GLSLGVLNMAIVIPQMIVSFGVGPIDA  462

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLP  616
            LFGGGNLP F+VGA++A  S ++A+T+LP
Sbjct  463  LFGGGNLPGFVVGAIAALISSVVALTVLP  491



>gb|KFK32062.1| hypothetical protein AALP_AA6G194700 [Arabis alpina]
Length=526

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 163/221 (74%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVND----NGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+         +Y+ GVRAGALGLML SVVLGF S+G
Sbjct  299  LNWIAWFPFLLFDTDWMGREVYGGDSGGNDGDRRVYNIGVRAGALGLMLNSVVLGFTSLG  358

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRK---YDAHGHPLLPNSSVKA  340
            +E LAR +G VK LW  VNFILA  L +TV VTK A  SR      A    + P   VK 
Sbjct  359  LEWLARGVGGVKRLWGIVNFILAFCLGMTVVVTKLADSSRAGGGGSAVLETVAPPVGVKI  418

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GAL++F +LG+PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIVVPQM VS  +GP
Sbjct  419  GALSLFALLGVPLAITYSIPFALASIFSSTSGAGQ-GLSLGVLNLAIVVPQMVVSVGAGP  477

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            +D +FGGGN+P F++ AV+AA S ILA+T+LP P  +  ++
Sbjct  478  FDEMFGGGNIPGFVLAAVAAAVSAILALTVLPSPPPEADVL  518



>ref|XP_008465545.1| PREDICTED: sucrose transport protein SUC8-like isoform X2 [Cucumis 
melo]
Length=495

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 150/211 (71%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWI WFPF++YDTDWM  EVYGG+      +   YD+GVRAGALGLM+ S VLGF ++ 
Sbjct  275  LNWIGWFPFIMYDTDWMGLEVYGGKPKGSPEEVKFYDRGVRAGALGLMINSFVLGFSALA  334

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R LG ++  W  VN I  + +  TV VTK A   R  +     L P  +V+AGA 
Sbjct  335  IEPISRILGGLRWWWGVVNIIFTVCMGSTVVVTKVAQRWRAVNGL---LPPPINVRAGAF  391

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            +IF VLGIPL+VTFS+PFALA I+SS++ +GQ GLSLG+LNL IV+PQ  VS +SGP DA
Sbjct  392  SIFAVLGIPLSVTFSVPFALASIFSSESDAGQ-GLSLGILNLFIVIPQFIVSSVSGPLDA  450

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G +++ AS + A+ +LP P
Sbjct  451  AFGGGNLPAFVMGGIASFASAMCAMFVLPDP  481



>ref|XP_004138920.1| PREDICTED: sucrose transport protein SUC2-like [Cucumis sativus]
Length=485

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 151/217 (70%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWI WFPF++YDTDWM  EVYGG+      +   YD GVRAGALGLM+ S VLGF ++G
Sbjct  265  LNWIGWFPFIMYDTDWMGLEVYGGKPKGSPEEVKFYDLGVRAGALGLMVNSFVLGFSALG  324

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R LG ++  W  VN I  + +  TV VTK A   R  +    P L   +V+AGA 
Sbjct  325  IEPISRILGGLRWWWGIVNIIFTVCMGSTVVVTKVAERWRSVNGLRPPPL---NVRAGAF  381

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            +IF +LGIPL+VTFS+PFALA I+SS++ +GQ GLSLG+LNL IV+PQ  VS +SGP DA
Sbjct  382  SIFAILGIPLSVTFSVPFALASIFSSESDAGQ-GLSLGILNLFIVIPQFIVSAVSGPLDA  440

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
             FGGGNLPAF++G +++ AS + A+ +LP P     +
Sbjct  441  AFGGGNLPAFVMGGIASFASAMCAMFVLPDPPPQSDV  477



>ref|XP_004159998.1| PREDICTED: sucrose transport protein SUC2-like [Cucumis sativus]
Length=495

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 151/217 (70%), Gaps = 8/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWI WFPF++YDTDWM  EVYGG+      +   YD GVRAGALGLM+ S VLGF ++G
Sbjct  275  LNWIGWFPFIMYDTDWMGLEVYGGKPKGSPEEVKFYDLGVRAGALGLMVNSFVLGFSALG  334

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R LG ++  W  VN I  + +  TV VTK A   R  +    P L   +V+AGA 
Sbjct  335  IEPISRILGGLRWWWGIVNIIFTVCMGSTVVVTKVAERWRSVNGLRPPPL---NVRAGAF  391

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            +IF +LGIPL+VTFS+PFALA I+SS++ +GQ GLSLG+LNL IV+PQ  VS +SGP DA
Sbjct  392  SIFAILGIPLSVTFSVPFALASIFSSESDAGQ-GLSLGILNLFIVIPQFIVSAVSGPLDA  450

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGKI  640
             FGGGNLPAF++G +++ AS + A+ +LP P     +
Sbjct  451  AFGGGNLPAFVMGGIASFASAMCAMFVLPDPPPQSDV  487



>ref|XP_008465544.1| PREDICTED: sucrose transport protein SUC8-like isoform X1 [Cucumis 
melo]
Length=528

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 150/211 (71%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWI WFPF++YDTDWM  EVYGG+      +   YD+GVRAGALGLM+ S VLGF ++ 
Sbjct  275  LNWIGWFPFIMYDTDWMGLEVYGGKPKGSPEEVKFYDRGVRAGALGLMINSFVLGFSALA  334

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E ++R LG ++  W  VN I  + +  TV VTK A   R  +     L P  +V+AGA 
Sbjct  335  IEPISRILGGLRWWWGVVNIIFTVCMGSTVVVTKVAQRWRAVNGL---LPPPINVRAGAF  391

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            +IF VLGIPL+VTFS+PFALA I+SS++ +GQ GLSLG+LNL IV+PQ  VS +SGP DA
Sbjct  392  SIFAVLGIPLSVTFSVPFALASIFSSESDAGQ-GLSLGILNLFIVIPQFIVSSVSGPLDA  450

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             FGGGNLPAF++G +++ AS + A+ +LP P
Sbjct  451  AFGGGNLPAFVMGGIASFASAMCAMFVLPDP  481



>ref|XP_010543261.1| PREDICTED: LOW QUALITY PROTEIN: sucrose transport protein SUC1-like 
[Tarenaya hassleriana]
Length=525

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 11/217 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEV----NDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+     +   +Y+ GVRAGALGLML SVVLGF S+ 
Sbjct  294  LNWIAWFPFLLFDTDWMGREVYGGDSAGDESQRRVYNVGVRAGALGLMLNSVVLGFTSLA  353

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDA--HGHPLLPNSS----  331
            VE +AR +G V  LW  VNF+LA+ L +TV +TK A   R   A   G   LP       
Sbjct  354  VEWMARGVGGVNRLWGIVNFVLALCLGMTVVITKVAESGRHLTAVSKGRGSLPPPPPPVG  413

Query  332  VKAGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFL  511
            VK GAL++F +  +PLA+T+S+PFALA I+SS +G+GQ GLSLGVLNLAIVVPQM VS  
Sbjct  414  VKVGALSLFALSDVPLAITYSIPFALASIFSSSSGAGQ-GLSLGVLNLAIVVPQMVVSVG  472

Query  512  SGPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKP  622
             GP+D +FGGGNLP F+VGAV+AAASG+LA+T+LP P
Sbjct  473  GGPFDEMFGGGNLPGFVVGAVAAAASGVLALTVLPSP  509



>ref|XP_010675270.1| PREDICTED: sucrose transport protein SUC2-like [Beta vulgaris 
subsp. vulgaris]
Length=486

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 154/214 (72%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
             NWIAWFPFL+++TDW+  E+YGG    N     LYD GVR GALGL+L +  LG MS+ 
Sbjct  275  FNWIAWFPFLMFNTDWVGLEIYGGNPQGNAGQMRLYDMGVRTGALGLLLTAATLGCMSLC  334

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            ++ L++ LG  + LW  VNF+LA  LA T+ +TKAA  +R++     P  P+S +K+  L
Sbjct  335  IDPLSKMLGGARRLWGLVNFVLAAALACTLPLTKAAEKARRHMPPNVP--PSSHIKSATL  392

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F   GIP A TFS+PFALA ++SSD+G+G  GLSLG++NLAI VPQMFVS +SGPWD 
Sbjct  393  GLFAATGIPQAATFSIPFALASMFSSDSGAGH-GLSLGLMNLAICVPQMFVSLISGPWDK  451

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            +FGGGNLPAF++GAV+A  SGILAI +LP   S+
Sbjct  452  IFGGGNLPAFLLGAVAAVISGILAIFVLPPTSSN  485



>ref|XP_010094855.1| Sucrose transport protein SUC2 [Morus notabilis]
 gb|EXB57384.1| Sucrose transport protein SUC2 [Morus notabilis]
Length=492

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 159/234 (68%), Gaps = 31/234 (13%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN--DNG---LYDKGVRAGALGLMLQSVVLGFMSI  166
            LNW+AWFPFLL+DTDWM +EVYGGEV   + G   +YD+GV AGALGLML SVVLGFMS+
Sbjct  251  LNWVAWFPFLLFDTDWMGKEVYGGEVTAAEEGPRRMYDRGVHAGALGLMLNSVVLGFMSL  310

Query  167  GVELLARQLGD-------------------VKMLWVGVNFILAIGLALTVAVTKAASHSR  289
            GVE +AR LG                    VK LW  VNF+LA+ LALTV +TK A  SR
Sbjct  311  GVEPVARLLGGGKRLFLAGGGEPVARLLGGVKRLWGVVNFVLAVCLALTVLITKMAEASR  370

Query  290  KYDAHGHPLLPNSSVKAGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVL  469
               A      P   V+AGALA+F  LG+PLAVT+S+PFALA I+SS +G+GQ G  +   
Sbjct  371  SGTAA--VAAPPVGVRAGALALFAALGVPLAVTYSVPFALASIFSSTSGAGQ-GHQIQTY  427

Query  470  NLAIVVPQMFVSFLSGPWDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            +    V QM VS  SGPWDALFGG NLPAF+VGA+SAA SG+L++T+LP P  D
Sbjct  428  H----VVQMVVSVASGPWDALFGGSNLPAFVVGAISAAVSGLLSLTMLPSPPPD  477



>ref|XP_006371473.1| hypothetical protein POPTR_0019s11560g [Populus trichocarpa]
 gb|ERP49270.1| hypothetical protein POPTR_0019s11560g [Populus trichocarpa]
Length=482

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 135/175 (77%), Gaps = 8/175 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNW+AWFPFLL+DTDWM REVYGG+ + N     +YD+GVRAGALGLML SVVLG  S+G
Sbjct  307  LNWVAWFPFLLFDTDWMGREVYGGDSSGNADQLKMYDRGVRAGALGLMLNSVVLGVTSLG  366

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VE LAR +G VK LW  VNF+LAI LA+T+ +TK A  +R+Y   +   H L P   +KA
Sbjct  367  VEALARGVGGVKRLWGIVNFVLAICLAMTILITKLAQSNRRYTTVNGGTHLLTPPPGIKA  426

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVS  505
            GALA+F V+GIP A+T+S+PFALA I+S+ +G+GQ GLSLGVLNL+IV+PQ+  S
Sbjct  427  GALALFAVMGIPQAITYSIPFALASIFSNTSGAGQ-GLSLGVLNLSIVIPQVSAS  480



>gb|KHN32800.1| Sucrose transport protein [Glycine soja]
Length=380

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  74   EVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELLARQLGDVKMLWVGVNFILAIGLAL  253
            E++    YD GV AG+LGLML +VVL  MS+ +E L R +G +K LW  VN +LAI L +
Sbjct  183  ELDSVKAYDSGVHAGSLGLMLNAVVLAVMSLAIEPLGRVVGGIKWLWGIVNILLAICLGM  242

Query  254  TVAVTKAASHSRKYDAHGHPLL---PNSSVKAGALAIFCVLGIPLAVTFSLPFALACIYS  424
            TV +TK A H R  +    P L   P+  +K G++  F VLGIPLA+TFS+PFALA IYS
Sbjct  243  TVLITKIAEHERLLN----PALVGNPSLGIKVGSMVFFSVLGIPLAITFSVPFALASIYS  298

Query  425  SDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGGGNLPAFIVGAVSAAASGILAI  604
            S +G+GQ GLSLGVLN+AIVVPQM VS +SGPWDALFGGGNLPAF++GAV+A  S ILA+
Sbjct  299  STSGAGQ-GLSLGVLNIAIVVPQMIVSTISGPWDALFGGGNLPAFVLGAVAAVVSAILAV  357

Query  605  TLLPKPRS  628
             LLP P+ 
Sbjct  358  LLLPTPKK  365



>gb|ADE77095.1| unknown [Picea sitchensis]
Length=288

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 146/210 (70%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            L+W++WFPF L+DTDWM REVY G+ N  G     Y KGV+ GA GL+L S+VLG  S+ 
Sbjct  67   LSWLSWFPFFLFDTDWMGREVYQGDPNAKGTKAAAYHKGVQEGAFGLLLNSIVLGVSSLF  126

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E L R +G  K +W   NFI+ + +A T AV  A + S  +    + +   SSVKA ++
Sbjct  127  IEPLCRWMGS-KNIWATSNFIVFVCMAST-AVISAYALSEHHRGIQYMIGNVSSVKAASV  184

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++DAG GQ GLS+GVLNL+IV+PQM V+  +GPWDA
Sbjct  185  VLFALLGFPLAITYSVPFSVTAELTADAGGGQ-GLSIGVLNLSIVIPQMIVALGAGPWDA  243

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGN+PAF++ +V A A+GI+A+  LP 
Sbjct  244  LFGGGNVPAFVLASVFALAAGIIAVIKLPH  273



>emb|CDP19968.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 145/211 (69%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWI WFPF ++ TDWM +EVYGG+ N N     LY  GV  G +GLML  VVLG +S+ 
Sbjct  283  LNWIGWFPFTMFSTDWMGKEVYGGQANGNAQDIQLYQLGVWTGTMGLMLYVVVLGTVSLF  342

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            +E L R +G+V  +W   NF+LAI + +T  +TK A  +R+     A    + P  SVK 
Sbjct  343  MEPLVRMIGNVAKVWGIGNFVLAICMVMTTYITKMAIDARQLVDSTASKGLITPPPSVKI  402

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
             +L++F +LGIP AVT+S+PFALA IYS+++G+GQ GL LGVLNLAIV+PQMFV+  SG 
Sbjct  403  SSLSLFAILGIPQAVTYSIPFALASIYSNESGTGQ-GLGLGVLNLAIVIPQMFVAVSSGQ  461

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLL  613
             D ++   NLPAF++GA++A  SG LA TLL
Sbjct  462  LDDVYYDSNLPAFLMGAIAAGLSGTLAFTLL  492



>ref|XP_001766981.1| predicted protein [Physcomitrella patens]
 gb|EDQ68147.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 139/215 (65%), Gaps = 10/215 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVND---NGLYDKGVRAGALGLMLQSVVLGFMSIGV  172
            L WIAWFPFLL+DTDWM REVYGGE +D   +  Y  GV  G+LGLML SVVLG  S+ +
Sbjct  273  LTWIAWFPFLLFDTDWMGREVYGGEPSDPLKSKWYYDGVHMGSLGLMLNSVVLGLSSLCI  332

Query  173  ELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALA  352
            E + R+LG    +W   N I+ +    T  VT AA  +    A G    P++ V   AL 
Sbjct  333  EFVCRKLGS-SYVWGIANMIMTVCFVGTYLVTHAAKSAL---AAGEG--PSTWVVTSALV  386

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF VLG PLAVT+S+P+AL   Y+   G GQ GLS+GVLNLA+V PQ+ VS  SGPWD L
Sbjct  387  IFAVLGAPLAVTYSVPYALTATYTEKVGGGQ-GLSVGVLNLAVVTPQVIVSVGSGPWDEL  445

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            F GGN+PAF++GA SA    I A+ LLP+P  D K
Sbjct  446  FNGGNMPAFLLGAGSALLGAIAAVLLLPRPPPDFK  480



>gb|KHN08210.1| Sucrose transport protein SUC4-like protein, partial [Glycine 
soja]
Length=362

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 136/207 (66%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            L WI WFPFLL+DTDWM RE+YGGE N+   +D GVR GALGL+L SVVLG  S+ +E L
Sbjct  153  LTWIGWFPFLLFDTDWMGREIYGGEPNEGPNHDTGVRMGALGLLLNSVVLGVTSVLLERL  212

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R+ G    LW   N ++A+     + VT  A++           LP + +   +L IF 
Sbjct  213  CRKRGP-GFLWGISNILMAVCFISMLVVTYVANNIGYVGKD----LPPTGIVIASLIIFT  267

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LG PLA+T+S+P+AL   +    G GQ GLS+GVLNLAIV PQM VS  SGPWD LFGG
Sbjct  268  ILGFPLAITYSVPYALISTHIQSLGLGQ-GLSMGVLNLAIVFPQMVVSLGSGPWDQLFGG  326

Query  542  GNLPAFIVGAVSAAASGILAITLLPKP  622
            GN PAF V AV+A ASG++A+  +P+P
Sbjct  327  GNSPAFGVAAVAALASGLIAVLFIPRP  353



>ref|XP_009759497.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Nicotiana 
sylvestris]
Length=471

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 146/218 (67%), Gaps = 11/218 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY     GE  +   Y++GVR GA GL+L SVVLG  S  
Sbjct  252  LTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGITSFF  311

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALT--VAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +E + + +G  +++W   N I+   +A T  ++V   ++HSR      H +    S K  
Sbjct  312  IEPMCKWIGS-RLVWAVSNLIVFACMASTAIISVVSISAHSRGVQ---HVIEATESTKIA  367

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            +L +F +LGIPLAVT+S+PF++    ++DAG GQ GL++GVLNLAIVVPQM VS  +GPW
Sbjct  368  SLVVFSLLGIPLAVTYSVPFSITAELTADAGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPW  426

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            DALFGGGN+PAF++ ++SA A+GI A+  LP   S+ K
Sbjct  427  DALFGGGNVPAFVLASLSALAAGIFAMLRLPNLSSNYK  464



>gb|KHF99226.1| Sucrose transport SUC2 -like protein [Gossypium arboreum]
Length=499

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 136/217 (63%), Gaps = 44/217 (20%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN----GLYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG+   N     LY+ GV AGALGLML SVVLGF S+G
Sbjct  308  LNWIAWFPFLLFDTDWMGREVYGGDSQGNILVLKLYNNGVHAGALGLMLNSVVLGFTSLG  367

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKY---DAHGHPLLPNSSVKA  340
            VELLAR +G V  LW  VNF+LA+ LA+TV VTK A  SR++   D    PL P + VKA
Sbjct  368  VELLARGVGGVNRLWGIVNFLLAVCLAMTVLVTKLAESSRRFITVDGVTVPLPPPAGVKA  427

Query  341  GALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGP  520
            GAL++F VLG+PLA+                                      VS  SGP
Sbjct  428  GALSLFAVLGVPLAI-------------------------------------LVSLGSGP  450

Query  521  WDALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            +DA+FGGGNLPAF++GA++AAASG  A+TLLP    D
Sbjct  451  FDAIFGGGNLPAFVLGAIAAAASGTFALTLLPSLPPD  487



>ref|XP_003523764.1| PREDICTED: sucrose transport protein SUC4-like isoform X1 [Glycine 
max]
 ref|XP_006578254.1| PREDICTED: sucrose transport protein SUC4-like isoform X2 [Glycine 
max]
Length=513

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 136/207 (66%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            L WI WFPFLL+DTDWM RE+YGGE N+   YD GVR GALGL+L SVVLG  S+ +E L
Sbjct  304  LTWIGWFPFLLFDTDWMGREIYGGEPNEGPNYDTGVRMGALGLLLNSVVLGVTSVLLERL  363

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R+ G    LW   N ++A+     + VT  A++           LP + +   +L IF 
Sbjct  364  CRKRGP-GFLWGISNILMAVCFISMLVVTYVANNIGYVGKD----LPPTGIVIASLIIFT  418

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LG PLA+T+S+P+AL   +    G GQ GLS+GVLNLAIV PQM VS  SGPWD LFGG
Sbjct  419  ILGFPLAITYSVPYALISTHIQSLGLGQ-GLSMGVLNLAIVFPQMVVSLGSGPWDQLFGG  477

Query  542  GNLPAFIVGAVSAAASGILAITLLPKP  622
            GN PAF V AV+A ASG++A+  +P+P
Sbjct  478  GNSPAFGVAAVAALASGLIAVLFIPRP  504



>ref|XP_009593382.1| PREDICTED: sucrose transport protein SUC3 isoform X3 [Nicotiana 
tomentosiformis]
Length=484

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY     GE  +   Y++GVR GA GL+L SVVLG  S  
Sbjct  265  LTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGITSFF  324

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALT--VAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +E + + +G  +++W   N I+   +A T  +++   ++HSR      H +    S K  
Sbjct  325  IEPMCKWIGS-RLVWAVSNLIVFACMASTAIISLVSISAHSRGVQ---HVIEATQSTKIA  380

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            +L +F +LGIPLAVT+S+PF++    ++DAG GQ GL++GVLNLAIVVPQM VS  +GPW
Sbjct  381  SLVVFSLLGIPLAVTYSVPFSITAELTADAGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPW  439

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            DALFGGGN+PAF++ ++SA A+GI A+  LP   S+
Sbjct  440  DALFGGGNIPAFVLASLSALAAGIFAMLRLPNLSSN  475



>ref|XP_002978870.1| hypothetical protein SELMODRAFT_177267 [Selaginella moellendorffii]
 gb|EFJ19827.1| hypothetical protein SELMODRAFT_177267 [Selaginella moellendorffii]
Length=531

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 138/215 (64%), Gaps = 15/215 (7%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN-----GLYDKGVRAGALGLMLQSVVLGFMSI  166
            L W+AWFPFLLYDTDWM  E+Y G+ +        LY+KGVR G+ GLML SVVLG  S+
Sbjct  297  LTWVAWFPFLLYDTDWMGHEIYRGQPDSRLQARTDLYNKGVRMGSFGLMLNSVVLGLTSL  356

Query  167  GVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGA  346
             VE L R++G    LW   + ILA   A  V +TK A   R          P++ V    
Sbjct  357  MVEPLCRRVGP-SYLWGFADVILAFCFAGIVGITKVAGKGRSP--------PSAGVLTVV  407

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LGIPLAVT+S+P+AL   Y+S  G GQ GLS+GVLNLA+V+PQ+ +S  SGPWD
Sbjct  408  LLLFSILGIPLAVTYSVPYALTASYTSSIGGGQ-GLSMGVLNLAVVIPQVIISLGSGPWD  466

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
              FGGGN+P+F+V + +A   G+LAIT LPK  + 
Sbjct  467  QAFGGGNIPSFLVASGAALIGGVLAITKLPKTHTK  501



>gb|AAQ84310.1| fiber sucrose transporter [Gossypium barbadense]
Length=301

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 136/216 (63%), Gaps = 6/216 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPFLL+DTDWM RE+YGG+ N+   Y+ GVR GA+GLML SVVLG  S+ +E L
Sbjct  92   LNWIGWFPFLLFDTDWMGREIYGGQPNEGANYNSGVRMGAVGLMLNSVVLGITSVLMEKL  151

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
              + G    +W   N ++A+     + ++    H    D  GH  LP + +   AL IF 
Sbjct  152  CSKWG-AGFIWGVSNIVMALCFLSMLILSYVTDH---MDYIGHD-LPPAGIMIAALLIFS  206

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LG PLAVT+S+P+AL        G GQ GLS+GVLNLAIV+PQ+ VS  SGPWD LFGG
Sbjct  207  ILGFPLAVTYSVPYALISTRIESLGLGQ-GLSMGVLNLAIVIPQVVVSMGSGPWDELFGG  265

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            GN PAF V  V++  SG++AI  +P+        +P
Sbjct  266  GNSPAFAVAGVASLTSGLIAILAIPRSSPQKIRALP  301



>ref|XP_009129115.1| PREDICTED: sucrose transport protein SUC3-like isoform X2 [Brassica 
rapa]
Length=447

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 145/216 (67%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G    + L    Y +GVR GA GL+L SVVLGF S  
Sbjct  229  LTWLSWFPFFLFDTDWMGREVYHGNPTGDSLLVKLYGQGVREGAFGLLLNSVVLGFSSFL  288

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  + +W   NF +   +A T AV    S     + + H +LPN + +  A+
Sbjct  289  IEPMCQRMG-ARAVWALSNFTVFACMAGT-AVISLMSLRDNSEGNEH-ILPNETTRTAAV  345

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWDA
Sbjct  346  IVFALLGFPLAITYSVPFSVTAEVTADSGGGQ-GLAIGVLNLAIVIPQMIVSIGAGPWDA  404

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            LFGGGNLPAF++ +V+A A+G++A+  LP   S  K
Sbjct  405  LFGGGNLPAFVLASVAAFAAGVIALRSLPTLSSSFK  440



>ref|XP_008778269.1| PREDICTED: sucrose transport protein SUT4-like isoform X1 [Phoenix 
dactylifera]
Length=606

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 142/210 (68%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVN----DNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W +WFPF L+DTDWM REVY G  N    ++  Y KGVR GA GL+L SVVLG  S+ 
Sbjct  386  LTWASWFPFFLFDTDWMGREVYHGNPNGDPSESLAYHKGVREGAFGLLLNSVVLGVSSLL  445

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            ++ + R++G  + +W   NFI+ I +A T  +T   S S+  +   H +  N+++K  AL
Sbjct  446  IDPMCRRMG-ARFVWAMSNFIVFICMAATT-ITSLLSISQHSNGIQHVIGENTAIKIAAL  503

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             IF +LG PLA+T+S+PF++    ++D G GQ GL+ GVLNLAIV+PQM VS  +GPWDA
Sbjct  504  VIFSILGFPLAITYSVPFSVTADLTADTGGGQ-GLATGVLNLAIVIPQMIVSLGAGPWDA  562

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGN+PAF + +V A A+GILA   LP+
Sbjct  563  LFGGGNIPAFAIASVFALAAGILAFLKLPR  592



>ref|XP_009759496.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Nicotiana 
sylvestris]
Length=605

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 146/218 (67%), Gaps = 11/218 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY     GE  +   Y++GVR GA GL+L SVVLG  S  
Sbjct  386  LTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGITSFF  445

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALT--VAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +E + + +G  +++W   N I+   +A T  ++V   ++HSR      H +    S K  
Sbjct  446  IEPMCKWIGS-RLVWAVSNLIVFACMASTAIISVVSISAHSRGVQ---HVIEATESTKIA  501

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            +L +F +LGIPLAVT+S+PF++    ++DAG GQ GL++GVLNLAIVVPQM VS  +GPW
Sbjct  502  SLVVFSLLGIPLAVTYSVPFSITAELTADAGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPW  560

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            DALFGGGN+PAF++ ++SA A+GI A+  LP   S+ K
Sbjct  561  DALFGGGNVPAFVLASLSALAAGIFAMLRLPNLSSNYK  598



>ref|XP_002988479.1| hypothetical protein SELMODRAFT_269407 [Selaginella moellendorffii]
 gb|EFJ10569.1| hypothetical protein SELMODRAFT_269407 [Selaginella moellendorffii]
Length=508

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 138/215 (64%), Gaps = 15/215 (7%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDN-----GLYDKGVRAGALGLMLQSVVLGFMSI  166
            L W+AWFPFLLYDTDWM  E+Y G+ +        LY+KGVR G+ GLML SVVLG  S+
Sbjct  274  LTWVAWFPFLLYDTDWMGHEIYRGQPDSRLQARTDLYNKGVRMGSFGLMLNSVVLGLTSL  333

Query  167  GVELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGA  346
             VE L R++G    LW   + ILA   A  V +TK A   R          P++ V    
Sbjct  334  MVEPLCRRVGP-SYLWGFADVILAFCFAGIVGITKVAEKGRSP--------PSAGVLTVV  384

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LGIPLAVT+S+P+AL   Y+S  G GQ GLS+GVLNLA+V+PQ+ +S  SGPWD
Sbjct  385  LLLFSILGIPLAVTYSVPYALTASYTSSIGGGQ-GLSMGVLNLAVVIPQVIISLGSGPWD  443

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
              FGGGN+P+F+V + +A   G+LAI+ LPK  + 
Sbjct  444  QAFGGGNIPSFLVASGAALIGGVLAISKLPKTHTK  478



>ref|XP_002311596.1| sucrose transporter family protein [Populus trichocarpa]
 gb|EEE88963.1| sucrose transporter family protein [Populus trichocarpa]
Length=605

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 144/210 (69%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G+     N+  LYD+GVR GA GL+L SVVLG  S  
Sbjct  386  LTWLSWFPFFLFDTDWMGREVYHGDPKGNSNEVELYDQGVREGAFGLLLNSVVLGISSFL  445

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R+LG  + +W   NFI+ + +A T AV    S     +   H +  N+ ++  AL
Sbjct  446  IEPMCRRLGS-RFVWAMSNFIVFVCMAGT-AVISLISVGEYSEGIEHVIGGNAPIRIAAL  503

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM +S  +GPWDA
Sbjct  504  IVFALLGFPLAITYSVPFSVTAELTADSGGGQ-GLAIGVLNLAIVIPQMIISIGAGPWDA  562

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGN+PAF++ +VSA A+G++A   LP 
Sbjct  563  LFGGGNIPAFVLASVSALAAGVIATLKLPN  592



>gb|KDO82867.1| hypothetical protein CISIN_1g012185mg [Citrus sinensis]
Length=453

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 144/215 (67%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G+   N      YD+GVR GA GL+L SVVLG  S  
Sbjct  240  LTWLSWFPFFLFDTDWMGREVYHGDPKGNDHEVKFYDQGVREGAFGLLLNSVVLGVSSFL  299

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH-GHPLLPNSSVKAGA  346
            +E + R +G  +++W   NFI+   +A T  ++  +   R+Y     H +  N ++K  +
Sbjct  300  IEPMCRWIGS-RLVWAISNFIVFACMATTAIISVISV--REYSGGIEHGIGANQAIKVAS  356

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LG PLA+T+S+PFA+    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWD
Sbjct  357  LVVFTLLGFPLAITYSVPFAITAELTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWD  415

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            ALFGGGN+PAF++ ++SA A G++A   LP   S+
Sbjct  416  ALFGGGNIPAFVLASLSALAGGVVATLKLPHLSSN  450



>ref|XP_010271544.1| PREDICTED: sucrose transport protein SUC4 [Nelumbo nucifera]
Length=503

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 139/213 (65%), Gaps = 11/213 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            L WI WFPFLL+DTDWM RE+Y G+ N+   Y  GVR GALGLML S+VLG  S+ +E L
Sbjct  294  LTWIGWFPFLLFDTDWMGREIYKGKPNEGQNYHIGVRMGALGLMLNSIVLGLTSVVLEKL  353

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R+ G   ++W   N ++++GL   + ++    +   ++      LP   V   ALA+F 
Sbjct  354  CRKWGS-GLVWGTSNVLMSLGLITMLIISLVVKNMHFHNGD----LPPYGVVIAALAVFA  408

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            VLG+PL+VT+S+P+A+        G GQ GLS+GVLNLAIV+PQ+ VS  SGPWD LFGG
Sbjct  409  VLGVPLSVTYSIPYAMVSTRIESLGLGQ-GLSMGVLNLAIVIPQVLVSLGSGPWDQLFGG  467

Query  542  GNLPAFIVGAVSAAASGILAI-----TLLPKPR  625
            GN P+F VGAV+A  SG++AI     T  PKPR
Sbjct  468  GNSPSFAVGAVAAFTSGLVAILALSRTYTPKPR  500



>gb|KDO82870.1| hypothetical protein CISIN_1g012185mg [Citrus sinensis]
 gb|KDO82871.1| hypothetical protein CISIN_1g012185mg [Citrus sinensis]
 gb|KDO82872.1| hypothetical protein CISIN_1g012185mg [Citrus sinensis]
Length=460

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 144/215 (67%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G+   N      YD+GVR GA GL+L SVVLG  S  
Sbjct  240  LTWLSWFPFFLFDTDWMGREVYHGDPKGNDHEVKFYDQGVREGAFGLLLNSVVLGVSSFL  299

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH-GHPLLPNSSVKAGA  346
            +E + R +G  +++W   NFI+   +A T  ++  +   R+Y     H +  N ++K  +
Sbjct  300  IEPMCRWIGS-RLVWAISNFIVFACMATTAIISVISV--REYSGGIEHGIGANQAIKVAS  356

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LG PLA+T+S+PFA+    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWD
Sbjct  357  LVVFTLLGFPLAITYSVPFAITAELTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWD  415

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            ALFGGGN+PAF++ ++SA A G++A   LP   S+
Sbjct  416  ALFGGGNIPAFVLASLSALAGGVVATLKLPHLSSN  450



>ref|XP_001777456.1| predicted protein [Physcomitrella patens]
 gb|EDQ57743.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 140/213 (66%), Gaps = 8/213 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVND---NGLYDKGVRAGALGLMLQSVVLGFMSIGV  172
            L WIAWFPFLL+DTDWM REVYGGE +D   +  Y  GV  G+LGL+L SVVLG  S+ +
Sbjct  279  LTWIAWFPFLLFDTDWMGREVYGGEPSDPLKSVWYYDGVHMGSLGLLLNSVVLGLSSLAI  338

Query  173  ELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALA  352
            + + R+LG    +W   N I+A     T  VT AAS +        P    + V   ALA
Sbjct  339  DFVCRKLGS-SYVWGIANMIMAACFGGTGLVTLAASRAAALAPSAGP---PTYVIYSALA  394

Query  353  IFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDAL  532
            IF +LGIPLAVT+S+P++L   Y+   G GQ GLS+G+LNLA+V PQM VS  SGPWD L
Sbjct  395  IFSILGIPLAVTYSVPYSLTATYTEKVGGGQ-GLSVGLLNLAVVAPQMVVSVGSGPWDEL  453

Query  533  FGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            FGGGN+PAF+ GAV+A   GI A+ LLP+P  D
Sbjct  454  FGGGNMPAFLFGAVAAFIGGIAAVLLLPRPPPD  486



>ref|XP_006434634.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
 gb|ESR47874.1| hypothetical protein CICLE_v10000828mg [Citrus clementina]
Length=484

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 125/173 (72%), Gaps = 9/173 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            LNWIAWFPFLL+DTDWM REVYGG    +     +Y+ GVRAG+LGLML ++VLGF S+G
Sbjct  296  LNWIAWFPFLLFDTDWMGREVYGGSSKGSAEELRVYNNGVRAGSLGLMLNAIVLGFTSLG  355

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHG----HPLLPNSSVK  337
            VE+LA+ +G VK LW  VNF+LA+ L  T  +TK A  +R+         H L P   VK
Sbjct  356  VEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVK  415

Query  338  AGALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQM  496
             GALAIF VLGIP A+TFS+PFA+A I+S  + +GQ GLSLGVLNLAIVVPQ+
Sbjct  416  VGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQ-GLSLGVLNLAIVVPQV  467



>ref|XP_006438653.1| hypothetical protein CICLE_v10030996mg [Citrus clementina]
 ref|XP_006438654.1| hypothetical protein CICLE_v10030996mg [Citrus clementina]
 gb|ESR51893.1| hypothetical protein CICLE_v10030996mg [Citrus clementina]
 gb|ESR51894.1| hypothetical protein CICLE_v10030996mg [Citrus clementina]
Length=469

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 144/215 (67%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G+   N      YD+GVR GA GL+L SVVLG  S  
Sbjct  249  LTWLSWFPFFLFDTDWMGREVYHGDPKGNDHEVKFYDQGVREGAFGLLLNSVVLGVSSFL  308

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH-GHPLLPNSSVKAGA  346
            +E + R +G  +++W   NFI+   +A T  ++  +   R+Y     H +  N ++K  +
Sbjct  309  IEPMCRWIGS-RLVWAISNFIVFACMATTAIISVISV--REYSGGIEHGIGANQAIKVAS  365

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LG PLA+T+S+PFA+    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWD
Sbjct  366  LVVFTLLGFPLAITYSVPFAITAELTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWD  424

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            ALFGGGN+PAF++ ++SA A G++A   LP   S+
Sbjct  425  ALFGGGNIPAFVLASLSALAGGVVATLKLPHLSSN  459



>ref|XP_006483200.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Citrus 
sinensis]
 ref|XP_006483201.1| PREDICTED: sucrose transport protein SUC3 isoform X3 [Citrus 
sinensis]
 ref|XP_006483202.1| PREDICTED: sucrose transport protein SUC3 isoform X4 [Citrus 
sinensis]
 gb|KDO82868.1| hypothetical protein CISIN_1g012185mg [Citrus sinensis]
Length=469

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 144/215 (67%), Gaps = 9/215 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G+   N      YD+GVR GA GL+L SVVLG  S  
Sbjct  249  LTWLSWFPFFLFDTDWMGREVYHGDPKGNDHEVKFYDQGVREGAFGLLLNSVVLGVSSFL  308

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH-GHPLLPNSSVKAGA  346
            +E + R +G  +++W   NFI+   +A T  ++  +   R+Y     H +  N ++K  +
Sbjct  309  IEPMCRWIGS-RLVWAISNFIVFACMATTAIISVISV--REYSGGIEHGIGANQAIKVAS  365

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LG PLA+T+S+PFA+    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWD
Sbjct  366  LVVFTLLGFPLAITYSVPFAITAELTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWD  424

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            ALFGGGN+PAF++ ++SA A G++A   LP   S+
Sbjct  425  ALFGGGNIPAFVLASLSALAGGVVATLKLPHLSSN  459



>ref|XP_010096375.1| Sucrose transport protein SUC3 [Morus notabilis]
 gb|EXB63850.1| Sucrose transport protein SUC3 [Morus notabilis]
Length=618

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 146/210 (70%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L+W++WFPF L+DTDWM REVY G+    +++   YD+GVR GA GL+L SVVLG  S  
Sbjct  398  LSWLSWFPFFLFDTDWMGREVYHGDPKGSLSEVDAYDQGVREGAFGLLLNSVVLGISSFL  457

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  +++W   NFI+   +A T A+    S     +   H +  N S+K  +L
Sbjct  458  IEPMCQRMG-ARLVWALSNFIVFACMAGT-AIISLISVGEYSNGIQHVIGGNESIKTASL  515

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIVVPQM VS  +GPWDA
Sbjct  516  VVFALLGFPLAITYSVPFSVTAQLTADSGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPWDA  574

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGNLPAF++ +VSA A+G++AI  LP 
Sbjct  575  LFGGGNLPAFVLASVSALAAGVIAIRRLPN  604



>ref|XP_008465743.1| PREDICTED: sucrose transport protein SUC3 [Cucumis melo]
Length=606

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 146/210 (70%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L+W++WFPF L+DTDWM REVY G+    + D  +YD+GVR GA GL+L SVVLG  S  
Sbjct  386  LSWLSWFPFFLFDTDWMGREVYHGDPKGSLTDERVYDQGVREGAFGLLLNSVVLGISSFF  445

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  +++W   NFI+   +A T  ++   S S   +   H +  NS++K  AL
Sbjct  446  IEPMCQRMG-ARLVWAMSNFIVFACMAGTTIIS-LISVSHYSEGIEHIIGGNSTIKNAAL  503

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
            A+F +LG PLA+T+S+PF+L    ++D+G GQ GL++GVLNLA+V+PQM VS  +GPWDA
Sbjct  504  AVFALLGFPLAITYSVPFSLTAELTADSGGGQ-GLAIGVLNLAVVIPQMIVSLGAGPWDA  562

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LF GGN+PAF + ++ A A+G++A+  LP 
Sbjct  563  LFSGGNIPAFALASICALAAGVVAVLRLPN  592



>gb|EYU28727.1| hypothetical protein MIMGU_mgv1a006020mg [Erythranthe guttata]
Length=461

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 143/210 (68%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REV+     GE  +   Y++GVR GA GL+L SVVLG  S  
Sbjct  241  LTWLSWFPFFLFDTDWMGREVFHGDPKGEAAEIEAYNQGVREGAFGLLLNSVVLGITSFF  300

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  +++W   NFI+ I +A T A+    S  +  D   H +  N + K  +L
Sbjct  301  IEPMCQRIG-ARLVWATSNFIVFICMAGT-AIISMISVRQYSDGVQHVIGANGTTKIASL  358

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG+PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWDA
Sbjct  359  VVFALLGLPLAITYSVPFSVTAELTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWDA  417

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGN+PAF + +V A A+G++A+  LP 
Sbjct  418  LFGGGNIPAFALASVCALAAGVIAVQRLPN  447



>emb|CDY41670.1| BnaC02g34840D [Brassica napus]
Length=533

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 144/216 (67%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G      L    Y +GVR GA GL+L SVVLGF S  
Sbjct  315  LTWLSWFPFFLFDTDWMGREVYHGNPTGESLLVKLYGQGVREGAFGLLLNSVVLGFSSFL  374

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  + +W   NF +   +A T AV    S     + + H +LPN + +  A+
Sbjct  375  IEPMCQRMG-ARAVWALSNFTVFACMAGT-AVISLMSLKDNSEGNEH-ILPNETTRTAAV  431

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWDA
Sbjct  432  IVFALLGFPLAITYSVPFSVTAEVTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWDA  490

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            LFGGGNLPAF++ +V+A A+G++A+  LP   S  K
Sbjct  491  LFGGGNLPAFVLASVAAFAAGVIALRSLPTLSSSFK  526



>ref|XP_006363242.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Solanum 
tuberosum]
Length=491

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 146/216 (68%), Gaps = 7/216 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY     GE ++   Y++GVR GA GL+L SVVLG  S  
Sbjct  272  LTWLSWFPFFLFDTDWMGREVYHGDPKGEADEVNAYNQGVREGAFGLLLNSVVLGVSSFL  331

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + + +G  +++W   NFI+ + +A T A+    S S   +   H +    S +  AL
Sbjct  332  IEPMCKWIGS-RLVWAASNFIVFVCMACT-AIISVVSISAHTEGVQHVIGATRSTQIAAL  389

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LGIPLAVT+S+PF++    ++DAG GQ GL++GVLNLAIVVPQM VS  +GPWDA
Sbjct  390  VVFSLLGIPLAVTYSVPFSITAELTADAGGGQ-GLAIGVLNLAIVVPQMVVSLGAGPWDA  448

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            LFGGGN+PAF++ +++A A+GI A+  LP   S+ K
Sbjct  449  LFGGGNIPAFVLASLAALAAGIFAMLRLPNLSSNFK  484



>emb|CAA76367.1| sucrose/H+ symporter [Daucus carota]
 emb|CAA76368.1| sucrose/H+ symporter [Daucus carota]
 emb|CAC19688.1| sucrose/proton symporter [Daucus carota]
Length=501

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 136/210 (65%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPF+L+DTDWM RE+YGGE N    Y  GVR GA GLM+ SVVLG  S+ +E L
Sbjct  293  LNWIGWFPFILFDTDWMGREIYGGEPNQGQSYSDGVRMGAFGLMMNSVVLGITSVLMEKL  352

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R  G    +W   N ++ I     + +T  A   +  D   +P  P + +   AL +F 
Sbjct  353  CRIWGS-GFMWGLSNILMTICFFAMLLITFIA---KNMDYGTNP--PPNGIVISALIVFA  406

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LGIPLA+T+S+P+AL        G GQ GLS+GVLNLAIVVPQ+ VS  SGPWD LFGG
Sbjct  407  ILGIPLAITYSVPYALVSTRIESLGLGQ-GLSMGVLNLAIVVPQVIVSLGSGPWDQLFGG  465

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            GN PAF+V A+SA A+G++A+  + +PR D
Sbjct  466  GNSPAFVVAALSAFAAGLIALIAIRRPRVD  495



>gb|AIU94754.1| sucrose transporter 2a [Morus alba var. multicaulis]
Length=515

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 146/210 (70%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L+W++WFPF L+DTDWM REVY G+    +++   YD+GVR GA GL+L SVVLG  S  
Sbjct  295  LSWLSWFPFFLFDTDWMGREVYHGDPKGSLSEVDGYDQGVREGAFGLLLNSVVLGISSFL  354

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  +++W   NFI+   +A T A+    S     +   H +  N ++K  +L
Sbjct  355  IEPMCQRMG-ARLVWALSNFIVFACMAGT-AIISLISVGEYSNGIQHVIGGNETIKTASL  412

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIVVPQM VS  +GPWDA
Sbjct  413  VVFALLGFPLAITYSVPFSVTAQLTADSGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPWDA  471

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGNLPAF++ +VSA A+G++AI  LP 
Sbjct  472  LFGGGNLPAFVLASVSALAAGVIAIRRLPN  501



>ref|XP_009593381.1| PREDICTED: sucrose transport protein SUC3 isoform X2 [Nicotiana 
tomentosiformis]
Length=605

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY     GE  +   Y++GVR GA GL+L SVVLG  S  
Sbjct  386  LTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGITSFF  445

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALT--VAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +E + + +G  +++W   N I+   +A T  +++   ++HSR      H +    S K  
Sbjct  446  IEPMCKWIGS-RLVWAVSNLIVFACMASTAIISLVSISAHSRGVQ---HVIEATQSTKIA  501

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            +L +F +LGIPLAVT+S+PF++    ++DAG GQ GL++GVLNLAIVVPQM VS  +GPW
Sbjct  502  SLVVFSLLGIPLAVTYSVPFSITAELTADAGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPW  560

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            DALFGGGN+PAF++ ++SA A+GI A+  LP   S+
Sbjct  561  DALFGGGNIPAFVLASLSALAAGIFAMLRLPNLSSN  596



>ref|XP_002983014.1| hypothetical protein SELMODRAFT_234154 [Selaginella moellendorffii]
 gb|EFJ15823.1| hypothetical protein SELMODRAFT_234154 [Selaginella moellendorffii]
Length=521

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 145/215 (67%), Gaps = 15/215 (7%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGE----VNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L+W++WFPF L+DTDWM REVY G+    ++    Y KGV+AGA GL+L SVVLG  S  
Sbjct  308  LSWLSWFPFFLFDTDWMGREVYNGDPSGGIDKAKSYQKGVQAGAFGLLLNSVVLGVSSFL  367

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            ++ L R LG  K LW   NFI+ I +A T  ++ +A H  + D H        S+K GAL
Sbjct  368  IDPLCRWLGS-KTLWATSNFIVFICMASTAIISASAYHHFQ-DFH--------SIKNGAL  417

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F VLG PLAVT+S+PF++    ++D G GQ GL++G+LNL++V+PQ+ V+  +GPWDA
Sbjct  418  VLFAVLGFPLAVTYSVPFSITAELTADTGGGQ-GLAMGILNLSVVIPQLVVALGAGPWDA  476

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDG  634
            +FGGGN PAF++ A+ A  +GI+AI  LP+   +G
Sbjct  477  VFGGGNEPAFVLAALFALVAGIIAIAWLPQLSREG  511



>ref|XP_009593380.1| PREDICTED: sucrose transport protein SUC3 isoform X1 [Nicotiana 
tomentosiformis]
Length=618

 Score =   191 bits (484),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVY----GGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY     GE  +   Y++GVR GA GL+L SVVLG  S  
Sbjct  399  LTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGITSFF  458

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALT--VAVTKAASHSRKYDAHGHPLLPNSSVKAG  343
            +E + + +G  +++W   N I+   +A T  +++   ++HSR      H +    S K  
Sbjct  459  IEPMCKWIGS-RLVWAVSNLIVFACMASTAIISLVSISAHSRGVQ---HVIEATQSTKIA  514

Query  344  ALAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPW  523
            +L +F +LGIPLAVT+S+PF++    ++DAG GQ GL++GVLNLAIVVPQM VS  +GPW
Sbjct  515  SLVVFSLLGIPLAVTYSVPFSITAELTADAGGGQ-GLAIGVLNLAIVVPQMIVSLGAGPW  573

Query  524  DALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSD  631
            DALFGGGN+PAF++ ++SA A+GI A+  LP   S+
Sbjct  574  DALFGGGNIPAFVLASLSALAAGIFAMLRLPNLSSN  609



>ref|XP_009129114.1| PREDICTED: sucrose transport protein SUC3-like isoform X1 [Brassica 
rapa]
Length=572

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 145/216 (67%), Gaps = 8/216 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGL----YDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G    + L    Y +GVR GA GL+L SVVLGF S  
Sbjct  354  LTWLSWFPFFLFDTDWMGREVYHGNPTGDSLLVKLYGQGVREGAFGLLLNSVVLGFSSFL  413

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + +++G  + +W   NF +   +A T AV    S     + + H +LPN + +  A+
Sbjct  414  IEPMCQRMG-ARAVWALSNFTVFACMAGT-AVISLMSLRDNSEGNEH-ILPNETTRTAAV  470

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWDA
Sbjct  471  IVFALLGFPLAITYSVPFSVTAEVTADSGGGQ-GLAIGVLNLAIVIPQMIVSIGAGPWDA  529

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            LFGGGNLPAF++ +V+A A+G++A+  LP   S  K
Sbjct  530  LFGGGNLPAFVLASVAAFAAGVIALRSLPTLSSSFK  565



>gb|KHN00701.1| Sucrose transport protein SUC2 [Glycine soja]
Length=446

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            +NW+AWFP++L+DTDWM REVYGG+V D   YD GV  GALGLML SVVL  MS+ VE L
Sbjct  258  INWVAWFPYVLFDTDWMGREVYGGKVGDKA-YDSGVHVGALGLMLNSVVLALMSLAVEPL  316

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R +G VK LW  VN ILA+ +A+TV +TKAA H R  +A      P+  VKA AL  F 
Sbjct  317  GRLVGGVKWLWGIVNVILAVCMAMTVLITKAAEHER-LNAVSLVGYPSLGVKAAALTFFS  375

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFL  511
            VLG+PLA+T+S+PFALA IYS+ +G+GQ GLSLGVLN+AIVVPQ+ +  L
Sbjct  376  VLGVPLAITYSVPFALASIYSTTSGAGQ-GLSLGVLNVAIVVPQVRIHLL  424



>gb|ADW94618.1| sucrose transporter 5 [Populus tremula x Populus alba]
Length=597

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            L W++WFPF L+DTDWM REVY G+   N     LYD+GVR GA GL+L SVVLG  S  
Sbjct  378  LTWLSWFPFFLFDTDWMGREVYHGDPKGNSNEVELYDQGVREGAFGLLLNSVVLGISSFL  437

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGAL  349
            +E + R+LG  + +W   NFI+   +A T AV    S     +   H +  N+ ++  AL
Sbjct  438  IEPMCRRLGS-RFVWAMSNFIVFACMAGT-AVISLISVGEYSEGIEHVIGGNAPIRIAAL  495

Query  350  AIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDA  529
             +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM +S  +GPWDA
Sbjct  496  IVFALLGFPLAITYSVPFSVTAELTADSGGGQ-GLAIGVLNLAIVIPQMIISIGAGPWDA  554

Query  530  LFGGGNLPAFIVGAVSAAASGILAITLLPK  619
            LFGGGN+PAF++ +VSA A+G++A   LP 
Sbjct  555  LFGGGNIPAFVLASVSALAAGVIATLKLPN  584



>gb|KHG09278.1| Sucrose transport SUC4 -like protein [Gossypium arboreum]
 gb|KHG21060.1| Sucrose transport SUC4 -like protein [Gossypium arboreum]
Length=507

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 140/217 (65%), Gaps = 7/217 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPFLL+DTDWM RE+YGG+ N+   Y+ GVR GA GLML SVVLG  S+ +E L
Sbjct  297  LNWIGWFPFLLFDTDWMGREIYGGQPNEGDNYNAGVRMGAFGLMLNSVVLGITSVLMEKL  356

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
              + G    +W   N ++A+     + ++  A+H   Y  HG   LP   +  GAL IF 
Sbjct  357  CSKWG-AGFIWGVSNILMALCFLAMLVLSYVANH-LDYIGHG---LPPIGIVIGALVIFS  411

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
             LGIPLA+T+S+P+AL        G GQ GLS+GVLNLAIV+PQ+ VS  SGPWD LFGG
Sbjct  412  FLGIPLAITYSVPYALISSRIESLGLGQ-GLSMGVLNLAIVIPQVVVSLGSGPWDQLFGG  470

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDG-KIVIP  649
            GN PAF V  V+A   G++AI  +P+  S   ++V+P
Sbjct  471  GNSPAFAVAGVAALTGGLVAILAIPRSSSQKPRVVLP  507



>ref|XP_010695439.1| PREDICTED: sucrose transport protein SUC4 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010695440.1| PREDICTED: sucrose transport protein SUC4 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010695441.1| PREDICTED: sucrose transport protein SUC4 [Beta vulgaris subsp. 
vulgaris]
Length=534

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 142/214 (66%), Gaps = 6/214 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            L WI WFPFLL+DTDWM REVYGG+ ++  +Y +GV  GALGLM QSVVLG  S+ +E L
Sbjct  322  LTWIGWFPFLLFDTDWMGREVYGGDPDEGQIYHRGVSTGALGLMSQSVVLGITSLLMEKL  381

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             ++LG   +LW   N I+++     + +    S   K D+ G    PN +V A A+ +F 
Sbjct  382  CKKLGS-GILWGISNIIMSLCFVAMLVIAFVLS---KADSFGSGSPPNGAVIA-AVIVFT  436

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LG+PLAVT+S+P+AL        G GQ GLS+GVLNLAIV+PQ+ VS  SGPWD LFGG
Sbjct  437  ILGMPLAVTYSIPYALISSRIESLGLGQ-GLSMGVLNLAIVLPQVIVSLGSGPWDQLFGG  495

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIV  643
            GN P+  V  V++ ASG++AI  LP+ R+D   V
Sbjct  496  GNSPSIAVAGVASFASGLMAILALPRSRTDKSRV  529



>gb|KDP41540.1| hypothetical protein JCGZ_15947 [Jatropha curcas]
Length=500

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 140/216 (65%), Gaps = 6/216 (3%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNGLYDKGVRAGALGLMLQSVVLGFMSIGVELL  181
            LNWI WFPFLL+DTDWM RE+YGG+ N+   Y+ GVR GA  LML SV+LG  S+ +E L
Sbjct  289  LNWIGWFPFLLFDTDWMGREIYGGKPNEGENYNIGVRTGAFALMLNSVILGITSVLMEKL  348

Query  182  ARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAHGHPLLPNSSVKAGALAIFC  361
             R+ G    +W   N ++A+     + ++  A+H   Y  H    LP + +   A+ IF 
Sbjct  349  CRKWG-AGFIWGISNIVMALCFLAMLTISYVATHI-GYMGHD---LPPAGIVTAAVVIFA  403

Query  362  VLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWDALFGG  541
            +LG+PLA+T+S+P+AL        G GQ GLS+GVLNLAIVVPQ+ VS  SGPWD LFGG
Sbjct  404  ILGVPLAITYSVPYALISSRIEPLGLGQ-GLSMGVLNLAIVVPQVIVSLGSGPWDQLFGG  462

Query  542  GNLPAFIVGAVSAAASGILAITLLPKPRSDGKIVIP  649
            GN PAF VGA++A + G++AI  +P+       V+P
Sbjct  463  GNSPAFAVGALAALSGGLIAILGIPRSTPQKPRVLP  498



>gb|AHH34924.1| sucrose transporter 2 isoform 8 [Theobroma cacao]
Length=405

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 148/217 (68%), Gaps = 9/217 (4%)
 Frame = +2

Query  2    LNWIAWFPFLLYDTDWMAREVYGGEVNDNG----LYDKGVRAGALGLMLQSVVLGFMSIG  169
            L+W++WFPF L+DTDWM REVY G+ N N     LYD+GVR GA GL+L SVVLG  S  
Sbjct  186  LSWLSWFPFFLFDTDWMGREVYHGDPNGNASQIKLYDQGVREGAFGLLLNSVVLGVSSFF  245

Query  170  VELLARQLGDVKMLWVGVNFILAIGLALTVAVTKAASHSRKYDAH-GHPLLPNSSVKAGA  346
            ++ + +++G  +++W   N+ +   +A+T  ++  +   R+Y     H +  +++++  A
Sbjct  246  IDPMCQRMGS-RLVWAMSNYTVFACMAVTAIISLVSV--REYSQGIEHVIGGSAAIRIAA  302

Query  347  LAIFCVLGIPLAVTFSLPFALACIYSSDAGSGQAGLSLGVLNLAIVVPQMFVSFLSGPWD  526
            L +F +LG PLA+T+S+PF++    ++D+G GQ GL++GVLNLAIV+PQM VS  +GPWD
Sbjct  303  LVVFALLGFPLAITYSVPFSVTAELTADSGGGQ-GLAIGVLNLAIVIPQMIVSLGAGPWD  361

Query  527  ALFGGGNLPAFIVGAVSAAASGILAITLLPKPRSDGK  637
            ALFGGGN+PAFI+ +  A A+G++A   LP   S  K
Sbjct  362  ALFGGGNIPAFILASFCALAAGVIATLKLPDLSSSFK  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2044329971256