BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25071_g1_i2 len=647 path=[1420:0-37 1458:38-55 1476:56-93
1514:94-136 5692:137-185 6149:186-201 6165:202-214 5006:215-310
6201:311-412 1815:413-482 6270:483-495 2529:496-556 2590:557-646]

Length=647
                                                                      Score     E

ref|XP_009765161.1|  PREDICTED: uncharacterized protein LOC104216739    131   6e-33   
ref|XP_009622757.1|  PREDICTED: uncharacterized protein LOC104114073    129   4e-32   
ref|XP_010324710.1|  PREDICTED: uncharacterized protein LOC104648643    104   2e-22   
ref|XP_009606623.1|  PREDICTED: uncharacterized protein LOC104100954    102   7e-22   
ref|XP_006351054.1|  PREDICTED: uncharacterized protein LOC102581981    101   4e-21   
ref|XP_009803102.1|  PREDICTED: uncharacterized protein LOC104248530    100   5e-21   
ref|XP_008461757.1|  PREDICTED: probable nucleoredoxin 1-1            95.9    8e-21   
ref|XP_006365047.1|  PREDICTED: uncharacterized protein LOC102593110  98.2    2e-20   
ref|XP_004151553.1|  PREDICTED: probable nucleoredoxin 1-1-like       94.0    4e-20   
ref|XP_009603826.1|  PREDICTED: uncharacterized protein LOC104098722  95.9    3e-19   
ref|XP_006362282.1|  PREDICTED: uncharacterized protein LOC102595178  95.9    5e-19   
ref|XP_009124845.1|  PREDICTED: uncharacterized protein LOC103849...  89.7    3e-18   
ref|XP_010317353.1|  PREDICTED: uncharacterized protein LOC104646058  92.0    6e-18   
ref|XP_006369466.1|  DC1 domain-containing family protein             87.8    9e-18   
ref|XP_006492914.1|  PREDICTED: uncharacterized protein LOC102618400  88.2    1e-17   
emb|CDX95602.1|  BnaC03g24830D                                        87.4    3e-17   
ref|XP_011087021.1|  PREDICTED: uncharacterized protein LOC105168581  86.3    3e-17   
gb|KDO70910.1|  hypothetical protein CISIN_1g040047mg                 87.0    4e-17   
ref|XP_006429888.1|  hypothetical protein CICLE_v10013549mg           87.0    4e-17   
ref|NP_181966.1|  cysteine/histidine-rich C1 domain-containing pr...  86.3    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011002292.1|  PREDICTED: uncharacterized protein LOC105109324  84.7    1e-16   
ref|XP_006295388.1|  hypothetical protein CARUB_v10024483mg           84.3    3e-16   
ref|XP_006362284.1|  PREDICTED: uncharacterized protein LOC102595829  85.5    4e-16   
ref|XP_006391683.1|  hypothetical protein EUTSA_v10023934mg           83.2    4e-16   
ref|XP_009133672.1|  PREDICTED: uncharacterized protein LOC103858132  82.4    1e-15   
ref|XP_010506364.1|  PREDICTED: uncharacterized protein LOC104782986  82.0    2e-15   
ref|XP_011088907.1|  PREDICTED: uncharacterized protein LOC105170022  84.3    2e-15   
ref|XP_006298947.1|  hypothetical protein CARUB_v10015072mg           81.6    2e-15   
emb|CDX83428.1|  BnaA03g20780D                                        81.6    3e-15   
ref|XP_009587920.1|  PREDICTED: uncharacterized protein LOC104085561  81.6    3e-15   
ref|XP_010506361.1|  PREDICTED: uncharacterized protein LOC104782983  81.3    3e-15   
ref|XP_010518036.1|  PREDICTED: uncharacterized protein LOC104793382  81.3    4e-15   
ref|XP_009142260.1|  PREDICTED: uncharacterized protein LOC103866137  80.9    4e-15   
dbj|BAF80452.1|  DC1 domain containing protein                        80.5    6e-15   Nicotiana tabacum [American tobacco]
ref|XP_010518037.1|  PREDICTED: uncharacterized protein LOC104793384  80.5    6e-15   
gb|KDP20386.1|  hypothetical protein JCGZ_05269                       79.7    6e-15   
gb|EYU27137.1|  hypothetical protein MIMGU_mgv1a0206321mg             80.5    1e-14   
ref|NP_180394.1|  cysteine/histidine-rich C1-like domain-containi...  79.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295416.1|  hypothetical protein CARUB_v10024514mg           79.3    2e-14   
ref|NP_199165.1|  cysteine/histidine-rich C1 domain-containing pr...  79.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506363.1|  PREDICTED: uncharacterized protein LOC104782985  79.0    2e-14   
ref|XP_008245408.1|  PREDICTED: uncharacterized protein LOC103343524  78.6    2e-14   
ref|XP_009775179.1|  PREDICTED: uncharacterized protein LOC104225108  80.5    2e-14   
ref|XP_009143019.1|  PREDICTED: uncharacterized protein LOC103866791  79.0    2e-14   
ref|XP_009792329.1|  PREDICTED: uncharacterized protein LOC104239399  78.6    3e-14   
ref|XP_006359185.1|  PREDICTED: uncharacterized protein LOC102578150  78.6    3e-14   
ref|XP_010481852.1|  PREDICTED: uncharacterized protein LOC104760602  78.2    4e-14   
ref|XP_009591761.1|  PREDICTED: uncharacterized protein LOC104088734  77.4    4e-14   
gb|KFK41231.1|  hypothetical protein AALP_AA2G102500                  77.8    5e-14   
ref|XP_011087030.1|  PREDICTED: uncharacterized protein LOC105168590  79.3    5e-14   
ref|XP_006397613.1|  hypothetical protein EUTSA_v10001601mg           77.4    6e-14   
ref|XP_010510646.1|  PREDICTED: uncharacterized protein LOC104786891  77.4    7e-14   
ref|XP_010474009.1|  PREDICTED: uncharacterized protein LOC104753454  79.0    8e-14   
ref|XP_006418664.1|  hypothetical protein EUTSA_v10002650mg           76.6    1e-13   
ref|XP_010442014.1|  PREDICTED: uncharacterized protein LOC104725107  76.6    1e-13   
ref|XP_006281652.1|  hypothetical protein CARUB_v10027788mg           76.6    2e-13   
ref|XP_010257481.1|  PREDICTED: uncharacterized protein LOC104597562  76.3    2e-13   
ref|XP_009142259.1|  PREDICTED: uncharacterized protein LOC103866135  76.3    2e-13   
ref|XP_011087011.1|  PREDICTED: uncharacterized protein LOC105168571  76.3    2e-13   
ref|NP_181965.1|  cysteine/histidine-rich C1 domain-containing pr...  76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295592.1|  hypothetical protein CARUB_v10024700mg           75.5    3e-13   
emb|CDY30467.1|  BnaA04g25680D                                        75.5    3e-13   
ref|XP_010508303.1|  PREDICTED: uncharacterized protein LOC104784899  75.5    3e-13   
ref|XP_009763577.1|  PREDICTED: uncharacterized protein LOC104215463  74.7    4e-13   
ref|XP_009142258.1|  PREDICTED: uncharacterized protein LOC103866134  75.1    4e-13   
ref|XP_010265934.1|  PREDICTED: uncharacterized protein LOC104603561  75.1    4e-13   
ref|XP_006397615.1|  hypothetical protein EUTSA_v10001796mg           75.1    4e-13   
ref|XP_011036333.1|  PREDICTED: uncharacterized protein LOC105133...  77.8    5e-13   
ref|XP_011036334.1|  PREDICTED: uncharacterized protein LOC105133...  77.8    5e-13   
ref|XP_002512181.1|  protein binding protein, putative                74.3    5e-13   Ricinus communis
ref|XP_007048688.1|  Binding protein, putative                        74.3    5e-13   
ref|XP_011036335.1|  PREDICTED: uncharacterized protein LOC105133...  77.8    6e-13   
ref|XP_010506360.1|  PREDICTED: uncharacterized protein LOC104782982  74.3    9e-13   
emb|CDP07682.1|  unnamed protein product                              74.3    9e-13   
emb|CDY23431.1|  BnaC04g49590D                                        73.9    9e-13   
ref|XP_006359188.1|  PREDICTED: uncharacterized protein LOC102579475  73.9    9e-13   
ref|NP_179365.1|  cysteine/histidine-rich C1 domain-containing pr...  73.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004229343.2|  PREDICTED: uncharacterized protein LOC101249296  76.3    1e-12   
ref|XP_010544532.1|  PREDICTED: diacylglycerol kinase theta-like      73.9    1e-12   
gb|EYU27129.1|  hypothetical protein MIMGU_mgv1a020238mg              73.2    1e-12   
ref|XP_010544531.1|  PREDICTED: uncharacterized protein LOC104817156  73.6    1e-12   
ref|XP_010514676.1|  PREDICTED: uncharacterized protein LOC104790594  73.6    2e-12   
ref|XP_010489404.1|  PREDICTED: uncharacterized protein LOC104767077  73.6    2e-12   
ref|XP_010467568.1|  PREDICTED: uncharacterized protein LOC104747...  73.2    2e-12   
gb|AEI52549.1|  cysteine/histidine-rich DC1 domain protein            72.8    2e-12   
ref|XP_002522096.1|  protein binding protein, putative                72.8    2e-12   Ricinus communis
ref|XP_006359175.1|  PREDICTED: uncharacterized protein LOC102603106  72.4    3e-12   
gb|EYU27132.1|  hypothetical protein MIMGU_mgv1a025339mg              72.0    3e-12   
ref|XP_006359183.1|  PREDICTED: uncharacterized protein LOC102605804  72.8    3e-12   
ref|XP_006359182.1|  PREDICTED: uncharacterized protein LOC102605462  74.3    3e-12   
ref|XP_010322058.1|  PREDICTED: uncharacterized protein LOC104647902  74.3    3e-12   
ref|XP_009774519.1|  PREDICTED: uncharacterized protein LOC104224534  72.4    3e-12   
ref|XP_010659603.1|  PREDICTED: uncharacterized protein LOC100244183  73.6    4e-12   
pir||T08861  hypothetical protein A_TM017A05.3 - Arabidopsis thal...  74.3    4e-12
ref|XP_011075259.1|  PREDICTED: uncharacterized protein LOC105159772  72.0    4e-12   
ref|XP_004229360.1|  PREDICTED: uncharacterized protein LOC101254632  72.0    5e-12   
ref|XP_010322098.1|  PREDICTED: uncharacterized protein LOC104647934  71.2    6e-12   
ref|XP_009596187.1|  PREDICTED: uncharacterized protein LOC104092315  71.6    7e-12   
ref|XP_002325342.1|  DC1 domain-containing family protein             74.3    8e-12   Populus trichocarpa [western balsam poplar]
emb|CDP07681.1|  unnamed protein product                              70.9    8e-12   
ref|XP_009765121.1|  PREDICTED: uncharacterized protein LOC104216701  72.4    8e-12   
ref|XP_009143017.1|  PREDICTED: uncharacterized protein LOC103866789  71.2    8e-12   
ref|XP_006359155.1|  PREDICTED: uncharacterized protein LOC102596695  71.2    1e-11   
ref|XP_008246270.1|  PREDICTED: probable nucleoredoxin 1              68.6    2e-11   
gb|KFK37245.1|  hypothetical protein AALP_AA4G232600                  70.1    2e-11   
gb|EYU27121.1|  hypothetical protein MIMGU_mgv1a025457mg              71.6    2e-11   
emb|CDY23430.1|  BnaC04g49580D                                        69.7    3e-11   
gb|EYU27139.1|  hypothetical protein MIMGU_mgv1a018142mg              71.6    3e-11   
emb|CDY17855.1|  BnaC04g03640D                                        69.7    3e-11   
ref|XP_002275658.1|  PREDICTED: uncharacterized protein LOC100258837  69.7    3e-11   Vitis vinifera
ref|XP_010435990.1|  PREDICTED: uncharacterized protein LOC104719723  69.3    3e-11   
ref|XP_009596216.1|  PREDICTED: uncharacterized protein LOC104092334  69.7    4e-11   
ref|XP_009614686.1|  PREDICTED: uncharacterized protein LOC104107...  69.3    4e-11   
ref|XP_009619361.1|  PREDICTED: uncharacterized protein LOC104111386  70.1    6e-11   
ref|XP_004136731.1|  PREDICTED: uncharacterized protein LOC101202742  68.9    6e-11   
gb|EYU27138.1|  hypothetical protein MIMGU_mgv1a019574mg              67.0    6e-11   
ref|XP_010441210.1|  PREDICTED: uncharacterized protein LOC104724421  68.6    7e-11   
ref|NP_198875.1|  cysteine/histidine-rich C1 domain-containing pr...  68.6    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450640.1|  PREDICTED: uncharacterized protein LOC104732759  68.6    8e-11   
ref|XP_008443040.1|  PREDICTED: uncharacterized protein LOC103486755  68.6    8e-11   
emb|CDP07680.1|  unnamed protein product                              69.7    1e-10   
gb|EYU39948.1|  hypothetical protein MIMGU_mgv11b021121mg             67.8    1e-10   
ref|XP_011000768.1|  PREDICTED: uncharacterized protein LOC105108...  68.6    2e-10   
ref|XP_011000773.1|  PREDICTED: uncharacterized protein LOC105108...  68.6    2e-10   
ref|XP_010246187.1|  PREDICTED: uncharacterized protein LOC104589539  68.9    2e-10   
ref|XP_011000772.1|  PREDICTED: uncharacterized protein LOC105108...  68.6    2e-10   
ref|XP_011000771.1|  PREDICTED: uncharacterized protein LOC105108...  68.6    2e-10   
ref|XP_011000767.1|  PREDICTED: uncharacterized protein LOC105108...  68.6    2e-10   
ref|XP_002268131.1|  PREDICTED: uncharacterized protein LOC100261320  68.9    2e-10   Vitis vinifera
ref|XP_009786636.1|  PREDICTED: uncharacterized protein LOC104234719  68.9    2e-10   
ref|NP_180334.1|  cysteine/histidine-rich C1 domain-containing pr...  69.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286066.1|  hypothetical protein CARUB_v10007599mg           67.0    2e-10   
ref|XP_009103612.1|  PREDICTED: uncharacterized protein LOC103829678  69.3    2e-10   
ref|XP_006493876.1|  PREDICTED: uncharacterized protein LOC102615121  69.7    2e-10   
ref|XP_004229344.1|  PREDICTED: uncharacterized protein LOC101249575  67.0    3e-10   
ref|XP_002322661.1|  hypothetical protein POPTR_0016s04640g           69.3    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009614685.1|  PREDICTED: uncharacterized protein LOC104107...  68.2    3e-10   
ref|XP_006369462.1|  hypothetical protein POPTR_0001s23660g           68.2    3e-10   
emb|CDY04505.1|  BnaA07g13310D                                        68.9    3e-10   
gb|EYU27122.1|  hypothetical protein MIMGU_mgv1a017892mg              67.4    3e-10   
ref|XP_006359159.1|  PREDICTED: uncharacterized protein LOC102598...  68.2    3e-10   
ref|XP_006359160.1|  PREDICTED: uncharacterized protein LOC102598...  68.2    3e-10   
gb|EYU27150.1|  hypothetical protein MIMGU_mgv1a018784mg              66.2    3e-10   
gb|KDO59944.1|  hypothetical protein CISIN_1g045770mg                 69.3    3e-10   
gb|EYU27149.1|  hypothetical protein MIMGU_mgv1a012140mg              67.0    4e-10   
ref|XP_006359156.1|  PREDICTED: uncharacterized protein LOC102597028  67.0    4e-10   
gb|EYU27106.1|  hypothetical protein MIMGU_mgv1a024431mg              68.2    4e-10   
ref|XP_011002310.1|  PREDICTED: uncharacterized protein LOC105109329  67.4    4e-10   
ref|XP_006296128.1|  hypothetical protein CARUB_v10025280mg           68.6    5e-10   
ref|XP_009771792.1|  PREDICTED: uncharacterized protein LOC104222273  67.4    5e-10   
gb|EYU27147.1|  hypothetical protein MIMGU_mgv1a023839mg              65.5    5e-10   
ref|XP_006347358.1|  PREDICTED: uncharacterized protein LOC102591548  67.8    5e-10   
ref|XP_010099226.1|  hypothetical protein L484_010166                 65.9    5e-10   
ref|XP_006494733.1|  PREDICTED: uncharacterized protein LOC102619...  68.2    6e-10   
ref|XP_006494731.1|  PREDICTED: uncharacterized protein LOC102619...  68.2    7e-10   
ref|XP_010067903.1|  PREDICTED: uncharacterized protein LOC104454684  67.4    7e-10   
ref|XP_002863648.1|  predicted protein                                65.9    7e-10   
gb|EYU27101.1|  hypothetical protein MIMGU_mgv1a018252mg              65.1    7e-10   
ref|XP_009401012.1|  PREDICTED: uncharacterized protein LOC103985121  66.6    8e-10   
gb|KDO59888.1|  hypothetical protein CISIN_1g001175mg                 68.2    8e-10   
ref|XP_010417918.1|  PREDICTED: uncharacterized protein LOC104703584  67.8    8e-10   
ref|XP_010653882.1|  PREDICTED: uncharacterized protein LOC104880120  66.2    9e-10   
ref|XP_006494732.1|  PREDICTED: uncharacterized protein LOC102619...  67.8    9e-10   
gb|EYU27120.1|  hypothetical protein MIMGU_mgv1a020005mg              65.1    1e-09   
ref|XP_009792330.1|  PREDICTED: X-linked retinitis pigmentosa GTP...  67.0    1e-09   
ref|XP_006427959.1|  hypothetical protein CICLE_v10027164mg           67.4    1e-09   
gb|EYU27125.1|  hypothetical protein MIMGU_mgv1a018137mg              67.0    1e-09   
gb|KDO50452.1|  hypothetical protein CISIN_1g047354mg                 67.0    1e-09   
ref|XP_011088894.1|  PREDICTED: uncharacterized protein LOC105170014  64.7    1e-09   
ref|XP_004229362.2|  PREDICTED: uncharacterized protein LOC101255237  67.4    1e-09   
gb|KDO38181.1|  hypothetical protein CISIN_1g048092mg                 67.0    1e-09   
dbj|BAF80453.1|  DC1 domain containing protein                        64.7    1e-09   Nicotiana tabacum [American tobacco]
ref|XP_006373734.1|  hypothetical protein POPTR_0016s04400g           67.0    1e-09   
gb|EYU27145.1|  hypothetical protein MIMGU_mgv1a023592mg              64.3    1e-09   
ref|XP_006428003.1|  hypothetical protein CICLE_v10027267mg           67.0    1e-09   
ref|XP_006464849.1|  PREDICTED: uncharacterized protein LOC102606978  66.2    1e-09   
ref|XP_002530545.1|  protein binding protein, putative                65.9    2e-09   Ricinus communis
gb|EYU27152.1|  hypothetical protein MIMGU_mgv1a026602mg              63.9    2e-09   
ref|XP_011039457.1|  PREDICTED: uncharacterized protein LOC105136...  66.6    2e-09   
ref|XP_004241463.2|  PREDICTED: uncharacterized protein LOC101268692  66.2    2e-09   
gb|KCW66146.1|  hypothetical protein EUGRSUZ_G03410                   65.9    2e-09   
gb|EYU39949.1|  hypothetical protein MIMGU_mgv1a026991mg              64.3    2e-09   
ref|XP_002317723.2|  DC1 domain-containing family protein             65.9    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011039456.1|  PREDICTED: uncharacterized protein LOC105136...  66.6    2e-09   
emb|CDY67171.1|  BnaCnng53840D                                        64.3    2e-09   
ref|XP_009125148.1|  PREDICTED: uncharacterized protein LOC103850185  64.3    2e-09   
gb|EYU27127.1|  hypothetical protein MIMGU_mgv1a026504mg              65.9    2e-09   
emb|CAN66246.1|  hypothetical protein VITISV_033016                   65.9    2e-09   Vitis vinifera
ref|XP_007162329.1|  hypothetical protein PHAVU_001G142800g           66.2    3e-09   
emb|CDX67465.1|  BnaA07g15050D                                        63.9    3e-09   
ref|XP_006373751.1|  hypothetical protein POPTR_0016s04730g           63.9    3e-09   
ref|XP_002322659.2|  hypothetical protein POPTR_0016s04390g           65.5    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006359186.1|  PREDICTED: uncharacterized protein LOC102578476  63.9    3e-09   
ref|XP_006359187.1|  PREDICTED: uncharacterized protein LOC102578819  63.2    3e-09   
ref|XP_006468700.1|  PREDICTED: uncharacterized protein LOC102618382  66.2    4e-09   
ref|XP_006373756.1|  hypothetical protein POPTR_0016s04770g           65.5    4e-09   
ref|XP_010510747.1|  PREDICTED: stress protein DDR48-like isoform X2  65.5    4e-09   
ref|XP_010510746.1|  PREDICTED: uncharacterized protein LOC104786...  65.5    5e-09   
ref|XP_006373731.1|  hypothetical protein POPTR_0016s043802g          63.2    5e-09   
ref|XP_006373733.1|  hypothetical protein POPTR_0016s04390g           65.5    5e-09   
gb|KDO76992.1|  hypothetical protein CISIN_1g045873mg                 65.1    6e-09   
gb|KDO77182.1|  hypothetical protein CISIN_1g039635mg                 65.1    6e-09   
ref|XP_007030565.1|  Cysteine/Histidine-rich C1 domain family pro...  65.1    7e-09   
ref|XP_006427961.1|  hypothetical protein CICLE_v10027263mg           64.7    8e-09   
ref|XP_006464498.1|  PREDICTED: uncharacterized protein LOC102623574  64.7    8e-09   
ref|XP_009773620.1|  PREDICTED: uncharacterized protein LOC104223817  62.4    9e-09   
ref|XP_006448472.1|  hypothetical protein CICLE_v10014060mg           64.7    9e-09   
ref|XP_002323327.2|  DC1 domain-containing family protein             64.3    9e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006855604.1|  hypothetical protein AMTR_s00044p00069570        63.5    9e-09   
ref|XP_010473158.1|  PREDICTED: uncharacterized protein LOC104752661  64.3    9e-09   
emb|CDP07683.1|  unnamed protein product                              63.9    1e-08   
ref|XP_006478123.1|  PREDICTED: uncharacterized protein LOC102618330  63.2    1e-08   
ref|XP_009384606.1|  PREDICTED: uncharacterized protein LOC103972122  62.0    1e-08   
ref|XP_009587118.1|  PREDICTED: uncharacterized protein LOC104084868  63.2    1e-08   
ref|XP_009591760.1|  PREDICTED: uncharacterized protein LOC104088...  63.2    2e-08   
ref|XP_006294621.1|  hypothetical protein CARUB_v10023658mg           63.2    2e-08   
ref|XP_007039749.1|  Cysteine/Histidine-rich C1 domain family pro...  63.5    2e-08   
ref|XP_011088918.1|  PREDICTED: diacylglycerol kinase theta-like      62.4    2e-08   
ref|XP_007029374.1|  Cysteine/Histidine-rich C1 domain family pro...  63.5    2e-08   
ref|XP_009591759.1|  PREDICTED: uncharacterized protein LOC104088...  63.2    2e-08   
ref|XP_006373757.1|  hypothetical protein POPTR_0016s04780g           63.2    2e-08   
ref|XP_007029009.1|  Cysteine/Histidine-rich C1 domain family pro...  62.0    2e-08   
gb|KDO46400.1|  hypothetical protein CISIN_1g035521mg                 62.0    3e-08   
ref|XP_010058185.1|  PREDICTED: uncharacterized protein LOC104445959  63.2    3e-08   
ref|XP_004229346.1|  PREDICTED: uncharacterized protein LOC101250152  62.4    3e-08   
gb|KDO48122.1|  hypothetical protein CISIN_1g042732mg                 61.6    3e-08   
ref|XP_006855605.1|  hypothetical protein AMTR_s00044p00070150        62.0    3e-08   
ref|XP_006441352.1|  hypothetical protein CICLE_v10024031mg           62.0    3e-08   
ref|XP_004295355.1|  PREDICTED: uncharacterized protein LOC101300707  62.8    4e-08   
ref|XP_007029172.1|  Cysteine/Histidine-rich C1 domain family pro...  62.8    4e-08   
ref|XP_009596208.1|  PREDICTED: uncharacterized protein LOC104092...  61.2    4e-08   
ref|XP_006409752.1|  hypothetical protein EUTSA_v10016319mg           62.4    4e-08   
ref|XP_009596198.1|  PREDICTED: uncharacterized protein LOC104092...  61.2    4e-08   
gb|EYU27128.1|  hypothetical protein MIMGU_mgv1a022928mg              62.0    4e-08   
gb|KFK32385.1|  hypothetical protein AALP_AA6G234500                  62.4    4e-08   
ref|XP_006373755.1|  hypothetical protein POPTR_0016s047601g          60.8    5e-08   
ref|XP_002323288.2|  hypothetical protein POPTR_0016s04350g           62.4    5e-08   Populus trichocarpa [western balsam poplar]
emb|CDX91385.1|  BnaC04g07650D                                        61.2    5e-08   
ref|XP_009143447.1|  PREDICTED: uncharacterized protein LOC103867159  61.2    5e-08   
ref|XP_006359193.1|  PREDICTED: uncharacterized protein LOC102581474  61.6    6e-08   
ref|XP_010053581.1|  PREDICTED: uncharacterized protein LOC104441996  61.6    6e-08   
ref|XP_006493588.1|  PREDICTED: uncharacterized protein LOC102620333  61.2    6e-08   
ref|NP_181318.1|  cysteine/histidine-rich C1 domain-containing pr...  61.2    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023022.1|  Cysteine/Histidine-rich C1 domain family pro...  60.5    6e-08   
ref|XP_011033197.1|  PREDICTED: uncharacterized protein LOC105131...  61.6    7e-08   
ref|XP_006387214.1|  hypothetical protein POPTR_1519s00200g           59.3    8e-08   
ref|XP_009804497.1|  PREDICTED: uncharacterized protein LOC104249718  60.5    8e-08   
ref|XP_006493596.1|  PREDICTED: uncharacterized protein LOC102622534  61.2    8e-08   
ref|XP_010318329.1|  PREDICTED: uncharacterized protein LOC101264193  61.2    8e-08   
ref|XP_006295890.1|  hypothetical protein CARUB_v10025020mg           60.5    9e-08   
ref|XP_007219149.1|  hypothetical protein PRUPE_ppa016475mg           61.2    9e-08   
ref|XP_009793294.1|  PREDICTED: uncharacterized protein LOC104240207  59.3    9e-08   
emb|CDP10152.1|  unnamed protein product                              60.1    1e-07   
ref|XP_006373753.1|  hypothetical protein POPTR_0016s04750g           59.7    1e-07   
ref|XP_009596227.1|  PREDICTED: uncharacterized protein LOC104092341  60.1    1e-07   
ref|XP_006410101.1|  hypothetical protein EUTSA_v10017722mg           61.2    1e-07   
ref|XP_008245400.1|  PREDICTED: zinc finger homeobox protein 3-like   60.8    1e-07   
ref|XP_010055458.1|  PREDICTED: uncharacterized protein LOC104443655  61.2    1e-07   
ref|XP_006359192.1|  PREDICTED: uncharacterized protein LOC102580796  60.1    1e-07   
ref|XP_006487867.1|  PREDICTED: uncharacterized protein LOC102609693  60.8    1e-07   
gb|KCW71933.1|  hypothetical protein EUGRSUZ_E00393                   60.8    1e-07   
gb|EYU27144.1|  hypothetical protein MIMGU_mgv1a019454mg              60.5    2e-07   
ref|XP_007031380.1|  Cysteine/Histidine-rich C1 domain family pro...  60.1    2e-07   
gb|KDP46658.1|  hypothetical protein JCGZ_10967                       60.5    2e-07   
ref|XP_006410975.1|  hypothetical protein EUTSA_v10017859mg           59.7    2e-07   
gb|EYU27109.1|  hypothetical protein MIMGU_mgv1a024965mg              60.1    2e-07   
ref|XP_010940196.1|  PREDICTED: uncharacterized protein LOC105058837  58.5    2e-07   
ref|XP_010055461.1|  PREDICTED: uncharacterized protein LOC104443657  60.1    2e-07   
ref|XP_006493673.1|  PREDICTED: uncharacterized protein LOC102629364  60.1    2e-07   
ref|XP_007030367.1|  Cysteine/Histidine-rich C1 domain family pro...  60.1    3e-07   
ref|XP_009604305.1|  PREDICTED: uncharacterized protein LOC104099108  57.8    3e-07   
ref|XP_011073147.1|  PREDICTED: uncharacterized protein LOC105158187  59.3    3e-07   
ref|XP_011033196.1|  PREDICTED: uncharacterized protein LOC105131...  59.7    3e-07   
ref|XP_002463170.1|  hypothetical protein SORBIDRAFT_02g039045        57.4    3e-07   Sorghum bicolor [broomcorn]
gb|KDO39370.1|  hypothetical protein CISIN_1g041617mg                 59.3    3e-07   
gb|KDO64872.1|  hypothetical protein CISIN_1g036302mg                 59.7    3e-07   
ref|XP_011033194.1|  PREDICTED: uncharacterized protein LOC105131...  59.7    4e-07   
ref|XP_007030357.1|  Cysteine/Histidine-rich C1 domain family pro...  59.7    4e-07   
ref|XP_009603982.1|  PREDICTED: uncharacterized protein LOC104098855  57.4    4e-07   
ref|XP_006432979.1|  hypothetical protein CICLE_v10003276mg           59.3    4e-07   
ref|XP_006373750.1|  hypothetical protein POPTR_0016s047201g          58.9    5e-07   
gb|AAK55771.1|AC079038_5  Hypothetical protein                        56.6    5e-07   
ref|XP_006446008.1|  hypothetical protein CICLE_v10018184mg           58.9    6e-07   
ref|XP_006471929.1|  PREDICTED: uncharacterized protein LOC102617456  58.9    6e-07   
ref|XP_007162330.1|  hypothetical protein PHAVU_001G142900g           58.2    8e-07   
ref|XP_007023018.1|  Cysteine/Histidine-rich C1 domain family pro...  58.5    9e-07   
gb|EYU27124.1|  hypothetical protein MIMGU_mgv1a018864mg              57.4    9e-07   
ref|XP_011033198.1|  PREDICTED: uncharacterized protein LOC105131...  58.5    9e-07   
gb|KCW71924.1|  hypothetical protein EUGRSUZ_E00381                   58.2    9e-07   
gb|EYU35252.1|  hypothetical protein MIMGU_mgv1a020442mg              57.8    1e-06   
ref|XP_006373752.1|  hypothetical protein POPTR_0016s04740g           58.2    1e-06   
ref|XP_010559202.1|  PREDICTED: uncharacterized protein LOC104827679  57.4    1e-06   
ref|XP_008350965.1|  PREDICTED: uncharacterized protein LOC103414344  55.5    1e-06   
ref|XP_007028907.1|  Uncharacterized protein TCM_024834               58.5    1e-06   
gb|EYU27133.1|  hypothetical protein MIMGU_mgv1a024743mg              55.1    1e-06   
ref|XP_009410586.1|  PREDICTED: atherin-like                          57.8    1e-06   
ref|XP_007219446.1|  hypothetical protein PRUPE_ppa021057mg           55.1    1e-06   
gb|KCW45923.1|  hypothetical protein EUGRSUZ_L00189                   56.2    1e-06   
ref|XP_010058184.1|  PREDICTED: uncharacterized protein LOC104445957  58.2    1e-06   
emb|CAN66248.1|  hypothetical protein VITISV_033018                   56.2    1e-06   
gb|KCW71929.1|  hypothetical protein EUGRSUZ_E00386                   57.8    1e-06   
ref|XP_007011181.1|  Cysteine/Histidine-rich C1 domain family pro...  57.8    1e-06   
gb|EYU27146.1|  hypothetical protein MIMGU_mgv1a011839mg              57.0    1e-06   
ref|XP_007011180.1|  Cysteine/Histidine-rich C1 domain family pro...  57.8    1e-06   
gb|EYU27108.1|  hypothetical protein MIMGU_mgv1a022256mg              57.0    1e-06   
gb|KDO70911.1|  hypothetical protein CISIN_1g037846mg                 55.8    2e-06   
ref|XP_010456987.1|  PREDICTED: uncharacterized protein LOC104738520  57.4    2e-06   
ref|XP_010441986.1|  PREDICTED: uncharacterized protein LOC104725076  57.0    2e-06   
ref|XP_002271768.1|  PREDICTED: diacylglycerol kinase theta-like      57.0    2e-06   
emb|CAN76522.1|  hypothetical protein VITISV_034514                   57.4    2e-06   
gb|EYU41773.1|  hypothetical protein MIMGU_mgv1a024136mg              56.6    2e-06   
ref|XP_006429887.1|  hypothetical protein CICLE_v10013637mg           55.5    2e-06   
gb|KDO39369.1|  hypothetical protein CISIN_1g043301mg                 56.6    2e-06   
ref|XP_010055460.1|  PREDICTED: uncharacterized protein LOC104443656  57.4    2e-06   
emb|CAN63103.1|  hypothetical protein VITISV_029578                   57.4    2e-06   
ref|XP_007030370.1|  Uncharacterized protein TCM_026167               57.4    2e-06   
ref|XP_002862969.1|  predicted protein                                54.3    2e-06   
ref|XP_010434825.1|  PREDICTED: uncharacterized protein LOC104718...  55.1    3e-06   
ref|XP_010658575.1|  PREDICTED: uncharacterized protein LOC104881138  55.8    4e-06   
emb|CDX71437.1|  BnaC04g16720D                                        56.6    4e-06   
ref|XP_010053575.1|  PREDICTED: uncharacterized protein LOC104441990  55.5    4e-06   
ref|XP_007029176.1|  Cysteine/Histidine-rich C1 domain family pro...  56.2    4e-06   
ref|XP_007201930.1|  hypothetical protein PRUPE_ppa018521mg           56.2    5e-06   
ref|XP_006432978.1|  hypothetical protein CICLE_v10003700mg           55.5    5e-06   
ref|XP_007039748.1|  Cysteine/Histidine-rich C1 domain family pro...  56.2    5e-06   
ref|XP_010509273.1|  PREDICTED: LOW QUALITY PROTEIN: diacylglycer...  55.8    5e-06   
gb|EYU27131.1|  hypothetical protein MIMGU_mgv1a025308mg              55.8    5e-06   
ref|XP_007026910.1|  Cysteine/Histidine-rich C1 domain family pro...  55.5    6e-06   
ref|XP_009587921.1|  PREDICTED: uncharacterized protein LOC104085562  55.5    6e-06   
gb|EYU27126.1|  hypothetical protein MIMGU_mgv1a025310mg              55.5    7e-06   
ref|XP_004507389.1|  PREDICTED: uncharacterized protein LOC101513960  55.1    7e-06   
gb|KDP24637.1|  hypothetical protein JCGZ_25553                       55.1    8e-06   
ref|XP_007023019.1|  Cysteine/Histidine-rich C1 domain family pro...  55.5    9e-06   
ref|XP_010434819.1|  PREDICTED: uncharacterized protein LOC104718...  55.5    9e-06   
ref|XP_006410115.1|  hypothetical protein EUTSA_v10016584mg           55.5    9e-06   
ref|XP_006341198.1|  PREDICTED: diacylglycerol kinase theta-like      54.7    1e-05   
emb|CDY12656.1|  BnaA02g13240D                                        55.1    1e-05   
ref|XP_006410102.1|  hypothetical protein EUTSA_v10016296mg           55.1    1e-05   
ref|NP_181316.1|  cysteine/histidine-rich C1 domain-containing pr...  54.7    1e-05   
ref|XP_007131878.1|  hypothetical protein PHAVU_011G048900g           54.3    1e-05   
ref|XP_009127564.1|  PREDICTED: uncharacterized protein LOC103852...  55.1    1e-05   
ref|XP_010467569.1|  PREDICTED: uncharacterized protein LOC104747...  53.9    1e-05   
ref|XP_010099221.1|  hypothetical protein L484_010161                 53.5    1e-05   
gb|KDP39904.1|  hypothetical protein JCGZ_03435                       54.7    2e-05   
emb|CDP21193.1|  unnamed protein product                              54.3    2e-05   
gb|EYU27135.1|  hypothetical protein MIMGU_mgv11b0112341mg            53.1    2e-05   
ref|XP_008241198.1|  PREDICTED: uncharacterized protein LOC103339643  54.3    2e-05   
gb|KFK23682.1|  hypothetical protein AALP_AAs63807U000300             54.3    2e-05   
ref|XP_006471697.1|  PREDICTED: uncharacterized protein LOC102621084  54.3    2e-05   
ref|XP_010111365.1|  hypothetical protein L484_028022                 54.3    2e-05   
ref|XP_006428054.1|  hypothetical protein CICLE_v10027597mg           54.7    2e-05   
emb|CDY50382.1|  BnaCnng19140D                                        54.7    2e-05   
ref|XP_006493872.1|  PREDICTED: uncharacterized protein LOC102613643  54.3    2e-05   
ref|XP_007030637.1|  Cysteine/Histidine-rich C1 domain family pro...  54.3    2e-05   
ref|XP_010517057.1|  PREDICTED: diacylglycerol kinase theta           53.9    2e-05   
ref|XP_008787842.1|  PREDICTED: uncharacterized protein LOC103705770  52.8    2e-05   
ref|XP_006410972.1|  hypothetical protein EUTSA_v10017725mg           53.1    2e-05   
ref|XP_011041124.1|  PREDICTED: diacylglycerol kinase theta           53.9    2e-05   
ref|XP_010910408.1|  PREDICTED: uncharacterized protein LOC105036333  53.5    2e-05   
ref|XP_010514884.1|  PREDICTED: uncharacterized protein LOC104790794  53.9    2e-05   
ref|XP_007019808.1|  Cysteine/Histidine-rich C1 domain family pro...  54.3    2e-05   
ref|XP_007023025.1|  Cysteine/Histidine-rich C1 domain family pro...  54.3    3e-05   
gb|KHG23659.1|  hypothetical protein F383_04166                       53.9    3e-05   
ref|XP_007030358.1|  Uncharacterized protein TCM_026154               53.9    3e-05   
ref|XP_007030562.1|  Cysteine/Histidine-rich C1 domain family pro...  53.5    3e-05   
ref|XP_006435484.1|  hypothetical protein CICLE_v10001981mg           53.5    3e-05   
ref|XP_007023017.1|  Cysteine/Histidine-rich C1 domain family pro...  53.9    3e-05   
ref|XP_006492915.1|  PREDICTED: uncharacterized protein LOC102618677  53.5    3e-05   
gb|EYU27105.1|  hypothetical protein MIMGU_mgv1a026194mg              53.1    3e-05   
ref|XP_006464537.1|  PREDICTED: uncharacterized protein LOC102611510  53.9    3e-05   
ref|XP_008466547.1|  PREDICTED: uncharacterized protein LOC103503932  53.9    3e-05   
ref|XP_009365080.1|  PREDICTED: uncharacterized protein LOC103954953  52.8    3e-05   
emb|CDY65338.1|  BnaCnng46700D                                        53.5    4e-05   
ref|XP_002307829.2|  hypothetical protein POPTR_0005s28020g           53.1    4e-05   
gb|KCW77901.1|  hypothetical protein EUGRSUZ_D02159                   53.1    4e-05   
ref|XP_007030356.1|  Cysteine/Histidine-rich C1 domain family pro...  53.5    4e-05   
ref|XP_002878575.1|  hypothetical protein ARALYDRAFT_900610           53.5    4e-05   
ref|XP_007023008.1|  Cysteine/Histidine-rich C1 domain family pro...  53.5    4e-05   
ref|XP_006362281.1|  PREDICTED: uncharacterized protein LOC102594839  53.1    4e-05   
ref|XP_007023006.1|  Cysteine/Histidine-rich C1 domain family pro...  53.5    4e-05   
ref|XP_009796150.1|  PREDICTED: uncharacterized protein LOC104242767  53.1    4e-05   
ref|XP_007023007.1|  Cysteine/Histidine-rich C1 domain family pro...  53.5    4e-05   
ref|XP_006377073.1|  hypothetical protein POPTR_0012s13310g           53.1    4e-05   
emb|CDY39253.1|  BnaC06g27380D                                        53.5    5e-05   
gb|KEH30369.1|  cysteine/histidine-rich C1 domain protein             52.8    5e-05   
ref|XP_007041932.1|  Binding protein, putative                        51.6    5e-05   
ref|XP_009133207.1|  PREDICTED: uncharacterized protein LOC103857736  52.8    5e-05   
ref|XP_006428055.1|  hypothetical protein CICLE_v10027368mg           52.8    5e-05   
gb|KHN45431.1|  hypothetical protein glysoja_028438                   53.1    5e-05   
ref|XP_007029010.1|  Cysteine/Histidine-rich C1 domain family pro...  53.1    5e-05   
gb|EAZ04681.1|  hypothetical protein OsI_26835                        52.4    5e-05   
ref|XP_004147879.1|  PREDICTED: uncharacterized protein LOC101206551  53.1    6e-05   
ref|XP_006427896.1|  hypothetical protein CICLE_v10027175mg           53.1    6e-05   
ref|XP_003554214.1|  PREDICTED: uncharacterized protein LOC100810028  53.1    6e-05   
gb|KFK36673.1|  hypothetical protein AALP_AA4G154900                  52.0    6e-05   
ref|XP_008350958.1|  PREDICTED: transcription factor mef2A-like       52.8    6e-05   
ref|XP_010687681.1|  PREDICTED: diacylglycerol kinase theta-like      51.6    6e-05   
ref|XP_006493875.1|  PREDICTED: uncharacterized protein LOC102614813  52.8    6e-05   
ref|XP_004295357.1|  PREDICTED: uncharacterized protein LOC101301568  53.1    6e-05   
ref|XP_007153122.1|  hypothetical protein PHAVU_003G008600g           52.4    6e-05   
ref|XP_010430684.1|  PREDICTED: uncharacterized protein LOC104714914  52.8    7e-05   
ref|XP_006395426.1|  hypothetical protein EUTSA_v10005296mg           52.8    7e-05   
ref|XP_007043120.1|  Cysteine/Histidine-rich C1 domain family pro...  52.0    7e-05   
emb|CDX84608.1|  BnaA03g16220D                                        52.4    7e-05   
emb|CDY22034.1|  BnaA09g00630D                                        52.8    7e-05   
ref|XP_008359545.1|  PREDICTED: uncharacterized protein LOC103423255  52.4    7e-05   
ref|XP_009779824.1|  PREDICTED: uncharacterized protein LOC104228964  52.4    8e-05   
ref|XP_009798303.1|  PREDICTED: uncharacterized protein LOC104244556  52.0    8e-05   
ref|XP_007010036.1|  Cysteine/Histidine-rich C1 domain family pro...  52.8    8e-05   
gb|KDP27106.1|  hypothetical protein JCGZ_20330                       52.4    8e-05   
ref|XP_004959826.1|  PREDICTED: uncharacterized protein LOC101780629  52.4    8e-05   
gb|KDO48121.1|  hypothetical protein CISIN_1g042921mg                 52.4    8e-05   
ref|XP_007019855.1|  Cysteine/Histidine-rich C1 domain family pro...  52.4    8e-05   
gb|KHN25342.1|  hypothetical protein glysoja_010259                   51.6    9e-05   
ref|NP_001175296.1|  Os07g0611500                                     52.0    9e-05   
emb|CDP18736.1|  unnamed protein product                              52.4    9e-05   
ref|XP_011095209.1|  PREDICTED: uncharacterized protein LOC105174719  52.0    9e-05   
ref|XP_007029175.1|  Cysteine/Histidine-rich C1 domain family pro...  52.4    9e-05   
ref|XP_007028814.1|  Cysteine/Histidine-rich C1 domain family pro...  52.0    1e-04   
emb|CDY07768.1|  BnaA03g17430D                                        52.0    1e-04   
ref|NP_178367.1|  cysteine/histidine-rich C1 domain-containing pr...  52.4    1e-04   
ref|XP_007028813.1|  Cysteine/Histidine-rich C1 domain family pro...  52.0    1e-04   
ref|XP_003556619.1|  PREDICTED: uncharacterized protein LOC100797641  52.0    1e-04   
ref|XP_008451176.1|  PREDICTED: uncharacterized protein LOC103492553  51.6    1e-04   
emb|CAN76803.1|  hypothetical protein VITISV_000633                   52.0    1e-04   
ref|XP_010422952.1|  PREDICTED: uncharacterized protein LOC104708145  52.0    1e-04   
ref|XP_008466555.1|  PREDICTED: uncharacterized protein LOC103503...  52.4    1e-04   
ref|XP_009365079.1|  PREDICTED: uncharacterized protein LOC103954952  52.0    1e-04   
ref|XP_007030365.1|  Cysteine/Histidine-rich C1 domain family pro...  51.6    1e-04   
emb|CDY27940.1|  BnaCnng05250D                                        52.0    1e-04   
ref|XP_010051205.1|  PREDICTED: uncharacterized protein LOC104439899  52.0    1e-04   
ref|XP_003541098.2|  PREDICTED: uncharacterized protein LOC100790779  51.6    1e-04   
ref|XP_010505377.1|  PREDICTED: diacylglycerol kinase theta-like      51.6    1e-04   
ref|XP_009790389.1|  PREDICTED: diacylglycerol kinase theta-like      51.2    1e-04   
gb|KGN59975.1|  hypothetical protein Csa_3G859620                     52.0    1e-04   
ref|NP_189387.2|  cysteine/histidine-rich C1 domain-containing pr...  52.0    1e-04   
ref|NP_181967.1|  cysteine/histidine-rich C1 domain-containing pr...  50.8    1e-04   
ref|XP_006289397.1|  hypothetical protein CARUB_v10002896mg           52.0    1e-04   
emb|CDY64703.1|  BnaCnng44590D                                        52.0    1e-04   
ref|XP_008354970.1|  PREDICTED: mediator of RNA polymerase II tra...  51.6    1e-04   
ref|XP_010051207.1|  PREDICTED: uncharacterized protein LOC104439902  52.0    2e-04   
ref|XP_010418159.1|  PREDICTED: uncharacterized protein LOC104703784  52.0    2e-04   
gb|KCW55308.1|  hypothetical protein EUGRSUZ_I01234                   51.2    2e-04   
ref|XP_010999501.1|  PREDICTED: uncharacterized protein LOC105107312  50.8    2e-04   
gb|KHN45428.1|  hypothetical protein glysoja_028435                   51.6    2e-04   
emb|CDY37144.1|  BnaA02g24630D                                        51.6    2e-04   
ref|XP_010495358.1|  PREDICTED: uncharacterized protein LOC104772443  51.2    2e-04   
ref|XP_010472181.1|  PREDICTED: uncharacterized protein LOC104751...  51.6    2e-04   
ref|XP_010472179.1|  PREDICTED: uncharacterized protein LOC104751...  51.6    2e-04   
gb|EYU27140.1|  hypothetical protein MIMGU_mgv1a013216mg              50.8    2e-04   
ref|XP_007008862.1|  Cysteine/Histidine-rich C1 domain family pro...  51.2    2e-04   
ref|XP_009618628.1|  PREDICTED: uncharacterized protein LOC104110783  50.8    2e-04   
gb|KHN07435.1|  hypothetical protein glysoja_012733                   51.6    2e-04   
ref|XP_009129012.1|  PREDICTED: uncharacterized protein LOC103853858  51.6    2e-04   
ref|XP_003520538.2|  PREDICTED: uncharacterized protein LOC100784177  51.6    2e-04   
ref|XP_008458884.1|  PREDICTED: uncharacterized protein LOC103498155  51.2    2e-04   
gb|KFK30839.1|  hypothetical protein AALP_AA6G032300                  51.6    2e-04   
ref|XP_002872442.1|  hypothetical protein ARALYDRAFT_911199           48.9    2e-04   
ref|XP_002273882.2|  PREDICTED: uncharacterized protein LOC100252968  51.2    2e-04   
ref|XP_009602754.1|  PREDICTED: uncharacterized protein LOC104097843  51.2    2e-04   
ref|XP_007009462.1|  Cysteine/Histidine-rich C1 domain family pro...  51.6    2e-04   
ref|XP_002313820.1|  DC1 domain-containing family protein             50.8    2e-04   
ref|XP_010421023.1|  PREDICTED: uncharacterized protein LOC104706522  51.6    2e-04   
ref|XP_002283292.1|  PREDICTED: uncharacterized protein LOC100257225  50.8    2e-04   
ref|XP_011037594.1|  PREDICTED: uncharacterized protein LOC105134753  50.8    2e-04   
ref|NP_179775.2|  Cysteine/Histidine-rich C1 domain family protein    51.6    2e-04   
gb|AAD20403.1|  unknown protein                                       51.6    2e-04   
ref|XP_002316259.2|  DC1 domain-containing family protein             50.8    2e-04   
ref|XP_006365493.1|  PREDICTED: uncharacterized protein LOC102590985  50.8    2e-04   
ref|XP_007009469.1|  Cysteine/Histidine-rich C1 domain family pro...  51.2    2e-04   
ref|NP_200802.1|  cysteine/histidine-rich C1 domain-containing pr...  51.2    2e-04   
ref|XP_009124846.1|  PREDICTED: uncharacterized protein LOC103849...  50.1    2e-04   
ref|XP_010651470.1|  PREDICTED: uncharacterized protein LOC104879633  50.8    2e-04   
ref|XP_006293237.1|  hypothetical protein CARUB_v10019568mg           51.2    2e-04   
emb|CDP14976.1|  unnamed protein product                              51.2    2e-04   
ref|XP_003625271.1|  hypothetical protein MTR_7g093330                50.8    2e-04   
ref|XP_002519112.1|  protein binding protein, putative                50.4    3e-04   
ref|XP_010524602.1|  PREDICTED: uncharacterized protein LOC104802616  50.8    3e-04   
gb|KCW68282.1|  hypothetical protein EUGRSUZ_F01949                   50.4    3e-04   
ref|XP_006442706.1|  hypothetical protein CICLE_v10023780mg           51.2    3e-04   
ref|XP_004246862.2|  PREDICTED: uncharacterized protein LOC101250920  50.8    3e-04   
ref|XP_009773541.1|  PREDICTED: diacylglycerol kinase theta-like      50.4    3e-04   
emb|CBI40789.3|  unnamed protein product                              50.8    3e-04   
ref|XP_007026909.1|  Cysteine/Histidine-rich C1 domain family pro...  50.8    3e-04   
ref|XP_007008861.1|  Cysteine/Histidine-rich C1 domain family pro...  51.2    3e-04   
ref|XP_002880400.1|  protein binding protein                          51.2    3e-04   
ref|XP_006295729.1|  hypothetical protein CARUB_v10024848mg           50.4    3e-04   
ref|XP_009801635.1|  PREDICTED: uncharacterized protein LOC104247346  50.4    3e-04   
ref|XP_010429335.1|  PREDICTED: uncharacterized protein LOC104713818  50.8    3e-04   
emb|CAN78576.1|  hypothetical protein VITISV_020584                   50.4    3e-04   
ref|XP_004308203.1|  PREDICTED: uncharacterized protein LOC101306865  50.4    3e-04   
gb|KGN59968.1|  hypothetical protein Csa_3G857580                     50.8    3e-04   
ref|XP_010493316.1|  PREDICTED: uncharacterized protein LOC104770567  50.8    3e-04   
ref|XP_007010130.1|  Cysteine/Histidine-rich C1 domain family pro...  50.8    3e-04   
ref|XP_004230849.1|  PREDICTED: uncharacterized protein LOC101260772  50.4    3e-04   
ref|XP_006287222.1|  hypothetical protein CARUB_v10000398mg           50.8    3e-04   
ref|XP_006493589.1|  PREDICTED: uncharacterized protein LOC102620618  50.4    3e-04   
ref|XP_007200363.1|  hypothetical protein PRUPE_ppa010622mg           50.1    3e-04   
ref|XP_006410973.1|  hypothetical protein EUTSA_v10017531mg           50.1    3e-04   
ref|XP_010539152.1|  PREDICTED: uncharacterized protein LOC104813282  50.4    3e-04   



>ref|XP_009765161.1| PREDICTED: uncharacterized protein LOC104216739 [Nicotiana sylvestris]
Length=315

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 97/172 (56%), Gaps = 13/172 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPH L ++++E  +  NC IC L + G A+GC+ C F++H   C DL  +I H SHP
Sbjct  127  HFSHPHALNKYDVERDNEINCKICGLQLVGSAYGCQRCQFYLH-VSCFDLPQKIQHDSHP  185

Query  184  AHPLHLRPPSFDPN--HICDACLSPANTP-LYRCGICDYDLHVDCAVLTTSDTAVDG--T  348
            AHPL LR PS+  N    CDAC        LY C  C++DLHV CA L       D    
Sbjct  186  AHPLTLRYPSYYKNCGKTCDACCEDIRRSFLYCCDPCNFDLHVTCATLYGIARRADSPKD  245

Query  349  LMRLYYSFPVGAS------VWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
             +RLYYSFP+  +        C  CN ++S+  GW++Y +DTG+ AH  C K
Sbjct  246  TLRLYYSFPINDNNHMHWIARCNVCNKKVSKE-GWLYYSRDTGYIAHIKCAK  296



>ref|XP_009622757.1| PREDICTED: uncharacterized protein LOC104114073 [Nicotiana tomentosiformis]
Length=315

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 97/172 (56%), Gaps = 13/172 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPH L ++++E  +  NC +C L I G A+GC+ C F++H   C DL  +I H SHP
Sbjct  127  HFSHPHSLNKYDVERDNEINCKVCGLQILGSAYGCQRCQFYLH-VSCFDLPQKIQHDSHP  185

Query  184  AHPLHLRPPSFDPN--HICDACLSPANTP-LYRCGICDYDLHVDCAVLTTSDTAVDG--T  348
            AHPL LR  S+  N    CDAC        LY C  C++DLHV CA L +     D    
Sbjct  186  AHPLTLRNLSYYKNCGKSCDACCEDIRRSFLYCCDPCNFDLHVTCATLYSIARRNDSPKD  245

Query  349  LMRLYYSFPVGAS------VWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
             +RLYYSFPV  +        C  CN ++S+  GW++Y KDTG+ AH  C K
Sbjct  246  TLRLYYSFPVSDNNQMHWIARCNVCNKKVSKE-GWLYYSKDTGYIAHIKCAK  296



>ref|XP_010324710.1| PREDICTED: uncharacterized protein LOC104648643 [Solanum lycopersicum]
Length=533

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 96/173 (55%), Gaps = 14/173 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH HPL +F+L+  +   C++C++ ISG+A+GC+ C +F+H + C ++  +I H  HP
Sbjct  128  HFSHRHPLLRFHLKGTEVIRCNMCAITISGVAYGCDCCRYFLH-EVCSNIPKRIRHDFHP  186

Query  184  AHPLHLRP-PSF-------DPNHICDACL--SPANTPLYRCGICDYDLHVDCAVLTTSDT  333
             H L L P PS        +    C AC   S   +  Y C +C +DLH++CA + T   
Sbjct  187  MHSLTLLPIPSIALWHSKVETEFCCVACGYDSSLFSFYYHCDLCKFDLHLECASVMTRLI  246

Query  334  AVDGTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  + L+ SFP+   GA+V C  CN  ++R+  W++Y+++  +  HF C 
Sbjct  247  RKVKYPLDLFTSFPLKSEGAAVLCSICNQVMNRQSAWLFYNREFDYICHFECA  299


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 75/167 (45%), Gaps = 11/167 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGT-NCSICS-LPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH HPL       +    +C ICS   +SG  + C+ C++FI D+ C  L  +I H  
Sbjct  341  HFSHRHPLKAIKQTNETPIRSCCICSNQDLSG--YICQLCNYFI-DESCFPLPRRIQHHF  397

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDC--AVLTTSDTAVDGTL  351
            HP HPL L   +  P   C AC    N   Y C  C + LH  C  A +T +        
Sbjct  398  HPNHPLILATYNDQPKSKCRAC-GHENGATYCCFTCKFSLHRSCAGAPMTFTLGTNKKVS  456

Query  352  MRLYYSFPVG---ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             +L YS+P     A + C  C+ E + +  +++Y+ D     H  C 
Sbjct  457  YKLLYSYPYDGEMAVIKCNICSNEFNSKESFMYYNFDLDEVLHVQCA  503



>ref|XP_009606623.1| PREDICTED: uncharacterized protein LOC104100954 [Nicotiana tomentosiformis]
Length=478

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 86/174 (49%), Gaps = 11/174 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L  ++L   D  +C  C   ISG+A+GC+ C +F+H + C +    I H +H
Sbjct  82   KHFSHRHNLLMYSLRASDCVHCYFCETIISGMAYGCKRCRYFLH-ESCSEFPQLIEHLAH  140

Query  181  PAHPLHLR-PPSFDPNHICDACLSPANTPL-----YRCGICDYDLHVDCAVLTTSDTAVD  342
            P H L L+  P+FD  +IC AC    N  L     Y C +CD+ +H+ CA +        
Sbjct  141  PGHQLTLKYTPTFDSGYICKACHVGDNPALLFNFHYSCNLCDFAIHMGCASMPCK-VFHK  199

Query  343  GTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVI  495
             T + L+YS P+      + C  CN  I++   WV+YD    F  HF C    I
Sbjct  200  ETGLSLFYSNPLKNEAGPLLCDICNHSINKTNSWVYYDHSHNFITHFGCAADSI  253


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 73/170 (43%), Gaps = 15/170 (9%)
 Frame = +1

Query  46   IQDGTNCSICSLPISG-LAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLRPPSFDP  222
            I     C IC L +S     GC  CD+ IH+  C  L  +I H  HP H L L P     
Sbjct  312  IVKNHKCGICGLDLSTDKKKGCSTCDYIIHER-CSQLPEKIQHPFHP-HTLTLVPKKDGV  369

Query  223  NHICDACLSPAN-----TPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPVGAS  387
               C+ C   +      T LY+C ICD+ LH  CA        +D TL    YSFP    
Sbjct  370  EVQCNGCRQSSGCHTNYTVLYQCKICDFQLHPSCAACPRRLKKLDLTLC---YSFPYKNE  426

Query  388  V---WCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFLRPL  528
            V   +C  C+  I+ +  W++Y ++     H  C   V + +    LR L
Sbjct  427  VSKLFCSYCSKVIN-KDQWLYYGRNKDEKRHITCQLAVGVSNCYVTLRDL  475



>ref|XP_006351054.1| PREDICTED: uncharacterized protein LOC102581981 [Solanum tuberosum]
Length=536

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 97/173 (56%), Gaps = 14/173 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH HPL +F+L+  +   C++C++ IS +A+GC+ C +F+H + C ++  +I H  HP
Sbjct  132  HFSHRHPLLRFHLKGTEVIRCNMCTIIISRVAYGCDCCRYFLH-EVCSNIPKRIRHDFHP  190

Query  184  AHPLHLRP-PSF-------DPNHICDACL--SPANTPLYRCGICDYDLHVDCAVLTTSDT  333
             H L L P PS        +    C AC   +   +  Y C +C +DLH++CA +TT   
Sbjct  191  MHSLTLLPIPSIALWHSKVESEFCCVACGYDNSLFSFYYHCDLCKFDLHLECASVTTKLI  250

Query  334  AVDGTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  + L+ SFP+   GA++ C  CN  ++R+ GW++Y+++  +  HF C 
Sbjct  251  HKVKYPLDLFTSFPLKSEGAALLCCICNQVMNRQSGWLFYNREFDYICHFECA  303


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 76/167 (46%), Gaps = 11/167 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDG-TNCSICS-LPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH HPL       +    NC ICS   +SG  + C+ C++FI D+ C  L  +I H  
Sbjct  345  HFSHRHPLTAIKQTNKASIMNCCICSNQALSG--YICQLCNYFI-DETCFPLPRRIQHHF  401

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDC--AVLTTSDTAVDGTL  351
            HP HPL L   +  P   C AC        YRC  C + LH  C  A +T +        
Sbjct  402  HPNHPLILASYNDPPKSKCRACGHEEGAK-YRCSTCKFSLHRCCAGAPMTFTLGTNKKVS  460

Query  352  MRLYYSFPVG---ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             +L YS+P     A + C  C+ E++ +  +++Y+ D     H  C 
Sbjct  461  YKLLYSYPCDGEMAVIKCSGCSSELNSKESFMYYNFDLDEVLHVQCA  507



>ref|XP_009803102.1| PREDICTED: uncharacterized protein LOC104248530 [Nicotiana sylvestris]
Length=479

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 85/174 (49%), Gaps = 11/174 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L  ++L   D  +C  C   ISG+A+GC+ C +F+H + C +    I H +H
Sbjct  83   KHFSHRHNLLMYSLRASDFVHCYFCETIISGMAYGCKRCRYFLH-ESCSEFPQLIEHLAH  141

Query  181  PAHPLHLR-PPSFDPNHICDACLSPANTPL-----YRCGICDYDLHVDCAVLTTSDTAVD  342
            P H L L+  P+ D  +IC AC    N  L     Y C +CD+ +H+ CA +        
Sbjct  142  PGHQLTLKYTPTVDSGYICKACHVGDNPALLFNFHYSCNLCDFAIHMGCASMPCK-VFHK  200

Query  343  GTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVI  495
             T + L+YS P+      + C  CN  I++   WV+YD    F  HF C    I
Sbjct  201  ETGLSLFYSNPLKNEAGPLLCDICNHSINKTNSWVYYDHSHNFITHFGCAADSI  254


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 70/170 (41%), Gaps = 15/170 (9%)
 Frame = +1

Query  46   IQDGTNCSICSLPISG-LAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLRPPSFDP  222
            I     C IC L +S     GC  CD+ IH+  C  L  +I H  HP H L L P     
Sbjct  313  IVKNRKCGICGLDLSTDKKKGCSTCDYIIHER-CSQLPEKIQHPFHP-HTLILVPKKDGV  370

Query  223  NHICDACLSPAN-----TPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPVGAS  387
               C+ C          T LY+C ICD+ LH  CA        +D TL    Y FP    
Sbjct  371  EVQCNGCRQSNGCHTNYTVLYQCKICDFQLHPSCAACPRRLKKLDLTLC---YEFPYKNE  427

Query  388  V---WCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFLRPL  528
            V   +C  C+  I+ +  W++Y +      H  C   V + +    LR L
Sbjct  428  VSKLFCSYCSKVIN-KDQWLYYGRSKDERRHITCQLAVGVSNCYVTLRDL  476



>ref|XP_008461757.1| PREDICTED: probable nucleoredoxin 1-1 [Cucumis melo]
Length=178

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 80/166 (48%), Gaps = 10/166 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCE--ACDFFIHDDDCLDLKLQIHHT  174
             H SHPHPL    +   DGT CS C  P+SG A+ C    C+F +H   C  L  +IHH 
Sbjct  4    QHFSHPHPLAAAKVVEDDGTICSGCEFPLSGAAYKCTKPKCEFHLH-QLCFALPPEIHHP  62

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   PP  D    CD C    +  +YRC  C +DLH+ CA L  T      D
Sbjct  63   SHPKHPLILTGSPPYVDGEFACDGCDDVGSGFIYRCPRCQFDLHIHCAALPETLVGKNHD  122

Query  343  GTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              L  ++ S   G    C  C  E   RGGWV+Y     F  H +C
Sbjct  123  HPLRLVFES--KGKGFCCGVCE-EGFGRGGWVYYCGVCDFGVHVHC  165



>ref|XP_006365047.1| PREDICTED: uncharacterized protein LOC102593110 [Solanum tuberosum]
Length=461

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 84/167 (50%), Gaps = 11/167 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L  ++L   D  +C+ C   ISG+++GC+ C +F+H + C +    I H +HP
Sbjct  67   HFSHRHNLLTYSLRASDSVHCNFCETTISGMSYGCKRCRYFLH-ESCFEFPQVIEHLAHP  125

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPL-----YRCGICDYDLHVDCAVLTTSDTAVDGT  348
             H L L+  S D  + C AC    N  L     Y C  CD+ LH+ CA ++      + T
Sbjct  126  GHQLILKYSSNDQFN-CKACHVGDNPALLFNFHYSCDHCDFSLHMGCASMSYKVLHKEMT  184

Query  349  LMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
            L  ++YS P+      + C  CN  I +  GWV+YD    F  HF C
Sbjct  185  L-SVFYSNPLRNEAGPLLCDICNHSIEKSSGWVYYDYGHNFVTHFGC  230


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 77/183 (42%), Gaps = 16/183 (9%)
 Frame = +1

Query  13   HPHPLYQFNLEIQDGTN---CSICSLPISG-LAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H H L Q +  + +      C IC + +S     GC +CDF IH+  C  L  +I H  H
Sbjct  281  HRHVLQQLDRSMDNSVKNRKCGICGMDVSSDKKKGCSSCDFIIHER-CSFLPEKIQHPFH  339

Query  181  PAHPLHLRPPSFDPNHICDACLSPAN-----TPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
            P HPL L P        C  C   +      T LY+C IC+Y LH  CA        +D 
Sbjct  340  P-HPLTLVPKKDGVEVQCVGCRQSSGCHTNYTVLYQCKICEYQLHPSCAACPRRLKKLDL  398

Query  346  TLMRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFL  519
            TL    YSFP    V    CN   ++  +  W++Y +      H  C   V + +    L
Sbjct  399  TLC---YSFPYKNEVSKLYCNYCSKVINKDEWLYYGRSNDEKRHITCQLAVGISNCYVTL  455

Query  520  RPL  528
            R L
Sbjct  456  RDL  458



>ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus]
 ref|XP_004169106.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus]
 gb|KGN58631.1| hypothetical protein Csa_3G705670 [Cucumis sativus]
Length=179

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 78/165 (47%), Gaps = 8/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCE--ACDFFIHDDDCLDLKLQIHHT  174
             H SHPHPL    L   DGT CS C  P+SG A  C    C+F +H D C  L  +IHH 
Sbjct  4    QHFSHPHPLAAATLVEDDGTLCSACEFPLSGAAFKCSKPKCEFHLH-DLCFALPPEIHHP  62

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-G  345
            SHP HPL L   PP       CD C    +  +YRC  C +DLH+ CA L  +    +  
Sbjct  63   SHPKHPLILAGSPPYVGGEFACDGCGDVGSGFIYRCPRCQFDLHIHCAALPETVVGKNHD  122

Query  346  TLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              +RL +    G    C  C  E    GGWV+Y     F  H +C
Sbjct  123  HPLRLGFE-SKGKGFCCGVCE-EGFGNGGWVYYCGVCDFGVHVHC  165



>ref|XP_009603826.1| PREDICTED: uncharacterized protein LOC104098722 [Nicotiana tomentosiformis]
Length=558

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 96/192 (50%), Gaps = 32/192 (17%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            +H SH HPL +F+L   +   C++C+  ISG+A+GC+ C +F+H + C  +  +I H  H
Sbjct  135  DHFSHRHPLLRFHLRGTENIRCNMCTFIISGVAYGCDHCRYFLH-EVCSSIPKRIRHDFH  193

Query  181  PAHPLHLRP-PS--------------------FDPNHICDACLSPANTP-------LYRC  276
            P H L L P PS                    F     C AC    + P        Y C
Sbjct  194  PMHSLTLCPIPSISLCYSKVESELLAVAEKRDFGTEFRCVACGYDNSYPQKSLFAFYYHC  253

Query  277  GICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYD  447
             +C++DLH++CA + T+        + L+  FP+   GA+++C  CN  ++R   W++Y+
Sbjct  254  DVCNFDLHLECASVPTTLIHKVKYPLDLFTIFPLESEGAALFCDICNQVMNREFSWLFYN  313

Query  448  KDTGFTAHFNCG  483
            ++  +  HF CG
Sbjct  314  REFDYICHFECG  325


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 73/166 (44%), Gaps = 9/166 (5%)
 Frame = +1

Query  4    HASHPHPLYQF-NLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SH HPL     +      +C ICS   S   + C+ C++FI D+ C  L  +I H  H
Sbjct  367  HFSHRHPLKAIKQMNEASIMSCCICSNKSSS-GYICQQCNYFI-DESCFQLPPKIRHQYH  424

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDC--AVLTTSDTAVDGTLM  354
            P H L L   +  PN  C AC S      Y C  C + LH  C  A +T +         
Sbjct  425  PNHTLILVSYTDHPNIHCTAC-SQEVGAAYHCSACKFCLHRTCAGAPMTLTLGTNKKVSY  483

Query  355  RLYYSFPVG---ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            +L YS+P     A + C  C+ +++ +  +++Y+ D        C 
Sbjct  484  KLLYSYPFEGEMAVINCSACSNKLNSKQSFLYYNFDLDEVLDVQCA  529



>ref|XP_006362282.1| PREDICTED: uncharacterized protein LOC102595178 [Solanum tuberosum]
Length=807

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 90/175 (51%), Gaps = 15/175 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA-CDFFIHDDDCLDLKLQIHHTS  177
            NH SH HPL + +L   +G NC+ C++ ISG A+ CE  C +++H + C +   +IHH  
Sbjct  24   NHFSHRHPLLRLHLRESEGINCTFCNISISGWAYACEKHCGYYLH-EVCSNFPREIHHDF  82

Query  178  HPA--HPLHLRPPSF---DPNHICDAC-----LSPANTPLYRCGICDYDLHVDCAVLTTS  327
            HP   H L+LRP      D    C  C     +       Y C  C+++LHV+CA +   
Sbjct  83   HPGYDHTLNLRPFQLANNDEKFHCAVCGDDDSVHSLFQSYYGCESCNFNLHVECASVPID  142

Query  328  DTAVDGTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             +     L+ L+ SFP+    A++ C  C  ++   G W++Y+ +  +  HFNC 
Sbjct  143  LSRNVKYLLHLFVSFPITSEAATIICSICAKDVPSTGCWLFYNHEHDYLCHFNCA  197


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (49%), Gaps = 16/175 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA-CDFFIHDDDCLDLKLQIHHTS  177
            NH +H HPL+Q +   ++   CS C++ ISG  + C   CD+++H + C +   +I H  
Sbjct  407  NHFNHRHPLFQSHFRQRERIQCSFCNIVISGRGYACNKHCDYYLH-EVCSNFPREIQHDF  465

Query  178  HPA--HPLHLRP--PSFDPNHICDAC-----LSPANTPLYRCGICDYDLHVDCAVL-TTS  327
            HP   H L LRP   +      C AC     +       Y C  C+++LHV+CA +  T 
Sbjct  466  HPGSDHNLILRPFKATNREQFHCAACGHDDSVHSLFQSYYGCESCNFNLHVECASIPITL  525

Query  328  DTAVDGTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            D  V   L  L+ SFP+    A++ C  C   +   G W++Y+    +  H NC 
Sbjct  526  DQKVKYPL-HLFLSFPITSETATLSCSICTEVVPTSGCWLFYNHKHDYLCHVNCA  579


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 79/188 (42%), Gaps = 12/188 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L ++N +      C++C        + C  C++FI D  C  +   I H SHP
Sbjct  621  HFSHRHTLKEYNSD--KSLACNLCRSKYFK-GYFCSDCNYFI-DRTCFSVPSMIQHMSHP  676

Query  184  AHPLHLR--PPSFDPNHICDACL---SPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
             HPL L       + N  C  C      ++   Y C  C + L   CA    + T     
Sbjct  677  QHPLRLTCYLDYQNENVNCRCCQVNKESSHNRAYYCAPCKFILSCQCAGAPKTLTLASNV  736

Query  349  LMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFL  519
              +L++ FP     A V CK C+ ++  + G ++Y+ +   T H +C      K +   L
Sbjct  737  SYKLFFEFPFKHENAEVKCKICSEKVVIKDGLLYYNLERDETLHVSCALTNESKKKMTSL  796

Query  520  RPLMRYLR  543
             P +  +R
Sbjct  797  IPRLNEVR  804


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 54/139 (39%), Gaps = 9/139 (6%)
 Frame = +1

Query  91   GLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLR-PPSFDPNHI----CDACLSPA  255
             + + C  C++FI +  C  +   I H SHP HPL L     +   ++    C       
Sbjct  208  SMGYFCSDCNYFI-EKICFSVPFMIRHMSHPQHPLKLTCYLDYQNENVNCLGCQGGFQNG  266

Query  256  NTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPV---GASVWCKKCNGEISRR  426
             +  Y C  C   ++  CA    + T  D     L++ FP     A + C  C+ ++  +
Sbjct  267  RSRAYYCAPCKLIINHQCAGAPKTLTLADNVSYELFFEFPFKQENAEIKCNICSKKVVTK  326

Query  427  GGWVWYDKDTGFTAHFNCG  483
             G ++Y        H  C 
Sbjct  327  DGMLYYSLKRDEALHVVCA  345



>ref|XP_009124845.1| PREDICTED: uncharacterized protein LOC103849885 isoform X1 [Brassica 
rapa]
Length=232

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 80/163 (49%), Gaps = 8/163 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC-EACDFFIHDDDCLDLKLQIHHTS  177
             H SH HPL  F  + +D   CS C L ++G A  C + CD+F+H   C DL  +I+H S
Sbjct  13   RHPSHNHPLRVFKAQNEDEIICSGCELDLTGQAFKCTKDCDYFLHKS-CFDLPCEINHKS  71

Query  178  HPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGT  348
            HP HP+ L   PP    ++ CDAC    +   Y C +C YD+HV CA +  T D      
Sbjct  72   HPDHPITLFYSPPYDHQSYECDACGEYGSGFTYNCSVCKYDVHVGCAFIPETVDREDHKH  131

Query  349  LMRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L Y  P   G    C  C  E+S    W +Y K+  +  H
Sbjct  132  PLTLLYKIPCEDGKIYVCDVCEEEVS-ENLWTYYCKECDYGTH  173



>ref|XP_010317353.1| PREDICTED: uncharacterized protein LOC104646058, partial [Solanum 
lycopersicum]
Length=524

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (50%), Gaps = 11/175 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L  ++L   D  +C+ C   ISG+++GC+ C +F+H + C +    I H +H
Sbjct  123  KHFSHRHNLLTYSLRASDSVHCNFCETIISGMSYGCKRCRYFLH-ESCFEFPQVIEHLAH  181

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPL-----YRCGICDYDLHVDCAVLTTSDTAVDG  345
            P H L L+  + D    C+AC    N  L     Y C  CD+ LH+ CA +       + 
Sbjct  182  PEHQLTLKYGN-DDQFNCNACHVGDNPALLFNFHYSCDHCDFSLHMGCASMPYKALHKEM  240

Query  346  TLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILK  501
             L  ++YS P+      + C  C+  I ++ GW++Y+    F +HF C   ++ +
Sbjct  241  AL-SVFYSNPLRNEAGPLLCDICDHSIEKQSGWIYYNYGHNFLSHFGCVADIVYE  294


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 73/165 (44%), Gaps = 15/165 (9%)
 Frame = +1

Query  61   NCSICSLPISG-LAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLRPPSFDPNHICD  237
             C IC + IS     GC +CDF IH+  C  L  +I H  HP HPL L P        C 
Sbjct  363  KCGICGMDISSDKKKGCSSCDFIIHER-CSFLPEKIQHPFHP-HPLSLVPKKDGVEVHCV  420

Query  238  ACLSPAN-----TPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPVGASV---W  393
             C   +      T LYRC IC++ LH  CA        +D TL    YSFP    V   +
Sbjct  421  GCRQSSGCHTNYTVLYRCKICEFQLHPSCAASPRRLKKLDLTLC---YSFPYKNEVSKLY  477

Query  394  CKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFLRPL  528
            C  C+  IS +  W++Y + +    H  C   V + +    LR L
Sbjct  478  CNYCSKVIS-KDEWLYYGRSSDEKRHITCQLAVGISNCYVTLRDL  521



>ref|XP_006369466.1| DC1 domain-containing family protein [Populus trichocarpa]
 gb|ERP66035.1| DC1 domain-containing family protein [Populus trichocarpa]
Length=190

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 83/172 (48%), Gaps = 11/172 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL   +++ ++ + CS C L +SG A+ C    CDFF+H   C +L  ++ HT
Sbjct  18   KHFSHSHPLRPVDVKEEEESICSGCELDLSGSAYKCTKSTCDFFLHKS-CFELPRELEHT  76

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP H L L   PP  D    C+AC     +  Y C  C ++LHV CA L  +   VD  
Sbjct  77   SHPQHLLVLLSSPPGDDSKFTCNACGDYGTSFAYHCATCQFNLHVGCAFLPKTMKHVDHN  136

Query  349  -LMRLYYSF----PVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKP  489
              + L YS       G    C  C  E+S+   WV+Y  D  +    +C  P
Sbjct  137  HPLTLSYSTNFLDKEGLVFTCDVCRKEVSQT-SWVYYCLDCDYGTDLHCTTP  187



>ref|XP_006492914.1| PREDICTED: uncharacterized protein LOC102618400 [Citrus sinensis]
Length=246

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 86/172 (50%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L  + ++  +  +CS C L ISG A+GC  C FF+H + C +    + HTSH
Sbjct  4    KHFSHPHNLRIYQVQHGNEYSCSACELIISGSAYGCWECKFFLH-EQCGNASCAMQHTSH  62

Query  181  PAHPLHLRPPSF--DPNHICDACLSPANTPLYRCGICDYDLHVDCAVL---TTSDTAVDG  345
            P H L L P +     N +C+AC  P +   + C +CD+DLHV CA L      D+    
Sbjct  63   PMHHLTLVPTTTYSAGNFLCNACGEPGSAFSFCCPLCDFDLHVQCAFLPEILIHDSHFHS  122

Query  346  TLMRLYYSFPVG-----ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
              + L Y+ P       +S  C  C+ +I ++  W +      F AH +C +
Sbjct  123  --LSLSYALPAAHHYESSSYVCDICHKQIDQKCFWSYNCFACNFHAHVSCTR  172



>emb|CDX95602.1| BnaC03g24830D [Brassica napus]
Length=242

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 78/165 (47%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL+ F  + +D   CS C L ++G A  C    CD+F+H   C DL  +I+H 
Sbjct  13   KHPSHKHPLHIFKAQEEDEIMCSGCELGLTGQAFKCTKSDCDYFLHKS-CFDLPREINHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGT  348
            SHP HPL L   P +   + CDAC    ++  Y C  C YD+HV CA L  T D      
Sbjct  72   SHPDHPLTLLHSPPYGHAYGCDACGQYGSSFTYHCSKCQYDVHVGCAFLPETLDRDDHEH  131

Query  349  LMRLYYSFPV----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L YS P     G    C  C   +     WV++ K   +  H
Sbjct  132  KLTLVYSSPCKGRDGVVFMCDVCKETVLSENLWVYHCKVCDYGTH  176



>ref|XP_011087021.1| PREDICTED: uncharacterized protein LOC105168581 [Sesamum indicum]
Length=191

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 78/168 (46%), Gaps = 9/168 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
            NH SH HPL    L  +D   CS C L I G A+ C    C F +HD  C DL  +I H 
Sbjct  21   NHFSHRHPLELSQLHQEDKAICSGCELDILGSAYVCTKPNCTFLLHDF-CFDLPRRIRHY  79

Query  175  SHPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP  D    CDAC    +   Y CG C +DLHV+CA L   +   D  
Sbjct  80   SHPKHPLGLSFSPPYNDGEFTCDACGHSGHAFTYHCGTCKFDLHVECAALPEVENRRDHE  139

Query  349  L-MRLYYSFPVG--ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              + L    P G  A   C  C+G I  +G W++        AH  C 
Sbjct  140  HPLVLSCGSPEGSAAEFVCYVCSGCIG-KGCWMYCCLACNCGAHLECA  186



>gb|KDO70910.1| hypothetical protein CISIN_1g040047mg [Citrus sinensis]
Length=240

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L  + ++  +  +CS C L ISG A+GC  C FF+H + C +    + HTSH
Sbjct  4    KHFSHPHNLRIYQVQHGNEYSCSACELIISGSAYGCWECKFFLH-EQCGNASRAMQHTSH  62

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVL---TTSDTAVDG  345
            P H L L P +     N +C+AC  P +   + C +CD+DLHV CA L      D+    
Sbjct  63   PMHHLTLVPTTTYSAGNFLCNACGEPGSAFSFCCPLCDFDLHVQCAFLPEILIHDSHFHS  122

Query  346  TLMRLYYSFPVG-----ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
              + L Y+ P       +S  C  C+ ++ ++  W +      F AH +C +
Sbjct  123  --LNLSYALPAAHHYESSSYVCDICHKQLDQKCFWSYNCFACNFHAHVSCTR  172



>ref|XP_006429888.1| hypothetical protein CICLE_v10013549mg [Citrus clementina]
 gb|ESR43128.1| hypothetical protein CICLE_v10013549mg [Citrus clementina]
Length=246

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L  + ++  +  +CS C L ISG A+GC  C FF+H + C +    + HTSH
Sbjct  4    KHFSHPHNLRIYQVQHGNEYSCSACELIISGSAYGCWECKFFLH-EQCGNASRAMQHTSH  62

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVL---TTSDTAVDG  345
            P H L L P +     N +C+AC  P +   + C +CD+DLHV CA L      D+    
Sbjct  63   PMHHLTLVPTTTYSAGNFLCNACGEPGSAFSFCCPLCDFDLHVQCAFLPEILIHDSHFHS  122

Query  346  TLMRLYYSFPVG-----ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
              + L Y+ P       +S  C  C+ ++ ++  W +      F AH +C +
Sbjct  123  --LNLSYALPAAHHYESSSYVCDICHKQLDQKCFWSYNCFACNFHAHVSCTR  172



>ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC16105.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana]
 dbj|BAD44495.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=247

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 79/166 (48%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             HASH HPL  F    +D   CS C L ++G A  C    CD+F+H   C DL  + +H 
Sbjct  13   RHASHNHPLRVFKARDEDEVVCSGCELELTGQAFKCMKSDCDYFLHKS-CFDLPRETNHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            SHP H L L   P +  ++ CDAC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHPNHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPETVEREDHEH  131

Query  352  -MRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L Y+ P      GA   C  C  ++S    WV+Y K+  +  H
Sbjct  132  PLTLLYNTPCKGREDGAKFICDVCEEKMS-ENLWVYYCKECDYGTH  176



>ref|XP_011002292.1| PREDICTED: uncharacterized protein LOC105109324 [Populus euphratica]
Length=198

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 83/178 (47%), Gaps = 11/178 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL   +++  +   CS C L +SG A+ C    CDFF+H   C +L  ++ HT
Sbjct  18   KHFSHSHPLRPVDVKEDEEIICSGCELDLSGSAYKCTKSMCDFFLHRS-CFELPRELEHT  76

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-G  345
            SHP H L L   PP  D    C+AC     +  Y C  C ++LHV CA L  +   VD  
Sbjct  77   SHPQHLLVLLSSPPGDDSYFTCNACGDYGTSFAYHCTTCQFNLHVGCAFLPKTMKHVDHD  136

Query  346  TLMRLYYSFPV----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQ  507
              + L YS       G    C  C  E+S +  WV+Y  D  +    +C  P   + +
Sbjct  137  HPLTLLYSTNFLDREGLVFTCDACRKEVS-QTSWVYYCLDCDYGTDLHCTTPAECRRE  193



>ref|XP_006295388.1| hypothetical protein CARUB_v10024483mg [Capsella rubella]
 gb|EOA28286.1| hypothetical protein CARUB_v10024483mg [Capsella rubella]
Length=246

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 78/166 (47%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F    +D   CS C L ++G A  C    CDFF+H   C DL  + +H 
Sbjct  13   RHPSHNHPLNIFKARGKDEVVCSGCELELTGQAFKCMKSDCDFFLHKS-CFDLPRETNHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SHP H L L   P +  ++ CDAC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHPDHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPETVEREDHEH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L Y+ P      GA   C  C  ++S    WV+Y KD  +  H
Sbjct  132  PLTLLYNTPCKGREDGAMFICDVCEEDMS-ENLWVYYCKDCDYGTH  176



>ref|XP_006362284.1| PREDICTED: uncharacterized protein LOC102595829 [Solanum tuberosum]
Length=386

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 87/174 (50%), Gaps = 14/174 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA-CDFFIHDDDCLDLKLQIHHTS  177
            NH SH HP  + +L   +G  C+ C++ ISG A+ CE  CD ++H + C +   +IHH  
Sbjct  45   NHFSHRHPFLRLHLRESEGIKCTFCNISISGWAYACEKHCDCYLH-EVCSNFPREIHHDF  103

Query  178  HPAH-PLHLRPPSFDPNHI---CDAC-----LSPANTPLYRCGICDYDLHVDCAVLTTSD  330
            HP +  L LRP     N+    C AC     +       Y C  C+++LHV+CA +    
Sbjct  104  HPGYDTLILRPFQLANNNEQFHCAACGHDDSVHSLFQSYYGCESCNFNLHVECASIPIDL  163

Query  331  TAVDGTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            +     L+  + SFP+    A+++C  C   +   G W++Y+ +  +  H NC 
Sbjct  164  SRNVKYLLHRFVSFPITSETATLFCSICTDVVPTSGCWLFYNHEHDYLCHINCA  217



>ref|XP_006391683.1| hypothetical protein EUTSA_v10023934mg, partial [Eutrema salsugineum]
 gb|ESQ28969.1| hypothetical protein EUTSA_v10023934mg, partial [Eutrema salsugineum]
Length=183

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 81/168 (48%), Gaps = 11/168 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL+ F  + +D   CS C L ++G A  C  + CD+F+H   C DL  +I H 
Sbjct  13   KHPSHNHPLWVFKSQEEDEIICSGCELDLTGQAFKCMKKDCDYFLH-KSCFDLPGEITHK  71

Query  175  SHPAHPLH-LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SHP HPL  L  P +  ++ C+AC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHPDHPLTLLYSPPYGQSYGCNACGELGSGFTYNCSECQYDVHVGCAFIPETAEPEDHEH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
             + L Y+ P      G    C  C  ++S    WV+Y K+  +  H  
Sbjct  132  PLTLLYNTPCKGREDGVMFICDVCEEDMSED-LWVYYCKECDYGTHVQ  178



>ref|XP_009133672.1| PREDICTED: uncharacterized protein LOC103858132 [Brassica rapa]
Length=242

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 79/166 (48%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL+ F  + +D   CS C L ++G A  C    CD+F+H   C DL  +++H 
Sbjct  13   KHPSHKHPLHIFKAQEEDEIICSGCELELTGEAFKCTKSDCDYFLHKS-CFDLPRELNHK  71

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP     + CDAC    ++ +Y C  C YD+HV CA L       D  
Sbjct  72   SHPNHPLTLLHSPPYESNAYGCDACGQYGSSFIYHCSKCQYDVHVGCAFLPEILEREDHE  131

Query  349  -LMRLYYSFP----VGASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L ++ P     G    C  C   +S    WV++ K   +  H
Sbjct  132  HKLTLVFNSPCKGREGMVFMCDVCKETVS-ENLWVYHCKVCDYGTH  176



>ref|XP_010506364.1| PREDICTED: uncharacterized protein LOC104782986 [Camelina sativa]
Length=246

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 78/166 (47%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F    +D   CS C L ++G A  C    CDFF+H   C DL  + +H 
Sbjct  13   RHPSHNHPLRIFKARSKDEVVCSGCELELTGQAFKCMKSDCDFFLHKS-CFDLPRETNHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SHP H L L   P +  ++ CDAC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHPDHSLTLLHSPPYGQSYKCDACGEYGSGFTYNCSECQYDVHVGCAFIPETVEREDHEH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L Y+ P      GA   C  C  ++S    WV+Y ++  +  H
Sbjct  132  PLTLLYNTPCKGREDGAMFICDVCEEDMS-ENLWVYYCQECDYGKH  176



>ref|XP_011088907.1| PREDICTED: uncharacterized protein LOC105170022 [Sesamum indicum]
Length=486

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 74/169 (44%), Gaps = 11/169 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SHPH L    +E ++   CS C   +SG A+ C    C F +H   C D   ++ H 
Sbjct  272  KHFSHPHVLKAMEIEKKNAKVCSACECELSGSAYCCTEPYCTFNLHKS-CFDSPREVRHK  330

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SH  HPL L   P +     C+ACL       Y C  C YDLH+DC     + T  D   
Sbjct  331  SHLQHPLTLLTAPPYKDGFTCNACLKDGKAFAYTCSTCSYDLHIDCIQWPDTVTRPDHKH  390

Query  349  LMRLYYSFPVG-----ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
             + LYYS P       A+  C  C   +     WV+Y ++  F  H  C
Sbjct  391  ALALYYSSPAAEVSPEATFMCDACKNPV-HEMAWVYYCRECDFGTHLEC  438


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 53/113 (47%), Gaps = 3/113 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    L      +CS C  P  G  + C  C +F+H + C      + H SH
Sbjct  4    KHFSHNHGLVFHQLPQGSEIHCSGCKSPGLGNVYVCWQCSYFLH-EQCFRAARSLKHPSH  62

Query  181  PAHPLHLRP-PSFDP-NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT  333
            P HPL L P P++   +  C++C        Y C  C++D+HV CA L   ++
Sbjct  63   PLHPLTLVPFPTYPSGSFFCNSCNHAGYGLSYSCSECEFDIHVHCAHLPNPNS  115



>ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Capsella rubella]
 gb|EOA31845.1| hypothetical protein CARUB_v10015072mg [Capsella rubella]
Length=244

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 76/165 (46%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  +  + +D   CS C L + G +  C    CD+F+H   CLDL  +I H 
Sbjct  9    RHPSHNHPLRGYKAQAEDEIICSGCDLNLIGASFKCTKSDCDYFLHKS-CLDLPREIRHK  67

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDG  345
            SHP HPL L   P + +  + C+AC    +   Y C  C YD+HV C  +  T   +   
Sbjct  68   SHPNHPLTLLYSPQNNNSTYTCNACGEYGSGFTYNCSTCQYDVHVGCVSMPETMKHSEHA  127

Query  346  TLMRLYYSFPVGAS--VWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
              + L YS P        C  C+ E      W++Y K   F AH 
Sbjct  128  HTLALIYSLPCPKDHVFGCDVCD-ETMLDNQWLYYCKTCDFGAHL  171



>emb|CDX83428.1| BnaA03g20780D [Brassica napus]
Length=241

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 78/166 (47%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL+ F  +  D   CS C L ++G A  C    CD+F+H   C DL  +I+H 
Sbjct  13   KHPSHKHPLHIFKAQEGDEIICSGCELELTGEAFKCTKSDCDYFLHKS-CFDLPREINHK  71

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP     + CDAC    ++ +Y C  C YD+HV CA L       D  
Sbjct  72   SHPNHPLTLLHSPPYESNAYGCDACGQYGSSFIYHCSKCQYDVHVGCAFLPEILEREDHE  131

Query  349  L-MRLYYSFP----VGASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L ++ P     G    C  C   +S    WV++ K   +  H
Sbjct  132  HPLTLVFNSPCKGREGMVFMCDVCKETVS-ENLWVYHCKVCDYGTH  176



>ref|XP_009587920.1| PREDICTED: uncharacterized protein LOC104085561 [Nicotiana tomentosiformis]
Length=236

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 82/172 (48%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SHPH L    ++  +   CS C   +SG+++ C    C+F +H   C +L  +I H 
Sbjct  2    KHFSHPHALELSEVQETNEIICSGCENKLSGISYKCTKPNCEFTLHKS-CFELPRKIQHN  60

Query  175  SHPAHPLHLRPPSFDPNHI---CDACLSPANTPLYRCGICDYDLHVDCAV----LTTSDT  333
            SHP HPL L P   + + I   C+AC       +Y C  C++ LH +CA+      T + 
Sbjct  61   SHPNHPLTLYPSLPERDSIYFGCNACGEEPKAFVYECLECNFSLHTNCAISWAETVTRED  120

Query  334  AVDGTLMRLYYSFPVGASV--WCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  ++  + FP+   V  +CK C+G +     W++Y  D  F+ H  C 
Sbjct  121  HQHSLTLQYQWPFPIDDYVHLFCKVCDG-LCNDSNWLYYCADCKFSTHLKCA  171



>ref|XP_010506361.1| PREDICTED: uncharacterized protein LOC104782983 [Camelina sativa]
Length=241

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 83/179 (46%), Gaps = 12/179 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL    +  +D   CS C L ++G A  C    CD+F+H   C DL  +I+H 
Sbjct  13   RHPSHNHPLRVCKVRGEDEIICSGCELELTGHAFKCTKSDCDYFLHKS-CFDLPREINHK  71

Query  175  SHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGT  348
            SHP H L L   S +   + CDAC    +   Y C  C YD+HV CA +  T        
Sbjct  72   SHPEHSLTLLHSSPYGQPYTCDACGEYGSGFTYNCSACQYDVHVGCAFIPETVKREGHEH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQP  510
             + L Y+ P      GA   C+ C   +S    WV+Y K+  +  H +   PV   H+P
Sbjct  132  PLTLLYNTPCKGREDGAMFICEVCEENMS-ENLWVYYCKECDYGTHVH-SCPVYEAHEP  188



>ref|XP_010518036.1| PREDICTED: uncharacterized protein LOC104793382 [Camelina sativa]
Length=261

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 82/179 (46%), Gaps = 12/179 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL    +  +D   CS C L ++G A  C    CD+F+H   C DL  +I H 
Sbjct  32   RHPSHNHPLRVCKVRGEDEIICSGCELELTGHAFKCTKSDCDYFLHKS-CFDLPREIDHK  90

Query  175  SHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGT  348
            SHP H L L   S +   + CDAC    +   Y C  C YD+HV CA +  T    V   
Sbjct  91   SHPEHSLTLLHSSPYGQPYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPETVKREVHEH  150

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQP  510
             + L Y+ P      GA   C  C   +S    WV+Y K+  +  H +   PV   H+P
Sbjct  151  PLTLLYNTPCKGREDGAMFICDVCEENMS-ENLWVYYCKECDYGTHVH-SCPVYEAHEP  207



>ref|XP_009142260.1| PREDICTED: uncharacterized protein LOC103866137 [Brassica rapa]
Length=255

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 84/180 (47%), Gaps = 14/180 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D   CS C L + G A  C  + CD+F+H   C DL  +  H 
Sbjct  13   RHPSHNHPLRLFKSQEEDEIICSGCELNLIGQAFKCTKKDCDYFLHKS-CFDLPRETKHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-GT  348
            SH  HPL L   P +  ++ CDAC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHSDHPLTLLHSPPYGHSYTCDACGQYGSGFTYNCSECQYDVHVGCAFIPETVKREDHDH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHF-NCGKPVILKHQP  510
             + L Y+ P      GA   C  C  ++S    WV+Y K+  +  H  +C   V   HQP
Sbjct  132  PLTLVYNTPCKGREDGAMFICDVCEEDMS-ENLWVYYCKECDYGTHVHSCA--VYEDHQP  188



>dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum]
Length=236

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SHPH L    ++  +   CS C   +SG+++ C    C F +H   C +L  +I H 
Sbjct  2    KHFSHPHALELSEVQETNEIICSGCENKLSGISYKCTKPNCKFTLHKS-CFELPRKIQHN  60

Query  175  SHPAHPLHLRPPSFDPNHI---CDACLSPANTPLYRCGICDYDLHVDCAV----LTTSDT  333
            SHP HPL L P   + + I   C+AC       +Y C  C++ LH +CA+      T + 
Sbjct  61   SHPNHPLTLYPSLPERDSIYFGCNACGEEPKAFVYECLECNFSLHTNCAISWAETVTRED  120

Query  334  AVDGTLMRLYYSFPVGASV--WCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  ++  + FP+   V  +CK C+G +     W++Y  D  F+ H  C 
Sbjct  121  HQHSLTLQYQWPFPIDDYVHLFCKVCDG-LCNDSNWLYYCADCKFSTHLKCA  171



>ref|XP_010518037.1| PREDICTED: uncharacterized protein LOC104793384 [Camelina sativa]
Length=245

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 77/166 (46%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F    +D   CS C L ++G A  C    CDFF+H   C DL  +  H 
Sbjct  13   RHPSHNHPLRIFKARSKDEVVCSGCELELTGQAFKCMKSDCDFFLHKS-CFDLPRETSHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SHP H L L   P +  ++ C+AC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHPDHSLTLLHSPPYGQSYTCNACDEYGSGFTYNCSECQYDVHVGCAFIPETVEREDHEH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L Y+ P      GA   C  C  ++S    WV+Y ++  +  H
Sbjct  132  PLTLLYNTPCKGREDGAMFICDVCEEDMS-ENLWVYYCQECDYGTH  176



>gb|KDP20386.1| hypothetical protein JCGZ_05269 [Jatropha curcas]
Length=188

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 78/171 (46%), Gaps = 10/171 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL    ++ +D   C  C + +SG  + C    CDFF+H   C +L  ++ H 
Sbjct  18   KHFSHSHPLRPVAVKEEDEVICCGCEMDLSGSGYRCTKSNCDFFLHKS-CFELPRELQHN  76

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SH  H L L   PP+ D    C+AC        Y C  C ++LHV CA L  +   VD T
Sbjct  77   SHSNHSLTLVASPPNDDSKFTCNACGDYGTGFTYHCLTCQFNLHVGCAFLPQTIKHVDHT  136

Query  349  -LMRLYYSFPVG---ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKP  489
             L+ L+YS  +     +  C  C  E+     W++Y  D  +     C  P
Sbjct  137  HLLTLFYSSSIERGCTTFTCDACKKEVP-HSHWIYYCPDCDYGTDLACTVP  186



>gb|EYU27137.1| hypothetical protein MIMGU_mgv1a0206321mg, partial [Erythranthe 
guttata]
Length=317

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 79/178 (44%), Gaps = 11/178 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SHPH L    +E ++   CS C + ++G A+ C    C F +H   C D   +  H 
Sbjct  115  KHFSHPHVLNGMEIETENAKVCSACEIELTGAAYCCTESQCSFNLHKT-CFDAPREFPHK  173

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SH  HPL L   P +     C+AC+       Y C  C YDLH++C       T  D   
Sbjct  174  SHLEHPLTLVTEPPYSEGFTCNACMEEGKAFAYTCATCSYDLHINCVQWPEKVTFSDHKH  233

Query  349  LMRLYY--SFPVGASVWCKKCNGEISRR----GGWVWYDKDTGFTAHFNCGKPVILKH  504
             + LYY  S  VG++     C  ++         WV++ ++  F +H +C    + +H
Sbjct  234  PLTLYYSSSSAVGSANQEVTCTCDVCMNPVDDSAWVYFCRECNFVSHLDCVTSTLKQH  291



>ref|NP_180394.1| cysteine/histidine-rich C1-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AAD29826.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08098.1| cysteine/histidine-rich C1-like domain-containing protein [Arabidopsis 
thaliana]
Length=248

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 77/167 (46%), Gaps = 12/167 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  FN + +D   CS C   + G A  C    CD+F+H   C DL  +IHH 
Sbjct  12   RHPSHNHPLRVFNSKEEDEIICSGCEHDLIGQAFKCTKSECDYFLHKS-CFDLPGEIHHK  70

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SH  HPL L   PP+    + CDAC    +   Y C  C Y +HV CA +  +    D  
Sbjct  71   SHTNHPLTLLHSPPNGLSTYTCDACGEYGSAFTYHCSECKYHVHVGCAFVPENVKREDHE  130

Query  349  L-MRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L Y+ P      G    C  C  ++S    WV+Y K+  +  H
Sbjct  131  HPLTLLYNTPCKGRKDGVVFICDVCEVDVS-ENLWVYYCKECDYGTH  176



>ref|XP_006295416.1| hypothetical protein CARUB_v10024514mg [Capsella rubella]
 gb|EOA28314.1| hypothetical protein CARUB_v10024514mg [Capsella rubella]
Length=239

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 82/179 (46%), Gaps = 12/179 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL       +D   CS C L ++G A  C    CD+F+H   C DL  ++ H 
Sbjct  13   RHPSHTHPLRVCKARGEDEMICSGCELELTGQAFKCAKSDCDYFLHKS-CFDLPRELSHK  71

Query  175  SHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            SHP H L L   S +   + CDAC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHPDHSLTLHHSSPYGQPYTCDACGEYGSGFTYHCSACQYDVHVGCAFIPENVKREDHEH  131

Query  352  -MRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQP  510
             + L Y+ P      GA   C  C  +++    WV+Y K+  +  H +   PV   HQP
Sbjct  132  PLTLLYNTPCKGREDGAMFICDVCEEDMT-ENLWVYYCKECDYGTHVH-SCPVHENHQP  188



>ref|NP_199165.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB11615.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94976.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 76/167 (46%), Gaps = 11/167 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D T CS C L ++G A  C    CD+F+H   C DL  + ++ 
Sbjct  17   RHPSHNHPLRVFKAKEEDETACSGCELELTGQAFKCIKSECDYFLH-KSCFDLPSETNNK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDG  345
            SH  HPL L   PP     + CDAC    +   Y C  C+Y LHV CA +  T D     
Sbjct  76   SHQDHPLTLLHSPPDDRSVYTCDACDQYGSGFSYHCSNCNYSLHVGCAFIPETVDREDHE  135

Query  346  TLMRLYYSFPVGAS----VWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
              + L Y  P          C  C+  IS    W++Y KD  +  H 
Sbjct  136  HPLTLLYCTPCKGREDTYFTCSACDETIS-EDLWMYYCKDCDYGTHL  181



>ref|XP_010506363.1| PREDICTED: uncharacterized protein LOC104782985 [Camelina sativa]
Length=232

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 78/167 (47%), Gaps = 13/167 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL+ F    +D  +CS C+L ++G A  C    CD+F+H   C DL  + +H 
Sbjct  13   RHMSHNHPLHVFKARDKDEISCSGCNLDLTGQAFKCTKSECDYFLH-KSCFDLPRETNHK  71

Query  175  SHPAHPLH-LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            SHP H L  L  P     + C AC    +  +Y C  C YD+HV C  L  +    D   
Sbjct  72   SHPKHSLTLLHSPPNGQFYTCHACGEYGSGFVYNCAECQYDVHVGCVFLAETVKGEDHEH  131

Query  352  -MRLYYSFPV-----GASVWCKKCNGEISRRGG-WVWYDKDTGFTAH  471
             + L Y+ P      GA   C  C  E+   G  WV+Y K+  +  H
Sbjct  132  PLILLYNTPCKGNDDGAMFICDVC--EVYMSGNLWVYYCKECDYGTH  176



>ref|XP_008245408.1| PREDICTED: uncharacterized protein LOC103343524 [Prunus mume]
Length=193

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 80/176 (45%), Gaps = 17/176 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGL------AHGC--EACDFFIHDDDCLDLK  156
             H SH H L  + ++  D   CS C LP+  +      A+ C    C+F++HD  C +L 
Sbjct  3    KHFSHRHELCSYQVQEDDEITCSGCELPLDLMMNSATSAYKCTKSKCNFYLHDL-CFELP  61

Query  157  LQIHHTSHPAHPLHLRPPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVL-TTSD  330
             +I H SHP HPL L  P ++     CDAC        + C  C YDLHV CA L  T  
Sbjct  62   QEIKHKSHPKHPLTLSTPPYEYGEFTCDACGEFGTCFTFHCTHCKYDLHVQCATLPETLS  121

Query  331  TAVDGTLMRLYYSFP-----VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  L+ L+YS P      G    C  C G    RG W++  +D  ++ H  C 
Sbjct  122  HHHHHHLLTLFYSLPDHHENEGKINICDFCQGTFP-RGCWLYSCRDCDYSTHLGCS  176



>ref|XP_009775179.1| PREDICTED: uncharacterized protein LOC104225108 [Nicotiana sylvestris]
Length=396

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 82/166 (49%), Gaps = 31/166 (19%)
 Frame = +1

Query  70   ICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLRP-PS-----------  213
            +C+  ISG+A+GC  C +F+H+  C ++  +I H   P H L LRP PS           
Sbjct  1    MCTFIISGVAYGCAHCRYFLHEV-CSNIPKRIRHHFLPMHSLTLRPIPSIALCYLKVESE  59

Query  214  ---------FDPNHICDACLSPANTPL----YRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
                     F     C AC    N  L    Y C +C++DLH++CA + T+        +
Sbjct  60   LLAVAEKRGFGTEFRCVAC--GYNKSLFGFYYHCDVCNFDLHLECASVPTTLIHKVKYPL  117

Query  355  RLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             L+  FP+   GA+V+C  CN  ++R   WV+Y+++  +  HF CG
Sbjct  118  DLFTIFPLESEGAAVFCDICNQVMNRESSWVFYNREFDYICHFECG  163


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 72/167 (43%), Gaps = 9/167 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDG-TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH HPL       +    +C ICS   S   + C+ C++F+ D+ C  L  +I H  
Sbjct  204  THFSHRHPLKAIKYTNEASIMSCCICSNKSSS-GYICQQCNYFM-DESCFPLPPKIRHQY  261

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGTL  351
            HP H L L   +  PN  C AC S      Y    C + LH  CA   L  +        
Sbjct  262  HPNHTLILASYTDLPNIHCTAC-SQEVGAAYHWSACKFSLHRTCAGAPLALTLGTNKKVS  320

Query  352  MRLYYSFPVG---ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             +L YSFP     A + C  C+ +++ +  +++Y+ D     H  C 
Sbjct  321  YKLLYSFPFEGEMAVINCSDCSSKLNSKHSFLYYNFDLDEVLHVQCA  367



>ref|XP_009143019.1| PREDICTED: uncharacterized protein LOC103866791 [Brassica rapa]
Length=253

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 80/178 (45%), Gaps = 26/178 (15%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  +  D T CS C L ++G A  C    CD+ +H   C DL  + HH 
Sbjct  17   RHQSHSHPLRVFKAKEDDETVCSGCELELTGQAFKCTKSDCDYLLH-KSCFDLPGETHHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SH  HPL L   PP  +  + C+AC    +   Y C  C Y+LHV CA L         T
Sbjct  76   SHKDHPLTLLYSPPDDESVYTCNACDQYGSGFTYHCSNCKYNLHVGCASLPE-------T  128

Query  349  LMRLYYSFPVGASVWCKKCNG------------EISRRGGWVWYDKDTGFTAH-FNCG  483
            ++R  +  P+   ++C  C G            E      WV+Y ++  +  H ++C 
Sbjct  129  ILREDHEHPLTL-LYCTSCKGREDTTFICSACDETVLEDLWVYYCRECDYGTHVYSCA  185



>ref|XP_009792329.1| PREDICTED: uncharacterized protein LOC104239399 [Nicotiana sylvestris]
Length=236

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SHPH L    +E  +   CS C   +SG ++ C    C+F +H   C +L  +I H 
Sbjct  2    KHFSHPHALEFCEVEETNEIICSGCENKLSGTSYKCTKPNCEFTLHKS-CFELPRKIQHN  60

Query  175  SHPAHPLHLRPPSFDPNHI---CDACLSPANTPLYRCGICDYDLHVDCAVL----TTSDT  333
            SHP HPL L P   + + I   C+AC       +Y C  C++ LH +CA+      T + 
Sbjct  61   SHPIHPLTLYPSLPERDSIYFGCNACGEEPKAFVYECLDCNFSLHANCAISWPENVTRED  120

Query  334  AVDGTLMRLYYSFPVGASV--WCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  ++  + FP+   V  +CK C+G +     W++Y  +  F+ H  C 
Sbjct  121  HQHSLTLQYQWPFPIDDYVHLFCKVCDG-LCNDSRWLYYCAECKFSTHLKCA  171



>ref|XP_006359185.1| PREDICTED: uncharacterized protein LOC102578150 [Solanum tuberosum]
Length=245

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 84/182 (46%), Gaps = 10/182 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLP--ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L Q  +   +  NC+ C  P   +   +GC  C +F+H++ C +    ++H+S
Sbjct  14   HFSHQHVLKQI-VNPTETLNCNACEKPNNTNKPFYGCNTCQYFLHEN-CFNAPRILNHSS  71

Query  178  HPAHPL--HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            HP+HPL  H  P     ++ C+AC S  N   Y C  CD+D+H+ CA   +S      T 
Sbjct  72   HPSHPLTLHQIPSYTSGSYFCNACGSVGNGFCYNCADCDFDIHLQCASCPSSILVDKHTH  131

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFLRPL  528
             + + Y +P  +   C  C   +     W +Y     F +H NC   +I      F + L
Sbjct  132  QLEIQYGYPEDSEYVCDIC-SVMMNNDNWFYYCGGCDFASHLNCA--IISPEVGVFPKQL  188

Query  529  MR  534
             R
Sbjct  189  QR  190



>ref|XP_010481852.1| PREDICTED: uncharacterized protein LOC104760602 [Camelina sativa]
Length=256

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 74/166 (45%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D T CS C L + G A  C    CD+F+H   C DL  + HH 
Sbjct  17   RHPSHNHPLRVFKAKEEDETACSGCELELIGQAFKCIKSDCDYFLH-KSCFDLPSETHHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDG  345
            SH  HPL L   PP     + CDAC    +   Y C  C+Y+LHV C  +  T D     
Sbjct  76   SHQDHPLTLLHSPPDERSVYTCDACDQYGSGFTYHCSNCNYNLHVGCTFIPETIDREDHE  135

Query  346  TLMRLYYSFPVGAS----VWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L Y  P          C  C   IS    W++Y K+  +  H
Sbjct  136  HPLTLLYCTPCKGHEDTIFTCSVCEETIS-EDLWMYYCKECDYGTH  180



>ref|XP_009591761.1| PREDICTED: uncharacterized protein LOC104088734 [Nicotiana tomentosiformis]
Length=190

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 78/171 (46%), Gaps = 13/171 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISG-LAHGCEA--CDFFIHDDDCLDLKLQIHH  171
            +H SH HPL   ++E +D   CS C   +SG  A+ C    C+F +HD  C +L  QI H
Sbjct  11   SHFSHRHPLKISDVEEEDQVICSGCEHDLSGGSAYACTKMNCNFILHDS-CFELPRQIKH  69

Query  172  TSHPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
             SHP H L L   PP  D    CDAC +  +   + C  C +DLHV+CA L   +   D 
Sbjct  70   KSHPKHTLTLLFFPPYDDGEFTCDACGNSGHAFTFHCEKCKFDLHVECASLPEIEERKDH  129

Query  346  T------LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
                      +++       + C  C   + +R  W +Y     F  H +C
Sbjct  130  QHPLTLCYSNVFFGKDKDVDLMCYVCQRGVGKR-CWFYYCLACKFATHMDC  179



>gb|KFK41231.1| hypothetical protein AALP_AA2G102500 [Arabis alpina]
Length=244

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 77/166 (46%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     +++D   CS C + + G A  C    CD+F+H   C +L  +I H 
Sbjct  13   RHPSHNHPLRGCKAQVEDEIICSGCDIELDGAAFKCTMSDCDYFLHMS-CFELPREIRHK  71

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDG  345
            SHP HPL L   PP       C+AC    +  +Y C IC YD+HV C  +  T       
Sbjct  72   SHPDHPLVLLFSPPYESGGFGCNACTQDGSGYVYHCSICKYDVHVGCVSMPETMKHDEHA  131

Query  346  TLMRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              + L YS P+  G    C  C+  I  R  W++Y +   +  H +
Sbjct  132  HTLTLLYSPPLQEGRIFNCDVCHETIP-RSFWLYYCQKCDWGTHLH  176



>ref|XP_011087030.1| PREDICTED: uncharacterized protein LOC105168590 [Sesamum indicum]
Length=391

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 9/169 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLE--IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SHPHPL   N +  +   ++C  C+L  SG+ + C  C FF+H   C ++  +I H  
Sbjct  16   HFSHPHPLKLINYQQTLNSASSCPGCNLKPSGMIYSCTTCHFFLH-KKCFEMPKKITHPF  74

Query  178  HPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV-DGT  348
            H  H   L P P++      CDAC    N   Y C  C  DLH+ CA +  S T V    
Sbjct  75   HKEHAFTLLPEPAYAEGLFNCDACGETGNGFSYHCKPCGIDLHILCAAMPLSLTHVCHMH  134

Query  349  LMRLYYSFPVGASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            ++ L +  P G  V+ C  C G  S    W++     GF AH NC + V
Sbjct  135  VLALTFGSPYGDKVFSCHICKGPGSDH--WLYRCNLCGFDAHLNCARRV  181



>ref|XP_006397613.1| hypothetical protein EUTSA_v10001601mg [Eutrema salsugineum]
 gb|ESQ39066.1| hypothetical protein EUTSA_v10001601mg [Eutrema salsugineum]
Length=248

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 76/166 (46%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     ++++   CS C L ++G A  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHSHPLRSHKAQVEEEIICSGCELDLTGAAFKCTKSECDYFLHKS-CFELPRETRHK  67

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            +HP HPL L   PP     + C+AC    +  +Y C IC +DLHV C  +  S    +  
Sbjct  68   AHPDHPLTLLYSPPYESSTYGCNACGEYGSGFVYNCSICQFDLHVGCVSMPESVEREEHA  127

Query  349  --LMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              L  LY S +  G    C  C   +     W +Y K+  F  H +
Sbjct  128  HPLTLLYCSPYQNGLIFHCNVCEETVPDH-LWSYYCKECDFGTHLH  172



>ref|XP_010510646.1| PREDICTED: uncharacterized protein LOC104786891 [Camelina sativa]
Length=253

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 76/167 (46%), Gaps = 12/167 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D   CS C   + G A  C    CD+ +H   C DL+ +  H 
Sbjct  17   RHTSHNHPLRVFKSQEEDQIICSGCEHELIGQAFKCTKSECDYILHKS-CFDLRGETQHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP+    + CDAC    +   Y C  C Y +HV CA +  +    D  
Sbjct  76   SHPNHPLALLYSPPNGLSTYTCDACGEYGSAFTYHCSECKYHIHVGCAFVPENVERDDHE  135

Query  349  L-MRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L Y+ P      G    C  C  ++S +  WV+Y K+  +  H
Sbjct  136  HPLTLLYNTPCKGREDGMMFICDVCEEDMSEK-LWVYYCKECDYGTH  181



>ref|XP_010474009.1| PREDICTED: uncharacterized protein LOC104753454 [Camelina sativa]
Length=407

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 76/167 (46%), Gaps = 12/167 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D   CS C   + G A  C    CD+F+H   C DL+ +  H 
Sbjct  17   RHPSHNHPLRVFKSQEEDQIICSGCEHELIGQAFKCTKSECDYFLHKS-CFDLRCETQHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP+    + CDAC    +   Y C  C Y +HV CA +  +    D  
Sbjct  76   SHPNHPLALLYSPPNGLSTYTCDACGEYGSAFTYHCSECKYHIHVGCAFVPENVERDDHE  135

Query  349  L-MRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L Y+ P      G    C  C  ++S    WV+Y K+  +  H
Sbjct  136  HPLTLLYNTPCKGREDGMMFICDVCEEDMS-ENLWVYYCKECDYGTH  181


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 69/153 (45%), Gaps = 12/153 (8%)
 Frame = +1

Query  43   EIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHTSHPAHPLHL--RPP  210
            +I D   CS C   + G A  C    CD+F+H   C DL+ +  H SHP HPL L   PP
Sbjct  190  DIXDQIICSGCEHELIGQAFKCTKSECDYFLHKS-CFDLRCETQHKSHPNHPLALLYSPP  248

Query  211  SFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL-MRLYYSFPV---  378
            +    + CDAC    +   Y C  C Y +HV CA +  +    D    + L Y+ P    
Sbjct  249  NGLSTYTCDACGEYGSAFTYHCSECKYHIHVGCAFVPENVERDDHEHPLTLLYNTPCKGR  308

Query  379  --GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              G    C  C  ++S    WV+Y K+  +  H
Sbjct  309  EDGMMFICDVCEEDMS-ENLWVYYCKECDYGTH  340



>ref|XP_006418664.1| hypothetical protein EUTSA_v10002650mg [Eutrema salsugineum]
 gb|ESQ37100.1| hypothetical protein EUTSA_v10002650mg [Eutrema salsugineum]
Length=243

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 78/166 (47%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  +  D   CS C L ++G A+ C  + C++F+H   C DL  +I+H 
Sbjct  13   KHPSHNHPLRVFKSQEGDEIICSGCELDVTGKAYKCMKKDCNYFLH-KSCFDLPGEINHK  71

Query  175  SHPAHPLH-LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            SHP HPL  L  P +  ++ C AC    +   Y C  C YD+HV C  +  +    D   
Sbjct  72   SHPDHPLTLLYSPPYGQSYGCTACGDSGSGFTYNCSECQYDVHVGCVFIPETMEREDHEH  131

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
             + L Y+ P      G    C  C  ++S    WV+Y K   +  H
Sbjct  132  PLTLLYNTPCKGREDGLIFICDVCEEDMS-EDLWVYYCKKCDYGTH  176



>ref|XP_010442014.1| PREDICTED: uncharacterized protein LOC104725107 [Camelina sativa]
Length=256

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 73/166 (44%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D   CS C L + G A  C    CD+F+H   C DL  + HH 
Sbjct  17   RHPSHNHPLRVFKAKEEDEAACSGCELELIGQAFKCIESDCDYFLHKS-CFDLPSETHHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDG  345
            SH  HPL L   PP     + CDAC    +   Y C  C+Y+LHV C  +  T D     
Sbjct  76   SHQDHPLTLLHSPPDERSVYTCDACDQYGSGFTYHCSNCNYNLHVGCTFIPETIDREDHE  135

Query  346  TLMRLYYSFPVGAS----VWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L Y  P          C  C   IS    W++Y K+  +  H
Sbjct  136  HPLTLLYCTPCKGHEDTIFTCSVCEETIS-EDLWMYYCKECDYGTH  180



>ref|XP_006281652.1| hypothetical protein CARUB_v10027788mg [Capsella rubella]
 gb|EOA14550.1| hypothetical protein CARUB_v10027788mg [Capsella rubella]
Length=258

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 74/166 (45%), Gaps = 11/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D T CS C L + G A  C    CD+F+H   C DL  +  H 
Sbjct  17   RHPSHNHPLRVFKAKEEDETACSGCELELIGQAFKCIKSECDYFLH-KSCFDLPCETRHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDG  345
            SH  HPL L   PP     + C+ C    +   Y C  C+Y+LHV+CA +  T D     
Sbjct  76   SHKDHPLTLLHSPPDDRSIYTCNGCDQYGSGFTYHCSNCNYNLHVECAFIPETIDREDHE  135

Query  346  TLMRLYYSFPVGAS----VWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              + L Y  P          C  C   IS    W++Y K+  +  H
Sbjct  136  HPLTLLYCTPCKGREDTIFTCSVCEETIS-EDLWMYYCKECDYGTH  180



>ref|XP_010257481.1| PREDICTED: uncharacterized protein LOC104597562 [Nelumbo nucifera]
Length=223

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 77/167 (46%), Gaps = 10/167 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H  HPH L    L+  +   CS C LP  S   +GC +C++F+H+  CL+LK  + H +
Sbjct  4    QHFDHPHLLDLHELQEGEKIQCSGCELPGGSDSMYGCNSCNYFLHEK-CLNLKRWMEHPA  62

Query  178  HPAHPLHLRPPSFDPN--HICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            HP HPL   P    PN    C+AC    +   Y C  C++DLH  CA L  +    +G  
Sbjct  63   HPEHPLTFLPKPTYPNGSFRCNACGDDGSAFSYCCAFCEFDLHTHCASLPRT-VVHEGHS  121

Query  352  MRLYYSFPVGAS----VWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              L  +F +  +      C  CNG    +  WV+   D  F  H  C
Sbjct  122  HPLTLTFKLSGAETTIFTCDVCNGNADLQ-YWVYNCDDCNFGTHLGC  167



>ref|XP_009142259.1| PREDICTED: uncharacterized protein LOC103866135 [Brassica rapa]
 emb|CDY30468.1| BnaA04g25690D [Brassica napus]
Length=247

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 75/169 (44%), Gaps = 12/169 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  +  D   CS C L + G A+ C    C++F+H   C DL  +  H 
Sbjct  17   RHPSHDHPLRVFKSQEGDEIICSGCELELIGQAYKCTKSECNYFLHKS-CFDLPGETLHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP       CDAC    +   Y C  C YD+HV CA +  +    D  
Sbjct  76   SHPNHPLTLVHSPPYDQSIFSCDACGEHGSGFTYHCSKCQYDVHVGCAFVPVTVQREDHE  135

Query  349  -LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              + L Y+ P      G +  C  C  ++     WV+Y K+  +  H  
Sbjct  136  HPLTLLYNTPCKGREDGVTFICDVCEEDMQEH-LWVYYCKECDYGTHVR  183



>ref|XP_011087011.1| PREDICTED: uncharacterized protein LOC105168571 [Sesamum indicum]
Length=247

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 76/165 (46%), Gaps = 6/165 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L     +  +  +C +C   IS   HGC +C F++H D C D    + H SH
Sbjct  7    QHFSHHHILIPLEPDQGEQISCKVCEGQISEPFHGCLSCHFYLH-DRCTDAPRSLDHPSH  65

Query  181  PAHPLHLRPPSFDPNH--ICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-L  351
            PAHPL L P    P    +C+AC        + C  C++DLHV CA++ ++    +    
Sbjct  66   PAHPLTLLPTPTYPTRSFMCNACALHGKAYSFSCACCEFDLHVQCALMPSTILVENHPHE  125

Query  352  MRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHFNC  480
            ++L +  P        +CN   EI  +  W++Y     F  H  C
Sbjct  126  LQLIFDSPCQDENTEFECNICKEIVHKDQWLFYCGACDFGGHLGC  170



>ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC16104.1| unknown protein [Arabidopsis thaliana]
 gb|AAR92250.1| At2g44370 [Arabidopsis thaliana]
 gb|AAS76240.1| At2g44370 [Arabidopsis thaliana]
 gb|AEC10413.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     ++++   CS C L + G A  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHNHPLRSHKAQVEEEIICSGCDLDLIGAAFKCTKSECDYFLHKS-CFELPRETRHK  67

Query  175  SHPAHPL-HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG--  345
            +HP HPL  L  P ++  + CDAC    +   Y C IC YD+HV C  +  S    +G  
Sbjct  68   AHPDHPLILLYSPPYESTYTCDACGEYGSGFTYNCSICQYDVHVGCVSMPES-VEREGHA  126

Query  346  -TLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
              L  LY S +  G    C  C  E      W +Y K+  +  H 
Sbjct  127  HPLTLLYRSPYQNGLIFNCDVCQ-ETVPDNLWSYYCKECDYGTHL  170



>ref|XP_006295592.1| hypothetical protein CARUB_v10024700mg [Capsella rubella]
 gb|EOA28490.1| hypothetical protein CARUB_v10024700mg [Capsella rubella]
Length=251

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 76/166 (46%), Gaps = 10/166 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     ++++   CS C L + G +  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHNHPLRSHKAQVEEEIICSGCDLDLVGASFKCTKSECDYFLHKS-CFELPRETRHK  67

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG--  345
            +HP HPL L   P ++  + CDAC    +   Y C IC YD+HV C  +  S    +G  
Sbjct  68   AHPDHPLTLLYSPPYESTYTCDACGEYGSGFTYNCSICQYDVHVGCVSMPES-VEREGHR  126

Query  346  -TLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              L  LY S +  G    C  C  E      W +Y K+  +  H +
Sbjct  127  HPLTLLYRSPYENGLIFNCDVCE-ETVPDNLWSYYCKECDYGTHLH  171



>emb|CDY30467.1| BnaA04g25680D [Brassica napus]
Length=244

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 75/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL       ++ T CS C L + G A  C    CD+F+H   C+DL  +  H 
Sbjct  9    RHPSHNHPLRGHKALAEEETICSGCDLDLIGAAFKCTKSECDYFLHKS-CVDLPRETRHK  67

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   PP     + C AC    +  +Y C IC +DLHV C  +  +      +
Sbjct  68   SHPDHPLTLLYSPPYESSTYECSACSEYGSGFVYNCSICQFDLHVGCISMPESVEREGHE  127

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              L  LY S +  G  V C  C   +     W +Y K+  +  H +
Sbjct  128  HPLTLLYCSPYTNGLIVKCDVCQETVPDH-LWSYYCKECDYGTHLH  172



>ref|XP_010508303.1| PREDICTED: uncharacterized protein LOC104784899 [Camelina sativa]
Length=251

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 74/165 (45%), Gaps = 8/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     ++++   C  C L + G A  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHNHPLRGHKAQVEEEIICYGCDLDLVGAAFKCTKSECDYFLHKS-CFELPRETRHK  67

Query  175  SHPAHPLHLR-PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            +HP HPL L   P ++  + CDAC    +   Y C  C YD+HV C  +  S      T 
Sbjct  68   AHPNHPLTLLFAPPYESTYTCDACGEYGSGFTYNCSTCQYDVHVGCVSMPESVEREGHTH  127

Query  349  -LMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
             L  LY S +  G    C  C  E      W +Y K+  + AH +
Sbjct  128  PLTLLYRSPYQNGLIFNCDVCQ-ETVPDNLWSYYCKECDYGAHLH  171



>ref|XP_009763577.1| PREDICTED: uncharacterized protein LOC104215463 [Nicotiana sylvestris]
Length=193

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 75/159 (47%), Gaps = 13/159 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISG-LAHGCEA--CDFFIHDDDCLDLKLQIHH  171
            +H SH HPL   ++E +D   CS C   +SG  A+ C    C+F +HD  C +L  QI H
Sbjct  11   SHFSHRHPLKISDVEEEDQVICSGCEHDLSGGSAYACTKVNCNFILHDS-CFELPRQIKH  69

Query  172  TSHPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
             SHP H L LR  PP  D    CDAC +  +   + C  C +DLHV+CA L   +   D 
Sbjct  70   KSHPKHTLTLRFFPPYDDGEFTCDACGNSGHAFTFHCEKCKFDLHVECASLPEIEERKDH  129

Query  346  ------TLMRLYYSFPVGASVWCKKCNGEISRRGGWVWY  444
                  +   +++       + C  C   +  +  W +Y
Sbjct  130  QHPLTLSYSNVFFGKDKDVDLMCYVCQRGVG-KSCWFYY  167



>ref|XP_009142258.1| PREDICTED: uncharacterized protein LOC103866134 [Brassica rapa]
Length=244

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 74/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL       ++ T CS C L + G A  C    CD+F+H   C DL  +  H 
Sbjct  9    RHPSHNHPLRGHKALAEEETICSGCDLDLIGAAFKCTKSECDYFLHKS-CFDLPRETRHK  67

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   PP     + C AC    +  +Y C IC +DLHV C  +  +      +
Sbjct  68   SHPDHPLTLLYSPPYESSTYECSACSEYGSGFVYNCSICQFDLHVGCISMPESVEREGHE  127

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              L  LY S +  G  V C  C   +     W +Y K+  +  H +
Sbjct  128  HPLTLLYCSPYTNGLIVKCDVCQETVPDH-LWSYYCKECDYGTHLH  172



>ref|XP_010265934.1| PREDICTED: uncharacterized protein LOC104603561 [Nelumbo nucifera]
Length=233

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFN-LEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SHPHPL  ++  +  DG  CS C L   G   GCE+C++++H + CL++   + H +
Sbjct  7    QHFSHPHPLNPYDEAQESDGIRCSGCELVTLGSLFGCESCNYYLH-EKCLNVGRWMEHPA  65

Query  178  HPAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS---DTAVD  342
            HP HPL L P    P  + +C+AC    ++    C  C++DLHV CA L  +   +    
Sbjct  66   HPNHPLTLLPVPTYPSGSFLCNACREDGSSFSLSCAHCEFDLHVQCASLPQTVVHEAHPH  125

Query  343  GTLMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
               +   YS P        +  C  C GE     GW++      F  H +C 
Sbjct  126  PLSLTFSYSNPKLSHAESIAFSCDVC-GEDVDLQGWLYLCVGCDFGDHLSCA  176



>ref|XP_006397615.1| hypothetical protein EUTSA_v10001796mg [Eutrema salsugineum]
 gb|ESQ39068.1| hypothetical protein EUTSA_v10001796mg [Eutrema salsugineum]
Length=247

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 84/179 (47%), Gaps = 12/179 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  + +D   CS C L ++G +  C  + CD+ +H   C DL  + +H 
Sbjct  13   RHPSHNHPLRIFKAQDEDEIICSGCELDMTGQSFKCTKKDCDYVLHKS-CFDLPGETNHK  71

Query  175  SHPAHPLHL-RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            SH  H L L   P +  ++ CDAC    +   Y C  C YD+HV CA +  +    D   
Sbjct  72   SHLDHRLTLLYSPPYGHSYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPETVEREDHEH  131

Query  352  -MRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQP  510
             + L Y+ P      GA   C  C  ++S    WV+Y K+  +  H +  K V   H+P
Sbjct  132  PLTLLYNTPCKGREDGAMFICDVCEEDMS-ENLWVYYCKECDYGTHVHSCK-VYEDHEP  188



>ref|XP_011036333.1| PREDICTED: uncharacterized protein LOC105133886 isoform X1 [Populus 
euphratica]
Length=840

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +1

Query  19   HPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLH  198
            H L  FN + +    C+ C L +SG A+GC  C+F++H + C D+  +I H  HP HPLH
Sbjct  152  HLLVSFNAKQEVEKTCTGCQLQLSGPAYGCLDCEFYLH-ESCKDMPSEIQHPYHPLHPLH  210

Query  199  LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA---VLTTSDTAVDGTLMRLYY  366
             +   +     CDAC  P     YRC  CD++LH+ CA   +   S     G    LYY
Sbjct  211  AQVAEYGSE--CDACHMPIRKVFYRCSECDFNLHILCANKSLQVASSLKFKGHEHDLYY  267


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 50/105 (48%), Gaps = 2/105 (2%)
 Frame = +1

Query  13   HPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHP  192
            H H L + N        C +C L ISG  + C  C+FFIH + CL+   +I H  H  HP
Sbjct  546  HKHKLTRANCTRGIKAKCKVCQLGISGATYCCINCNFFIH-ESCLETPQEIQHQYHLQHP  604

Query  193  LHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
            L  R    +P + C AC        Y C ICD+ LH  CA   TS
Sbjct  605  LLGRDFGGNPKN-CRACNLQTWDIAYYCDICDFALHFTCATYLTS  648



>ref|XP_011036334.1| PREDICTED: uncharacterized protein LOC105133886 isoform X2 [Populus 
euphratica]
Length=837

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +1

Query  19   HPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLH  198
            H L  FN + +    C+ C L +SG A+GC  C+F++H + C D+  +I H  HP HPLH
Sbjct  152  HLLVSFNAKQEVEKTCTGCQLQLSGPAYGCLDCEFYLH-ESCKDMPSEIQHPYHPLHPLH  210

Query  199  LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA---VLTTSDTAVDGTLMRLYY  366
             +   +     CDAC  P     YRC  CD++LH+ CA   +   S     G    LYY
Sbjct  211  AQVAEYGSE--CDACHMPIRKVFYRCSECDFNLHILCANKSLQVASSLKFKGHEHDLYY  267


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 50/105 (48%), Gaps = 2/105 (2%)
 Frame = +1

Query  13   HPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHP  192
            H H L + N        C +C L ISG  + C  C+FFIH + CL+   +I H  H  HP
Sbjct  546  HKHKLTRANCTRGIKAKCKVCQLGISGATYCCINCNFFIH-ESCLETPQEIQHQYHLQHP  604

Query  193  LHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
            L  R    +P + C AC        Y C ICD+ LH  CA   TS
Sbjct  605  LLGRDFGGNPKN-CRACNLQTWDIAYYCDICDFALHFTCATYLTS  648



>ref|XP_002512181.1| protein binding protein, putative [Ricinus communis]
 gb|EEF50215.1| protein binding protein, putative [Ricinus communis]
Length=187

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 79/171 (46%), Gaps = 10/171 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SH HPL   +++  +   C  C L +SG A+ C    C F +H   C +L  ++ H 
Sbjct  17   KHFSHSHPLRPADVKEDEEIICFGCELDLSGSAYKCSKSKCVFLLHKS-CFELPKELQHD  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SH  H L L   PP  D    C+AC        Y C +C ++LHV CA L  +   VD +
Sbjct  76   SHSEHLLTLLPSPPQDDSKFTCNACGDYGTAFAYHCAVCRFNLHVGCAFLPKNIKHVDHS  135

Query  349  -LMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKP  489
              + L+YS  +     S  C  C  ++S +G W++Y  +  +     C  P
Sbjct  136  HPLTLFYSSLMERGSTSFTCDACRKKVS-QGYWIYYCPECDYGTDLACTIP  185



>ref|XP_007048688.1| Binding protein, putative [Theobroma cacao]
 gb|EOX92845.1| Binding protein, putative [Theobroma cacao]
Length=202

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 79/175 (45%), Gaps = 14/175 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFN-LEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHH  171
            NH SH HPL   + ++ ++   CS C L + G    C    CDF +H   C +L L + H
Sbjct  15   NHFSHCHPLRPIDQIKAEEELICSGCGLEVIGSTFMCSKSDCDFILHKS-CFELNLVLQH  73

Query  172  TSHPAHPLHLR---PPSFDPN-HICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
             SHP H L L    P ++  N  IC AC        Y C  C +DLHV CA L  +    
Sbjct  74   KSHPPHSLKLLCAPPDNYSRNIFICHACHDYGTGFDYHCSTCQFDLHVGCAKLPKTINHK  133

Query  340  DGT-LMRLYYSFPVGA----SVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKP  489
            D   L+ LYYSF        +  C  C  ++  R  WV++ K   F  H  C  P
Sbjct  134  DHQHLLTLYYSFSCIKENIEAFVCDVCGQDVPDR-LWVYHCKKCDFGIHLRCTIP  187



>ref|XP_011036335.1| PREDICTED: uncharacterized protein LOC105133886 isoform X3 [Populus 
euphratica]
 ref|XP_011036336.1| PREDICTED: uncharacterized protein LOC105133886 isoform X4 [Populus 
euphratica]
Length=786

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +1

Query  19   HPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLH  198
            H L  FN + +    C+ C L +SG A+GC  C+F++H + C D+  +I H  HP HPLH
Sbjct  152  HLLVSFNAKQEVEKTCTGCQLQLSGPAYGCLDCEFYLH-ESCKDMPSEIQHPYHPLHPLH  210

Query  199  LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA---VLTTSDTAVDGTLMRLYY  366
             +   +     CDAC  P     YRC  CD++LH+ CA   +   S     G    LYY
Sbjct  211  AQVAEYGSE--CDACHMPIRKVFYRCSECDFNLHILCANKSLQVASSLKFKGHEHDLYY  267


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 54/120 (45%), Gaps = 2/120 (2%)
 Frame = +1

Query  13   HPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHP  192
            H H L + N        C +C L ISG  + C  C+FFIH + CL+   +I H  H  HP
Sbjct  546  HKHKLTRANCTRGIKAKCKVCQLGISGATYCCINCNFFIH-ESCLETPQEIQHQYHLQHP  604

Query  193  LHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSF  372
            L  R    +P + C AC        Y C ICD+ LH  CA   TS    +       +SF
Sbjct  605  LLGRDFGGNPKN-CRACNLQTWDIAYYCDICDFALHFTCATYLTSTLIHESHHEHTLFSF  663



>ref|XP_010506360.1| PREDICTED: uncharacterized protein LOC104782982 [Camelina sativa]
Length=252

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 75/166 (45%), Gaps = 10/166 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     ++++   CS C L + G A  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHNHPLRGHKAQVEEEIICSGCDLDLVGAAFKCTKSECDYFLHKS-CFELPRETRHK  67

Query  175  SHPAHPLHLR-PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG--  345
            +HP HPL L   P ++  + CDAC    +   Y C  C YD+HV C  +  S    +G  
Sbjct  68   AHPNHPLTLLFSPPYESTYTCDACGEYGSGFTYNCSTCQYDVHVGCVSMPES-VEREGHA  126

Query  346  -TLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              L  LY S +  G    C  C  E      W +Y K+  +  H +
Sbjct  127  HPLTLLYRSPYQNGLIFNCDVCQ-ETVPDNLWSYYCKECDYGTHLH  171



>emb|CDP07682.1| unnamed protein product [Coffea canephora]
Length=246

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 79/166 (48%), Gaps = 8/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH  H H L    L+  D   C  C L I    HGC +C++++H D CL++   I H SH
Sbjct  7    NHFGHEHLLTPLVLDEGDKLYCKACELQIIEPFHGCLSCNYYLH-DKCLNIPRSILHPSH  65

Query  181  PAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG--T  348
              HPL L P P++  +   C+AC S  N   Y C  C++D+H+ CA L      ++    
Sbjct  66   SDHPLTLLPFPTYPTSTFKCNACGSNGNGFSYSCAHCEFDIHIQCASLPRKVKHLEKHHH  125

Query  349  LMRLYYSFPVGASV--WCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
             ++L Y F    ++   C +C G+      W +Y  +  F  H  C
Sbjct  126  ELKLTYKFVQDKNLIFECDEC-GKTVDVDQWRYYCAECDFGTHLVC  170



>emb|CDY23431.1| BnaC04g49590D [Brassica napus]
Length=247

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 75/169 (44%), Gaps = 12/169 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL  F  +  D   CS C L + G A+ C    C +F+H   C +L  +  H 
Sbjct  17   RHPSHDHPLRVFKSQEGDEIICSGCELELIGQAYKCTKSECSYFLHKS-CFNLPGETLHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP       CDAC    +   Y C  C YD+HV CA +  +    D  
Sbjct  76   SHPNHPLTLVHSPPYDQSIFSCDACGEHGSGFAYHCSNCQYDVHVGCAFVPETVKREDHE  135

Query  349  -LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              + L Y+ P      G +  C  C  ++ +   WV+Y K+  +  H  
Sbjct  136  HPLTLLYNTPCKGSEDGVTFICDVCEEDM-QENLWVYYCKECDYGTHVR  183



>ref|XP_006359188.1| PREDICTED: uncharacterized protein LOC102579475 [Solanum tuberosum]
Length=240

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 78/166 (47%), Gaps = 10/166 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L Q  +   +   C+ C  P +     +GC  C +F+H++ C +    ++H+S
Sbjct  14   HFSHQHVLKQI-VNPTETLTCNACEKPNNSNKPFYGCNTCQYFLHEN-CFNAPRILNHSS  71

Query  178  HPAHPL--HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            HP HPL  H  P     ++IC+AC S  N   Y C  CD+D+H+ CA   +S   VD   
Sbjct  72   HPLHPLTLHQIPSYASGSYICNACGSVGNGFCYNCVDCDFDIHLQCASCPSS-ILVDKLP  130

Query  349  -LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              + + Y +P  +   C  C   +     W +Y     F +H NC 
Sbjct  131  HQLEIQYGYPEDSEYVCDIC-SVMMNNDNWFYYCGGCDFASHLNCA  175



>ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 pir||H84555 hypothetical protein At2g17740 [imported] - Arabidopsis thaliana
 gb|AAQ62414.1| At2g17740 [Arabidopsis thaliana]
 dbj|BAD42947.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43162.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44346.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44522.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06677.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=248

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 74/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     +++D   CS C L + G    C    CD+F+H   C DL  +I H 
Sbjct  8    RHPSHNHPLRGHKAQVEDEIICSGCDLDLLGAYFKCTKSECDYFLHKS-CFDLPREIRHK  66

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS---DTAV  339
            SHP HPL L   P + +  + CDAC    +   Y C IC YD+HV C  +  +   D  V
Sbjct  67   SHPDHPLILLYSPQNNNSTYTCDACGEYGSGFTYNCSICQYDVHVGCVSVPETMKHDEHV  126

Query  340  DGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
                +      P      C  C+ E      W++Y +   + AH +
Sbjct  127  HPLALIYKAPCPKDHIFTCDVCD-ETMPHNLWLYYCQKCDYGAHLH  171



>ref|XP_004229343.2| PREDICTED: uncharacterized protein LOC101249296 [Solanum lycopersicum]
Length=530

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 9/166 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLP--ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L Q     +    C+ C  P   +   +GC  C +F+H++ C +    + H+S
Sbjct  295  HFSHQHVLKQIVNPTELTLTCNACEKPNNTNKPFYGCNTCQYFLHEN-CFNAPRILIHSS  353

Query  178  HPAHPLHLRPPS--FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            HP+HPL LR  S     ++IC+AC S  N   + C  C++D+H+ CA   +S T VD   
Sbjct  354  HPSHPLTLRQISSYVSGSYICNACGSGGNGFCFNCSDCEFDIHLQCASCPSS-TLVDKHT  412

Query  352  --MRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              + L+Y +P      C  C   ++    W +Y     F +H NC 
Sbjct  413  HQLELHYGYPEDNEYVCDICFVRMN-NDNWFYYCGGCDFASHLNCA  457


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 77/173 (45%), Gaps = 20/173 (12%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLP--ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L       +    C+ C  P   +   +GC  C +F+H++ C +    ++H S
Sbjct  17   HFSHQHALKLIVNPTETILTCNACEKPNNTNKPFYGCNTCQYFLHEN-CFNAPRFLNHAS  75

Query  178  HPAHPLHLRPP------SFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
            HP+HPL L P       SF+    C AC +  N   + C  C++D+H+ CA L  S   +
Sbjct  76   HPSHPLTLLPRATYSSCSFN----CKACDTVGNGFCFSCACCEFDIHLQCASL-QSLILI  130

Query  340  DGTLMRLYYSF-----PVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            D    +L  +F        +   C  C  EI  +  W++Y     F +H +C 
Sbjct  131  DKHPHQLELNFGSPYEDKDSEYVCDIC-SEIMNKENWLYYCGGCDFASHLHCA  182



>ref|XP_010544532.1| PREDICTED: diacylglycerol kinase theta-like [Tarenaya hassleriana]
Length=252

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 85/174 (49%), Gaps = 10/174 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGT-NCSICSLPISGL-AHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SHPHPL     + +DG+ +CS C L ++GL ++ C AC F +H+  C ++  +I H  
Sbjct  14   HFSHPHPLQFSASDPRDGSASCSACKLKLAGLPSYSCLACAFNLHEK-CAEMPRKIKHPF  72

Query  178  HPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTT--SDTAVDG  345
               H L L P P ++     CDAC    +   Y CG C  DLH  CA + +  S+ +   
Sbjct  73   DEIHLLTLIPLPRYEEGRFRCDACGKDGDGFSYHCGDCGIDLHTVCANMPSHVSNQSHPQ  132

Query  346  TLMRLYYSFP-VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKH  504
              +RL +S P    S  C  C G  S    W++   + GF AH  C +  + + 
Sbjct  133  HELRLTFSVPDSSGSFCCMICRGMGS--NSWLYRCNECGFNAHLICARKRVRQQ  184



>gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial [Erythranthe 
guttata]
Length=187

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 74/158 (47%), Gaps = 13/158 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPI-SGLAHGCEA--CDFFIHDDDCLDLKLQIHH  171
            +H SH HPL    +  +D   CS C   I SG A+ C    C+F +HD  C DL  +I H
Sbjct  28   SHFSHRHPLELSEVHEEDHAICSGCEHDIISGSAYICAKPKCNFLLHDL-CFDLPRRIRH  86

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
              HP HPL L   PP  D    CDAC    +   Y CG C +DLHV+CA L  ++   D 
Sbjct  87   RCHPKHPLSLFIAPPYSDREFTCDACGESGHGFTYHCGSCKFDLHVECAALPETENRPDH  146

Query  346  T-LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVW  441
               + L   F       G    C  C G ++  G W++
Sbjct  147  QHPLILVGGFDPEKMVDGVDSVCYVCGGPMA-EGRWIY  183



>ref|XP_010544531.1| PREDICTED: uncharacterized protein LOC104817156 [Tarenaya hassleriana]
Length=258

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 72/166 (43%), Gaps = 12/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H  H HPL  F  + +    CS C L + G A  C    CD+F+H   C +L  Q +H 
Sbjct  17   RHPGHTHPLRLFKAKDEHEVVCSGCELELVGPAFKCTKSECDYFLHKS-CFELPRQTYHK  75

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L   PP     + CDAC        Y C  C +D+HV C  L  +    D  
Sbjct  76   SHPDHPLTLVHSPPYSQSIYTCDACGEYGTGFTYSCSECQFDVHVGCVSLPETMERDDHE  135

Query  349  --LMRLY---YSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
              L  LY   Y   VG  V C  C  E      WV+Y K+  +  H
Sbjct  136  HPLTLLYCSPYKDNVGDFV-CDVCR-ETVPENFWVYYCKECDYGTH  179



>ref|XP_010514676.1| PREDICTED: uncharacterized protein LOC104790594 [Camelina sativa]
Length=253

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 75/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     +++D   CS C L + G +  C    CD+F+H   C +L  +I H 
Sbjct  13   RHPSHNHPLRGHKAQVEDEIICSGCDLDLIGASFKCTKSECDYFLHKT-CFELPREIRHK  71

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SH  HPL L   P +    + CDAC    +   Y C IC YD+HV C  +  T       
Sbjct  72   SHADHPLTLLYSPQNNQSTYTCDACGEYGSGFTYNCSICHYDVHVGCVSMPETMKHDEHA  131

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
             TL+ LY +  P G    C  C  E      W+ Y +   + AH +
Sbjct  132  HTLVLLYSTPCPKGHIFTCDVCQ-ETMPDNLWLHYCQKCDYGAHLH  176



>ref|XP_010489404.1| PREDICTED: uncharacterized protein LOC104767077 [Camelina sativa]
Length=253

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 75/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     +++D   CS C L + G +  C    CD+F+H   C +L  +I H 
Sbjct  13   RHPSHNHPLRGHKAQVEDEIICSGCDLDLIGASFKCTKSECDYFLHKT-CFELPREIRHK  71

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SH  HPL L   P +    + CDAC    +   Y C IC YD+HV C  +  T       
Sbjct  72   SHADHPLTLLYSPQNNQSTYTCDACGEYGSGFTYNCSICHYDVHVGCVSMPETMKHDEHA  131

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
             TL+ LY +  P G    C  C  E      W+ Y +   + AH +
Sbjct  132  HTLVLLYSAPCPKGHIFTCDVCQ-ETMPDNLWLHYCQKCDYGAHLH  176



>ref|XP_010467568.1| PREDICTED: uncharacterized protein LOC104747605 isoform X1 [Camelina 
sativa]
Length=251

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 74/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     +++D   CS C L + G +  C    CD+ +H   C +L  +I H 
Sbjct  13   RHPSHNHPLRSHKAQVEDEIICSGCDLDLIGASFKCTKSECDYSLHKT-CFELSREIRHK  71

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   P +    + CDAC    +   Y C +C YD+HV C  +  T       
Sbjct  72   SHPDHPLTLLHSPQNNQSTYTCDACGEYGSGFTYNCSLCQYDVHVGCVSMPETMKHDEHA  131

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
             TL  LY +  P G    C  C  E      W+ Y +   + AH +
Sbjct  132  HTLALLYSTPCPKGHIFTCDVCQ-ETMPDNLWLHYCQKCDYGAHLH  176



>gb|AEI52549.1| cysteine/histidine-rich DC1 domain protein [Capsicum annuum]
Length=233

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 77/172 (45%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHT  174
             H SHPH L    ++  + T CS C   + G ++ C    C+F +H   C +L  +I H 
Sbjct  2    KHFSHPHALELSEVQQSNETVCSGCENKLCGTSYKCTKPNCEFSLHKS-CFELPRKIQHN  60

Query  175  SHPAHPLHLRP--PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV----LTTSDT  333
            SH  HPL L P  P  D  +  C+AC       +Y C  C++ LH  CA       T + 
Sbjct  61   SHLKHPLTLYPTLPQRDSMYFGCNACGEEPKCFVYECLECNFSLHAKCATSWPEYVTRED  120

Query  334  AVDGTLMRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                 +++  + FP+    +++C+ CNG +     W++Y        H  C 
Sbjct  121  HQHSLVLQYQWPFPIYDYVNIFCEVCNG-LCNDANWLYYCAQCKLGTHLQCA  171



>ref|XP_002522096.1| protein binding protein, putative [Ricinus communis]
 gb|EEF40296.1| protein binding protein, putative [Ricinus communis]
Length=240

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 83/174 (48%), Gaps = 15/174 (9%)
 Frame = +1

Query  1    NHASHPHPL--YQFNLEIQDGTNCSICSLPISGL--AHGCEACDFFIHDDDCLDLKLQIH  168
             H SH H L  + FN ++     C  C+  I     +HGC +C  F+HD  CL+L   + 
Sbjct  4    QHFSHKHFLIPHHFNDDVDQEIKCKACNRLIIATEPSHGCLSCKHFLHDQ-CLNLPRWLQ  62

Query  169  HTSHPAHPLHLRPPSFDP--NHICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDTAV  339
            H SH +H L L P    P  ++ C+AC  P  +   + C  C++DLH +CA L  S   +
Sbjct  63   HPSHHSHTLTLLPAPTYPCGSYSCNACGIPGGSSFSFSCAQCEFDLHTNCATL-PSTVLI  121

Query  340  DG---TLMRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
            D     L   + +FP     S+ C  CN E+  +  W++     GF  H NC K
Sbjct  122  DAHSHELTLTFDNFPSDGNISIVCDVCN-ELVNKSFWMYKCVGCGFDCHLNCVK  174



>ref|XP_006359175.1| PREDICTED: uncharacterized protein LOC102603106 [Solanum tuberosum]
Length=191

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 80/181 (44%), Gaps = 17/181 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFN--LEIQDGTNCSICSLPISGL-AHGCEA--CDFFIHDDDCLDLKLQI  165
            +H SH HPL + +  L+ +D   CS C   +S   A+ C    C+F +HD  C DL  QI
Sbjct  10   SHFSHGHPLIKISDILDEEDQVICSGCEHHLSSEPAYMCTKINCNFILHDS-CFDLPRQI  68

Query  166  HHTSHPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
             H SHP H L LR  PP  D    CDAC +  N   + C  C +DLHV+CA L   +   
Sbjct  69   KHKSHPKHTLSLRFFPPYNDGEFTCDACGNSGNAFTFHCDKCKFDLHVECASLPEIEERE  128

Query  340  DG--------TLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVI  495
            D             L+    V   V C  C   +  +  W +        AH +  K VI
Sbjct  129  DHQHPLTLCYNSSNLFVGKEVEVDVMCYVCKNGVG-KSCWFYCCLACKCGAHLDSIKYVI  187

Query  496  L  498
            +
Sbjct  188  I  188



>gb|EYU27132.1| hypothetical protein MIMGU_mgv1a025339mg [Erythranthe guttata]
Length=177

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 75/170 (44%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    NHASHPHPLY-----QFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQI  165
            +H SHPHPL      Q   E+   ++C  C+L  SG+ + C  C+F +H   C ++   I
Sbjct  6    HHFSHPHPLEIIICNQQTKELSPSSSCPGCNLKPSGVIYSCTICEFLLHKK-CFEMPKMI  64

Query  166  HHTSHPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-A  336
             H  H  HP  L P P++      CDAC    N   Y C  C  DLH+ CA L  + T A
Sbjct  65   THVGHKGHPFTLLPEPTYATGFFRCDACWGVGNGFSYHCRPCGMDLHLLCAALPLTITHA  124

Query  337  VDGTLMRLYYSFP-VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                 + L Y  P    +  C  C  +   +  W++     GF AH  C 
Sbjct  125  AHAHKLHLVYGSPYANKNFICDIC--KAFGQDHWLYRCGSCGFDAHLGCA  172



>ref|XP_006359183.1| PREDICTED: uncharacterized protein LOC102605804 [Solanum tuberosum]
Length=241

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 82/182 (45%), Gaps = 10/182 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLP--ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L +      +   C+ C  P   +   +GC  C +F+H++ C +    ++H+S
Sbjct  14   HFSHDHIL-KLIANPTETLTCNACEQPNNTNKPFYGCNTCQYFLHEN-CFNAPRILNHSS  71

Query  178  HPAHPL--HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-  348
            HP+HPL  H  P     ++ C+AC S  N   Y C  CD+D+H+ CA   +S      T 
Sbjct  72   HPSHPLTLHQIPSYTSGSYFCNACGSVGNGFCYNCADCDFDIHLQCASCPSSILVDKHTH  131

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFLRPL  528
             + + Y +P  +   C  C   +     W +Y     F +H NC   +I      F + L
Sbjct  132  QLEIQYGYPKDSEYVCDIC-SVMMNNDNWFYYCGGCDFASHLNCA--IISPEVGVFPKQL  188

Query  529  MR  534
             R
Sbjct  189  QR  190



>ref|XP_006359182.1| PREDICTED: uncharacterized protein LOC102605462 [Solanum tuberosum]
Length=393

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 13/171 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L +  L+  +   C  C   I    HGC +C+F++H D+CL+    + H SH
Sbjct  7    QHFSHHHILKKLVLDENEELQCQACEKFIFEPFHGCISCNFYLH-DNCLNAPRSLVHPSH  65

Query  181  PAHPLHLRP-PSFD-PNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL-  351
             +HPL L P P++   +  C+AC S   +    C  C++DLHV CAVL  +   +D    
Sbjct  66   LSHPLTLLPTPTYSCRSFTCNACGSEGRSCSLSCAHCEFDLHVQCAVLPQT-VLLDQHQH  124

Query  352  --MRLYYSFPVGAS-----VWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              ++L +    G         C  CNG++     W++Y  D  F  H  C 
Sbjct  125  HELKLIFDSSFGDEDESFIFVCDFCNGKV-EENSWLYYCADCDFGTHIECS  174



>ref|XP_010322058.1| PREDICTED: uncharacterized protein LOC104647902 [Solanum lycopersicum]
Length=397

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 79/170 (46%), Gaps = 11/170 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L +  L+  +   C  C   I    HGC +C+F++H D+CL+    + H SH
Sbjct  7    QHFSHHHILRKLVLDENEELQCQACENSIFVPFHGCISCNFYLH-DNCLNAPRSLIHPSH  65

Query  181  PAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL-  351
            P+HPL L P P++      C+AC S   +    C  C++DLH+ CA+L  +         
Sbjct  66   PSHPLTLLPTPTYSTRSFTCNACGSEGRSCSLSCAHCEFDLHMQCALLPQTVLLPQHHYH  125

Query  352  -MRLYYSFPVGAS-----VWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             ++L +    G         C  CNG++     W++Y  D  F  H  C 
Sbjct  126  ELKLIFDSSFGDEDESCIFVCDLCNGKV-EHNSWLYYCADCDFGTHIECS  174



>ref|XP_009774519.1| PREDICTED: uncharacterized protein LOC104224534 [Nicotiana sylvestris]
Length=247

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 82/170 (48%), Gaps = 12/170 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHHT  174
             H SHPH L   N    +   C+ C  P +     +GC +C +F+H++ C +    ++H+
Sbjct  16   QHFSHPHILKPVNPTEAETLTCNACEKPSNRNKPFYGCNSCQYFLHEN-CFNAPRFLNHS  74

Query  175  SHPAHPLHLRP-PSFDP-NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG-  345
            SHP+HPL L P P++   ++ C AC S  N   + C  C++D+H+ CA   +S   VD  
Sbjct  75   SHPSHPLTLLPMPTYSSRSYTCKACGSAGNGSCFSCACCEFDIHLQCASCPSS-IIVDKH  133

Query  346  -TLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
               + L++  P         C  CN  I  R  W++Y     F +H  C 
Sbjct  134  PHQLGLHFGSPYQDKNIEYVCDICN-VIMNRESWLYYCACCDFGSHLQCA  182



>ref|XP_010659603.1| PREDICTED: uncharacterized protein LOC100244183 [Vitis vinifera]
Length=335

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 67/155 (43%), Gaps = 11/155 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL    ++ +DG  CS C L +SG A+ C    CDF +H D C  L   I   
Sbjct  5    KHFSHKHPLCHAEVKEEDGFVCSGCELGLSGSAYKCTISNCDFLLH-DSCFKLAPVIKQR  63

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA----  336
            SHP HPL L   PP  D    C+ACL   +  +Y C  C +DLHV    +     A    
Sbjct  64   SHPHHPLTLLPSPPYDDSGFTCEACLYYGHAFVYHCAACQFDLHVRQLSMKAQKIAYVVT  123

Query  337  --VDGTLMRLYYSFPVGASVWCKKCNGEISRRGGW  435
              V  T     Y+F +   +  K    E      +
Sbjct  124  HCVIATTCIYVYTFSLQEMIHYKITQREKREMANY  158


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 68/161 (42%), Gaps = 19/161 (12%)
 Frame = +1

Query  25   LYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHL-  201
            +Y +   +Q+  +  I       +A      ++F H    L  ++ I H SHP HPL L 
Sbjct  132  IYVYTFSLQEMIHYKITQREKREMA------NYFNHHHPPLPQQV-IQHKSHPWHPLILL  184

Query  202  -RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG------TLMRL  360
              PP +     CDAC    +   Y C  C YDLHV CA L   +T + G      TL   
Sbjct  185  STPPYYGGGFTCDACRHGGHDFTYHCPTCHYDLHVGCASL--PETVIRGDHQHPLTLFYC  242

Query  361  YYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             Y    G +  C  C+G +   G W++Y K   +  H  C 
Sbjct  243  GYK-EEGNTFICDVCHGNVP-DGCWIYYCKSCDYGTHLGCA  281



>pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana
Length=457

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 56/109 (51%), Gaps = 5/109 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHTS  177
            H SH HPL     +++D   CS C L + G    C    CD+F+H   C DL  +I H S
Sbjct  218  HPSHNHPLRGHKAQVEDEIICSGCDLDLLGAYFKCTKSECDYFLHKS-CFDLPREIRHKS  276

Query  178  HPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
            HP HPL L   P + +  + CDAC    +   Y C IC YD+HV C  +
Sbjct  277  HPDHPLILLYSPQNNNSTYTCDACGEYGSGFTYNCSICQYDVHVGCVSV  325



>ref|XP_011075259.1| PREDICTED: uncharacterized protein LOC105159772 [Sesamum indicum]
Length=239

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 79/168 (47%), Gaps = 9/168 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L  + ++      C  C LP +     C  C+FF+H D C +    + H SH
Sbjct  4    KHFSHPHTLTLYKVQPGQQFQCHGCHLPCNDSVFACWRCNFFLH-DHCGNANRYVKHPSH  62

Query  181  PAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
              HPL L P P++   + +C+AC  P +T  Y C +C+ DLHV CA L     +  G   
Sbjct  63   SLHPLVLVPSPTYCSGSFLCNACGGPGSTFSYCCALCEVDLHVHCAYL-PPKVSHKGHQH  121

Query  355  RLYYSF----PVGASVWCKKCNGEISRRGGWVWYDK-DTGFTAHFNCG  483
             +  +F      G+  +CK C  E+S R    + DK +  F  H  C 
Sbjct  122  EVCLNFRPMDKKGSPEYCKICMKELSLRHWSYFCDKPECDFRVHTFCA  169



>ref|XP_004229360.1| PREDICTED: uncharacterized protein LOC101254632 [Solanum lycopersicum]
Length=248

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 81/169 (48%), Gaps = 13/169 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAH--GCEACDFFIHDDDCLDLKLQIHHTS  177
            H SHPH L    +   +   C+ C  P +   +  GC +C +F+HD+ C D    ++H S
Sbjct  17   HFSHPHILKPI-VNRHETLTCNACEQPNNNKPNFRGCNSCQYFLHDN-CFDAPRFLNHAS  74

Query  178  HPAHPLHL-RPPSFDPN-HICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG--  345
            HP+HPL L + PS+    + C AC S  N   + C  C++D+H+ CA   +S   VD   
Sbjct  75   HPSHPLTLHQIPSYSSRTYTCKACNSAGNAFCFSCAACEFDIHLQCASCPSS-ILVDKHP  133

Query  346  TLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              + L++  P         C  CN EI  +  W++Y     F +H  C 
Sbjct  134  HQLGLHFGSPYEDKNMEYVCDICN-EIMNKNDWLYYCAGCDFGSHLRCA  181



>ref|XP_010322098.1| PREDICTED: uncharacterized protein LOC104647934 [Solanum lycopersicum]
Length=193

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 78/175 (45%), Gaps = 17/175 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFN--LEIQDGTNCSICSLPIS-GLAHGCEA--CDFFIHDDDCLDLKLQI  165
            +H +H HPL + +  L+ +D   CS C   +S G A+ C    C+F +HD  C DL  QI
Sbjct  10   SHFTHRHPLIKISDILDEEDQVICSGCEHDLSSGPAYTCTKLNCNFILHDS-CFDLPRQI  68

Query  166  HHTSHPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
             H SHP H L LR  PP  D    CDAC +  +   + C  C +DLHV+CA L   +   
Sbjct  69   KHKSHPKHALSLRFFPPYNDGEFTCDACGNSGHAFTFHCDKCKFDLHVECASLPEIEERE  128

Query  340  DG--------TLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
            D             L+    V   V C  C   +  +  W +        AH +C
Sbjct  129  DHQHPLTLCYNSSNLFIGKEVEVDVMCYVCKNGVG-KSCWFYCCLACKCGAHLDC  182



>ref|XP_009596187.1| PREDICTED: uncharacterized protein LOC104092315 [Nicotiana tomentosiformis]
Length=256

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA---HGCEACDFFIHDDDCLDLKLQIHH  171
             H SHPH L   N    +  +C+ C  P +      +GC +C +F+H++ CL+    + H
Sbjct  15   QHFSHPHNLKLVNPTESETLSCNACEKPNNNNKPNFYGCNSCQYFLHEN-CLNAPRFLDH  73

Query  172  TSHPAHPLHLRP-PSFDP-NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
            +SHP+HPL+L P P++   ++ C AC S  N   + C  C++D+H+ CA   +S   VD 
Sbjct  74   SSHPSHPLNLFPIPTYSSRSYTCKACGSNGNGFCFSCACCEFDIHLQCASCPSS-ILVDK  132

Query  346  --TLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
                + L +  P      +  C  CN  I  R  W++Y     F +H  C  
Sbjct  133  HPHQLELLFGSPYDDKDITYVCDICN-VIMNRDSWLYYCAGCDFASHLQCAS  183



>ref|XP_002325342.1| DC1 domain-containing family protein [Populus trichocarpa]
 gb|EEE99723.1| DC1 domain-containing family protein [Populus trichocarpa]
Length=838

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +1

Query  19   HPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLH  198
            H L  FN + +    C+ C L +SG A+GC  C+F++H+  C D+  +I H  HP HPL 
Sbjct  152  HLLVSFNAKQEVEKTCTGCQLLLSGPAYGCLDCEFYLHES-CKDMPSEIQHPYHPPHPLR  210

Query  199  LRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA---VLTTSDTAVDGTLMRLYY  366
             +   +     CDAC  P     YRC  CD++LH+ CA   +   S     G    LYY
Sbjct  211  AQVAEYGSE--CDACHMPIRKVFYRCSECDFNLHILCANKSLQVASSLKHKGHEHNLYY  267


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 50/105 (48%), Gaps = 2/105 (2%)
 Frame = +1

Query  13   HPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHP  192
            H H L + N        C +C + ISG  + C  C+FF+H + CL+   +I H  H  HP
Sbjct  548  HKHKLTRANCAKGIKEKCKVCQVRISGATYCCINCNFFLH-ESCLETPQEIQHQYHLQHP  606

Query  193  LHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
            L  R    +P + C AC        Y C IC++ LH  CA   TS
Sbjct  607  LLGRDFDGNPKN-CRACNLQIWDIAYYCDICEFALHFTCATYLTS  650



>emb|CDP07681.1| unnamed protein product [Coffea canephora]
Length=199

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 82/188 (44%), Gaps = 30/188 (16%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPISGLAHGCE--ACDFFIHDDDCLDLKLQI  165
            +H SH HPL    +E +D      CS C + I G A+ C   +CDF +H   C+DL  ++
Sbjct  12   SHFSHRHPLELVEVEEEDDDQVNICSGCEVQILGSAYNCTKPSCDFILHHS-CIDLPRKV  70

Query  166  HHTSHPAHPL--HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
             H SHP HPL  H  PP  D    C+AC +P +   Y C  C YDLHV+CA L   +   
Sbjct  71   KHNSHPKHPLILHFFPPYGDGEFTCNACGNPGHGFTYHCMSCKYDLHVECASLPEVEYHE  130

Query  340  DGTL-MRLYYSFPVGASV--------------------WCKKCNGEISRRGGWVWYDKDT  456
            D      L YSF +                         C  C+G +  +G W +     
Sbjct  131  DHEHPFVLSYSFRLQNKAEGKGKGKGKAVAEEAELKDFECYVCHGPV-EKGCWAYSCSSC  189

Query  457  GFTAHFNC  480
             + AH  C
Sbjct  190  YYCAHLEC  197



>ref|XP_009765121.1| PREDICTED: uncharacterized protein LOC104216701 [Nicotiana sylvestris]
Length=331

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 80/165 (48%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L +  +++QD + CS C LP  G  + C+ C+F +H   C      I H SH
Sbjct  15   RHFSHPHEL-ELCIQLQDLSPCSGCRLPPLGQMYICKPCNFTLHLS-CAKFPQLITHPSH  72

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTL  351
            P HPL+L P S  P     CDAC    +   Y CG C++DLHV CA      T  +   L
Sbjct  73   PNHPLNLLPTSKYPGGRFNCDACNHRGDGFSYHCGSCEFDLHVICATRPLKITHQLHQCL  132

Query  352  MRLYYSFP-VGASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
            + L +  P  GA  + C  C    +++  W++      F  H +C
Sbjct  133  LELTFKNPYTGAKGFSCDVCRKIGTKQ--WLYRCPACEFDVHLDC  175



>ref|XP_009143017.1| PREDICTED: uncharacterized protein LOC103866789 [Brassica rapa]
Length=242

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 74/165 (45%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     + ++   CS C L + G A  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHNHPLRSHKAQAEEEIICSGCDLDLIGAAFKCTKSECDYFLHKS-CFELPRENRHK  67

Query  175  SHPAHPLHL-RPPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   P+++ +   CDAC    +   Y C IC YD+HV C  +  T       
Sbjct  68   SHPEHPLTLLYSPTYESSAFACDACGEYGSGFSYNCSICKYDVHVGCVSMPETVEREGHA  127

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
              L  LY S +  G    C +C+  +     W +Y K   +  H 
Sbjct  128  HPLTLLYRSPYQKGLIFNCDECHDTVP-DNLWSYYCKKCDYGTHL  171



>ref|XP_006359155.1| PREDICTED: uncharacterized protein LOC102596695 [Solanum tuberosum]
Length=260

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 81/169 (48%), Gaps = 13/169 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L +  +   +  NC+ C  P +     +GC  C +F+HD+ C +    I+H+S
Sbjct  17   HFSHSHIL-KLIMNPTETLNCNACEKPNNSHTPFYGCNTCQYFLHDN-CFNAPRFINHSS  74

Query  178  HPAHPL--HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            HP+HPL  H  P     ++ C AC S  N   + C  C++D+H+ CA  + S   V+  L
Sbjct  75   HPSHPLTLHQIPSYSSRSYTCKACGSAGNGFCFSCAACEFDIHLQCAS-SPSSILVNSHL  133

Query  352  --MRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              + L++  P         C  CN  I  R  W++Y     F +H +C 
Sbjct  134  HQLELHFGSPYEDKNIKYNCDMCN-VIMNRDDWLYYCAGCDFGSHLHCA  181



>ref|XP_008246270.1| PREDICTED: probable nucleoredoxin 1, partial [Prunus mume]
Length=120

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 57/115 (50%), Gaps = 10/115 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGL------AHGC--EACDFFIHDDDCLDLK  156
             H SH H L  + ++  D   CS C LP+  +      A+ C    C+F++HD  C +L 
Sbjct  3    KHFSHRHELCSYQVQEDDEITCSGCELPLDLMMNSATSAYKCTKSKCNFYLHDL-CFELP  61

Query  157  LQIHHTSHPAHPLHLRPPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVL  318
             +I H SHP HPL L  P ++     CDAC        + C  C YDLHV CA L
Sbjct  62   QEIKHKSHPKHPLTLSTPPYEYGEFTCDACGEFGTCFTFHCTHCKYDLHVQCATL  116



>gb|KFK37245.1| hypothetical protein AALP_AA4G232600 [Arabis alpina]
Length=250

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     + ++   CS C L + G +  C    C++F+H   C +L  +  H 
Sbjct  9    RHQSHSHPLRGHKAQAEEEIICSGCELDLIGASFKCTKSECEYFLHKS-CFELPRENRHK  67

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
            +HP HPL L   PP     + C+AC    +  +Y C IC YD+HV C  +  S
Sbjct  68   AHPDHPLTLLFSPPYESSTYTCNACGEYGSGFVYNCSICQYDVHVGCVAMHES  120



>gb|EYU27121.1| hypothetical protein MIMGU_mgv1a025457mg [Erythranthe guttata]
Length=366

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 79/169 (47%), Gaps = 15/169 (9%)
 Frame = +1

Query  1    NHASHPHPL--YQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            +H SHPHPL    +N  +     C+ C L   G+ + C  CD+F+H   C +++ +I H 
Sbjct  12   SHFSHPHPLKLIVYNQTLNILFPCAGCKLKPYGVLYSCLDCDYFLHQS-CFEMRKKITHP  70

Query  175  SHPAHPLHLRPPSFDPNH--ICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
             H  H L L     +P +  +CDAC        Y C  C +DLH+ CA+L  S T     
Sbjct  71   LHKKHDLTLM---INPAYRLVCDACGETGKGFSYHCKPCSFDLHILCAMLPLSVTHESHK  127

Query  349  LMRLYY----SFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            + +L      S+PV     C  C    SR+  W++  K  GF AH  C 
Sbjct  128  MHKLNLTSESSYPVN-KFSCDICLSVGSRQ--WLYRCKSCGFDAHLKCA  173



>emb|CDY23430.1| BnaC04g49580D [Brassica napus]
Length=248

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 72/166 (43%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL       ++   CS C L + G A  C    CD+F+H   C DL  +  H 
Sbjct  9    RHPSHNHPLRGHKALAEEEIICSGCDLDLIGAAFKCTKSECDYFLHKS-CFDLPRETRHK  67

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   PP     + C AC    +  +Y C IC +DLHV C  +  +      +
Sbjct  68   SHPDHPLTLLYSPPYDSSTYECSACSEYGSGFVYNCSICHFDLHVGCISMPESVEREGHE  127

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
              L  LY S +  G    C  C   +     W +Y K+  +  H +
Sbjct  128  HPLTLLYCSPYTNGLIFNCDVCQETVPDH-LWSYYCKECDYGTHLH  172



>gb|EYU27139.1| hypothetical protein MIMGU_mgv1a018142mg, partial [Erythranthe 
guttata]
Length=408

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 75/167 (45%), Gaps = 11/167 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHTS  177
            H SHPH L    ++ ++   CS C + ++G A+ C    C+F +H   C D  L++ H S
Sbjct  229  HFSHPHGLKGMEIKKKNAKVCSACEIELNGAAYCCTESQCNFNLH-KTCFDAPLKLRHKS  287

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGIC-DYDLHVDCAVLTTSDTAVDGT-L  351
            HP HPL L P   +    CDAC+      +Y C  C +  LH++CA              
Sbjct  288  HPEHPLTLLPYG-EGYFTCDACMKEGKAFVYTCTTCSNVRLHINCAQRPEKMVCPGHKHT  346

Query  352  MRLYYSFPVGA----SVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
            + LYYS    A    +  C  C   I     WV+Y +   F  H +C
Sbjct  347  LTLYYSSRAAANREVTFTCDVCMSLIDEM-AWVYYCRKCDFGTHLDC  392



>emb|CDY17855.1| BnaC04g03640D [Brassica napus]
Length=242

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 74/165 (45%), Gaps = 9/165 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     + ++   CS C L + G A  C    CD+F+H   C +L  +  H 
Sbjct  9    RHPSHNHPLRSHKAQAEEEIICSGCDLDLIGAAFKCTKSECDYFLHKS-CFELPRENCHK  67

Query  175  SHPAHPLHL-RPPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVD  342
            SHP HPL L   P+++ +   CDAC    +   Y C IC YD+HV C  +  T       
Sbjct  68   SHPEHPLTLLYSPTYESSSFACDACGEYGSGFSYNCSICKYDVHVGCVSMPETVEREGHA  127

Query  343  GTLMRLYYS-FPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
              L  LY S +  G    C +C+  +     W +Y K   +  H 
Sbjct  128  HPLTLLYRSPYQNGLIFNCDECHDNVP-DNLWSYYCKKCDYGTHL  171



>ref|XP_002275658.1| PREDICTED: uncharacterized protein LOC100258837 [Vitis vinifera]
Length=252

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 3/108 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H +H H L  F L+  +G +CS C    S  A+ C  CDFF+H  +C +    + H SH
Sbjct  4    KHFNHEHNLAIFELQAGNGIHCSGCRTLCSNSAYACWKCDFFLH-LECGNANRAMEHPSH  62

Query  181  PAHPLHLRP-PSFDP-NHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
              H L L P P++   + +C+AC +P ++  Y C +C++DLH+ CA+L
Sbjct  63   ELHHLTLVPYPTYSAGSFVCNACGAPGSSFSYCCSLCEFDLHIRCALL  110



>ref|XP_010435990.1| PREDICTED: uncharacterized protein LOC104719723 [Camelina sativa]
Length=233

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 72/166 (43%), Gaps = 12/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C DL  + +H
Sbjct  8    RHPSHNHPLRGHKCEAKDEIICSGCDLDLVGAAFKCTKSSDCDYFLHKS-CFDLPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-  342
             SH +H L L   P S    + C+AC    ++  Y C  C YD+HV C  +  +    D 
Sbjct  67   KSHQSHTLTLLYSPKS---TYTCNACGEYGSSFTYNCSACQYDVHVGCVSMPETVKREDH  123

Query  343  GTLMRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHF  474
               + L Y  P        KC+   +I     W +Y K+  +  H 
Sbjct  124  AHPLTLLYRSPYNQPGLVSKCDVCEDIVPDNIWSYYCKECDYATHL  169



>ref|XP_009596216.1| PREDICTED: uncharacterized protein LOC104092334 [Nicotiana tomentosiformis]
Length=251

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 82/171 (48%), Gaps = 13/171 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHHT  174
             H SHPH L   N    +   C+ C  P +     +GC +C +F+H++ C +    ++H+
Sbjct  13   QHFSHPHVLKPVNPAEVETLTCNACEKPSNSNKPFYGCNSCQYFLHEN-CSNAPRFLNHS  71

Query  175  SHPAHPLHLRP-PSFDP-NHICDACLSPANT-PLYRCGICDYDLHVDCAVLTTSDTAVDG  345
            SHP+HPL L P P++   ++ C+AC S  N    + C  C++D+H+ CA   +S   VD 
Sbjct  72   SHPSHPLTLLPIPTYSSRSYTCNACGSAGNIGSCFSCACCEFDIHLQCASCPSS-LLVDK  130

Query  346  --TLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                + L +  P         C  CN  I  R  W++Y     F +H  C 
Sbjct  131  HPHQLGLLFGSPYQDKNTEYVCDICNV-IMNRESWLYYCAGCDFASHLQCA  180



>ref|XP_009614686.1| PREDICTED: uncharacterized protein LOC104107555 isoform X2 [Nicotiana 
tomentosiformis]
Length=255

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 80/186 (43%), Gaps = 18/186 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L +   ++Q+ T CS C LP     + C+ C+F +H   C     QI H SH
Sbjct  15   KHFSHPHEL-ELCTQLQNPTPCSGCKLPPLAQMYMCKPCNFTLHLS-CTQFPEQISHPSH  72

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTL  351
            P HPL L P S  P  +  CDAC    +   Y C  C+YDLHV CA      T  +    
Sbjct  73   PDHPLALLPTSKYPGGLFNCDACNHRGDGFSYHCSDCEYDLHVICASRPLKITHQLHQCQ  132

Query  352  MRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK---------PVIL  498
            + L +  P        C  C+    ++  W++      F  H +C           P IL
Sbjct  133  LELTFKNPYTDAKGFSCDVCHKIGVKQ--WLYRCSSCDFDVHLDCSTSASISAVQGPTIL  190

Query  499  KHQPCF  516
            +H   F
Sbjct  191  QHHHSF  196


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 77/177 (44%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            +H SHP HPL         G   NC  C+    G ++ C  C++ +H   C    L+I H
Sbjct  68   SHPSHPDHPLALLPTSKYPGGLFNCDACNHRGDGFSYHCSDCEYDLHVI-CASRPLKITH  126

Query  172  TSHPAH-PLHLRPPSFDPNHI-CDACLSPANTP-LYRCGICDYDLHVDCAVLTTSDTAVD  342
              H     L  + P  D     CD C        LYRC  CD+D+H+DC+  + S +AV 
Sbjct  127  QLHQCQLELTFKNPYTDAKGFSCDVCHKIGVKQWLYRCSSCDFDVHLDCST-SASISAVQ  185

Query  343  G-TLMRLYYSFPVGASV--WCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKH  504
            G T+++ ++SFP   S     ++       R     +   TG T + +   P+   H
Sbjct  186  GPTILQHHHSFPGATSSHNQFQQAPMAAQMRPNQFMHSASTGATGNQSPQTPIFTGH  242



>ref|XP_009619361.1| PREDICTED: uncharacterized protein LOC104111386 [Nicotiana tomentosiformis]
Length=331

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 78/165 (47%), Gaps = 11/165 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPH L +   ++QD + CS C LP  G  + C  C+F +H   C      I H SHP
Sbjct  16   HFSHPHEL-ELCTQLQDLSPCSGCRLPPLGQMYICNPCNFTLHLS-CAKFPQLITHPSHP  73

Query  184  AHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTLM  354
             HPL+L P S  P     CDAC    +   Y CG C++DLHV CA      T  +   L+
Sbjct  74   NHPLNLLPTSKYPGGRFNCDACNHRGDGFSYHCGNCEFDLHVICATRPLKITHQLHQCLL  133

Query  355  RLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC  480
             L +  P   +   K  + ++ R+ G   W++      F  H +C
Sbjct  134  ELTFKNPYTGT---KGFSCDVCRKIGTKQWLYRCPACEFDVHLDC  175



>ref|XP_004136731.1| PREDICTED: uncharacterized protein LOC101202742 [Cucumis sativus]
 ref|XP_004163933.1| PREDICTED: uncharacterized LOC101202742 [Cucumis sativus]
 gb|KGN59292.1| hypothetical protein Csa_3G806240 [Cucumis sativus]
Length=253

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 81/168 (48%), Gaps = 13/168 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN----CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SH H L  + ++ +D TN    CS C     GL +GC++C+FF+H+  C      + 
Sbjct  5    KHFSHLHDLKLYQIQ-EDQTNQQFRCSGCYSLCHGLVYGCQSCEFFLHEA-CATAPRSLQ  62

Query  169  HTSHPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS-DTAV  339
            H SHP+H L L P P++ D + +C+AC +  ++  + C  CD DLHVDC +L    D   
Sbjct  63   HPSHPSHHLTLLPSPTYPDGSFLCNACGATGSSFCFSCIPCDIDLHVDCGLLPQQLDLES  122

Query  340  DGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                + L +S P   S  C  C   I  R  W +      F  H  C 
Sbjct  123  HRHTLSLLFSPP---SSICNLCRRAIDSR-YWSYSCSTCNFDIHTYCA  166



>gb|EYU27138.1| hypothetical protein MIMGU_mgv1a019574mg, partial [Erythranthe 
guttata]
Length=120

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 60/118 (51%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN--CSICSLPISG-LAHGCEACDFFIHDDDCLDLKLQIHH  171
             H SHPH L+  +  +    N  C  C LP+SG   +GC AC+F++H   C D     + 
Sbjct  2    QHFSHPHQLHDVSTTVSHNKNLPCFGCKLPLSGGTCYGCSACNFYLHKF-CFDHPQSAYF  60

Query  172  T-SHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD  342
              SHP H + L  P +    +CDAC  P N   Y C +C++++H +CA    +D   D
Sbjct  61   VDSHPKHTVGLLYPPYCQGAVCDACSEPCNGFTYNCTLCEFNVHANCAAFLHADPNND  118



>ref|XP_010441210.1| PREDICTED: uncharacterized protein LOC104724421 [Camelina sativa]
Length=233

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 72/166 (43%), Gaps = 12/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C DL  + +H
Sbjct  8    RHPSHNHPLRGHKCETKDEIICSGCDLDLVGAAFKCTKSADCDYFLHKS-CFDLPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-  342
             SH +H L L   P S    + C+AC    ++  Y C  C YD+HV C  +  +    D 
Sbjct  67   KSHQSHTLTLLYSPKS---TYTCNACGEYGSSFTYNCSACQYDVHVGCVSMPETVKREDH  123

Query  343  GTLMRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHF  474
               + L Y  P        KC+   +I     W +Y K+  +  H 
Sbjct  124  AHPLTLLYRSPYNQPGLDSKCDVCEDIVPDNIWSYYCKECDYATHL  169



>ref|NP_198875.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB08529.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAR20760.1| At5g40590 [Arabidopsis thaliana]
 gb|AAR24755.1| At5g40590 [Arabidopsis thaliana]
 gb|AED94570.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=234

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 72/166 (43%), Gaps = 12/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C +L  + +H
Sbjct  8    RHPSHNHPLRGHKCEAKDEIICSGCDLDLVGAAFKCTKSSDCDYFLHKS-CFELPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
             SH  H L L   P S    + C+AC    ++  Y C IC YD+HV C  +  +    D 
Sbjct  67   KSHQPHTLTLIYSPKS---TYTCNACGEYGSSFTYNCSICQYDVHVGCVSMPETVKREDH  123

Query  346  TL-MRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHF  474
               + L Y  P        KC+   +I     W +Y K+  +  H 
Sbjct  124  PHPLTLLYGSPYNQPGLVSKCDVCEDIVPDNLWSYYCKECDYATHL  169



>ref|XP_010450640.1| PREDICTED: uncharacterized protein LOC104732759 [Camelina sativa]
Length=233

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 72/166 (43%), Gaps = 12/166 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C DL  + +H
Sbjct  8    RHPSHNHPLRGHKCEAKDEIICSGCDLDLVGAAFKCTKSSDCDYFLHKS-CFDLPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-  342
             SH +H L L   P S    + C+AC    ++  Y C  C YD+HV C  +  +    D 
Sbjct  67   KSHQSHTLTLLYSPKS---TYTCNACGEYGSSFTYNCSACQYDVHVGCVSMPETVKREDH  123

Query  343  GTLMRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHF  474
               + L Y  P        KC+   +I     W +Y K+  +  H 
Sbjct  124  AHPLTLLYRSPYNQPGLDSKCDVCEDIVPDNIWSYYCKECDYATHL  169



>ref|XP_008443040.1| PREDICTED: uncharacterized protein LOC103486755 [Cucumis melo]
Length=254

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 81/169 (48%), Gaps = 14/169 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN----CSIC-SLPISGLAHGCEACDFFIHDDDCLDLKLQI  165
             H SH H L  + ++ +D TN    CS C SL   GL +GC++C+FF+H+  C      +
Sbjct  5    KHFSHLHDLELYQIQ-EDQTNQQFRCSGCESLCTHGLVYGCQSCEFFLHEA-CATAPRSL  62

Query  166  HHTSHPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS-DTA  336
             H SHP+H L L P P++ D + +C+AC +      + C  CD DLHVDC +L    D  
Sbjct  63   QHPSHPSHHLTLLPSPTYPDGSFLCNACGATGTAFCFSCIPCDIDLHVDCGLLPQQLDLE  122

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                 + L +S P   S  C  C   I  R  W +      F  H  C 
Sbjct  123  SHRHTLSLLFSPP---SSICNLCRRAIDSR-YWSYSCSTCNFDIHTYCA  167



>emb|CDP07680.1| unnamed protein product [Coffea canephora]
Length=439

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 77/174 (44%), Gaps = 15/174 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHT  174
             H SH H L   +++      CS C   ++G A+ C    C+F +H   C +L  +I H 
Sbjct  216  KHFSHQHALQLNDIKDTSPKVCSGCEDNLTGSAYSCVESQCNFHLHKS-CFELPREIRHK  274

Query  175  SHPAHPLHL--RPPSF--DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD  342
            SH  HPL L  +P S   D    C+ACL      +Y C  C +DLHV+C  L  S    D
Sbjct  275  SHLDHPLTLLAKPVSHYTDGQFACNACLQSGAAFVYNCESCSFDLHVECVSLPESIIRPD  334

Query  343  GT-LMRLYYSFPV------GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                ++L+YS PV        +  C  C   +     W++Y  +  F  H  C 
Sbjct  335  HKHPLKLFYSNPVPKEEGQQVTFVCDVCQKPV-HEIAWIYYCHECDFGTHLECA  387


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 73/158 (46%), Gaps = 9/158 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    L      +CS C  P SG  + C  C +F+H + C      + H SH
Sbjct  4    KHFSHVHGLVYQQLPQGTEVHCSGCKFPGSGCLYSCWQCSYFLH-EQCFQASRSLKHPSH  62

Query  181  PAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
            PAHPL L P P++  N   C+ C    N   Y C  CD+DLHV CA    + T +  TL 
Sbjct  63   PAHPLTLVPYPTYPSNSFYCNTCNLVGNGFSYCCSECDFDLHVHCA-FKPNATPLQATLS  121

Query  355  RL--YYSFP---VGASVWCKKCNGEISRRGGWVWYDKD  453
                Y+S+P    G   +    +  + +  G+ +++ +
Sbjct  122  PAPNYHSYPNVGYGTQNFSPHPSSPVDQTAGYSFHNAN  159



>gb|EYU39948.1| hypothetical protein MIMGU_mgv11b021121mg [Erythranthe guttata]
Length=236

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 4/109 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH HPL    ++  +   C+ C+LP +      C +C FF+H+  C +    + H S
Sbjct  4    KHFSHQHPLILHKIQPGEQFQCNGCNLPCVKDSIFTCWSCKFFLHEH-CGNANRYVKHPS  62

Query  178  HPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
            HP HPL L P P++     ICDAC SP     Y C +C+ DLH++CA L
Sbjct  63   HPTHPLVLVPIPTYCSGAFICDACGSPGTAFSYSCPLCEVDLHINCAFL  111



>ref|XP_011000768.1| PREDICTED: uncharacterized protein LOC105108233 isoform X2 [Populus 
euphratica]
Length=322

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 73/168 (43%), Gaps = 7/168 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH SHPHPL   N +     +CS C+L  SG  + C+ C+F +H   C  +   I H SH
Sbjct  11   NHFSHPHPLELSNAQSLYMNSCSACNLQPSGWMYSCKPCNFTLH-ISCTQMPTLITHPSH  69

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGT  348
            P HPL L      P  +  CD C    N   Y C  CD+D+H+ CA   L+ +  +    
Sbjct  70   PIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHRSHPHQ  129

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            L   +Y         C  C+   S    W++      F AH  C   V
Sbjct  130  LNLAFYPPYQTKGFSCDICHQIGSNH--WLYRCSACEFDAHMKCAMSV  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGTN--CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP HPL  F+  +  G +  C  C L  +G  + C  CDF +H   C    L + H 
Sbjct  66   HPSHPIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMM-CATNPLSLAHR  124

Query  175  SHPAHPLHLR--PPSFDPNHICDACLS-PANTPLYRCGICDYDLHVDCAVLTTSDT  333
            SHP H L+L   PP       CD C    +N  LYRC  C++D H+ CA+   + T
Sbjct  125  SHP-HQLNLAFYPPYQTKGFSCDICHQIGSNHWLYRCSACEFDAHMKCAMSVNNTT  179



>ref|XP_011000773.1| PREDICTED: uncharacterized protein LOC105108233 isoform X5 [Populus 
euphratica]
Length=317

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 73/168 (43%), Gaps = 7/168 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH SHPHPL   N +     +CS C+L  SG  + C+ C+F +H   C  +   I H SH
Sbjct  11   NHFSHPHPLELSNAQSLYMNSCSACNLQPSGWMYSCKPCNFTLH-ISCTQMPTLITHPSH  69

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGT  348
            P HPL L      P  +  CD C    N   Y C  CD+D+H+ CA   L+ +  +    
Sbjct  70   PIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHRSHPHQ  129

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            L   +Y         C  C+   S    W++      F AH  C   V
Sbjct  130  LNLAFYPPYQTKGFSCDICHQIGSNH--WLYRCSACEFDAHMKCAMSV  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGTN--CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP HPL  F+  +  G +  C  C L  +G  + C  CDF +H   C    L + H 
Sbjct  66   HPSHPIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMM-CATNPLSLAHR  124

Query  175  SHPAHPLHLR--PPSFDPNHICDACLS-PANTPLYRCGICDYDLHVDCAVLTTSDT  333
            SHP H L+L   PP       CD C    +N  LYRC  C++D H+ CA+   + T
Sbjct  125  SHP-HQLNLAFYPPYQTKGFSCDICHQIGSNHWLYRCSACEFDAHMKCAMSVNNTT  179



>ref|XP_010246187.1| PREDICTED: uncharacterized protein LOC104589539 [Nelumbo nucifera]
Length=355

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 83/198 (42%), Gaps = 17/198 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQ--DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
             H SHPHPL   NL+ Q  +  +CS C    SG  + C+AC++ +H   C  +   I H 
Sbjct  11   QHFSHPHPLELSNLQQQHPNLASCSGCKQSPSGWIYSCKACNYILHVS-CAQMPQLIQHP  69

Query  175  SHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVD  342
            + P H L L      P  +  CDAC    N   Y CG C  D+H+ CA   L+ S  A  
Sbjct  70   ADPTHALTLLSLPAYPEGVFNCDACGHKGNGFSYHCGACSLDIHIFCATKPLSLSHHAHP  129

Query  343  GTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG--------KPVIL  498
             TL   ++         C  C    S    W++      F AH NC         +P I 
Sbjct  130  HTLHLAFFPPYQNKGFSCDICKTMGSNH--WLYRCSMCEFDAHLNCAFSRTHLSLQPQIQ  187

Query  499  KHQPCFLRPLMRYLRRIS  552
            + QP  ++    + + + 
Sbjct  188  RSQPVQIQQYQSFPQAVQ  205



>ref|XP_011000772.1| PREDICTED: uncharacterized protein LOC105108233 isoform X4 [Populus 
euphratica]
Length=320

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 73/168 (43%), Gaps = 7/168 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH SHPHPL   N +     +CS C+L  SG  + C+ C+F +H   C  +   I H SH
Sbjct  11   NHFSHPHPLELSNAQSLYMNSCSACNLQPSGWMYSCKPCNFTLH-ISCTQMPTLITHPSH  69

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGT  348
            P HPL L      P  +  CD C    N   Y C  CD+D+H+ CA   L+ +  +    
Sbjct  70   PIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHRSHPHQ  129

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            L   +Y         C  C+   S    W++      F AH  C   V
Sbjct  130  LNLAFYPPYQTKGFSCDICHQIGSNH--WLYRCSACEFDAHMKCAMSV  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGTN--CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP HPL  F+  +  G +  C  C L  +G  + C  CDF +H   C    L + H 
Sbjct  66   HPSHPIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMM-CATNPLSLAHR  124

Query  175  SHPAHPLHLR--PPSFDPNHICDACLS-PANTPLYRCGICDYDLHVDCAVLTTSDT  333
            SHP H L+L   PP       CD C    +N  LYRC  C++D H+ CA+   + T
Sbjct  125  SHP-HQLNLAFYPPYQTKGFSCDICHQIGSNHWLYRCSACEFDAHMKCAMSVNNTT  179



>ref|XP_011000771.1| PREDICTED: uncharacterized protein LOC105108233 isoform X3 [Populus 
euphratica]
Length=322

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 73/168 (43%), Gaps = 7/168 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH SHPHPL   N +     +CS C+L  SG  + C+ C+F +H   C  +   I H SH
Sbjct  11   NHFSHPHPLELSNAQSLYMNSCSACNLQPSGWMYSCKPCNFTLH-ISCTQMPTLITHPSH  69

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGT  348
            P HPL L      P  +  CD C    N   Y C  CD+D+H+ CA   L+ +  +    
Sbjct  70   PIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHRSHPHQ  129

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            L   +Y         C  C+   S    W++      F AH  C   V
Sbjct  130  LNLAFYPPYQTKGFSCDICHQIGSNH--WLYRCSACEFDAHMKCAMSV  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGTN--CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP HPL  F+  +  G +  C  C L  +G  + C  CDF +H   C    L + H 
Sbjct  66   HPSHPIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMM-CATNPLSLAHR  124

Query  175  SHPAHPLHLR--PPSFDPNHICDACLS-PANTPLYRCGICDYDLHVDCAVLTTSDT  333
            SHP H L+L   PP       CD C    +N  LYRC  C++D H+ CA+   + T
Sbjct  125  SHP-HQLNLAFYPPYQTKGFSCDICHQIGSNHWLYRCSACEFDAHMKCAMSVNNTT  179



>ref|XP_011000767.1| PREDICTED: uncharacterized protein LOC105108233 isoform X1 [Populus 
euphratica]
Length=325

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 73/168 (43%), Gaps = 7/168 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH SHPHPL   N +     +CS C+L  SG  + C+ C+F +H   C  +   I H SH
Sbjct  11   NHFSHPHPLELSNAQSLYMNSCSACNLQPSGWMYSCKPCNFTLH-ISCTQMPTLITHPSH  69

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGT  348
            P HPL L      P  +  CD C    N   Y C  CD+D+H+ CA   L+ +  +    
Sbjct  70   PIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHRSHPHQ  129

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            L   +Y         C  C+   S    W++      F AH  C   V
Sbjct  130  LNLAFYPPYQTKGFSCDICHQIGSNH--WLYRCSACEFDAHMKCAMSV  175


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGTN--CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP HPL  F+  +  G +  C  C L  +G  + C  CDF +H   C    L + H 
Sbjct  66   HPSHPIHPLTLFSTPVYPGGSFKCDGCGLQGNGFNYHCTTCDFDVHMM-CATNPLSLAHR  124

Query  175  SHPAHPLHLR--PPSFDPNHICDACLS-PANTPLYRCGICDYDLHVDCAVLTTSDT  333
            SHP H L+L   PP       CD C    +N  LYRC  C++D H+ CA+   + T
Sbjct  125  SHP-HQLNLAFYPPYQTKGFSCDICHQIGSNHWLYRCSACEFDAHMKCAMSVNNTT  179



>ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261320 [Vitis vinifera]
Length=360

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDG---TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SH HPL   N   Q      +CS C L  SGL + C+ C++F+H   C  +  QI H+
Sbjct  14   HFSHSHPLQLSNHHPQQTLTLASCSGCKLKASGLIYDCKRCNYFLHIS-CSQMPQQITHS  72

Query  175  SHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCA  312
             H AH L L P    P  +  CDAC    N   Y CG+C+ DLH+ CA
Sbjct  73   FHKAHALSLLPNPAYPEGLFNCDACGKQGNGFSYHCGVCNIDLHILCA  120



>ref|XP_009786636.1| PREDICTED: uncharacterized protein LOC104234719, partial [Nicotiana 
sylvestris]
Length=418

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 74/157 (47%), Gaps = 14/157 (9%)
 Frame = +1

Query  52   DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPA--HPLHLRP---PSF  216
            +G  C+ C + ISG A+ CE    ++H D C +   +I H  +P   H L LRP    S 
Sbjct  69   EGIKCNFCDIIISGWAYACEKQCTYLH-DLCSNFPREIRHDFYPGFDHTLILRPFQSRSG  127

Query  217  DPNHICDACLSPAN-----TPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPV-  378
                 CDAC S  +        Y C  C+++LHV+CA +  +        + L+ SFP+ 
Sbjct  128  REQFRCDACGSGDSDETLFQSYYCCESCNFNLHVECASIPIALNQKVRYPLHLFLSFPIT  187

Query  379  --GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
               A+ +C  C   +   G WV+Y  D  +  HF+C 
Sbjct  188  TEAATPFCSICAKVVPTSGCWVFYSHDHDYLCHFDCA  224


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 69/157 (44%), Gaps = 10/157 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H +H H L ++NLE+    +CS+C+   S   + C  C++FI D  C  +  +I H SH
Sbjct  264  KHFTHRHSLKEYNLEMP--LSCSLCNFADSS-GYFCSDCNYFI-DKICFSIPSKIQHMSH  319

Query  181  PAHPLHLRPPSFDPNH---ICDACLS--PANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
            P HPL    P  D  H    C  CL+        Y C  C + +   CA    + T VD 
Sbjct  320  PQHPLKFT-PFLDLVHEDLKCSGCLADFKYRGMAYYCAPCKFSIEFYCAGAPKTLTLVDN  378

Query  346  TLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDT  456
                L++SFP        +CN +++  G    Y    
Sbjct  379  VSYELFFSFPFKHENAEIECNFKLASVGPLTCYKSQA  415



>ref|NP_180334.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC73034.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08023.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=718

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 86/182 (47%), Gaps = 23/182 (13%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T+   CS C L   +G  + C  C+F +H+  C  +K  I 
Sbjct  13   NHFSHPH-----RLQLTPATSSPPCSACKLTGGNGRVYSCRPCNFSLHES-CSKMKQVIT  66

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTA  336
            H SHP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+    +
Sbjct  67   HPSHPSHTLSLLVAPVYDGGYFNCDGCGIHGTGFSYQCSVCDFDIHALCAYKPLSIIHKS  126

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVIL  498
                 ++L +  P GA+   K  + +I R+ G   W++      F AH  C     P +L
Sbjct  127  HPQHNLKLAFQSPYGAN---KGFSCDICRKIGKNQWLYRCIPCEFDAHVGCITGPNPHLL  183

Query  499  KH  504
            +H
Sbjct  184  QH  185



>ref|XP_006286066.1| hypothetical protein CARUB_v10007599mg [Capsella rubella]
 gb|EOA18964.1| hypothetical protein CARUB_v10007599mg [Capsella rubella]
Length=234

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 68/164 (41%), Gaps = 8/164 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C DL  + +H
Sbjct  8    RHPSHNHPLRGHKCEAKDEIICSGCDLDLVGAAFKCTKSSDCDYFLH-KSCFDLPRETNH  66

Query  172  TSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGT  348
             SH  H L L   S    + C+AC    ++  Y C  C YD+HV C  +  T        
Sbjct  67   KSHQPHTLTLL-YSPKSTYTCNACGEYGSSFTYNCASCQYDVHVGCVSMPETVKREEHAH  125

Query  349  LMRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHF  474
             + L Y  P        KC+   +I     W +Y K   +  H 
Sbjct  126  PLTLLYGSPYNQPGLVSKCDVCEDIVPDNLWSYYCKKCDYATHL  169



>ref|XP_009103612.1| PREDICTED: uncharacterized protein LOC103829678 [Brassica rapa]
Length=669

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 57/190 (30%), Positives = 85/190 (45%), Gaps = 17/190 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            NH SHPHPL    +       CS C L   +G  + C  C+F +H+  C  +K  I H S
Sbjct  13   NHFSHPHPLQL--IPPTSSPPCSACKLAGGNGRVYSCRPCNFSLHES-CSKIKQVITHPS  69

Query  178  HPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDG  345
            HP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+    +   
Sbjct  70   HPSHTLTLLVAPVYDGGYFNCDGCGVNGTGFSYQCSLCDFDIHALCAYKPLSIVHNSHPQ  129

Query  346  TLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVILKHQ  507
              ++L +  P GA+   K  + +I  + G   W++      F  H  C     P +L+H 
Sbjct  130  HTLKLAFHSPYGAN---KGFSCDICLKIGKNQWLYRCVPCEFDGHVGCINAHHPHLLQHS  186

Query  508  PCFLRPLMRY  537
                 PL  +
Sbjct  187  SSAPTPLAHH  196



>ref|XP_006493876.1| PREDICTED: uncharacterized protein LOC102615121 [Citrus sinensis]
Length=991

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 57/112 (51%), Gaps = 4/112 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPIS-GLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH HPL    L++ D  NC +C   IS G ++GC  C F+IH   C +L  +I H  
Sbjct  155  EHFSHHHPLTL--LKLDDVMNCRLCLKTISDGSSYGCAPCKFYIHSS-CRELPQEIKHPF  211

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT  333
            HP H L L        + CDACL       YRC  C ++LH +CA L  S T
Sbjct  212  HPRHCLKLSISKKKVKYRCDACLFDIQNLRYRCVKCGFNLHPECASLKPSIT  263



>ref|XP_004229344.1| PREDICTED: uncharacterized protein LOC101249575 [Solanum lycopersicum]
Length=236

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 77/173 (45%), Gaps = 14/173 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA-HGCEA--CDFFIHDDDCLDLKLQIHH  171
             H SHPH L  F ++  +   CS C   + G   + C    C+F +H   C +L  +I H
Sbjct  2    KHFSHPHALAIFEVQESNEIICSGCENKLCGTTNYKCTKSNCEFTLHKS-CFELPRKILH  60

Query  172  TSHPAHPLHLRP--PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD  342
             SH  HPL L P  P  D  +  C+AC     + +Y C  C++ LH  C      +   +
Sbjct  61   NSHRDHPLTLYPTLPERDCMYFGCNACGEEPKSFVYECLECNFSLHAKCVTSVAENITRE  120

Query  343  ----GTLMRLYYSFPVG--ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                  +++  + FP+    +++CK C+G +     W++Y  +     H  C 
Sbjct  121  DHQHSLILQYEWPFPIEDCVNIFCKVCDG-LCNDSNWLYYCTECKLGTHLQCA  172



>ref|XP_002322661.1| hypothetical protein POPTR_0016s04640g [Populus trichocarpa]
 gb|EEF04422.1| hypothetical protein POPTR_0016s04640g [Populus trichocarpa]
Length=701

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 57/110 (52%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C  C FF+H   C DL  +I 
Sbjct  4    EHFSHPDHPLILVNQVLEYSCELVICSGCEGPIWGPCYSCTCCYFFLHKK-CADLPREIK  62

Query  169  HTSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               HP HPLHL  +PPS     +CD C    N+ +Y C +C +DL + CA
Sbjct  63   RRIHPRHPLHLLAKPPSNYTRCVCDRCDKTCNSFVYHCSLCKFDLDIKCA  112


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H  HP  L +      +G  CS+C  P+SG  + C +C+FF+H   C +L  ++    HP
Sbjct  129  HKDHPLILNEEQEYHGEGVVCSVCKEPMSGPIYSCTSCNFFLH-KKCAELPPKMKRHIHP  187

Query  184  AHPLHLRPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDCA  312
             HPL L P   + + ICD C      + +Y C +C+Y+LH+ CA
Sbjct  188  EHPLRLLP---NHDMICDFCNETCYESFVYFCIVCEYNLHIKCA  228



>ref|XP_009614685.1| PREDICTED: uncharacterized protein LOC104107555 isoform X1 [Nicotiana 
tomentosiformis]
Length=352

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 56/105 (53%), Gaps = 4/105 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPH L +   ++Q+ T CS C LP     + C+ C+F +H   C     QI H SHP
Sbjct  16   HFSHPHEL-ELCTQLQNPTPCSGCKLPPLAQMYMCKPCNFTLHLS-CTQFPEQISHPSHP  73

Query  184  AHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCA  312
             HPL L P S  P  +  CDAC    +   Y C  C+YDLHV CA
Sbjct  74   DHPLALLPTSKYPGGLFNCDACNHRGDGFSYHCSDCEYDLHVICA  118


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 77/177 (44%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            +H SHP HPL         G   NC  C+    G ++ C  C++ +H   C    L+I H
Sbjct  68   SHPSHPDHPLALLPTSKYPGGLFNCDACNHRGDGFSYHCSDCEYDLHVI-CASRPLKITH  126

Query  172  TSHPAH-PLHLRPPSFDPNHI-CDACLSPANTP-LYRCGICDYDLHVDCAVLTTSDTAVD  342
              H     L  + P  D     CD C        LYRC  CD+D+H+DC+  + S +AV 
Sbjct  127  QLHQCQLELTFKNPYTDAKGFSCDVCHKIGVKQWLYRCSSCDFDVHLDCST-SASISAVQ  185

Query  343  G-TLMRLYYSFPVGASV--WCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKH  504
            G T+++ ++SFP   S     ++       R     +   TG T + +   P+   H
Sbjct  186  GPTILQHHHSFPGATSSHNQFQQAPMAAQMRPNQFMHSASTGATGNQSPQTPIFTGH  242



>ref|XP_006369462.1| hypothetical protein POPTR_0001s23660g [Populus trichocarpa]
 gb|ERP66031.1| hypothetical protein POPTR_0001s23660g [Populus trichocarpa]
Length=321

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 74/169 (44%), Gaps = 12/169 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDG---TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
             H SHPHPL   N + Q      +CS C L ISG  + C  C++F+H   C  +  QI H
Sbjct  13   QHFSHPHPLQLSNYQPQQTLCLASCSGCKLKISGWIYACTQCNYFLHVS-CSQMPQQITH  71

Query  172  TSHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVL---TTSDTA  336
              H  H L L      P  +  CDAC    N   Y CG C+  +H  CA +    T  + 
Sbjct  72   PYHQNHVLSLLSTPMYPGDLFNCDACGKQGNGFSYHCGTCNIYIHTTCAAMPLVLTHQSH  131

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                 +  +  +P   S  C  C+   S++  W++     GF AH +C 
Sbjct  132  HHQLNLTPFAPYP-NMSFSCDMCHNFGSKQ--WLYRCNLCGFDAHLDCA  177


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = +1

Query  52   DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLRPPSFDPN--  225
            D  NC  C    +G ++ C  C+ +IH   C  + L + H SH  H L+L P +  PN  
Sbjct  90   DLFNCDACGKQGNGFSYHCGTCNIYIHTT-CAAMPLVLTHQSH-HHQLNLTPFAPYPNMS  147

Query  226  HICDACLSPANTP-LYRCGICDYDLHVDCAV  315
              CD C +  +   LYRC +C +D H+DCAV
Sbjct  148  FSCDMCHNFGSKQWLYRCNLCGFDAHLDCAV  178



>emb|CDY04505.1| BnaA07g13310D [Brassica napus]
Length=666

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 56/182 (31%), Positives = 84/182 (46%), Gaps = 18/182 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            NH SHPHPL    +       CS C L   +G  + C  C+F +H+  C  +K  I H S
Sbjct  13   NHFSHPHPLQL--IPPTSSPPCSACKLTGGNGRVYSCRPCNFSLHES-CSKMKQVITHPS  69

Query  178  HPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDG  345
            HP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+   ++   
Sbjct  70   HPSHTLTLLVAPVYDGGYFNCDGCGVNGTGFSYQCSLCDFDIHALCAYKPLSIVHSSHPQ  129

Query  346  TLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNCGKPVILKHQPCF  516
              ++L +  P GA+   K  + +I  + G   W++      F +H  C    I  H P  
Sbjct  130  HTLKLAFHSPYGAN---KGFSCDICLKIGKNQWLYRCVPCEFDSHVGC----INAHHPHL  182

Query  517  LR  522
            L+
Sbjct  183  LQ  184



>gb|EYU27122.1| hypothetical protein MIMGU_mgv1a017892mg [Erythranthe guttata]
Length=282

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 78/174 (45%), Gaps = 15/174 (9%)
 Frame = +1

Query  1    NHASHPHPL----YQFNLEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQI  165
            +H SHPHPL    +Q  L +   + CS C L  SG  + C  C DFF+H   C ++  ++
Sbjct  7    SHFSHPHPLKLVDHQQTLNLIT-SPCSACKLEPSGTIYSCTICKDFFLH-KKCFEMPTKL  64

Query  166  HHTSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
             H  H  H L L  +P   +    CDAC    +   Y C  C +DLHV CA L  S T  
Sbjct  65   IHPFHKKHALTLTSKPTYGEMLFRCDACQQRGDGFSYHCKPCGFDLHVLCATLPFSITHE  124

Query  340  DGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNCGKPV  492
               + +L     +   +   K N  I  + G   W++  K  GF AH  C  P 
Sbjct  125  SHAIHKLEL---ITCELSKSKFNCSICMKLGLRQWLYRCKSCGFDAHLKCVGPT  175



>ref|XP_006359159.1| PREDICTED: uncharacterized protein LOC102598002 isoform X1 [Solanum 
tuberosum]
Length=380

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 75/166 (45%), Gaps = 8/166 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLE-IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SHPH L     +       CS C +  +G  + C++C+FF+H + C  +  QI+H   
Sbjct  16   HFSHPHTLELITHQNFAPSQLCSGCKIQANGSVYTCKSCNFFLHVE-CSQMPQQINHPFD  74

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-L  351
              H L L P S  P  N  CDAC    +   Y C  C  DLH+ CAVL    T       
Sbjct  75   KEHSLTLLPKSIYPEGNFRCDACGETGDGFSYHCNSCGIDLHILCAVLPQYITHRSHRHQ  134

Query  352  MRLYYSFPV-GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
            + + +S P    S  C  C    +++  W++     GF AH NC K
Sbjct  135  LEIQFSSPYPSKSFRCDICKNIGTKQ--WLYRCHTCGFDAHLNCTK  178



>ref|XP_006359160.1| PREDICTED: uncharacterized protein LOC102598002 isoform X2 [Solanum 
tuberosum]
Length=378

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 75/166 (45%), Gaps = 8/166 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLE-IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SHPH L     +       CS C +  +G  + C++C+FF+H + C  +  QI+H   
Sbjct  16   HFSHPHTLELITHQNFAPSQLCSGCKIQANGSVYTCKSCNFFLHVE-CSQMPQQINHPFD  74

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-L  351
              H L L P S  P  N  CDAC    +   Y C  C  DLH+ CAVL    T       
Sbjct  75   KEHSLTLLPKSIYPEGNFRCDACGETGDGFSYHCNSCGIDLHILCAVLPQYITHRSHRHQ  134

Query  352  MRLYYSFPV-GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
            + + +S P    S  C  C    +++  W++     GF AH NC K
Sbjct  135  LEIQFSSPYPSKSFRCDICKNIGTKQ--WLYRCHTCGFDAHLNCTK  178



>gb|EYU27150.1| hypothetical protein MIMGU_mgv1a018784mg, partial [Erythranthe 
guttata]
Length=205

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 71/172 (41%), Gaps = 15/172 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    L+  +   C  C +PI    +GC  C +F+H   C D      H SH
Sbjct  7    QHFSHEHMLIPIELDEGEEFKCKACEMPIDDPFYGCPPCKYFLHAIICYDAPRSTVHPSH  66

Query  181  PAHPLHLRPPSFDPNH--ICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            P+HPL L P    P+    C+AC S  N      C  C++DLH+ CA L  +        
Sbjct  67   PSHPLALTPMPTYPSRSFTCNACGSDGNKGFSLSCAHCEFDLHLHCAELPGTFFYEREHA  126

Query  352  MRLYYSFPVG---------ASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              L   F             ++ C  CN +   +  W++Y ++  +  H  C
Sbjct  127  HDLKLVFEPSLCRDKTTNDRNIPCYICNED---QISWLYYCEECKYVVHMKC  175



>gb|KDO59944.1| hypothetical protein CISIN_1g045770mg [Citrus sinensis]
Length=901

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 57/112 (51%), Gaps = 4/112 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPIS-GLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH HPL    L++ D  NC +C   IS G ++GC  C F+IH   C +L  +I H  
Sbjct  155  EHFSHHHPLTL--LKLDDVMNCRLCLKTISDGSSYGCAPCKFYIHSS-CRELPQEIKHPF  211

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT  333
            HP H L L        + CDACL       YRC  C ++LH +CA L  S T
Sbjct  212  HPRHCLKLSISKKKVKYRCDACLFDIQNLRYRCVKCGFNLHPECASLKPSIT  263



>gb|EYU27149.1| hypothetical protein MIMGU_mgv1a012140mg [Erythranthe guttata]
Length=260

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 71/164 (43%), Gaps = 7/164 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L   +L+  +   C  C   +S   +GC  C+FF+H   C +    + H SH
Sbjct  8    QHFSHEHILAPLHLDAGEEIKCDGCEELVSDTFYGCLECNFFLHPV-CSEAPRSMVHPSH  66

Query  181  PAHPL--HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVDGT  348
            P HPL  H  P      + CDAC S      + C  C++DLH+ CA L  T         
Sbjct  67   PDHPLTLHQNPTYSSRAYCCDACGSGGKGFSFSCAHCEFDLHILCAALAPTFLFKKEHPH  126

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              +L         + C  C+  +  +G W++Y    G  AH NC
Sbjct  127  EFKLVCEPERANKLTCYICS--VGNQGYWLYYCGACGIGAHVNC  168



>ref|XP_006359156.1| PREDICTED: uncharacterized protein LOC102597028 [Solanum tuberosum]
Length=266

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 76/169 (45%), Gaps = 12/169 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP--ISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
             H SH H L       +    C+ C  P   S   +GC  C +F+H++ C +    ++H 
Sbjct  16   QHFSHSHILKLIVNPTETVLTCNACEQPNNTSKPFYGCNTCQYFLHEN-CFNAPRFLNHA  74

Query  175  SHPAHPLHLRPPSFDPN--HICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP+HPL L P +   +    C AC S  N   + C  C++D+H+ CA L +S   VD  
Sbjct  75   SHPSHPLTLLPSATYSSCSFTCKACDSAGNGFCFSCACCEFDIHLQCASL-SSLILVDKH  133

Query  349  LMRLYYSFPV-----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              +L  +F        +   C  C  EI  +  W++Y     F +H  C
Sbjct  134  PHQLELNFGSPYEDKDSEYVCDICT-EIMNKENWLYYCGGCDFASHLQC  181



>gb|EYU27106.1| hypothetical protein MIMGU_mgv1a024431mg, partial [Erythranthe 
guttata]
Length=380

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 81/176 (46%), Gaps = 19/176 (11%)
 Frame = +1

Query  1    NHASHPHPL--YQFNLEIQDGTNCSICSL-PISGLAHGCEAC-DFFIHDDDCLDLKLQIH  168
             H SHPH L    +N  +   + C  C L P +G+ + C  C D+F+H   C ++  +I 
Sbjct  6    EHFSHPHTLTLVVYNQTLNLNSPCPACKLKPSAGMLYTCTVCKDYFLHKQ-CFEMPKKID  64

Query  169  HTSHPAHPLHLRP-PSFDPNH-ICDACLSPANTPLYRCGICDYDLHVDCAVL------TT  324
            H  H  H L L P P++  ++ +C+AC        Y CG CD DLH+ CA+L       +
Sbjct  65   HLCHKKHGLTLLPKPAYKQDYFVCNACGESGVGFSYNCGRCDVDLHITCALLPLFVKHKS  124

Query  325  SDTAVDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
                +D T    Y S     S  C  C+   SR   W++  K   F AH  C + V
Sbjct  125  HAHKLDLTFESPYPS----KSFTCAICDAPGSRH--WLYRCKLCEFNAHLTCARSV  174



>ref|XP_011002310.1| PREDICTED: uncharacterized protein LOC105109329 [Populus euphratica]
 ref|XP_011002319.1| PREDICTED: uncharacterized protein LOC105109331 [Populus euphratica]
Length=320

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 74/169 (44%), Gaps = 12/169 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDG---TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
             H SHPHPL   N + Q      +CS C L ISG  + C  C++F+H   C  +  QI H
Sbjct  13   QHFSHPHPLQLSNYQPQQTLCLASCSCCKLKISGSIYACTQCNYFLH-VSCSQMPQQITH  71

Query  172  TSHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVL---TTSDTA  336
              H  H L L      P  +  CDAC    N   Y CG C+  +H  CA +    T  + 
Sbjct  72   PYHQNHVLSLLSTPMYPGDLFNCDACGKQGNGFSYHCGTCNIYIHTTCAAMPLVLTHQSH  131

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
                 +  +  +P   S  C  C+   S++  W++     GF AH +C 
Sbjct  132  HHQLNLIPFVPYP-NMSFSCDICHNFGSKQ--WLYRCNLCGFDAHLDCA  177



>ref|XP_006296128.1| hypothetical protein CARUB_v10025280mg [Capsella rubella]
 gb|EOA29026.1| hypothetical protein CARUB_v10025280mg [Capsella rubella]
Length=706

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 54/171 (32%), Positives = 81/171 (47%), Gaps = 20/171 (12%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T+   CS C L   +G  + C  C+FF+H + C  +K  I 
Sbjct  13   NHFSHPH-----RLQLAPATSSPPCSACKLAGGNGRVYSCRPCNFFLH-ESCSKMKQVIT  66

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTA  336
            H SHP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+    +
Sbjct  67   HPSHPSHTLTLLVAPVYDGGYFNCDGCGVHGTGFSYQCSLCDFDIHALCAYKPLSIIHQS  126

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC  480
                 ++L +  P GA+   K  + +I  + G   W++      F AH  C
Sbjct  127  HPQHSLKLTFHSPYGAN---KGFSCDICLKIGKNQWLYRCIPCEFDAHVAC  174


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 53/115 (46%), Gaps = 8/115 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP H L      + DG   NC  C +  +G ++ C  CDF IH   C    L I H 
Sbjct  67   HPSHPSHTLTLLVAPVYDGGYFNCDGCGVHGTGFSYQCSLCDFDIHAL-CAYKPLSIIHQ  125

Query  175  SHPAHPLHL---RPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDCAVLTTS  327
            SHP H L L    P   +    CD CL    N  LYRC  C++D HV C   T S
Sbjct  126  SHPQHSLKLTFHSPYGANKGFSCDICLKIGKNQWLYRCIPCEFDAHVACIAATNS  180



>ref|XP_009771792.1| PREDICTED: uncharacterized protein LOC104222273 [Nicotiana sylvestris]
Length=349

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 75/164 (46%), Gaps = 9/164 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPH L +   ++Q+ T CS C LP     + C+ C+F +H   C     QI+H SH 
Sbjct  14   HFSHPHEL-ELCAQLQNPTPCSGCKLPPLAQMYTCKPCNFTLH-LSCTQFPEQINHPSHS  71

Query  184  AHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTLM  354
             HPL L P S  P  +  CDAC    +   Y C  C+YDLHV CA      T  +    +
Sbjct  72   DHPLALLPTSKYPGGLFNCDACNHRGDGFSYHCSDCEYDLHVICASRPLKITHQLHKCQL  131

Query  355  RLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
            +L +  P        C  C+    ++  W++      F  H NC
Sbjct  132  QLTFKNPYADAKGFSCDVCHKIGVKQ--WLYRCSSCDFDVHLNC  173



>gb|EYU27147.1| hypothetical protein MIMGU_mgv1a023839mg, partial [Erythranthe 
guttata]
Length=192

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 73/172 (42%), Gaps = 18/172 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA-HGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH H L +  L+  +   C+ C   +     +GC  C +F+H++ C +    I H S
Sbjct  12   QHFSHKHILTRLQLDEVEEITCNACECDVEEEQFYGCTDCKYFLHEE-CAEAPRSIEHRS  70

Query  178  HPAHPLHLRPPSFDPNH--ICDACLSPANTPLYRCGICDYDLHVDCAVLTTS--------  327
            HP+HPL L   +   N   ICDAC        Y C  C +DLH+ C+ L  +        
Sbjct  71   HPSHPLTLHAAATYSNQSFICDACGYVGYGFCYSCAHCSFDLHLFCSTLPHTIPKEEEHP  130

Query  328  -DTAVDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
             +  +     +L  S  +    +C   N E      W++Y +   F  H NC
Sbjct  131  HEIQLVCEQEKLLTSDMISICSFCDAMNTEC-----WIYYCETCNFGFHLNC  177



>ref|XP_006347358.1| PREDICTED: uncharacterized protein LOC102591548 [Solanum tuberosum]
Length=370

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 55/106 (52%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L +   ++QD + CS C LP SG  + C  C++ +H   C      I H SH
Sbjct  15   KHFSHPHEL-ELCTQLQDLSPCSGCRLPPSGQMYICRPCNYTLH-LSCAKFPQLITHPSH  72

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCA  312
            P HPL+L P S  P     CDAC        Y C  C++DLHV CA
Sbjct  73   PNHPLNLLPTSKYPGGQFNCDACKRHGTGFSYHCSYCEFDLHVICA  118


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 73/174 (42%), Gaps = 8/174 (5%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP HPL         G   NC  C    +G ++ C  C+F +H   C    L+I H 
Sbjct  69   HPSHPNHPLNLLPTSKYPGGQFNCDACKRHGTGFSYHCSYCEFDLHVI-CASRPLKITHE  127

Query  175  SHP-AHPLHLRPPSFDPNHI-CDACLSPANTP-LYRCGICDYDLHVDCAVLTTSDTAVDG  345
             H  +  L  + P  +     CD C        LYRC  C++D+H+DC        A   
Sbjct  128  LHQCSLELTFKNPYANAKGFSCDVCRKIGVKQWLYRCPACEFDVHLDCLTSAPRQEASQS  187

Query  346  TLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQ  507
            T ++ ++SFP GA    ++       R   + +   TG   + +  +P + + Q
Sbjct  188  TALQHHHSFP-GAPNQFQQATVGRQARSHHLMHAASTGAITNNHSLQPTVFQGQ  240



>ref|XP_010099226.1| hypothetical protein L484_010166 [Morus notabilis]
 gb|EXB77340.1| hypothetical protein L484_010166 [Morus notabilis]
Length=234

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 77/183 (42%), Gaps = 26/183 (14%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPI--SGLAHGCE------ACDFFIHDDDCLDLK  156
             H SH HPL  + +E      C +C   I  +  A+ C       +C++F     C +L 
Sbjct  4    KHFSHRHPLSPYEVEEDQDIICCVCEEEILPTSPAYKCNNKNNSISCEYFHLHKHCFELP  63

Query  157  LQIHHTSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSD  330
             +  H+SHP H L L  +PPS+  N  C AC    ++ +Y C  C++ LHV C+ L    
Sbjct  64   REFQHSSHPQHSLTLLPKPPSYLFN--CAACAGYNSSFVYNCAACEFALHVRCSGLEELV  121

Query  331  TAVDGT-LMRLYYSF------------PVGASVWCKKCNGEISRRGGWVWYDKDTGFTAH  471
               D    ++L +S                   WC  C G   + G W +  K+ G+  H
Sbjct  122  RREDHQHPLQLVFSLRPEQKEEEEEEDEEEKDYWCDIC-GCCVKEGRWAYLCKECGYVTH  180

Query  472  FNC  480
              C
Sbjct  181  LEC  183



>ref|XP_006494733.1| PREDICTED: uncharacterized protein LOC102619482 isoform X3 [Citrus 
sinensis]
Length=1026

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL    L   D  NC +CS  I+G  +GC  C+F+IH+    +   +I H  H
Sbjct  13   EHCSHRHPLTLMKLHDID-MNCKLCSKSINGPGYGCAPCEFYIHNSCRDEFPQEIRHPFH  71

Query  181  PAHPLHL---RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLT  321
            P H L L    P  +D    CDAC        YRC +C ++LH++C+ L 
Sbjct  72   PRHSLQLLDGEPNRYD----CDACQFNIQGLRYRCDMCAFNLHLECSSLK  117


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 2/108 (2%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L           NC  C   I G  +GC  C+F+IH   C +L  ++ H  H 
Sbjct  366  HFSHEHHLDVIPESEVTNLNCEFCCKTIDGRCYGCVGCEFYIHIS-CSELPTEVRHPFHQ  424

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
             HPL L        + CDAC    +   YRC  CD+DLH DC  L  +
Sbjct  425  LHPLTLLVAK-KFRYRCDACRFGIHGFRYRCDTCDFDLHPDCLSLKAN  471


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 47/105 (45%), Gaps = 3/105 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    +   +   C  C   I G  +GC+ C F++H   C++L  +IHH SH
Sbjct  238  RHFSHEHILILREIPKNNDIFCHGCREAIQGPTYGCDPCKFYLH-KSCVELPREIHHESH  296

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGIC-DYDLHVDCA  312
              H L LR         C AC    N   Y C  C  +DL + CA
Sbjct  297  -EHYLRLRLSDISKQITCHACGKLFNGFTYHCDTCYKFDLDIGCA  340



>ref|XP_006494731.1| PREDICTED: uncharacterized protein LOC102619482 isoform X1 [Citrus 
sinensis]
Length=1059

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL    L   D  NC +CS  I+G  +GC  C+F+IH+    +   +I H  H
Sbjct  13   EHCSHRHPLTLMKLHDID-MNCKLCSKSINGPGYGCAPCEFYIHNSCRDEFPQEIRHPFH  71

Query  181  PAHPLHL---RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLT  321
            P H L L    P  +D    CDAC        YRC +C ++LH++C+ L 
Sbjct  72   PRHSLQLLDGEPNRYD----CDACQFNIQGLRYRCDMCAFNLHLECSSLK  117


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 2/108 (2%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L           NC  C   I G  +GC  C+F+IH   C +L  ++ H  H 
Sbjct  366  HFSHEHHLDVIPESEVTNLNCEFCCKTIDGRCYGCVGCEFYIHIS-CSELPTEVRHPFHQ  424

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
             HPL L        + CDAC    +   YRC  CD+DLH DC  L  +
Sbjct  425  LHPLTLLVAK-KFRYRCDACRFGIHGFRYRCDTCDFDLHPDCLSLKAN  471


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 47/105 (45%), Gaps = 3/105 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    +   +   C  C   I G  +GC+ C F++H   C++L  +IHH SH
Sbjct  238  RHFSHEHILILREIPKNNDIFCHGCREAIQGPTYGCDPCKFYLH-KSCVELPREIHHESH  296

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGIC-DYDLHVDCA  312
              H L LR         C AC    N   Y C  C  +DL + CA
Sbjct  297  -EHYLRLRLSDISKQITCHACGKLFNGFTYHCDTCYKFDLDIGCA  340



>ref|XP_010067903.1| PREDICTED: uncharacterized protein LOC104454684 [Eucalyptus grandis]
Length=387

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 80/185 (43%), Gaps = 10/185 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH-TSH  180
            H SHPHPL   +       +CS C L  +G  +GC  C +F+H   C  +  QI+H    
Sbjct  10   HFSHPHPLTLNHQPQPQHASCSGCKLKTAGWTYGCAPCSYFLH-ISCSKMPPQINHPVDQ  68

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTL  351
              H L L P    P  +  CDAC    +   YRC  C+ DLH+ CA +  + T      L
Sbjct  69   YHHILTLIPTPVYPVGVFRCDACGKQGSGFSYRCASCNLDLHITCASMPLTQTHPSHHHL  128

Query  352  MRLYYSFP-VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC--GKPVILKHQPCFLR  522
            + L +S P    S  C  C    S +  W++      F AH +C   KPV     P    
Sbjct  129  LNLTFSPPYTNRSFSCDICQNLGSSQ--WLYRCHSCEFDAHLSCTMKKPVAPVSTPLQQL  186

Query  523  PLMRY  537
            P+  Y
Sbjct  187  PMQSY  191



>ref|XP_002863648.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=239

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 70/155 (45%), Gaps = 11/155 (7%)
 Frame = +1

Query  34   FNLEIQDGTNCSICSLPISGLAHGC--EACDFFIHDDDCLDLKLQIHHTSHPAHPLHL--  201
            F  + +D T CS C L ++G A  C    CD+F+H   C DL  + +H SH  HPL L  
Sbjct  14   FKAKEEDETACSGCELELTGQAFKCIKSECDYFLHKS-CFDLPNETNHKSHQDHPLTLLH  72

Query  202  RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGTLMRLYYSFPV  378
             PP     + CDAC    +   Y    C+Y+LHV CA +  T D       + L Y  P 
Sbjct  73   SPPDDRSVYTCDACDQYGSGFTYHFSNCNYNLHVGCAFIPETVDREDHEHPLTLLYCTPC  132

Query  379  GAS----VWCKKCNGEISRRGGWVWYDKDTGFTAH  471
                     C  C+  IS    W++Y K+  +  H
Sbjct  133  KGREDTIFTCSVCDETIS-EDLWMYYCKECDYGTH  166



>gb|EYU27101.1| hypothetical protein MIMGU_mgv1a018252mg, partial [Erythranthe 
guttata]
Length=182

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 78/172 (45%), Gaps = 16/172 (9%)
 Frame = +1

Query  1    NHASHPHPL----YQFNLEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQI  165
            +H SHPHPL    YQ  L +   + C+ C L  SG+ + C  C D+F+H   C ++  +I
Sbjct  17   HHFSHPHPLKPIAYQQTLNLT--SPCAACKLKPSGMIYTCTVCKDYFLHKQ-CFEMPRKI  73

Query  166  HHTSHPAHPLHLRPPS--FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL---TTSD  330
             H  H   PL L P +       +CD C    +   Y C  C YDLH+ CA++    T +
Sbjct  74   DHLCH-EKPLTLLPKTGYAKGYFVCDGCGQTGDGFSYNCDPCGYDLHMLCALMPLFATHE  132

Query  331  TAVDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
            + V    +      P   S  C  C G    R  W++  K   F AH NC +
Sbjct  133  SHVHKLDLTFESPEPT-KSFACGIC-GNPGSRQLWLYRCKLCEFNAHLNCAR  182



>ref|XP_009401012.1| PREDICTED: uncharacterized protein LOC103985121 [Musa acuminata 
subsp. malaccensis]
Length=294

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 82/176 (47%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            NH SHPHPL   +L+ Q  T   C+ C+   SG A+ C+AC++ +H   C ++  +I H 
Sbjct  11   NHFSHPHPLELASLQ-QSLTPPTCAGCTFRASGWAYSCKACNYTLH-ISCAEMPQRIRHP  68

Query  175  SHPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDG  345
            +HP H L L   P   + +  CDAC        Y C  C  DLH  CA +  S +     
Sbjct  69   AHPQHSLTLLTVPAYKEGSFNCDACGHDGAGFSYHCEPCGVDLHSLCASMPLSVSHGAHE  128

Query  346  TLMRLYYSFPVGASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQP  510
              + L +S P   + + C  C G  S    W++      F AH  C    +L+ +P
Sbjct  129  HPLSLVFSVPYENNGFSCDLCGGMGSNH--WLYRCAMCEFDAHIGCATANMLQAEP  182



>gb|KDO59888.1| hypothetical protein CISIN_1g001175mg [Citrus sinensis]
Length=1132

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL    L   D  NC +CS  I+G  +GC  C+F+IH+    +   +I H  H
Sbjct  86   EHCSHRHPLTLMKLHDID-MNCKLCSKSINGPGYGCAPCEFYIHNSCRDEFPQEIRHPFH  144

Query  181  PAHPLHL---RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLT  321
            P H L L    P  +D    CDAC        YRC +C ++LH++C+ L 
Sbjct  145  PRHSLQLLDGEPNRYD----CDACQFNIQGLRYRCDMCAFNLHLECSSLK  190


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 2/108 (2%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L           NC  C   I G  +GC  C+F+IH   C +L  ++ H  H 
Sbjct  439  HFSHEHHLDVIPESEVTNLNCEFCCKTIDGRCYGCVGCEFYIHIS-CSELPTEVRHPFHQ  497

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
             HPL L        + CDAC    +   YRC  CD+DLH DC  L  +
Sbjct  498  LHPLTLLVAK-KFRYRCDACRFGIHGFRYRCDTCDFDLHPDCLSLKAN  544


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 47/105 (45%), Gaps = 3/105 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    +   +   C  C   I G  +GC+ C F++H   C++L  +IHH SH
Sbjct  311  RHFSHEHILILREIPKNNDIFCHGCREAIQGPTYGCDPCKFYLH-KSCVELPREIHHESH  369

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGIC-DYDLHVDCA  312
              H L LR         C AC    N   Y C  C  +DL + CA
Sbjct  370  -EHYLRLRLSDISKQITCHACGKLFNGFTYHCDTCYKFDLDIGCA  413



>ref|XP_010417918.1| PREDICTED: uncharacterized protein LOC104703584 [Camelina sativa]
Length=705

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 57/182 (31%), Positives = 85/182 (47%), Gaps = 23/182 (13%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T+   CS C L   +G  + C  C+F +H+  C  +K  I 
Sbjct  14   NHFSHPH-----GLQLTPATSSPPCSACKLAGGNGRVYSCRPCNFSLHES-CSKMKQVIT  67

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTS--DTA  336
            H SHP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA  T S    +
Sbjct  68   HPSHPSHTLSLLVAPVYDGGYFNCDGCGVHGTGFSYQCSLCDFDIHALCAYKTLSIIHNS  127

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVIL  498
                 ++L +  P GA+   K  + +I  + G   W++      F AH  C     P +L
Sbjct  128  HPQHNLKLTFHPPYGAN---KGFSCDICLKIGKNQWLYRCIPCEFDAHVGCIAAPNPHLL  184

Query  499  KH  504
            +H
Sbjct  185  QH  186



>ref|XP_010653882.1| PREDICTED: uncharacterized protein LOC104880120 [Vitis vinifera]
Length=290

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 71/166 (43%), Gaps = 9/166 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQ--DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH HPL + NL+ Q      CS C    SG  +GC  C++F+H   C  +   ++H  
Sbjct  11   HFSHEHPLKRMNLQDQTTKTVTCSGCEFEASGWVYGCNTCNYFLHKP-CSKMPEILNHPF  69

Query  178  HPAHPLHLRPPSFDPN--HICDACLSPANTPLYRCGICDYDLHVDCAVLTTS-DTAVDGT  348
             P H L L P    P    ICDAC        Y C  C  DLH  CA L TS D +    
Sbjct  70   DPDHTLLLFPNPVYPGGAFICDACREIGTGFSYHCTECQIDLHNLCAFLPTSVDHSSHHH  129

Query  349  LMRLYYSFPV-GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             + L+   P       C  C    S++  W++      F AH +C 
Sbjct  130  TLDLWSGSPYKNEEFLCDICQDPGSKQ--WLYRCNSCQFDAHMSCA  173



>ref|XP_006494732.1| PREDICTED: uncharacterized protein LOC102619482 isoform X2 [Citrus 
sinensis]
Length=1027

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL    L   D  NC +CS  I+G  +GC  C+F+IH+    +   +I H  H
Sbjct  13   EHCSHRHPLTLMKLHDID-MNCKLCSKSINGPGYGCAPCEFYIHNSCRDEFPQEIRHPFH  71

Query  181  PAHPLHL---RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLT  321
            P H L L    P  +D    CDAC        YRC +C ++LH++C+ L 
Sbjct  72   PRHSLQLLDGEPNRYD----CDACQFNIQGLRYRCDMCAFNLHLECSSLK  117


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 2/108 (2%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L           NC  C   I G  +GC  C+F+IH   C +L  ++ H  H 
Sbjct  366  HFSHEHHLDVIPESEVTNLNCEFCCKTIDGRCYGCVGCEFYIHIS-CSELPTEVRHPFHQ  424

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
             HPL L        + CDAC    +   YRC  CD+DLH DC  L  +
Sbjct  425  LHPLTLLVAK-KFRYRCDACRFGIHGFRYRCDTCDFDLHPDCLSLKAN  471


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 47/105 (45%), Gaps = 3/105 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    +   +   C  C   I G  +GC+ C F++H   C++L  +IHH SH
Sbjct  238  RHFSHEHILILREIPKNNDIFCHGCREAIQGPTYGCDPCKFYLH-KSCVELPREIHHESH  296

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGIC-DYDLHVDCA  312
              H L LR         C AC    N   Y C  C  +DL + CA
Sbjct  297  -EHYLRLRLSDISKQITCHACGKLFNGFTYHCDTCYKFDLDIGCA  340



>gb|EYU27120.1| hypothetical protein MIMGU_mgv1a020005mg, partial [Erythranthe 
guttata]
Length=229

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 79/172 (46%), Gaps = 17/172 (10%)
 Frame = +1

Query  1    NHASHPHPL----YQFNLEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQI  165
            +H SHPHPL    Y+  L +   + CS C +  SG+ + C  C D F+H   C D+  ++
Sbjct  11   SHFSHPHPLKLIVYKQTLNL--TSPCSACKIEPSGMIYCCIMCEDHFLH-QRCFDMPKKM  67

Query  166  HHTSHPAHPLHL-RPPSFDPNH--ICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDT  333
             H  H  H L L   PS    H  +CDAC         Y C  C  DLH+ CAV+  S T
Sbjct  68   THPCHEKHSLTLISKPSNRNEHFFVCDACSERGKGGFSYHCKPCRIDLHLLCAVMPLSVT  127

Query  334  AVDGTLMRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              D  + +L+ +F         C  C    SR+  WV+  K  GF AH  C 
Sbjct  128  H-DSHVHKLHLTFESYPEKKFSCNICMNTGSRQ--WVYRCKSCGFDAHLKCA  176



>ref|XP_009792330.1| PREDICTED: X-linked retinitis pigmentosa GTPase regulator-interacting 
protein 1-like [Nicotiana sylvestris]
Length=411

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 89/188 (47%), Gaps = 15/188 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L   N    +  +C+ C  P +   +GC +C +F+H ++CL+    + H SH
Sbjct  15   QHFSHPHILKLVNPTEAETLSCNACEKPNNPNFYGCNSCQYFLH-ENCLNAPRFLDHLSH  73

Query  181  PAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLT-TSDTAVDGTL  351
            P H L L P P++ + ++ C AC S  N   + C  C++D+H+ CA+L  T         
Sbjct  74   PYHHLTLLPVPTYTNRSYTCKACGSDGNGYSFSCAACEFDIHLHCALLPHTVFLPQHRHE  133

Query  352  MRLYYSFPV------GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG--KPVILKHQ  507
            + L +  P        ++V+      + +    W++Y  +  F  H  CG  KPV    Q
Sbjct  134  LELIFDSPFDDDEEDESTVFVCDLCRDNADLNYWLYYCAECDFGTHLECGNSKPV---SQ  190

Query  508  PCFLRPLM  531
                RP++
Sbjct  191  QVRERPVL  198



>ref|XP_006427959.1| hypothetical protein CICLE_v10027164mg, partial [Citrus clementina]
 gb|ESR41199.1| hypothetical protein CICLE_v10027164mg, partial [Citrus clementina]
Length=786

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H  Y  NLE  +  N  +C   I+G  HGC  C+F+IH + C  L   I H  HP
Sbjct  268  HFSHEH--YLVNLEAAE-VNFKLCLKNINGQCHGCAQCEFYIH-NSCASLIQGIRHPFHP  323

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLY  363
             H L L      P ++C+AC        YRC  CD+DLH++C  L  +     G    L 
Sbjct  324  RHSLTLLAIK-KPRYVCNACGFHVPDLRYRCDKCDFDLHLECVSLKAA-IEYKGHRHPLI  381

Query  364  YSFPVGASVWCKKCNGEIS  420
                +  S  C+ C  E+ 
Sbjct  382  LVQNMSYSFQCEACGCEMQ  400



>gb|EYU27125.1| hypothetical protein MIMGU_mgv1a018137mg [Erythranthe guttata]
Length=449

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 75/172 (44%), Gaps = 11/172 (6%)
 Frame = +1

Query  1    NHASHPHPLYQF--NLEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQIHH  171
            +H SHPHP+        ++    CS C+L ISG  + C+ C D+F+H   C ++  +I H
Sbjct  6    SHFSHPHPMNLIVCKQTVKLHLPCSACNLNISGTIYCCQICKDYFLH-KSCFEMPERITH  64

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
              H  H L L   P   DP   CDAC        Y C  C  +LH+ CA +    T    
Sbjct  65   PFHKQHALALITEPAYGDPRFRCDACGERGKGFSYSCKPCGINLHMSCATMPLLVTNASH  124

Query  346  TLMRLYYSF--PVGASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
               +L  +F  P   S + C  C    SR+  W++      F AH  C   V
Sbjct  125  GTHKLVLTFESPYAESKFTCDICRRIGSRQ--WLYRCGSCRFDAHLKCAAAV  174



>gb|KDO50452.1| hypothetical protein CISIN_1g047354mg [Citrus sinensis]
Length=415

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 67/149 (45%), Gaps = 7/149 (5%)
 Frame = +1

Query  46   IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPA--HPLHLRPPSFD  219
            I+D   C +C   I G  +GC  C+F+IH + C +L  ++ H  HP   H L L+   F 
Sbjct  14   IEDDVKCKLCCKHIHGSGYGCAPCEFYIH-NSCAELPKELRHPLHPLPNHSLTLQESKFL  72

Query  220  PNHICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYSFPVGASVWC  396
              + CDAC    N  + YRC  CD+ LH++CA L  S    +G    L     +     C
Sbjct  73   EGYYCDACDLNVNPGVCYRCDYCDFALHLECAYLKPS-VKYEGHEHLLILVENMSYQGIC  131

Query  397  KKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            + C  EI   G +        F  H  CG
Sbjct  132  EACGFEI--EGTFFVRCVQCCFNLHVQCG  158


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 69/166 (42%), Gaps = 9/166 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQ--DGTNCSICSLPISG--LAHGCEACDFFIHDDDCLDLKLQIH  168
             H SH H LY F LE +  DG  C  C   I     A+GC+ C F++H   C +L  Q  
Sbjct  236  RHFSHDHCLY-FALESKRNDGVTCYACERLIQADDPAYGCDPCGFYLHKS-CAELPWQPQ  293

Query  169  HTSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            H  H  HPL++         +C AC    +  +Y C  CD+ L +DC  L          
Sbjct  294  HLLH-RHPLYVSTDHSKTERVCSACHKNVSGFIYECNRCDFTLDIDCFSLQFRVELQGDE  352

Query  349  LMRLYYSFPVGASVWCKKCN--GEISRRGGWVWYDKDTGFTAHFNC  480
             +  ++   V      + C+   E       V+Y  +  F A F+C
Sbjct  353  QIFTFFENLVDDEYDAQICDICEEERHPKACVYYCSECDFIAEFDC  398



>ref|XP_011088894.1| PREDICTED: uncharacterized protein LOC105170014 [Sesamum indicum]
Length=197

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 56/113 (50%), Gaps = 8/113 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTN--CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            HASHPH L        +  N  C  C+LP+ G  + C  C+F++H   C DL    H  S
Sbjct  3    HASHPHDLSVAPNTPHENKNLACFGCNLPLFGTCYSCSTCNFYLHKF-CFDLPQSSHVAS  61

Query  178  HPAHPLHLRPPSF--DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSD  330
            HP H L L  P +   P   CD+C    N   Y C  C+Y++H  CAVL  SD
Sbjct  62   HPNHTLGLLYPPYCHGP---CDSCGDSCNGFTYNCTFCNYNIHASCAVLLHSD  111



>ref|XP_004229362.2| PREDICTED: uncharacterized protein LOC101255237 [Solanum lycopersicum]
Length=789

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 83/182 (46%), Gaps = 18/182 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SHPH L    +   +   C+ C  P I+   +GC  C +F+H++ CL+    + H+S
Sbjct  12   QHFSHPHILIPI-VNPTETLTCNACEQPNITSNFYGCNTCQYFLHEN-CLNAPRFLDHSS  69

Query  178  HPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVDG  345
            HP+H L L P P++ + +  C AC S  N   + C  CD+D+HV CA+L  T        
Sbjct  70   HPSHHLTLLPAPTYSNRSFTCKACGSAGNGCSFSCACCDFDIHVQCALLPQTVVLPQQHH  129

Query  346  TLMRLYYSFPV------GASVWCKKC--NGEISRRGGWVWYDKDTGFTAHFNCGKPVILK  501
              + L +  P            C  C  N ++S    W++Y  D  F  H  C     ++
Sbjct  130  HELELIFESPYDDDADESTVFICDVCHDNADLS---NWLYYCADCDFGTHLKCAISKSVR  186

Query  502  HQ  507
             Q
Sbjct  187  QQ  188


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 88/187 (47%), Gaps = 20/187 (11%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SHPH L    +   +   C+ C  P I+   +GC  C +F+H++ CL+    ++H+S
Sbjct  491  QHFSHPHILKPI-VNPTETLTCNACEHPNITSNFYGCNTCQYFLHEN-CLNAPRFLNHSS  548

Query  178  HPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD--G  345
            HP+H L L P P++ + ++ C AC S      + C  C++D H+ CA+L  +        
Sbjct  549  HPSHHLTLLPTPTYSNRSYTCKACGSAGKGCSFSCACCEFDTHMHCALLPQTVVLPQHHH  608

Query  346  TLMRLYYSFPV---GASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNCG--------KP  489
              + L +  P    G +V+ C  C   +     W +Y  D  F  H  CG        +P
Sbjct  609  HELELIFESPFYDDGNTVFVCDLCRDNVD-LNNWFYYCADCDFGTHLECGISKTVSQERP  667

Query  490  VILKHQP  510
             +L ++P
Sbjct  668  ELLGNKP  674


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 77/170 (45%), Gaps = 13/170 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLA-HGCEA--CDFFIHDDDCLDLKLQIHHT  174
            H SH HPL    ++  +   CS C   +   A + C    C+F +H   C +L  +I H+
Sbjct  224  HFSHSHPLELCKVQQSNEIICSGCEDELCDTANYKCTKSICEFTLHKS-CFELPEKIQHS  282

Query  175  SHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAV-LTTSDTAVDG  345
            SHP HPL L P S +      C+AC    N+ +Y C  C++ LH  CA  L  + T  D 
Sbjct  283  SHPNHPLTLYPTSPERRLYFGCNACGEIPNSFVYECLECNFSLHAKCATSLAENITREDH  342

Query  346  T-LMRLYYSFPV----GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
               ++L Y +P        ++C  C+G       W++Y  +     H  C
Sbjct  343  QHSLKLQYQWPFPSEDSVDIYCNVCDG-YCNDSLWLYYCAECKLGTHLKC  391



>gb|KDO38181.1| hypothetical protein CISIN_1g048092mg, partial [Citrus sinensis]
Length=471

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H  Y  NLE  +  N  +C   I+G  HGC  C+F+IH + C  L   I H  HP
Sbjct  132  HFSHEH--YLVNLEAAE-VNFKLCLKNINGQCHGCAQCEFYIH-NSCASLIQGIRHPFHP  187

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLY  363
             H L L      P ++C+AC        YRC  CD+DLH++C  L  +     G    L 
Sbjct  188  RHSLTLLAIK-KPRYVCNACGFHVPDLRYRCDKCDFDLHLECVSLKAA-IEYKGHRHPLI  245

Query  364  YSFPVGASVWCKKCNGEIS  420
                +  S  C+ C  E+ 
Sbjct  246  LVQNMSYSFQCEACGCEMQ  264



>dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum]
Length=212

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 75/178 (42%), Gaps = 14/178 (8%)
 Frame = +1

Query  1    NHASHPHPLYQF---NLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            NH SHPHPL      N        CS C +   G  + C++C+FF+H + C  +  QI H
Sbjct  16   NHFSHPHPLELITNQNFASSSSQLCSGCKIQAIGSIYTCKSCNFFLHTE-CSQMPQQITH  74

Query  172  TSHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA-VD  342
                 H   L P    P+    CDAC    +   Y C  C  DLH+ CAV     T    
Sbjct  75   PFDKEHHFTLLPKPIYPDGKFNCDACGENGDGFSYHCKTCGTDLHILCAVFPQCVTHWSH  134

Query  343  GTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNCGKPVILKHQ  507
               + L +S P     +C     +I ++ G   W++  +  GF AH NC       HQ
Sbjct  135  HHQLDLKFSPPYPGKSFC----CDICKKVGTNHWLYRCQTCGFDAHLNCTTLQAPPHQ  188



>ref|XP_006373734.1| hypothetical protein POPTR_0016s04400g [Populus trichocarpa]
 gb|ERP51531.1| hypothetical protein POPTR_0016s04400g [Populus trichocarpa]
Length=698

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPDHPLILINQVLEYSCELVICSGCEGPIWGPGYSCTSCYFFLHKK-CAELPREIM  62

Query  169  HTSHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               HP HPLHL P S +   + CD C     + +Y C +C++DL + CA
Sbjct  63   RCIHPRHPLHLLPKSPYKGEYGCDRCQKTCKSFVYHCSVCEFDLDIKCA  111


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 5/112 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H  HP  L +      +G  C +C  P+SG ++ C +C+FF+H   C +L  +I    HP
Sbjct  128  HKDHPLILNEEQEYHGEGVQCCVCKEPMSGPSYSCTSCNFFLH-KKCAELPPEIKQHLHP  186

Query  184  AHPLHLRPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDCAVLTTSDTA  336
             HPL L P   + + ICD C      + LY C +C+Y+LH+ CA     D A
Sbjct  187  EHPLRLLP---NHDMICDFCNETCYESFLYFCIVCEYNLHIKCAFPPCIDAA  235



>gb|EYU27145.1| hypothetical protein MIMGU_mgv1a023592mg, partial [Erythranthe 
guttata]
Length=204

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 16/161 (10%)
 Frame = +1

Query  43   EIQDGTNCSICSLPISGL-AHGCEA--CDFFIHDDDCLDLKLQIHHTSHPAHPLHLRP--  207
            E ++   CS+C L +S   A+ C    C F +H   C +L  +  H SHP H   L    
Sbjct  23   EDEEIVICSVCILQLSSSDAYACTKTDCKFILHKS-CFELPHKFKHKSHPDHVFTLLSEL  81

Query  208  -PSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVDGTLMRLYYS---  369
             PS   +  C AC        ++C  CDY +HV CA+L  T    A +   + LYYS   
Sbjct  82   HPSSTTSLSCSACSDAVTGFAFQCDSCDYKMHVKCALLPETVECRAHEHKHLDLYYSTSK  141

Query  370  --FPVGASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              +   ++V+ C  C+G+++  G W +Y K+  F AH +C 
Sbjct  142  IRYEEYSNVFSCDVCDGDVA-EGYWTYYCKECDFGAHLDCA  181



>ref|XP_006428003.1| hypothetical protein CICLE_v10027267mg, partial [Citrus clementina]
 gb|ESR41243.1| hypothetical protein CICLE_v10027267mg, partial [Citrus clementina]
Length=853

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL    L   D  NC +CS  I+G  +GC  C+F+IH+    +   +I H  H
Sbjct  140  EHCSHRHPLTLMKLHDID-MNCKLCSKSINGPGYGCAPCEFYIHNSCRDEFPQEIRHPFH  198

Query  181  PAHPLHL---RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLT  321
            P H L L    P  +D    CDAC        YRC +C ++LH++C+ L 
Sbjct  199  PRHSLQLLDGEPNRYD----CDACQFNIQGLRYRCDMCAFNLHLECSSLK  244


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 2/108 (2%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L           NC  C   I G  +GC  C+F+IH   C +L  ++ H  H 
Sbjct  493  HFSHEHHLDVIPESEVTNLNCEFCCKTIDGRCYGCVGCEFYIHIS-CSELPTEVRHPFHQ  551

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
             HPL L        + CDAC    +   YRC  CD+DLH DC  L  +
Sbjct  552  LHPLTLLVAK-KFRYRCDACRFGIHGFRYRCDTCDFDLHPDCLSLKAN  598


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 47/105 (45%), Gaps = 3/105 (3%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    +   +   C  C   I G  +GC+ C F++H   C++L  +IHH SH
Sbjct  365  RHFSHEHILILREIPKNNDIFCHGCREAIQGPTYGCDPCKFYLH-KSCVELPREIHHESH  423

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGIC-DYDLHVDCA  312
              H L LR         C AC    N   Y C  C  +DL + CA
Sbjct  424  -EHYLRLRLSDISKQITCHACGKLFNGFTYHCDTCYKFDLDIGCA  467



>ref|XP_006464849.1| PREDICTED: uncharacterized protein LOC102606978 [Citrus sinensis]
Length=332

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 55/108 (51%), Gaps = 5/108 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H  Y  NLE  +  N  +C   I+G  HGC  C+F+IH + C  L   I H  HP
Sbjct  216  HFSHEH--YLVNLEAAE-VNFKLCLKNINGQCHGCAQCEFYIH-NSCASLIQGIRHPFHP  271

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS  327
             H L L      P ++C+AC        YRC  CD+DLH++C  L  +
Sbjct  272  RHSLTLLAIK-KPRYVCNACGFHVPDLRYRCDKCDFDLHLECVSLKAA  318



>ref|XP_002530545.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31836.1| protein binding protein, putative [Ricinus communis]
Length=324

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 73/169 (43%), Gaps = 8/169 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQ-DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SHPHPL+  NL+     T+CS C L  SG  + C  C+F +H   C  L   I H SH
Sbjct  12   HFSHPHPLHLSNLQSSYPITHCSACQLESSGWMYSCNPCNFTLH-LSCSQLPSLITHPSH  70

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTL  351
            P H L L P    PN +  CDAC        Y C  C +D+H  CA    S T      L
Sbjct  71   PNHTLDLLPSPIYPNGVFSCDACGHGGLGFGYHCNHCSFDIHTTCAQNPLSLTNQFHPHL  130

Query  352  MRLYYSFPVGASVW-CKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVI  495
            ++L +  P     + C  C    S    W++      F AH  C    +
Sbjct  131  LQLTFDPPYHTKGFSCDICQKIGSNH--WLYRCAPCEFDAHLECAMGAV  177



>gb|EYU27152.1| hypothetical protein MIMGU_mgv1a026602mg, partial [Erythranthe 
guttata]
Length=184

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 77/173 (45%), Gaps = 19/173 (11%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H +    L+  D   C+ C   ++    GC  C FF+H ++C  +   + H SHP
Sbjct  8    HFSHEHIMIPIELDEDDEVKCNACEQLLTEPFIGCPPCQFFLH-ENCFHVPRSMDHPSHP  66

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGI-CDYDLHVDCAVLTTSDTAVDGTLMRL  360
            +HPL L P    P + C+AC S      + CG  C++ LH+ CA+L  + +  D     L
Sbjct  67   SHPLTLDPTPPHP-YTCNACGSHGKAFGFGCGAHCEFHLHLRCAILPETFSYDDEHPHGL  125

Query  361  YYSFP------VGAS-------VWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
               F       +G S       + C  CN     +  W++Y +   + AH  C
Sbjct  126  ELVFEPPSFKNLGTSDDSQLVKIPCYICN---ENQVSWLYYCEACEYVAHLKC  175



>ref|XP_011039457.1| PREDICTED: uncharacterized protein LOC105136013 isoform X2 [Populus 
euphratica]
Length=649

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N E++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPVHPLILINQELEYCGELVICSGCDEPIWGPCYSCTSCYFFLHKK-CAELPREIK  62

Query  169  HTSHPAHPLHL--RPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL  +PPS +    ICD C     + +Y C +C +DLH+ CA
Sbjct  63   RHIHFKHPLHLLAKPPSHYIWGCICDLCKKTCESFVYHCSVCKFDLHIKCA  113


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +1

Query  52   DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHL--RPPSFDP-  222
            +G  CS C  PISG ++ C +C+FF+H   C +L  +I    HP HPLHL  +PP+    
Sbjct  146  EGVMCSGCDEPISGPSYRCTSCNFFLHKK-CTELPQEIKRCLHPQHPLHLSAKPPAHHTW  204

Query  223  NHICDACLSPANTPLYRCGICDYDLHVDCAV  315
              +CD C     + +YRC  C++ L + CA+
Sbjct  205  KWMCDLCNKTCKSFVYRCSFCNFYLDIKCAL  235


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 8/165 (5%)
 Frame = +1

Query  19   HPL-YQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPL  195
            HPL    N   +D   C+IC     G ++ C+ C  F+        K  I H  H  HPL
Sbjct  431  HPLTLILNTWEEDPFQCAICEQYCHGFSYNCDRCHSFLDVRCFKSTKDSIEHGGH-EHPL  489

Query  196  HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGTLMRLYYSF  372
            +L   S   N  C  C     +  +RC +CD++L   CA L   +    D   + L Y  
Sbjct  490  YLAVES--ENRHCSGCGISGESQTFRCVVCDFNLDFKCATLPDKARHRYDEHPLFLTYVD  547

Query  373  PVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC--GKPVILK  501
            P      C+ C  E   +  W +  ++  F AH  C  GK   +K
Sbjct  548  PNDYQYVCQICEKERDPK-LWFYRCEECDFDAHRECVLGKNPFIK  591



>ref|XP_004241463.2| PREDICTED: uncharacterized protein LOC101268692 [Solanum lycopersicum]
Length=388

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 54/106 (51%), Gaps = 4/106 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L +   ++QD + CS C LP SG  + C  C+F +H   C      I H SH
Sbjct  33   KHFSHPHEL-ELCTQLQDLSPCSGCRLPPSGQMYICRPCNFTLH-LSCAKFPQLITHPSH  90

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCA  312
            P H L+L P S  P     CDAC        Y C  C++DLHV CA
Sbjct  91   PNHSLNLLPTSKYPGGQFNCDACKRHGTGFSYHCSYCEFDLHVICA  136



>gb|KCW66146.1| hypothetical protein EUGRSUZ_G03410 [Eucalyptus grandis]
Length=362

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 79/183 (43%), Gaps = 9/183 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH-TSH  180
            H SHPHPL   +       +CS C L  +G  +GC  C +F+H   C  +  QI+H    
Sbjct  10   HFSHPHPLTLNHQPQPQHASCSGCKLKTAGWTYGCAPCSYFLH-ISCSKMPPQINHPVDQ  68

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTL  351
              H L L P    P  +  CDAC    +   YRC  C+ DLH+ CA +  + T      L
Sbjct  69   YHHILTLIPTPVYPVGVFRCDACGKQGSGFSYRCASCNLDLHITCASMPLTQTHPSHHHL  128

Query  352  MRLYYSFP-VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG-KPVILKHQPCFLRP  525
            + L +S P    S  C  C    S +  W++      F AH +C  K     HQP    P
Sbjct  129  LNLTFSPPYTNRSFSCDICQNLGSSQ--WLYRCHSCEFDAHLSCTMKKPAQNHQPPPQLP  186

Query  526  LMR  534
              R
Sbjct  187  QAR  189



>gb|EYU39949.1| hypothetical protein MIMGU_mgv1a026991mg [Erythranthe guttata]
Length=228

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 73/168 (43%), Gaps = 8/168 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA-HGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH H L  + +E      C+ C LP    +   C  C FF+H+  C +    + H +
Sbjct  4    KHFSHQHNLTLYRVEPGQQFQCNGCHLPCQKDSIFACWMCSFFLHEH-CGNANRYVKHPA  62

Query  178  HPAHPLHLR--PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD---  342
            H  HPL L   P       +C+ C  P     Y C +C+ DLHV CA L    + V+   
Sbjct  63   HAPHPLVLMVAPTYCSATFLCNCCGRPGTALSYCCPLCEIDLHVPCAYLPLKVSHVNHPH  122

Query  343  GTLMRLYYSFPVGASVWCKKCNGEIS-RRGGWVWYDKDTGFTAHFNCG  483
               +RL        + +CK C+ E+S +   +V   ++  F  H  CG
Sbjct  123  ELFLRLGSQITEAPTQYCKICSNEVSCKYWRYVCDKEECDFRVHTFCG  170



>ref|XP_002317723.2| DC1 domain-containing family protein [Populus trichocarpa]
 gb|EEE95943.2| DC1 domain-containing family protein [Populus trichocarpa]
Length=326

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 72/168 (43%), Gaps = 7/168 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            NH SHPHPL   N +     +CS C+L  SG  + C+ C+F +H   C  +   I H  H
Sbjct  11   NHFSHPHPLELSNAQSLYMNSCSACNLQPSGWMYSCKPCNFTLH-ISCTQMPTLITHPCH  69

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGT  348
            P HPL L      P  +  CD C    N   Y C  CD+D+H+ CA   L+ +  +    
Sbjct  70   PIHPLTLFSTPVYPGGSFNCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHQSHPHQ  129

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPV  492
            L   +Y         C  C+   S    W++      F AH  C   V
Sbjct  130  LNLAFYPPYQTKGFCCDICHKIGSNH--WLYRCSACEFDAHMKCAMSV  175



>ref|XP_011039456.1| PREDICTED: uncharacterized protein LOC105136013 isoform X1 [Populus 
euphratica]
Length=674

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N E++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPVHPLILINQELEYCGELVICSGCDEPIWGPCYSCTSCYFFLHKK-CAELPREIK  62

Query  169  HTSHPAHPLHL--RPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL  +PPS +    ICD C     + +Y C +C +DLH+ CA
Sbjct  63   RHIHFKHPLHLLAKPPSHYIWGCICDLCKKTCESFVYHCSVCKFDLHIKCA  113


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +1

Query  52   DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHL--RPPSFDP-  222
            +G  CS C  PISG ++ C +C+FF+H   C +L  +I    HP HPLHL  +PP+    
Sbjct  146  EGVMCSGCDEPISGPSYRCTSCNFFLHKK-CTELPQEIKRCLHPQHPLHLSAKPPAHHTW  204

Query  223  NHICDACLSPANTPLYRCGICDYDLHVDCAV  315
              +CD C     + +YRC  C++ L + CA+
Sbjct  205  KWMCDLCNKTCKSFVYRCSFCNFYLDIKCAL  235


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 8/165 (5%)
 Frame = +1

Query  19   HPL-YQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPL  195
            HPL    N   +D   C+IC     G ++ C+ C  F+        K  I H  H  HPL
Sbjct  456  HPLTLILNTWEEDPFQCAICEQYCHGFSYNCDRCHSFLDVRCFKSTKDSIEHGGH-EHPL  514

Query  196  HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGTLMRLYYSF  372
            +L   S   N  C  C     +  +RC +CD++L   CA L   +    D   + L Y  
Sbjct  515  YLAVES--ENRHCSGCGISGESQTFRCVVCDFNLDFKCATLPDKARHRYDEHPLFLTYVD  572

Query  373  PVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC--GKPVILK  501
            P      C+ C  E   +  W +  ++  F AH  C  GK   +K
Sbjct  573  PNDYQYVCQICEKERDPK-LWFYRCEECDFDAHRECVLGKNPFIK  616



>emb|CDY67171.1| BnaCnng53840D [Brassica napus]
Length=233

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 70/168 (42%), Gaps = 14/168 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGC---EACDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C  L  + +H
Sbjct  8    RHPSHNHPLRSHKCEAKDEIICSGCDLDLIGAAFKCTKSSECDYFLHKS-CFSLPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-  342
             SH  H L L   P S    + C AC    ++  Y C IC YD+HV C  +  +    D 
Sbjct  67   KSHQPHCLTLLYSPKSM---YTCQACGEYGSSFTYNCSICQYDVHVGCVSMPETVKREDH  123

Query  343  GTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFN  477
               + L YS P    G    C  C  E      W +Y  +  +  H +
Sbjct  124  AHPLTLLYSSPYTEPGLVFTCDVCK-ETVPDNLWAYYCMECDYGTHLH  170



>ref|XP_009125148.1| PREDICTED: uncharacterized protein LOC103850185 [Brassica rapa]
Length=233

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 70/167 (42%), Gaps = 14/167 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C  L  + +H
Sbjct  8    RHPSHNHPLRSHKCEAKDEIICSGCDLDLIGAAFKCTKSSDCDYFLHKS-CFSLPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-  342
             SH  H L+L   P S    + C AC    ++  Y C IC YD+HV C  +  +    D 
Sbjct  67   KSHQPHCLNLLYSPKSM---YTCHACGEYGSSFTYNCSICQYDVHVGCVSMPETVKREDH  123

Query  343  GTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
               + L YS P    G    C  C  E      W +Y  +  +  H 
Sbjct  124  AHPLTLLYSSPYTEPGLVFTCDVCK-ETVPDNLWAYYCMECDYGTHL  169



>gb|EYU27127.1| hypothetical protein MIMGU_mgv1a026504mg [Erythranthe guttata]
Length=426

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 78/176 (44%), Gaps = 21/176 (12%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQD------GTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQ  162
            H SHPHPL   +++ Q        ++C  C L +SG  + C  C DFF+H   C D+  +
Sbjct  20   HFSHPHPLKLISIDHQQQQQTLISSSCLGCDLNLSGTIYSCTICKDFFLH-KKCFDMPKK  78

Query  163  IHHTSHPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSD  330
            I H  H  H L L P P++      CDAC        Y C  C+ DLH+ CA   L+ ++
Sbjct  79   ITHPFHKDHTLTLLPKPAYSTGVFNCDACFETGKGFSYSCEPCEIDLHILCASMPLSVTN  138

Query  331  TAVDGTLMRLYYSFPVGASVW----CKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
            T      + L Y  P     +    CKK  G+      W++      F AH  C +
Sbjct  139  TTCHPHKLDLTYGSPYETKNFTCDVCKKIGGD-----HWLYRCGACEFDAHLKCAR  189



>emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera]
Length=366

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 54/105 (51%), Gaps = 6/105 (6%)
 Frame = +1

Query  13   HPHPLYQFNLEIQDG---TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H HPL   N   Q      +CS C L  SGL + C+ C++F+H   C  +  QI H+ H 
Sbjct  23   HSHPLQLSNHHPQQTLTLASCSGCKLKASGLIYDCKRCNYFLHIS-CSQMPQQITHSFHK  81

Query  184  AHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCA  312
            AH L L P    P  +  CDAC    N   Y CG+C+ DLH+ CA
Sbjct  82   AHALSLLPNPAYPEGLFNCDACGKQGNGFSYHCGVCNIDLHILCA  126



>ref|XP_007162329.1| hypothetical protein PHAVU_001G142800g [Phaseolus vulgaris]
 gb|ESW34323.1| hypothetical protein PHAVU_001G142800g [Phaseolus vulgaris]
Length=564

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 58/124 (47%), Gaps = 6/124 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E ++  N   CS C  PISG    CE C++ +H   C ++   + H
Sbjct  5    EHFSHIHPLL-LKQEKRNNNNRVLCSGCENPISGPVFSCEQCNYNLHKT-CAEMPRHVKH  62

Query  172  TSHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
              HP HPL L   S ++  ++CD+C       +Y C IC YDL V CA     D      
Sbjct  63   PLHPEHPLVLLSTSPYEGRYVCDSCRGIFQNFVYHCYICSYDLDVSCASQCNPDDGHKHE  122

Query  349  LMRL  360
             M +
Sbjct  123  FMSV  126



>emb|CDX67465.1| BnaA07g15050D [Brassica napus]
Length=233

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 69/167 (41%), Gaps = 14/167 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEA---CDFFIHDDDCLDLKLQIHH  171
             H SH HPL     E +D   CS C L + G A  C     CD+F+H   C  L  + +H
Sbjct  8    RHPSHNHPLRSHKCEAKDEIICSGCDLDLIGAAFKCTKSSDCDYFLHKS-CFSLPRETNH  66

Query  172  TSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVD-  342
             SH  H L L   P S    + C AC    ++  Y C IC YD+HV C  +  +    D 
Sbjct  67   KSHQPHCLTLLYSPKS---TYTCQACGEYGSSFTYNCSICQYDVHVGCVSMPETVKREDH  123

Query  343  GTLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHF  474
               + L YS P    G    C  C  E      W +Y  +  +  H 
Sbjct  124  AHPLTLLYSSPYTEPGLVFTCDVCK-ETVPDNLWAYYCMECDYGTHL  169



>ref|XP_006373751.1| hypothetical protein POPTR_0016s04730g [Populus trichocarpa]
 gb|ERP51548.1| hypothetical protein POPTR_0016s04730g [Populus trichocarpa]
Length=226

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HP    N  ++   +   CS C   I G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPDHPWILLNQALEYSCEVVICSGCEGQIWGPCYSCTSCYFFLHKK-CAELPREIK  62

Query  169  HTSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL  +PPS      CD    P N+ +Y C  C +DLH+ CA
Sbjct  63   RRIHRTHPLHLLAKPPSHYRRCACDRIAKPCNSFVYHCSSCKFDLHIKCA  112



>ref|XP_002322659.2| hypothetical protein POPTR_0016s04390g [Populus trichocarpa]
 gb|EEF04420.2| hypothetical protein POPTR_0016s04390g [Populus trichocarpa]
Length=457

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 54/109 (50%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHVSHPDHPLILINQVLEYSCELVICSGCEGPIWGPCYSCTSCYFFLHKK-CAELPREIM  62

Query  169  HTSHPAHPLHLRP-PSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL P P +     CD C    N+ +Y C  C +DL + CA
Sbjct  63   RRIHRRHPLHLLPKPPYKTRCFCDRCYKTCNSFVYHCSFCKFDLDIKCA  111


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H  HP  L +      +G  C +C  P+SG ++ C +C+ F+H   C +L  +I   SH
Sbjct  127  THKDHPLILNEEQEYHGEGVVCCVCKEPMSGPSYSCTSCNVFLH-KKCAELPPEIKRHSH  185

Query  181  PAHPLHLRPPSFDPNH--ICDACLSPANTPL-YRCGICDYDLHVDCA  312
            P HPL L      PNH  IC  C         Y C +C+++LH+ CA
Sbjct  186  PEHPLCLL-----PNHHMICSFCKETCYESFAYCCFVCEFNLHIKCA  227



>ref|XP_006359186.1| PREDICTED: uncharacterized protein LOC102578476 [Solanum tuberosum]
Length=244

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 77/167 (46%), Gaps = 10/167 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLP--ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            H SH H L +      +   C+ C  P   +   +GC  C +F+H++ C +    ++H+ 
Sbjct  14   HFSHDHIL-KLIANPTETLTCNACEQPNNTNKPFYGCNTCQYFLHEN-CFNAPRFLNHSC  71

Query  178  HPAHPLHLR-PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT-L  351
            HP+HPL L  PP     +IC+AC S  N   Y C  CD+D+H+ CA   +S      T  
Sbjct  72   HPSHPLTLHHPPYAGGYYICNACGSDGNGFCYNCAACDFDIHLQCASCPSSILVDKHTHQ  131

Query  352  MRLYYSFP---VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            + L++  P     +   C  C   +S    W++Y     F +H  C 
Sbjct  132  LELHFGSPDEDKDSKYVCDICFVTMS-NDNWLYYCAGCDFASHLYCA  177



>ref|XP_006359187.1| PREDICTED: uncharacterized protein LOC102578819, partial [Solanum 
tuberosum]
Length=190

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 81/165 (49%), Gaps = 13/165 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SHPH L +  +   +   C+ C  P I+   +GC  C +F+H++ CL+    + H+S
Sbjct  12   QHFSHPHFL-KLIVNPSETLTCNACEQPNITTTFYGCNTCQYFLHEN-CLNAPRFLDHSS  69

Query  178  HPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVDG  345
            HP+H L L P P++ + ++ C AC S  N   + C  C++D+H+ CA+L  T        
Sbjct  70   HPSHHLTLLPTPTYSNSSYTCKACGSAGNGCSFSCACCEFDVHMHCALLPQTVVLPQRHH  129

Query  346  TLMRLYYSFPV------GASVWCKKCNGEISRRGGWVWYDKDTGF  462
              + L +  P       G++++      +I     W++Y  D  F
Sbjct  130  HELELIFESPFYDDADDGSNIFVCDLCRDIVDLNNWLYYCTDCDF  174



>ref|XP_006468700.1| PREDICTED: uncharacterized protein LOC102618382 [Citrus sinensis]
Length=1272

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 72/162 (44%), Gaps = 8/162 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H  Y   L++ D   C +C   I G ++GC  C F IH+  C +L  ++ H  H
Sbjct  524  RHYSHYH--YLTVLDVGDA-ECQLCHKNIHGTSYGCTPCMFNIHES-CAELPQEVRHPFH  579

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDTAVDGTLMR  357
            P H L ++  +F   + CDAC       L YRC  CD+DLH++C  L  +    D   + 
Sbjct  580  PRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDKCDFDLHLECLSLKANIRYEDHQHLL  639

Query  358  LYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            +     +     C+ C  +I   G +     +     H  CG
Sbjct  640  ILIE-NMSCKSKCEACRCDIE--GTFFLRCVECKLNFHVQCG  678


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQ-DGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHH  171
             H SH HPL    +E++ + T C  C   I G    + C  C+F+IH   C +L  Q+ H
Sbjct  158  QHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKS-CSELPQQVRH  216

Query  172  TSHPAHPLHLRPPSFDPNHICDACLSPANTPL-YRCGICDYDLHVDCAVLT  321
              HP H L L+       + CDAC S  +  + YRC  CD+D+H +C  L 
Sbjct  217  PFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLK  267



>ref|XP_006373756.1| hypothetical protein POPTR_0016s04770g, partial [Populus trichocarpa]
 gb|ERP51553.1| hypothetical protein POPTR_0016s04770g, partial [Populus trichocarpa]
Length=696

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 55/110 (50%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  27   EHFSHPDHPLILINQVLEYSCELVICSGCEGPIWGPCYSCTSCYFFLHKK-CAELPREIK  85

Query  169  HTSHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL  +PPS      CD C    N+ +Y C  C +DL + CA
Sbjct  86   RRIHRRHPLHLLAKPPSHYTRCFCDRCYKTCNSFVYHCSFCKFDLDIKCA  135


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 80/187 (43%), Gaps = 32/187 (17%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H  HP  L +      +G  CS+C  P+SG ++ C +C+FF+H   C +L  +I    HP
Sbjct  152  HKDHPLILNEEQEYHGEGVVCSLCKEPMSGPSYSCTSCNFFLH-KKCAELPPEIKRHIHP  210

Query  184  AHPLHLRPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDCAV---LTTSDTAVDGTL  351
             HPL L P   + + IC  C      + +Y C +C+++LH+ CA    +  +D       
Sbjct  211  EHPLRLLP---NHHMICGFCKETCYESFVYCCFVCEFNLHIKCAFPPCVYAADQDQGHQF  267

Query  352  MRLY-------YSFPVGAS----------------VWCKKCNGEISRRGGWVWYDKDTGF  462
              L         SF   A                 ++C  C  E+  + G V+Y  +  F
Sbjct  268  RSLLNPLSLKSISFTCNACGTERDDSPFMCTTCQLLYCGICRLEVDSKYG-VYYCPNCDF  326

Query  463  TAHFNCG  483
             AH NC 
Sbjct  327  VAHVNCS  333



>ref|XP_010510747.1| PREDICTED: stress protein DDR48-like isoform X2 [Camelina sativa]
Length=729

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 56/182 (31%), Positives = 84/182 (46%), Gaps = 23/182 (13%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T    CS C L   +G  + C  C+F +H+  C  +K  I 
Sbjct  14   NHFSHPH-----RLQLSPATASPPCSACKLAGGNGRVYSCRPCNFSLHES-CSKMKQVIT  67

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTA  336
            H SHP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+    +
Sbjct  68   HPSHPSHTLSLLVAPVYDGGYFNCDGCGVHGTGFSYQCSLCDFDIHSLCAYKPLSIIHNS  127

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVIL  498
                 ++L +  P GA+   K  + +I  + G   W++      F AH  C     P +L
Sbjct  128  HPQHNLKLTFHPPYGAN---KGFSCDICLKIGKDQWLYRCIPCEFDAHIGCIAAPNPHLL  184

Query  499  KH  504
            +H
Sbjct  185  QH  186



>ref|XP_010510746.1| PREDICTED: uncharacterized protein LOC104786964 isoform X1 [Camelina 
sativa]
 ref|XP_010510749.1| PREDICTED: uncharacterized protein LOC104786965 [Camelina sativa]
Length=719

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 56/182 (31%), Positives = 84/182 (46%), Gaps = 23/182 (13%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T    CS C L   +G  + C  C+F +H+  C  +K  I 
Sbjct  14   NHFSHPH-----RLQLSPATASPPCSACKLAGGNGRVYSCRPCNFSLHES-CSKMKQVIT  67

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTA  336
            H SHP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+    +
Sbjct  68   HPSHPSHTLSLLVAPVYDGGYFNCDGCGVHGTGFSYQCSLCDFDIHSLCAYKPLSIIHNS  127

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVIL  498
                 ++L +  P GA+   K  + +I  + G   W++      F AH  C     P +L
Sbjct  128  HPQHNLKLTFHPPYGAN---KGFSCDICLKIGKDQWLYRCIPCEFDAHIGCIAAPNPHLL  184

Query  499  KH  504
            +H
Sbjct  185  QH  186



>ref|XP_006373731.1| hypothetical protein POPTR_0016s043802g, partial [Populus trichocarpa]
 gb|ERP51528.1| hypothetical protein POPTR_0016s043802g, partial [Populus trichocarpa]
Length=213

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 56/109 (51%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPDHPLILMNQVLEFSCELVICSGCEGPIWGPCYSCTSCYFFLHKK-CAELPREIK  62

Query  169  HTSHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL   S +  N++C+ C    N+ +Y C  C +DL + CA
Sbjct  63   RRIHRRHPLHLLAKSPYKGNYLCNRCTKTFNSFVYHCSYCKFDLDIKCA  111



>ref|XP_006373733.1| hypothetical protein POPTR_0016s04390g [Populus trichocarpa]
 gb|ERP51530.1| hypothetical protein POPTR_0016s04390g [Populus trichocarpa]
Length=650

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 54/109 (50%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHVSHPDHPLILINQVLEYSCELVICSGCEGPIWGPCYSCTSCYFFLHKK-CAELPREIM  62

Query  169  HTSHPAHPLHLRP-PSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL P P +     CD C    N+ +Y C  C +DL + CA
Sbjct  63   RRIHRRHPLHLLPKPPYKTRCFCDRCYKTCNSFVYHCSFCKFDLDIKCA  111


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H  HP  L +      +G  C +C  P+SG ++ C +C+ F+H   C +L  +I   SH
Sbjct  127  THKDHPLILNEEQEYHGEGVVCCVCKEPMSGPSYSCTSCNVFLH-KKCAELPPEIKRHSH  185

Query  181  PAHPLHLRPPSFDPNH--ICDACLSPANTPL-YRCGICDYDLHVDCA  312
            P HPL L      PNH  IC  C         Y C +C+++LH+ CA
Sbjct  186  PEHPLCLL-----PNHHMICSFCKETCYESFAYCCFVCEFNLHIKCA  227



>gb|KDO76992.1| hypothetical protein CISIN_1g045873mg [Citrus sinensis]
Length=868

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 72/162 (44%), Gaps = 8/162 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H  Y   L++ D   C +C   I G ++GC  C F IH+  C +L  ++ H  H
Sbjct  524  RHYSHYH--YLTVLDVGDA-ECQLCHKNIHGTSYGCTPCMFNIHES-CAELPQEVRHPFH  579

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDTAVDGTLMR  357
            P H L ++  +F   + CDAC       L YRC  CD+DLH++C  L  +    D   + 
Sbjct  580  PRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLL  639

Query  358  LYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            +     +     C+ C  +I   G +     +     H  CG
Sbjct  640  ILIE-NMSCKSKCEACRCDIE--GTFFLRCVECKLNFHVQCG  678


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQ-DGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHH  171
             H SH HPL    +E++ + T C  C   I G    + C  C+F+IH   C +L  Q+ H
Sbjct  158  QHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKS-CSELPQQVRH  216

Query  172  TSHPAHPLHLRPPSFDPNHICDACLSPANTPL-YRCGICDYDLHVDCAVLT  321
              HP H L L+       + CDAC S  +  + YRC  CD+D+H +C  L 
Sbjct  217  PFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLK  267



>gb|KDO77182.1| hypothetical protein CISIN_1g039635mg [Citrus sinensis]
Length=579

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 78/172 (45%), Gaps = 11/172 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL +  +   D   C IC   I G ++GC  C F+IH+  C +L  Q+ H  H
Sbjct  130  EHFSHRHPLIRLEV---DEEWCRICRNNILGPSYGCLPCKFYIHNS-CSELPQQVLHPFH  185

Query  181  PAHPLHLRPPSFDPNHICDACLSP-ANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMR  357
              H L L+  +F     CDAC S   +   YRC  CD+DLH+DC +         G    
Sbjct  186  AHHSLKLQN-TFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDC-ISVKPKIRYQGQEHL  243

Query  358  LYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG---KPVILKH  504
            L        +  C+ C+ + ++ G +     +  F  H  CG    P I++H
Sbjct  244  LVLMKSGSGTTTCQACSFD-TKPGAFFVRCVECDFKFHVQCGPASPPPIVEH  294



>ref|XP_007030565.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
 gb|EOY11067.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
Length=947

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 76/167 (46%), Gaps = 15/167 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACD-FFIHDDDCLDLKLQIHHTS  177
            +HA+H H L   N   + G  CS C L I GLA+ C  CD  +I  + CLD   ++    
Sbjct  564  SHANHEHMLVLGN--AKKGHYCSYCQLEIFGLAYCCLDCDDIYILHESCLDFPEKM---Q  618

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCA-VLTTSDTAVDGTLM  354
            HP HPLHL   + D   +CD C       +Y C  CD  LHV C   L  +     GT  
Sbjct  619  HPFHPLHLLVVNRDFYELCDFCGYGTLAIVYSCFECDLHLHVPCLNSLRQALRFKFGTHK  678

Query  355  RLYYSFPVGASV-----WCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              +Y   +G+ +     WC +C+   +   G  ++ K+   + H  C
Sbjct  679  LDFYYIGIGSQMLKEMCWCLRCDESCT---GPFYFCKEAYISFHLEC  722



>ref|XP_006427961.1| hypothetical protein CICLE_v10027263mg, partial [Citrus clementina]
 gb|ESR41201.1| hypothetical protein CICLE_v10027263mg, partial [Citrus clementina]
Length=726

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 71/163 (44%), Gaps = 10/163 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H+ H H L    L   D   C +C   I G  +GC  C+F+IH + C +L  ++ H  HP
Sbjct  193  HSIHCHTL---TLSEVDDVKCKLCCKHIHGSGYGCAPCEFYIH-NSCAELPKELRHPLHP  248

Query  184  A--HPLHLRPPSFDPNHICDAC-LSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
               H L L+   F   + CDAC L+      YRC  CD+ LH++CA L  S    +G   
Sbjct  249  LPNHSLTLQESKFLEGYYCDACDLNVNPGGCYRCDYCDFALHLECAYLKPS-VKYEGHEH  307

Query  355  RLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             L     +     C+ C  EI   G +        F  H  CG
Sbjct  308  LLILVENMSYQGICEACGFEI--EGTFFVRCVQCCFNLHVQCG  348


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 51/109 (47%), Gaps = 5/109 (5%)
 Frame = +1

Query  1    NHASHPHPLY-QFNLEIQDGTNCSICSLPISG--LAHGCEACDFFIHDDDCLDLKLQIHH  171
             H SH H LY  F  +  DG  C  C   I     A+GC+ C F++H   C +L  Q  H
Sbjct  426  RHFSHDHCLYFAFESKRNDGVTCYACERLIQADDPAYGCDPCGFYLHKS-CTELPWQPQH  484

Query  172  TSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
              H  HPL++       + +C AC    +  +Y C  CD+ L +DC  L
Sbjct  485  LLH-RHPLYVSTDHSKTDRVCSACHKNVSGFIYECNRCDFTLDIDCFSL  532



>ref|XP_006464498.1| PREDICTED: uncharacterized protein LOC102623574 [Citrus sinensis]
Length=1057

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 71/163 (44%), Gaps = 10/163 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H+ H H L    L   D   C +C   I G  +GC  C+F+IH + C +L  ++ H  HP
Sbjct  307  HSIHCHTL---TLSEVDDVKCKLCCKHIHGSGYGCAPCEFYIH-NSCAELPKELRHPLHP  362

Query  184  A--HPLHLRPPSFDPNHICDAC-LSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
               H L L+   F   + CDAC L+      YRC  CD+ LH++CA L  S    +G   
Sbjct  363  LPNHSLTLQESKFLEGYYCDACDLNVNPGGCYRCDYCDFALHLECAYLKPS-VKYEGHEH  421

Query  355  RLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             L     +     C+ C  EI   G +        F  H  CG
Sbjct  422  LLILVENMSYQGICEACGFEI--EGTFFVRCVQCCFNLHVQCG  462


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 72/164 (44%), Gaps = 10/164 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH HPL  F  +++D T C IC+  + G ++GC  C F+IH+      + Q  H  H
Sbjct  53   EHFSHQHPLDVF--QVKDAT-CRICNKNLRGQSYGCVPCGFYIHESCSKFPQQQTLHPFH  109

Query  181  PAHPLH-LRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
            P HP H L       N I  C+ACLS  N  +Y C  C++ LH  CA L   +    G  
Sbjct  110  P-HPGHFLSLSDIYKNSILDCEACLSMTNYFVYDCVKCEFCLHPQCASL-LPNVKYKGHE  167

Query  352  MRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              L     +     C+ C G I   G + +         H  CG
Sbjct  168  HLLILVENMSYKGECEACRGNI--EGTFFFRCVQCRLNFHVQCG  209


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 51/109 (47%), Gaps = 5/109 (5%)
 Frame = +1

Query  1    NHASHPHPLY-QFNLEIQDGTNCSICSLPISG--LAHGCEACDFFIHDDDCLDLKLQIHH  171
             H SH H LY  F  +  DG  C  C   I     A+GC+ C F++H   C +L  Q  H
Sbjct  540  RHFSHDHCLYFAFESKRNDGVTCYACERLIQADDPAYGCDPCGFYLHKS-CTELPWQPQH  598

Query  172  TSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
              H  HPL++       + +C AC    +  +Y C  CD+ L +DC  L
Sbjct  599  LLH-RHPLYVSTDHSKTDRVCSACHKNVSGFIYECNRCDFTLDIDCFSL  646



>ref|XP_009773620.1| PREDICTED: uncharacterized protein LOC104223817 [Nicotiana sylvestris]
Length=216

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 73/167 (44%), Gaps = 11/167 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H +H H L +FN    +G   ++C        + C  C++FI D +C  +  +I H SHP
Sbjct  35   HFTHRHALQEFN--SIEGLTYNLCKFE-HCTGYICSGCNYFI-DKNCFSIPFKIQHMSHP  90

Query  184  AHPLHL-RPPSFDPNHI-CDACLS--PANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTL  351
             HPL   R   F    + C  CL+        Y C  C + ++  CA    + T  D   
Sbjct  91   QHPLKFTRFLDFVHEDLKCSGCLADFKDRGRAYYCAPCKFIINRHCAGAPKTLTLADNVS  150

Query  352  MRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
              L++SFP     A + C  C+G +  + G ++Y+ +     H  C 
Sbjct  151  YALFFSFPFKHENAEIKCNFCSGTVLIKDGLLYYNLERDEAFHVFCA  197



>ref|XP_006448472.1| hypothetical protein CICLE_v10014060mg [Citrus clementina]
 gb|ESR61712.1| hypothetical protein CICLE_v10014060mg [Citrus clementina]
Length=1272

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 71/162 (44%), Gaps = 8/162 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L    L++ D   C +C   I G  +GC  C F IH+  C +L  ++ H  H
Sbjct  524  RHYSHYHHLTV--LDVGDA-ECQLCHKNIHGTGYGCTPCMFNIHES-CAELPQEVRHPFH  579

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPL-YRCGICDYDLHVDCAVLTTSDTAVDGTLMR  357
            P H L ++  +F   + CDAC       L YRC  CD+DLH++C  L  +    D   + 
Sbjct  580  PRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLL  639

Query  358  LYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
            +     +     C+ C  +I   G +     +     H  CG
Sbjct  640  ILIE-NMSCKSKCEACRCDIE--GTFFLRCVECKLNFHVQCG  678


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 5/111 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQ-DGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHH  171
             H SH HPL   ++E + + T C  C   I G    + C  C+F+IH   C +L  Q+ H
Sbjct  158  RHFSHRHPLILLDMESEAEDTKCKFCCKNIHGSQSYYCCGPCNFYIHKS-CSELLQQVRH  216

Query  172  TSHPAHPLHLRPPSFDPNHICDACLSPANTPL-YRCGICDYDLHVDCAVLT  321
              HP H L L+       + CDAC S  +  + YRC  CD+D+H +C  L 
Sbjct  217  PFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLK  267



>ref|XP_002323327.2| DC1 domain-containing family protein [Populus trichocarpa]
 gb|EEF05088.2| DC1 domain-containing family protein [Populus trichocarpa]
Length=675

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +1

Query  52   DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHL--RPPSFDPN  225
            +G  CS C  PISG ++ C +C+FF+H   C +L  +I    HP HPLHL  +PP+    
Sbjct  146  EGVMCSGCDEPISGPSYRCTSCNFFLHKK-CTELPQEIKRCLHPQHPLHLLAKPPAHHTG  204

Query  226  H-ICDACLSPANTPLYRCGICDYDLHVDCAV  315
              +CD C     + +YRC  C++ L + CA+
Sbjct  205  KWMCDLCNKTCKSFVYRCSFCNFYLDIKCAL  235


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 58/111 (52%), Gaps = 8/111 (7%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPVHPLILINQVLEYSGELVICSGCDEPIWGPCYSCTSCYFFLHKT-CAELPREIK  62

Query  169  HTSHPAHPLHL--RPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL  +PPS +    ICD C     + +Y C +C +DLH+ CA
Sbjct  63   RHIHFKHPLHLLAKPPSHYILGCICDLCKKTCESFVYHCSVCKFDLHIKCA  113


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (41%), Gaps = 8/165 (5%)
 Frame = +1

Query  19   HPLYQ-FNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPL  195
            HPL    N   +D   C+IC     G ++ C+ C  F+        K  I H  H  HPL
Sbjct  456  HPLILILNTWEEDPFQCAICEQYCHGFSYNCDRCHSFLDVRCFKSTKDSIEHGGH-EHPL  514

Query  196  HLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL-TTSDTAVDGTLMRLYYSF  372
            +L   S   N  C  C     +  +RC +CD++L   CA L   +    D   + L Y  
Sbjct  515  YLAVES--ENRHCSGCGVSGESQTFRCVVCDFNLDFKCATLPDKARHRYDEHPLFLTYID  572

Query  373  PVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC--GKPVILK  501
            P      C+ C  E   +  W +  ++  F AH  C  GK   +K
Sbjct  573  PNDYQYVCQICEKERDPK-LWFYRCEECDFDAHRECVLGKNPFIK  616



>ref|XP_006855604.1| hypothetical protein AMTR_s00044p00069570 [Amborella trichopoda]
 gb|ERN17071.1| hypothetical protein AMTR_s00044p00069570 [Amborella trichopoda]
Length=285

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 69/168 (41%), Gaps = 11/168 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SH H L   +L  Q  T CS C L  +  A+ C  C F +H   C  L  +I H SH
Sbjct  15   THFSHHHQLLICDLSHQP-TPCSCCGLSCTAWAYRCTPCAFALHMT-CAQLPQRITHPSH  72

Query  181  PAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
            P HPL L   PP  +    CD C  P     Y C  C +DLH  CAV   +    D  + 
Sbjct  73   PPHPLSLVSAPPYGEGLFNCDGCSRPGTCFSYHCSNCHFDLHTLCAVKPLTR-GHDSHMH  131

Query  355  RLYYSFP----VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
             LY +F        +  C  C G       W++     GF  H +C  
Sbjct  132  PLYLAFAPPPHYRGAFECDLCGGLGGHH--WLYRCDGCGFDVHLDCAS  177



>ref|XP_010473158.1| PREDICTED: uncharacterized protein LOC104752661 [Camelina sativa]
Length=706

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 84/182 (46%), Gaps = 23/182 (13%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T+   CS C L   +G  + C  C+F +H+  C  +   I 
Sbjct  14   NHFSHPH-----RLQVTPATSSAPCSACKLAWGNGRVYSCRPCNFSLHES-CSKMNQVII  67

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTA  336
            H SHP+H L L   P +D  +  CD C        Y+C +CD+D+H  CA   L+    +
Sbjct  68   HPSHPSHTLSLLVAPVYDGGYFNCDGCGVHGTGFSYQCSLCDFDIHALCAYKPLSIIHKS  127

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVIL  498
                 ++L +  P GA+   K  + +I  + G   W++      F AH  C     P +L
Sbjct  128  HPQHNLKLTFHPPYGAN---KGFSCDICLKIGKNQWLYRCIPCEFDAHVGCIAAPNPHLL  184

Query  499  KH  504
            +H
Sbjct  185  QH  186



>emb|CDP07683.1| unnamed protein product [Coffea canephora]
Length=390

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 54/112 (48%), Gaps = 7/112 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            NH SHPHPL   N + Q G +   CS C L  SG+ + C  C++F+H   C  +  +I H
Sbjct  28   NHFSHPHPLQLSNCQSQQGFSANLCSGCKLEASGIVYSCTMCNYFLH-QKCSQMPQKITH  86

Query  172  T-SHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVL  318
                  H L L P    P  I  CDAC    N   Y C  C  DLH+ CA +
Sbjct  87   PFDQNNHVLSLLPKPAYPGGIFNCDACSQQGNGFCYHCQTCGIDLHILCASM  138



>ref|XP_006478123.1| PREDICTED: uncharacterized protein LOC102618330 [Citrus sinensis]
Length=302

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 85/182 (47%), Gaps = 21/182 (12%)
 Frame = +1

Query  4    HASHPHPLYQFNLE-IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SH H L   N + +   T+CS C L  SGL + C+ C+F +H   C  +   I H SH
Sbjct  12   HFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLH-VSCTQMPQLITHPSH  70

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT--  348
            PAH L L P    P  I  CD C    +   Y C  CD+DLH+ CA  T   T +  +  
Sbjct  71   PAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCA--TKPLTLIHQSHP  128

Query  349  -LMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC-----GKPVILK  501
              ++L +  P     + K  + +I ++ G   W++      F AH +C      +P+  +
Sbjct  129  HQLQLTFDPP----YYTKGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQ  184

Query  502  HQ  507
            HQ
Sbjct  185  HQ  186



>ref|XP_009384606.1| PREDICTED: uncharacterized protein LOC103972122 [Musa acuminata 
subsp. malaccensis]
Length=230

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 74/171 (43%), Gaps = 7/171 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPHPL   +L  Q  T+C+ CS  +S  A+ C+ C + + D  C  +  ++ H +  
Sbjct  12   HFSHPHPLELTSLHRQPATSCAGCSRDLSDRAYSCKTCGYAL-DVSCAQMPQRVRHPADA  70

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTAVDGTLMR  357
            +H L L   +   +  C+AC +  +   Y CG C+ +LH  CA   L+    A    L  
Sbjct  71   SHSLTLL--TAGGSFRCNACGADGSAFFYHCGECNLNLHCSCAAMPLSVVHAAHLHPLTL  128

Query  358  LYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQP  510
             ++         C  C    S +  WV+     GF AH  C      +  P
Sbjct  129  FFFPHYENRGFSCDICGHPGSYQ--WVYSCTMCGFDAHVGCATAEEAQANP  177



>ref|XP_009587118.1| PREDICTED: uncharacterized protein LOC104084868 [Nicotiana tomentosiformis]
Length=339

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 71/167 (43%), Gaps = 10/167 (6%)
 Frame = +1

Query  1    NHASHPHPLYQF---NLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            NH SHPHPL      N        CS C +   G  + C++C+FF+H + C  +  QI H
Sbjct  16   NHFSHPHPLELITNQNFASSSSQLCSGCKIQAIGSIYTCKSCNFFLHTE-CSQMPQQITH  74

Query  172  TSHPAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA-VD  342
                 H   L P    P+    CDAC    +   Y C  C  DLH+ CAV     T    
Sbjct  75   PFDKEHHFTLLPKPIYPDGKFNCDACGENGDGFSYHCKTCGTDLHILCAVFPQCVTHWSH  134

Query  343  GTLMRLYYSFPV-GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
               + L +S P  G S  C  C    +    W++  +  GF AH NC
Sbjct  135  HHQLDLKFSPPYPGKSFCCDICKKVGTNH--WLYRCQTCGFDAHLNC  179



>ref|XP_009591760.1| PREDICTED: uncharacterized protein LOC104088733 isoform X2 [Nicotiana 
tomentosiformis]
Length=380

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 76/178 (43%), Gaps = 14/178 (8%)
 Frame = +1

Query  1    NHASHPHPLYQF---NLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            NH SHPHPL      N        CS C +  +G  + C++C+FF+H + C  +  Q  H
Sbjct  16   NHFSHPHPLELITNQNFASPSSQLCSGCKIQANGSIYTCKSCNFFLHTE-CAQMPQQTTH  74

Query  172  TSHPAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA-VD  342
                 H   L P    P  N  CDAC    +   Y C  C  DLH+ CA+     T    
Sbjct  75   PFDKEHHFTLLPKPIYPEGNFNCDACGEIGDGFSYHCKTCGTDLHILCAIFPLCVTHWSH  134

Query  343  GTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNCGKPVILKHQ  507
               + L +S P     +C  C  +I +  G   W++  +  GF AH NC K     HQ
Sbjct  135  HHQLELKFSPPYPDKSFC--C--DICKNVGTNHWLYRCQTCGFDAHLNCTKLQAPPHQ  188



>ref|XP_006294621.1| hypothetical protein CARUB_v10023658mg [Capsella rubella]
 gb|EOA27519.1| hypothetical protein CARUB_v10023658mg [Capsella rubella]
Length=320

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 79/173 (46%), Gaps = 14/173 (8%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN----CSICSLPISGL-AHGCEACDFFIHDDDCLDLKLQI  165
             H SHPHPL+  +   QD ++    C +C L +  L ++ C+ C+F IH   C +L  +I
Sbjct  11   RHFSHPHPLFNSSFIPQDQSSSSYCCVVCKLKLLNLPSYSCKPCNFHIHLK-CSELPQKI  69

Query  166  HHTSHPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAV  339
             H     H L L P P +      CDAC    +   Y CG C  DLH  CA + +  T  
Sbjct  70   RHPFDNIHLLSLIPSPKYQEGRFRCDACGKDGDGFAYHCGDCGIDLHTVCANMPSRVTHQ  129

Query  340  DGTLMRLYYSFPVGA---SVWCKKCNGEISRRGGWVWYDKDTG-FTAHFNCGK  486
                 +L  +F V A   S  C  C G  S    W++  ++ G F AH  C +
Sbjct  130  SHPHHQLSLTFSVSATASSFRCCVCRGLGS--NSWLYSCRECGAFDAHLLCAR  180



>ref|XP_007039749.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
 gb|EOY24250.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
Length=578

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H  H HPL  F  +  +   CS C   +SG  +GC  C FFIHD  C +L  +I H  H
Sbjct  5    KHFLHRHPL-SFIDKGNEELFCSRCLKHLSGSTYGCSRCKFFIHDH-CAELPPKIEHFLH  62

Query  181  PAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRL  360
            P  PL L+       + C+ C+ P     YRC  C +D+HV+CA+  T  +  +  +   
Sbjct  63   PC-PLVLKVLPLPVVYNCNLCIEPGAGSSYRCEECKFDMHVECALKPTFKSEGEELIQHF  121

Query  361  YYSFPV  378
             +  P+
Sbjct  122  THWHPL  127


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 51/113 (45%), Gaps = 4/113 (4%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAH--GCEACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL            C  C    SG  +  GC  C FF H    ++L  QIHH 
Sbjct  237  QHFSHQHPLALRESINGSEVRCRACEEICSGPTYTFGCSRCSFFFHRSCAVELPQQIHHP  296

Query  175  SHPAHPLHLRP-PSFDPNHICDAC-LSPANTPLYRCGICDYDLHVDCAVLTTS  327
             H  HPL L   P  +  + C AC L   +   YRC  C++ LH +CA LT S
Sbjct  297  FHSQHPLTLSSFPLKNFQYYCAACGLDVRSLLAYRCDKCEFTLHKNCAKLTPS  349


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 73/173 (42%), Gaps = 17/173 (10%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEI---QDGTNCSICSLPISG--LAHGCEACDFFIHDDDCLDLKLQI  165
             H +H HPL Q  LE    +D   C IC    SG   A+GC+ C+FF+H+     +  +I
Sbjct  119  QHFTHWHPL-QLVLEKNKEEDQVCCLICQKLCSGSATAYGCKQCEFFLHNSCMTSIPRKI  177

Query  166  HHTSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG  345
            +H  HP   + L  P     + C  C    +   + CG C + L V CA+L T  +    
Sbjct  178  NHFFHPCPLILLTSPFI---YTCGGCDERGSFLTFSCGRCCFQLDVKCALLPTVKSEDAK  234

Query  346  TLMRLYYSFPV-------GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG  483
             +    +  P+       G+ V C+ C  EI     + +      F  H +C 
Sbjct  235  QIQHFSHQHPLALRESINGSEVRCRACE-EICSGPTYTFGCSRCSFFFHRSCA  286



>ref|XP_011088918.1| PREDICTED: diacylglycerol kinase theta-like [Sesamum indicum]
Length=278

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 68/168 (40%), Gaps = 9/168 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SHPHPL Q    +   + CS C L  SG  + C  C+F +H   C  L  QI H    
Sbjct  16   HFSHPHPL-QLQPSVHP-SPCSACKLDASGTIYTCTVCNFLLHPT-CYQLPQQIKHPFDQ  72

Query  184  AHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTLM  354
             H   L P    P  +  CDAC +  +   Y C  C  DLH  CA L    T       +
Sbjct  73   NHAFSLLPTPVYPEGLFSCDACGNQGDAFSYHCTPCGIDLHTTCASLPMKFTHQCHQHEL  132

Query  355  RLYYSFPV-GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVI  495
             L +S P  G +  C  C    SR   W++      F  H  C   VI
Sbjct  133  SLAFSAPYPGNTFSCDVCKRTGSRT--WIYRCSTCEFDVHLTCVARVI  178



>ref|XP_007029374.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
 gb|EOY09876.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
Length=674

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 68/153 (44%), Gaps = 14/153 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
             H SH HPL     ++ +G   NCS C   + G ++ C  C F +H+  C  L  +I+H 
Sbjct  8    QHFSHIHPLIFTKRQVNEGEDINCSGCEKAVLGPSYNCCKCKFSLHEI-CAKLPFKINHP  66

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
             H  HPL L  +PP+     +CD C    N+ +Y C  C +DL + CA+L    T     
Sbjct  67   FHRNHPLILLSKPPTQYTECLCDFCDKTCNSFVYHCFTCRFDLDIPCALLQPQVTGDFLE  126

Query  349  LMRLYYSFPV---------GASVWCKKCNGEIS  420
            L R  +   +         G  V C  C   +S
Sbjct  127  LERFSHKHQLIFIENHVNQGKEVSCSGCKDMVS  159


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 72/174 (41%), Gaps = 16/174 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H SHPH L   N ++ D   C  C  PI    + C  CD F+H   CL L  +  H  H
Sbjct  397  KHFSHPHKL-TLNEKVNDDKLCDCCITPILEPFYSCLECDLFLHKT-CLQLPKRKQHPLH  454

Query  181  PAHPLHLRP--PSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
            P HPL L    P+F+    CDAC    +   Y C  C+++L V C        +   TL 
Sbjct  455  P-HPLTLLSNHPNFEGLFFCDACHQSCHGFTYNCDPCNFNLDVRCG-------SSSNTLK  506

Query  355  RLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK-PVILKHQ  507
               +  P+       C  C+        +++   D  F   FNC   P  ++H+
Sbjct  507  HEAHEHPLIFSKGTECIDCSA-CGYGNDYLYSCFDCSFALDFNCASLPHTVRHR  559


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 7/108 (6%)
 Frame = +1

Query  10   SHPHPLYQFNLEIQDG--TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            SH H L      +  G   +CS C   +SG ++ C  C+FF+H   C  L  +I+H  H 
Sbjct  131  SHKHQLIFIENHVNQGKEVSCSGCKDMVSGPSYSCSNCEFFLHRK-CYMLAPEINHPYHR  189

Query  184  AHPLHLR---PPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
             H L L    PPS+  + +CD CL      +Y C  C +DL ++CA L
Sbjct  190  EHSLILLTNLPPSYS-SCVCDFCLKTCQGFVYHCPSCKFDLDIECAFL  236



>ref|XP_009591759.1| PREDICTED: uncharacterized protein LOC104088733 isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 76/178 (43%), Gaps = 14/178 (8%)
 Frame = +1

Query  1    NHASHPHPLYQF---NLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHH  171
            NH SHPHPL      N        CS C +  +G  + C++C+FF+H + C  +  Q  H
Sbjct  16   NHFSHPHPLELITNQNFASPSSQLCSGCKIQANGSIYTCKSCNFFLHTE-CAQMPQQTTH  74

Query  172  TSHPAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA-VD  342
                 H   L P    P  N  CDAC    +   Y C  C  DLH+ CA+     T    
Sbjct  75   PFDKEHHFTLLPKPIYPEGNFNCDACGEIGDGFSYHCKTCGTDLHILCAIFPLCVTHWSH  134

Query  343  GTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNCGKPVILKHQ  507
               + L +S P     +C  C  +I +  G   W++  +  GF AH NC K     HQ
Sbjct  135  HHQLELKFSPPYPDKSFC--C--DICKNVGTNHWLYRCQTCGFDAHLNCTKLQAPPHQ  188



>ref|XP_006373757.1| hypothetical protein POPTR_0016s04780g [Populus trichocarpa]
 gb|ERP51554.1| hypothetical protein POPTR_0016s04780g [Populus trichocarpa]
Length=622

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H  HP  L +      +G  CS+C  PISG ++ C +C+FF+H   C +L  +I+   HP
Sbjct  89   HKDHPLILNEEQEYHGEGVVCSVCKEPISGPSYSCTSCNFFLH-KKCAELPPEINRHLHP  147

Query  184  AHPLHLRPPSFDPNHICDACLSP-ANTPLYRCGICDYDLHVDCA  312
             HPL L P   + + +CD C      + +Y C +C++++H+ CA
Sbjct  148  EHPLRLLP---NHDTMCDFCNETCCESFVYCCFVCEFNIHIKCA  188



>ref|XP_007029009.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
 gb|EOY09511.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma 
cacao]
Length=252

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 74/173 (43%), Gaps = 8/173 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGT-NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H  H H L  + L+  D    CS C    SG A+GC  C FF+H+  C +    + H S
Sbjct  4    KHFGHQHNLRIYQLQPGDHEYRCSGCDSFCSGSAYGCLGCKFFLHEQ-CGNAGRSLQHPS  62

Query  178  HPAHPLHLRPPS--FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL---TTSDTAVD  342
            HP H L L P +        C+AC    N   Y C +CD DLHV CA L      ++ + 
Sbjct  63   HPFHHLTLVPYTTHLAGTFACNACGDTGNAFSYCCPLCDVDLHVPCAFLPQIIKHESHLH  122

Query  343  GTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILK  501
               +     FP  +S +C  C+  +  +  W +      F AH  C    + +
Sbjct  123  SLSLTYSLPFPNVSSRFCDICHKLLDCK-YWSYNCFACNFAAHALCAAKEMRR  174



>gb|KDO46400.1| hypothetical protein CISIN_1g035521mg [Citrus sinensis]
Length=302

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 54/107 (50%), Gaps = 4/107 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLE-IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SH H L   N + +   T+CS C L  SGL + C+ C+F +H   C  +   I H SH
Sbjct  12   HFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLH-VSCTQMPQLITHPSH  70

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAV  315
            PAH L L P    P  I  CD C    +   Y C  CD+DLH+ CA 
Sbjct  71   PAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCAT  117



>ref|XP_010058185.1| PREDICTED: uncharacterized protein LOC104445959 [Eucalyptus grandis]
Length=1159

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 63/143 (44%), Gaps = 10/143 (7%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H SH H L    +      NC+ C    S  ++ C+ C FF+H   C +L  ++ H  HP
Sbjct  28   HFSHRHLLTICEISEHKEVNCAACKKHCSDESYCCKECKFFLHKS-CAELSRELKHDLHP  86

Query  184  AHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLY  363
             H L L       +  CDAC+       +RC  CD+DL ++CA  +T  + V+  +    
Sbjct  87   -HSLTLCDTVNYGSIYCDACMKRFRGFTFRCEECDFDLDIECAQKSTYGSNVNKQIQHFS  145

Query  364  YSFPV--------GASVWCKKCN  408
            +  P+           VWC+ C 
Sbjct  146  HGDPLILMEVIDEDKEVWCRACE  168


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 54/112 (48%), Gaps = 8/112 (7%)
 Frame = +1

Query  1    NHASHPHPL-YQFNLEIQDGTNCSICSLPIS---GLAHGCEACDFFIHDDDCLDLKLQIH  168
            +H  H HPL  +   +  D   C  C   I    G  +GCE C +F+H+  C +L L+  
Sbjct  259  DHFGHRHPLTLRLRDDEDDSFKCRACDESIERCLGPVYGCEQCKYFLHES-CAELPLERE  317

Query  169  HTSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTT  324
            H  H  HPL L+   +   H C  C +      YRC  CD+DL V CA +T+
Sbjct  318  HFYHEEHPLKLQVAKY---HNCALCGNRIEGYTYRCEQCDFDLDVLCAQMTS  366


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 77/179 (43%), Gaps = 13/179 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN-CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SH  PL    +  +D    C  C       A+ C++C FF+H   C +L+ ++ H  
Sbjct  142  QHFSHGDPLILMEVIDEDKEVWCRACEKRCLNNAYSCDSCQFFLHKS-CAELQQELCHPV  200

Query  178  HPAHPLHLRPPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLM  354
            H +H L L P   D   + CD C    +  +Y+C  C + L V CA L +S+T       
Sbjct  201  H-SHTLKLCPTVDDDAGLSCDFCGEIFHGFVYQCNECQFHLDVICAQLPSSETRGQKQTD  259

Query  355  RLYYSFPVGA--------SVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK-PVILKH  504
               +  P+          S  C+ C+  I R  G V+  +   +  H +C + P+  +H
Sbjct  260  HFGHRHPLTLRLRDDEDDSFKCRACDESIERCLGPVYGCEQCKYFLHESCAELPLEREH  318



>ref|XP_004229346.1| PREDICTED: uncharacterized protein LOC101250152 [Solanum lycopersicum]
Length=381

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 72/166 (43%), Gaps = 8/166 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLE-IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SHPH L     +       CS C +  +G  + C++C+FF+H + C  +  QI+H   
Sbjct  17   HFSHPHTLELITHQNFAPSQLCSCCKIQANGSVYTCKSCNFFLHVE-CSQMPQQINHPFD  75

Query  181  PAHPLHLRPPSFDP--NHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDG-TL  351
              H L L P    P  N  CDAC    +   Y C  C  DLH+ CAVL            
Sbjct  76   KQHALSLLPKPIYPEGNFRCDACGETGDGFSYHCNSCAIDLHILCAVLPQYIAHRSHCHQ  135

Query  352  MRLYYSFPV-GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK  486
            + + +S P    S  C  C    + +  W++     GF AH NC K
Sbjct  136  LEIQFSSPYPSKSFRCDICKHVGTNQ--WLYRCHTCGFDAHLNCTK  179



>gb|KDO48122.1| hypothetical protein CISIN_1g042732mg [Citrus sinensis]
Length=275

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = +1

Query  7    ASHPHPLYQFNL-------EIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQI  165
            +S  HP +Q NL         Q+  +C +C   I GL + C+ C+F +H   C  L  Q+
Sbjct  64   SSFMHPQHQLNLVNRIPQATRQNARSCDVCGDSIEGLFYRCKLCEFDVHPV-CTQLPQQV  122

Query  166  HHTSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA  336
             H    AHPL L+P S   +  C  C +   +  YRCGIC  D+H++C +LT  D A
Sbjct  123  RHVLDAAHPLTLQPFS---SAWCMVCRNECTSWRYRCGICGVDIHLEC-LLTPCDHA  175



>ref|XP_006855605.1| hypothetical protein AMTR_s00044p00070150 [Amborella trichopoda]
 gb|ERN17072.1| hypothetical protein AMTR_s00044p00070150 [Amborella trichopoda]
Length=315

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 75/168 (45%), Gaps = 14/168 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQD---GTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SH H L   NL   D    + CS C L  +  A+ C  C F +H   C  L   + H 
Sbjct  12   HFSHLHQLQLTNLAAADCYPPSLCSGCGLACTAWAYRCNPCAFSMHIT-CAQLPQSVTHP  70

Query  175  SHPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SHP HPL L P P++      C+AC    +   Y C IC+ DLH  CA +  S T V   
Sbjct  71   SHPPHPLSLLPFPAYKEGFFHCNACSRQGSNFSYHCSICEVDLHTFCASMPLSLTNVTHV  130

Query  349  -LMRLYYSFP-VGASVWCKKCNGEISRRGG--WVWYDKDTGFTAHFNC  480
              + L ++ P V     C  C+G     GG  W++      F AH +C
Sbjct  131  HPLTLAFAPPYVNRGFSCDVCSGV----GGDHWLYRCAACCFDAHLHC  174



>ref|XP_006441352.1| hypothetical protein CICLE_v10024031mg, partial [Citrus clementina]
 gb|ESR54592.1| hypothetical protein CICLE_v10024031mg, partial [Citrus clementina]
Length=332

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 54/107 (50%), Gaps = 4/107 (4%)
 Frame = +1

Query  4    HASHPHPLYQFNLE-IQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SH H L   N + +   T+CS C L  SGL + C+ C+F +H   C  +   I H SH
Sbjct  41   HFSHLHLLELSNPQTLNTMTSCSACKLQPSGLMYTCKPCNFTLH-VSCTQMPQLITHPSH  99

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAV  315
            PAH L L P    P  I  CD C    +   Y C  CD+DLH+ CA 
Sbjct  100  PAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCAT  146



>ref|XP_004295355.1| PREDICTED: uncharacterized protein LOC101300707 [Fragaria vesca 
subsp. vesca]
Length=1038

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 52/107 (49%), Gaps = 6/107 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQIHHTS  177
             H SH HPL  F  E Q   +C  C  P+ G ++ C  C   FI    C +L  ++HH  
Sbjct  5    QHFSHHHPL-MFKEEAQKDKHCRACGDPVLGPSYSCSQCSKLFILHKSCAELPREMHHPI  63

Query  178  HPAHPLHLRPPSFDPNHICDACLS--PANTPLYRCGICDYDLHVDCA  312
            H  HPL L     D  + CD C    P N  +YRC  C ++LH+ CA
Sbjct  64   HRKHPLVLS--CMDREYTCDICWKTHPINLFVYRCEPCAFELHLQCA  108



>ref|XP_007029172.1| Cysteine/Histidine-rich C1 domain family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY09674.1| Cysteine/Histidine-rich C1 domain family protein, putative isoform 
1 [Theobroma cacao]
Length=670

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 62/123 (50%), Gaps = 10/123 (8%)
 Frame = +1

Query  1    NHASHPHPLY------QFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKL-  159
            NH SH HPL       + + E ++G  C  C   + G  + C  C FF+H   C +L+L 
Sbjct  4    NHFSHDHPLVFIQEWSRASEEEEEGVCCFACEERVEGPCYCCSGCKFFLHKT-CAELELS  62

Query  160  -QIHHTSHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT  333
             ++ H  HP HPL L P S +  ++ CD C    +  +Y C  C +DL ++CA +  +  
Sbjct  63   PEVSHPFHPPHPLILLPKSPYSGSYSCDFCWGSFSGLVYHCASCQFDLDINCASIAGNFD  122

Query  334  AVD  342
             V+
Sbjct  123  KVE  125



>ref|XP_009596208.1| PREDICTED: uncharacterized protein LOC104092324 isoform X2 [Nicotiana 
tomentosiformis]
Length=245

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 84/184 (46%), Gaps = 10/184 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLA-HGCEACDFFIHDDDCLDLKLQIHHT  174
             H SH H L   N    +   C+ C    IS    +GC +C +F+H++ C +    ++H+
Sbjct  16   QHFSHSHILKIVNPTEAETLTCNACERKNISNKPFYGCNSCQYFLHEN-CFNAPRFLNHS  74

Query  175  SHPAHPLHLRP-PSFD-PNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SH +HPL L P P++   ++IC AC S  N   + C  C++D+H+ CA   +S    +  
Sbjct  75   SHSSHPLTLLPNPTYSIRSYICTACGSAGNGFCFSCACCEFDIHLQCASCPSSILIDEHP  134

Query  349  -LMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCF  516
              + L++  P         C  CN  I     W++Y     F +H  C     +   P  
Sbjct  135  HQLELHFGSPYDDKSIVYICDVCN-VIMNCDNWLYYCAGCDFASHLYCAISPEVGVFPRQ  193

Query  517  LRPL  528
             RP+
Sbjct  194  QRPI  197



>ref|XP_006409752.1| hypothetical protein EUTSA_v10016319mg [Eutrema salsugineum]
 gb|ESQ51205.1| hypothetical protein EUTSA_v10016319mg [Eutrema salsugineum]
Length=718

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 55/182 (30%), Positives = 84/182 (46%), Gaps = 23/182 (13%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTN---CSICSLPI-SGLAHGCEACDFFIHDDDCLDLKLQIH  168
            NH SHPH      L++   T+   CS C L   +G  + C  C+F +H+  C  +   I 
Sbjct  13   NHFSHPH-----RLQLTPATSSPPCSACKLAGGNGRVYSCRPCNFSLHES-CSKMSQVIT  66

Query  169  HTSHPAHPLHLR-PPSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAV--LTTSDTA  336
            H SHP+H L L   P +D  +  CD C        Y+C  CD+D+H  CA   L+    +
Sbjct  67   HPSHPSHTLTLLVAPVYDGGYFNCDGCGVIGTGFGYQCSRCDFDIHALCAYKPLSIIHKS  126

Query  337  VDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNC---GKPVIL  498
                 ++L +  P GA+   K  + +I  + G   W++      F AH  C    +P +L
Sbjct  127  HPQHNLKLTFHSPYGAN---KGFSCDICLKIGKNQWLYRCTPCEFDAHVGCITAPQPHLL  183

Query  499  KH  504
            +H
Sbjct  184  QH  185



>ref|XP_009596198.1| PREDICTED: uncharacterized protein LOC104092324 isoform X1 [Nicotiana 
tomentosiformis]
Length=255

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 84/184 (46%), Gaps = 10/184 (5%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLA-HGCEACDFFIHDDDCLDLKLQIHHT  174
             H SH H L   N    +   C+ C    IS    +GC +C +F+H++ C +    ++H+
Sbjct  16   QHFSHSHILKIVNPTEAETLTCNACERKNISNKPFYGCNSCQYFLHEN-CFNAPRFLNHS  74

Query  175  SHPAHPLHLRP-PSFD-PNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            SH +HPL L P P++   ++IC AC S  N   + C  C++D+H+ CA   +S    +  
Sbjct  75   SHSSHPLTLLPNPTYSIRSYICTACGSAGNGFCFSCACCEFDIHLQCASCPSSILIDEHP  134

Query  349  -LMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCF  516
              + L++  P         C  CN  I     W++Y     F +H  C     +   P  
Sbjct  135  HQLELHFGSPYDDKSIVYICDVCN-VIMNCDNWLYYCAGCDFASHLYCAISPEVGVFPRQ  193

Query  517  LRPL  528
             RP+
Sbjct  194  QRPI  197



>gb|EYU27128.1| hypothetical protein MIMGU_mgv1a022928mg [Erythranthe guttata]
Length=456

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 82/179 (46%), Gaps = 20/179 (11%)
 Frame = +1

Query  1    NHASHPHPLYQFN-----------LEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDC  144
             H SHPHPL   N           L +    +CS CSL ISG  + C  C DFF+H   C
Sbjct  17   THFSHPHPLTLINTNHHHQQQQQTLNLSSSCSCSGCSLGISGTIYSCAICKDFFLH-KKC  75

Query  145  LDLKLQIHHTSHPAHPLHLRP-PSFDPNHI-CDACLSPANTPLYRCGICDYDLHVDCAVL  318
             D+  +I H  H  HPL L P P+++     CDAC        Y C  C  DLHV CA +
Sbjct  76   FDMPKKITHPFHKEHPLTLLPVPAYEDGQFKCDACGEAGKCFSYHCKPCGVDLHVLCAAV  135

Query  319  TTSDTAVDGTLMRLYYSFPVGASVWCKKCNGEISRRGG---WVWYDKDTGFTAHFNCGK  486
              + T     + ++  SF   +    K  + +I ++ G   W++     GF AH +C +
Sbjct  136  PLTLTHSSHHMHKMDLSF--ESPYETKDFSCDICKKPGGDHWLYRCSPCGFDAHLSCAR  192



>gb|KFK32385.1| hypothetical protein AALP_AA6G234500 [Arabis alpina]
Length=664

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 42/109 (39%), Positives = 51/109 (47%), Gaps = 8/109 (7%)
 Frame = +1

Query  4    HASHP-HPLYQFNLEIQDGT--NCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHT  174
            H SHP H L      + DG   NC  C +  +G ++ C  CDF IH   C    L I H 
Sbjct  7    HPSHPAHTLSLLVAPVYDGGYFNCDGCGIIGTGFSYQCSRCDFDIH-ALCAYKPLSITHK  65

Query  175  SHPAHPLHL---RPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDC  309
            SHP H L +    P   +    CD CL    N  LYRC  C++D HV C
Sbjct  66   SHPQHNLQVAFHSPYGANKGFSCDICLKIGKNQWLYRCIPCEFDAHVGC  114



>ref|XP_006373755.1| hypothetical protein POPTR_0016s047601g, partial [Populus trichocarpa]
 gb|ERP51552.1| hypothetical protein POPTR_0016s047601g, partial [Populus trichocarpa]
Length=231

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 76/181 (42%), Gaps = 17/181 (9%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  28   EHFSHPDHPLILINQVLEYSCELVICSGCEGPIWGPCYSCTSCYFFLH-KKCAELPREIK  86

Query  169  HTSHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCAV------LTTS  327
               H  HPLHL   S +   + C+ C    N+ +Y C  C +DL + CA       + + 
Sbjct  87   RRIHRRHPLHLLAKSPYKGKYRCNRCTKTFNSFVYHCSFCKFDLDIKCAFQPGFFEVDSQ  146

Query  328  DTAVDGTLMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGK--PVILK  501
                D  L+        GA V C  C   +S   G  +      F  H  C +  P I +
Sbjct  147  FAHKDHPLILNEEQEYHGAGVVCSLCKEPMS---GPSYSCTSCNFFLHKKCAELPPEIKR  203

Query  502  H  504
            H
Sbjct  204  H  204



>ref|XP_002323288.2| hypothetical protein POPTR_0016s04350g [Populus trichocarpa]
 gb|EEF05049.2| hypothetical protein POPTR_0016s04350g [Populus trichocarpa]
Length=697

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H  HP  L +      +G  CS+C  P+SG ++ C +C+FF+H   C +L  +I+   HP
Sbjct  125  HKDHPLILNEEKEYHGEGVKCSVCKEPMSGPSYSCTSCNFFLH-KKCAELPPEINRHLHP  183

Query  184  AHPLHLRPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDCA  312
             HPL L P   + + IC  C      + +Y C +C+++LH+ CA
Sbjct  184  EHPLRLLP---NHHMICGFCKETCYESFVYCCFVCEFNLHIKCA  224


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HPL   N  ++   +   CS C  PI G  + C +C FF+H   C +L  +I 
Sbjct  4    EHFSHPDHPLILINHVLEYSCELVICSGCEGPIRGPCYSCTSCYFFLHKK-CAELPREIK  62

Query  169  HTSHPAHPLHLRPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               H  HPLHL   S ++  + CD C    N+ +Y C  C +DL + CA
Sbjct  63   RRIHRRHPLHLLAKSPYEGEYGCDRCAKIFNSFVYHCSFCKFDLDIKCA  111



>emb|CDX91385.1| BnaC04g07650D [Brassica napus]
Length=301

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 11/117 (9%)
 Frame = +1

Query  19   HPLYQFNLEI-------QDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            HP ++ +L +       Q+   C IC+  + GL + C+ C+F +H   C  L   + H  
Sbjct  68   HPQHELSLVVRKQQSTRQNERACDICNESVEGLFYRCKLCEFDVHPL-CTQLPQHVRHVL  126

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            HPAH L  R     P   C  C +P  +  YRC +C +D+H++C +   + +  D T
Sbjct  127  HPAHHLEFRLGGASP---CMVCYNPCQSWRYRCELCRFDIHMECILTVCNTSPSDKT  180



>ref|XP_009143447.1| PREDICTED: uncharacterized protein LOC103867159 [Brassica rapa]
 emb|CDX74931.1| BnaA05g06770D [Brassica napus]
Length=301

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 11/117 (9%)
 Frame = +1

Query  19   HPLYQFNLEI-------QDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            HP ++ +L +       Q+   C IC+  + GL + C+ C+F +H   C  L   + H  
Sbjct  68   HPQHELSLVVRKQQSTRQNERACDICNESVEGLFYRCKLCEFDVHPL-CTQLPQHVRHVL  126

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            HPAH L  R     P   C  C +P  +  YRC +C +D+H++C +   + +  D T
Sbjct  127  HPAHHLEFRLGGASP---CMVCYNPCQSWRYRCELCRFDIHMECILAVCNTSPPDNT  180



>ref|XP_006359193.1| PREDICTED: uncharacterized protein LOC102581474 [Solanum tuberosum]
Length=347

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 83/187 (44%), Gaps = 17/187 (9%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLP-ISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
             H SHPH L    +   +   C+ C  P I+   +GC  C +F+H + CL+    + H+ 
Sbjct  12   QHFSHPHILKPI-VNPTETLFCNACEQPNITSNFYGCNTCQYFLHQN-CLNAPRFLDHSC  69

Query  178  HPAHPLHLRP-PSF-DPNHICDACLSPANTPLYRCGICDYDLHVDCAVL--TTSDTAVDG  345
            HP+H L L P P++ + ++ C AC S  N   + C  C++D+H+ CA+L  T   +    
Sbjct  70   HPSHHLTLLPIPTYSNRSYTCKACASAGNGFSFSCACCEFDVHMHCALLPQTVFLSQHHH  129

Query  346  TLMRLYYSFPV-------GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCG--KPVIL  498
              + L +  P             C  C   +     W++Y  D  F  H  C   K V  
Sbjct  130  HDLELIFESPFYDDADDESTVFVCDLCRDNVD-LNNWLYYCSDCDFGTHLECAISKSVSQ  188

Query  499  KHQPCFL  519
            + +P  L
Sbjct  189  QERPKLL  195



>ref|XP_010053581.1| PREDICTED: uncharacterized protein LOC104441996 [Eucalyptus grandis]
 gb|KCW77906.1| hypothetical protein EUGRSUZ_D02164 [Eucalyptus grandis]
Length=411

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 72/180 (40%), Gaps = 14/180 (8%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEAC-DFFIHDDDCLDLKLQIHHTSH  180
            H SH HPL    L  +D   CS C   I G A+ C+ C   F  D  C  L     H  H
Sbjct  125  HFSHNHPLTLCFLTKKDYVRCSGCERQICGPAYRCKVCCQRFTLDKCCAQLPCLKEHPFH  184

Query  181  PAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTS--DTAVDGT  348
            P H L L  + P  D   +CDAC       +Y C IC +DL V CA LT S      DG 
Sbjct  185  PLHTLTLCKKSPYGDTRAVCDACKKTICGFVYHCDICQFDLDVVCASLTPSLKHEKHDGC  244

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC---GKPVILKHQPCFL  519
            L    +   +   V C  C    S     ++      F AH  C      V  K+ P FL
Sbjct  245  LA---FFEEINGQVPCNLCGKSCSNN---LYRCISCNFNAHSTCLQFASTVKHKYHPHFL  298



>ref|XP_006493588.1| PREDICTED: uncharacterized protein LOC102620333 [Citrus sinensis]
Length=291

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = +1

Query  7    ASHPHPLYQFNL-------EIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQI  165
            +S  HP +Q NL         Q+  +C +C   I GL + C+ C+F +H   C  L  Q+
Sbjct  64   SSFMHPQHQLNLVNRIPQATRQNARSCDVCGDSIEGLFYRCKLCEFDVHPV-CTQLPPQV  122

Query  166  HHTSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA  336
             H    AHPL L+P S   +  C  C +   +  YRCGIC  D+H++C +LT  D A
Sbjct  123  RHVLDAAHPLTLQPFS---SAWCMVCRNECTSWRYRCGICGVDIHLEC-LLTPCDHA  175



>ref|NP_181318.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AAR92255.1| At2g37820 [Arabidopsis thaliana]
 gb|AAS76245.1| At2g37820 [Arabidopsis thaliana]
 gb|AAY57581.1| PHD domain protein [Arabidopsis thaliana]
 gb|AEC09454.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=290

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 55/117 (47%), Gaps = 11/117 (9%)
 Frame = +1

Query  19   HPLYQFNLEI-------QDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            HP ++ +L +       Q+   C IC   + GL + C+ C+F +H   C  L   + H  
Sbjct  68   HPQHELSLVVRKQQSTRQNDRACDICDESVEGLFYRCKICEFDVHPL-CTQLPQHVRHVL  126

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            HPAH L  RP        C  C  P  +  YRC +C +D+H++C +   + +  D T
Sbjct  127  HPAHHLEFRPSGAS---TCMVCHGPCQSWRYRCELCRFDIHMECILAVCNTSPSDQT  180


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 67/164 (41%), Gaps = 12/164 (7%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H +H HPL +FN  I D   C  C    SG  + CE C++ +H + C    L +    H
Sbjct  12   QHFTHIHPLTEFN-SIGDFI-CDGCKTYGSGKTYRCEPCNYDLH-EYCATCPLTLPTFIH  68

Query  181  PAHPLHL----RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            P H L L    +  +   +  CD C        YRC IC++D+H  C  L      V   
Sbjct  69   PQHELSLVVRKQQSTRQNDRACDICDESVEGLFYRCKICEFDVHPLCTQLPQHVRHVLHP  128

Query  349  LMRLYYSFPVGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
               L +  P GAS  C  C+G       W +  +   F  H  C
Sbjct  129  AHHLEFR-PSGAST-CMVCHGPCQ---SWRYRCELCRFDIHMEC  167



>ref|XP_007023022.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
 gb|EOY25644.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao]
Length=237

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 72/175 (41%), Gaps = 11/175 (6%)
 Frame = +1

Query  19   HPLYQFNLEIQD-GTNCSICSLPISGLAHGCEA--CDFFIHDDDCLDLKLQIHHTSHPAH  189
            H L  FN+  +     C  C   I G A+ C +  C++ +H+  CL L   +    HP H
Sbjct  14   HKLEFFNVRSKSLDLKCDACRKQIVGPAYRCGSLFCNYQLHES-CLAL---VQEMQHPFH  69

Query  190  PLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGTLMRLYYS  369
            PLH   P    +  C AC    N   Y C  CD  LH DCA        +      LYY 
Sbjct  70   PLHPLHPQVFRSQYCSACKQQMNAISYSCQQCDLHLHFDCASSLKLALKLKFHQHSLYYF  129

Query  370  FP--VGASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKPVILKHQPCFLRPL  528
             P  V +   C +C   +S  G  +++  + G + HF C +        C + PL
Sbjct  130  GPHTVHSFGLCDRCKNHVS--GAPLYHCMECGISLHFGCVQMPHSIKSKCHIHPL  182



>ref|XP_011033197.1| PREDICTED: uncharacterized protein LOC105131758 isoform X4 [Populus 
euphratica]
Length=694

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 5/104 (5%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHP  183
            H  HP  L +      +G  CS+C  P+SG ++ C +C+FF+H   C +L  +I+   HP
Sbjct  130  HKDHPLILNEEQEYHGEGVMCSVCKEPMSGPSYSCTSCNFFLH-KKCAELPPEINRHLHP  188

Query  184  AHPLHLRPPSFDPNHICDACLSPA-NTPLYRCGICDYDLHVDCA  312
             HPL L P   + + IC+ C      + +Y C +C+++LH+ CA
Sbjct  189  EHPLRLLP---NHDTICNFCNETCYESFVYCCFVCEFNLHIKCA  229


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 56/111 (50%), Gaps = 8/111 (7%)
 Frame = +1

Query  1    NHASHP-HPLYQFNLEIQ---DGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIH  168
             H SHP HP    N  ++   +   CS C  PI G  + C +C FF+H   C +L L+I 
Sbjct  4    EHFSHPDHPSILVNQVLEYSCELVICSGCEGPIWGPCYSCTSCYFFLHKK-CAELPLEIK  62

Query  169  HTSHPAHPLHL--RPPS-FDPNHICDACLSPANTPLYRCGICDYDLHVDCA  312
               HP H LHL  +PPS +     CD C    N+ +Y C  C +DL + CA
Sbjct  63   RRIHPRHRLHLLAKPPSHYSTGCFCDRCDKTCNSFVYHCSFCKFDLDIKCA  113



>ref|XP_006387214.1| hypothetical protein POPTR_1519s00200g, partial [Populus trichocarpa]
 gb|ERP46128.1| hypothetical protein POPTR_1519s00200g, partial [Populus trichocarpa]
Length=186

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 44/85 (52%), Gaps = 2/85 (2%)
 Frame = +1

Query  64   CSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSHPAHPLHLRP-PSFDPNHICDA  240
            CS C  PI G  +   +C FF+H   C +L  +I    HP HPLHL P P +     CD 
Sbjct  13   CSGCEGPIWGPCYSRTSCYFFLHKK-CAELPREIKRRIHPRHPLHLMPQPPYKTRCFCDR  71

Query  241  CLSPANTPLYRCGICDYDLHVDCAV  315
            C    N+ +Y C  C++DL + CA 
Sbjct  72   CGKTFNSFVYHCSFCEFDLDIKCAF  96



>ref|XP_009804497.1| PREDICTED: uncharacterized protein LOC104249718 [Nicotiana sylvestris]
Length=254

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 74/168 (44%), Gaps = 10/168 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLA--HGCEACDFFIHDDDCLDLKLQIHHT  174
             H SH H L   N    +   C+ C  P +     +GC +C +F+H++ C +    + H+
Sbjct  16   QHFSHSHILKPINPAEVETLTCNACEQPNNDKPNFYGCNSCQYFLHEN-CFNAPRFLDHS  74

Query  175  SHPAHPLHL--RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA-VDG  345
            SH +HPL L   P     ++ C AC S  N   + C  C++D+H+ CA   +S    +  
Sbjct  75   SHSSHPLTLLASPTYSSRSYTCKACGSAGNGFCFSCACCEFDVHLQCASSPSSLLVDIHP  134

Query  346  TLMRLYYSFPV---GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNC  480
              + L +  P         C  CN  I +   W++Y     F +H  C
Sbjct  135  HQLELLFGSPFEDKNIVYSCDVCN-VIMKTDDWLYYCAGCDFMSHLPC  181



>ref|XP_006493596.1| PREDICTED: uncharacterized protein LOC102622534 [Citrus sinensis]
Length=396

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = +1

Query  7    ASHPHPLYQFNL-------EIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQI  165
            +S  HP +Q NL         Q+  +C +C   I GL + C+ C+F +H   C  L  Q+
Sbjct  169  SSFMHPQHQLNLVNRIPQATRQNARSCDVCGDSIEGLFYRCKLCEFDVHPV-CTQLPPQV  227

Query  166  HHTSHPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTA  336
             H    AHPL L+P S   +  C  C +   +  YRCGIC  D+H++C +LT  D A
Sbjct  228  RHVLDAAHPLTLQPFS---SAWCMVCRNECTSWRYRCGICGVDIHLEC-LLTPCDHA  280



>ref|XP_010318329.1| PREDICTED: uncharacterized protein LOC101264193 [Solanum lycopersicum]
Length=353

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 76/168 (45%), Gaps = 10/168 (6%)
 Frame = +1

Query  4    HASHPHPLYQFNLEIQDG-TNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
            H SHPH L +  +++Q+  T CS C LP S   + C+ C+F +H   C      I+H +H
Sbjct  16   HFSHPHEL-ELCIQLQNNPTPCSGCKLPSSPQMYTCKPCNFTLH-LSCTQFPKLINHPAH  73

Query  181  PAHPLHLRPPSFDPNHI--CDACLSPANTPLYRCGICDYDLHVDCAVLTTSDT-AVDGTL  351
            P H L L P S  P+ +  CDAC    +   Y C  C+YDLHV CA      T  +    
Sbjct  74   PDHTLALLPRSKYPHGLFNCDACNHRGDGFSYHCRDCEYDLHVICASKPLKITHQLHQCQ  133

Query  352  MRLYYSFPV--GASVWCKKCNGEISRRGGWVWYDKDTGFTAHFNCGKP  489
            + L +  P        C  C     ++  W++      F  H +C  P
Sbjct  134  LELTFKNPYADAKGFSCDVCQKIGVKQ--WLYRCGTCDFDVHLDCSNP  179



>ref|XP_006295890.1| hypothetical protein CARUB_v10025020mg [Capsella rubella]
 gb|EOA28788.1| hypothetical protein CARUB_v10025020mg [Capsella rubella]
Length=286

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 54/117 (46%), Gaps = 11/117 (9%)
 Frame = +1

Query  19   HPLYQFNLEI-------QDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTS  177
            HP +  NL +       Q+   C IC   + GL + C+ C+F +H   C  L   + H  
Sbjct  68   HPQHTLNLVVRKQQSTRQNDRACDICDESVEGLFYRCKICEFDVHPL-CTQLPQHVRHVL  126

Query  178  HPAHPLHLRPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVLTTSDTAVDGT  348
            HPAH L  R     P   C  C  P  +  YRC +C +D+H++C +   + +  D T
Sbjct  127  HPAHHLEFRLAGASP---CMVCHVPCQSWRYRCELCRFDIHMECILAVCNTSPSDQT  180


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 51/110 (46%), Gaps = 7/110 (6%)
 Frame = +1

Query  1    NHASHPHPLYQFNLEIQDGTNCSICSLPISGLAHGCEACDFFIHDDDCLDLKLQIHHTSH  180
             H +H HPL +FN  I D   C  C    SG  + CE C++ +H + C    L +    H
Sbjct  12   QHFTHIHPLLEFN-SIGDFI-CDGCKTYGSGKTYRCEPCNYDLH-EYCATCPLTLPTFIH  68

Query  181  PAHPLHL----RPPSFDPNHICDACLSPANTPLYRCGICDYDLHVDCAVL  318
            P H L+L    +  +   +  CD C        YRC IC++D+H  C  L
Sbjct  69   PQHTLNLVVRKQQSTRQNDRACDICDESVEGLFYRCKICEFDVHPLCTQL  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048