BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25066_g3_i2 len=2078 path=[1:0-357 359:358-417 419:418-449
9678:450-457 9686:458-460 462:461-485 487:486-510 512:511-552
554:553-602 604:603-603 605:604-698 700:699-722 724:723-724
726:725-726 9923:727-748 750:749-749 751:750-828 9961:829-839
841:840-848 850:849-1119 1121:1120-1194 10070:1195-1198
1200:1199-1219 @1221@!:1220-1828 1830:1829-1891 1893:1892-1938
1940:1939-1941 1943:1942-2077]

Length=2078
                                                                      Score     E

ref|XP_002266808.1|  PREDICTED: (-)-alpha-terpineol synthase            548   0.0      Vitis vinifera
ref|XP_010645642.1|  PREDICTED: (-)-alpha-terpineol synthase-like       541   0.0      
sp|Q93X23.1|MYRS_QUEIL  RecName: Full=Myrcene synthase, chloropla...    540   0.0      Quercus ilex [holly oak]
ref|XP_011088140.1|  PREDICTED: terpene synthase 10-like                538   3e-180   
ref|XP_006351725.1|  PREDICTED: (-)-alpha-terpineol synthase-like       538   3e-180   
emb|CDP21453.1|  unnamed protein product                                539   4e-180   
emb|CCM43927.1|  limonene synthase                                      537   4e-180   
ref|XP_010088018.1|  Myrcene synthase                                   537   2e-179   
ref|XP_004231365.1|  PREDICTED: terpene synthase 10                     536   2e-179   
gb|ADR74206.1|  (E)-beta-ocimene/myrcene synthase                       536   2e-179   
emb|CDP15198.1|  unnamed protein product                                536   3e-179   
gb|AHI50308.2|  limonene-myrcene synthase                               535   1e-178   
emb|CAN62729.1|  hypothetical protein VITISV_003091                     534   2e-178   Vitis vinifera
ref|NP_001268216.1|  (-)-alpha-terpineol synthase                       531   1e-177   
sp|Q6PWU2.1|ATESY_VITVI  RecName: Full=(-)-alpha-terpineol synthase     531   2e-177   Vitis vinifera
gb|KDP35323.1|  hypothetical protein JCGZ_09482                         531   2e-177   
gb|AHK23027.1|  leucoplast 1,8-cineole synthase                         526   2e-176   
ref|XP_010659051.1|  PREDICTED: (-)-alpha-terpineol synthase-like       526   6e-176   
gb|AFO59753.1|  chloroplast cineole synthase                            524   1e-175   
gb|AFO63173.1|  chloroplast cineolsynthase                              523   2e-175   
gb|ABP88782.1|  plastid 1,8-cineol synthase precursor                   526   2e-175   Nicotiana suaveolens
gb|AFO59752.1|  chloroplast cineole synthase                            523   3e-175   
gb|AFO63172.1|  chloroplast cineolsynthase                              522   6e-175   
ref|XP_009773702.1|  PREDICTED: terpene synthase 10-like isoform X1     522   3e-174   
gb|AEQ27769.1|  sesquiterpene synthase                                  521   4e-174   
ref|XP_009773708.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    523   6e-174   
ref|XP_002533355.1|  (R)-limonene synthase, putative                    520   1e-173   Ricinus communis
emb|CAK55186.1|  pinene synthase                                        521   1e-173   Quercus ilex [holly oak]
gb|AEX09186.1|  plastid terpineol synthase                              518   3e-173   
ref|XP_009773703.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    519   3e-173   
gb|AFB82540.1|  plastid monoterpene synthase                            518   3e-173   
ref|XP_009609201.1|  PREDICTED: terpene synthase 10-like                519   5e-173   
gb|KDP35321.1|  hypothetical protein JCGZ_09480                         519   9e-173   
gb|AII32477.1|  terpene synthase                                        517   7e-172   
ref|XP_004230563.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    516   1e-171   
ref|XP_004161807.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-alpha-te...    516   1e-171   
ref|XP_009779942.1|  PREDICTED: (-)-alpha-terpineol synthase-like       514   1e-171   
ref|XP_011009233.1|  PREDICTED: terpene synthase 10-like                516   2e-171   
ref|XP_004230556.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    514   5e-171   
ref|XP_006388684.1|  terpene synthase/cyclase family protein            511   3e-170   
ref|XP_007048227.1|  Myrcene synthase, chloroplastic, putative is...    511   1e-169   
ref|XP_006370878.1|  terpene synthase/cyclase family protein            510   2e-169   
ref|XP_009600964.1|  PREDICTED: (-)-alpha-terpineol synthase-like       509   3e-169   
gb|KHG23712.1|  Myrcene synthase, chloroplastic                         510   3e-169   
ref|XP_008461028.1|  PREDICTED: terpene synthase 10-like                509   7e-169   
gb|EYU18419.1|  hypothetical protein MIMGU_mgv1a0036601mg               508   1e-168   
gb|AID55337.1|  terpene synthase                                        507   6e-168   
ref|XP_008460926.1|  PREDICTED: terpene synthase 10-like                506   8e-168   
ref|XP_009791335.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    507   1e-167   
gb|AIU39888.1|  terpene synthase                                        506   2e-167   
ref|XP_009586876.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    506   2e-167   
ref|XP_004165181.1|  PREDICTED: myrcene synthase, chloroplastic-like    504   3e-167   
ref|XP_006365871.1|  PREDICTED: (-)-alpha-terpineol synthase-like       503   5e-167   
gb|KHG18659.1|  Myrcene synthase, chloroplastic                         503   1e-166   
ref|XP_006351729.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    503   2e-166   
ref|XP_008461030.1|  PREDICTED: terpene synthase 10-like                502   5e-166   
gb|AIU39887.1|  terpene synthase                                        502   6e-166   
ref|XP_006344475.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    501   1e-165   
emb|CAN74705.1|  hypothetical protein VITISV_032402                     500   1e-165   Vitis vinifera
gb|KHG20211.1|  Myrcene synthase, chloroplastic                         500   2e-165   
ref|XP_006365869.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    498   5e-165   
ref|XP_011088139.1|  PREDICTED: LOW QUALITY PROTEIN: terpene synt...    499   5e-165   
gb|AEP82768.1|  terpene synthase                                        496   2e-164   
gb|EYU18417.1|  hypothetical protein MIMGU_mgv1a003023mg                498   3e-164   
ref|XP_002512868.1|  (R)-limonene synthase, putative                    497   5e-164   Ricinus communis
ref|XP_004233802.1|  PREDICTED: (-)-alpha-terpineol synthase-like       494   9e-164   
ref|XP_006370889.1|  hypothetical protein POPTR_0019s014601g            493   1e-163   
ref|XP_009757423.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    496   2e-163   
emb|CAN64328.1|  hypothetical protein VITISV_027228                     494   2e-163   Vitis vinifera
gb|ADR74202.1|  terpene synthase                                        494   4e-163   
ref|NP_001268167.1|  (+)-alpha-phellandrene synthase                    494   4e-163   
sp|B3TPQ7.1|ATESY_MAGGA  RecName: Full=Alpha-terpineol synthase, ...    494   6e-163   Magnolia grandiflora [southern magnolia]
ref|XP_006351844.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    494   6e-163   
emb|CAN64943.1|  hypothetical protein VITISV_001721                     494   7e-163   Vitis vinifera
ref|XP_010090242.1|  Myrcene synthase                                   493   9e-163   
gb|ADR74201.1|  (+)-alpha-phellandrene synthase                         493   1e-162   
ref|XP_002267453.1|  PREDICTED: (-)-alpha-terpineol synthase            493   1e-162   Vitis vinifera
gb|AID55338.1|  terpene synthase                                        492   4e-162   
ref|XP_004150681.1|  PREDICTED: myrcene synthase, chloroplastic-like    492   6e-162   
ref|XP_006371106.1|  hypothetical protein POPTR_0019s03980g             490   1e-161   
ref|XP_007048226.1|  Myrcene synthase, chloroplastic, putative is...    492   2e-161   
gb|EYU43517.1|  hypothetical protein MIMGU_mgv1a020175mg                488   2e-161   
ref|XP_010645660.1|  PREDICTED: (-)-alpha-terpineol synthase-like       490   2e-161   
ref|XP_004161822.1|  PREDICTED: (-)-alpha-terpineol synthase-like       490   2e-161   
ref|XP_010109851.1|  Myrcene synthase                                   489   2e-161   
emb|CAN60797.1|  hypothetical protein VITISV_016813                     489   5e-161   Vitis vinifera
emb|CAN82665.1|  hypothetical protein VITISV_017009                     489   5e-161   Vitis vinifera
gb|AFQ23190.1|  alpha-pinene synthase                                   489   7e-161   
ref|XP_006351730.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    488   2e-160   
emb|CCM43928.1|  linalool/myrcene synthase                              486   3e-160   
gb|KDP35332.1|  hypothetical protein JCGZ_09491                         484   4e-160   
emb|CDP10957.1|  unnamed protein product                                484   6e-160   
gb|ACN42009.1|  linalool synthase                                       486   7e-160   Perilla setoyensis
ref|NP_001233809.1|  monoterpene synthase 2                             484   3e-159   
ref|XP_006351843.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    489   3e-159   
gb|AII32476.1|  terpene synthase                                        483   1e-158   
ref|XP_006484917.1|  PREDICTED: gamma-terpinene synthase, chlorop...    483   2e-158   
dbj|BAD91045.1|  monoterpene synthase                                   482   3e-158   Citrus unshiu [satsuma mandarin]
gb|AAL38029.1|AF444798_1  linalool synthase                             482   3e-158   Perilla frutescens var. crispa
gb|ABD77416.1|  limonene synthase                                       481   7e-158   Rosmarinus officinalis
ref|XP_002325741.2|  hypothetical protein POPTR_0019s01270g             481   9e-158   Populus trichocarpa [western balsam poplar]
ref|XP_007040297.1|  Myrcene synthase, chloroplastic, putative          480   1e-157   
dbj|BAF73933.1|  beta-pinene synthase                                   480   2e-157   Citrus jambhiri [citronelle]
ref|XP_010645413.1|  PREDICTED: (-)-alpha-terpineol synthase            478   3e-157   
ref|XP_010324138.1|  PREDICTED: monoterpene synthase 2 isoform X1       479   4e-157   
gb|AAM53945.1|AF514288_1  (-)-beta-pinene synthase                      479   6e-157   Citrus limon [lemon]
ref|XP_009791411.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    478   2e-156   
ref|XP_008460927.1|  PREDICTED: terpene synthase 10-like isoform X1     477   2e-156   
dbj|BAD27260.1|  beta-pinene synthase                                   476   5e-156   Citrus unshiu [satsuma mandarin]
ref|XP_008461029.1|  PREDICTED: terpene synthase 10-like                476   7e-156   
ref|XP_011088141.1|  PREDICTED: (-)-alpha-terpineol synthase-like       473   2e-155   
dbj|BAD27259.1|  gamma-terpinene synthase                               474   3e-155   Citrus unshiu [satsuma mandarin]
gb|KHG08606.1|  Myrcene synthase, chloroplastic                         474   3e-155   
emb|CCM43929.1|  linalool/myrcene synthase                              474   4e-155   
gb|ADX01381.1|  pinene synthase                                         473   9e-155   
ref|XP_010247894.1|  PREDICTED: terpene synthase 10-like                474   9e-155   
gb|ABH07678.1|  sabinene synthase                                       472   1e-154   Salvia pomifera
ref|XP_004231363.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    473   1e-154   
gb|ACN42013.2|  linalool synthase                                       473   1e-154   Perilla frutescens var. hirtella
ref|XP_006369784.1|  hypothetical protein POPTR_0001s31570g             472   3e-154   
ref|XP_006369780.1|  hypothetical protein POPTR_0001s315502g            469   6e-154   
gb|AAX16075.1|  linalool synthase                                       471   7e-154   Perilla citriodora
emb|CDP10953.1|  unnamed protein product                                470   2e-153   
ref|XP_004161823.1|  PREDICTED: (-)-alpha-terpineol synthase-like       470   2e-153   
ref|XP_006467490.1|  PREDICTED: gamma-terpinene synthase, chlorop...    470   3e-153   
sp|Q8L5K4.1|GTPS_CITLI  RecName: Full=Gamma-terpinene synthase, c...    469   5e-153   Citrus limon [lemon]
gb|ABP01684.1|  pinene synthase                                         469   5e-153   Rosmarinus officinalis
gb|ACN42011.1|  linalool synthase                                       469   5e-153   Perilla frutescens var. hirtella
ref|XP_006351728.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    468   8e-153   
gb|AHY21666.1|  multiproduct monoterpene synthase                       468   1e-152   
ref|XP_011015877.1|  PREDICTED: terpene synthase 10-like                468   1e-152   
ref|XP_006467489.1|  PREDICTED: gamma-terpinene synthase, chlorop...    468   2e-152   
sp|O81192.1|BPPS_SALOF  RecName: Full=(+)-bornyl diphosphate synt...    466   4e-152   Salvia officinalis
ref|XP_009602962.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    463   5e-152   
gb|AHY39266.1|  linalool synthase                                       466   5e-152   
ref|XP_006388836.1|  hypothetical protein POPTR_0092s00200g             466   6e-152   
ref|XP_006365870.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    462   6e-152   
pdb|1N1B|A  Chain A, Crystal Structure Of (+)-bornyl Diphosphate ...    464   7e-152   
ref|XP_009593950.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    466   7e-152   
gb|ADK73617.1|  terpene synthase 5                                      464   1e-151   
dbj|BAD27258.1|  gamma-terpinene synthase                               465   2e-151   Citrus unshiu [satsuma mandarin]
gb|AID51203.1|  gamma-terpinene synthase                                462   4e-151   
ref|XP_002298717.2|  hypothetical protein POPTR_0001s315502g            462   5e-151   Populus trichocarpa [western balsam poplar]
gb|AID51195.1|  gamma-terpinene synthase                                461   9e-151   
gb|AID51200.1|  gamma-terpinene synthase                                461   1e-150   
gb|AID51197.1|  gamma-terpinene synthase                                461   1e-150   
gb|AID51204.1|  gamma-terpinene synthase                                461   1e-150   
gb|AID51199.1|  gamma-terpinene synthase                                460   2e-150   
gb|AID51201.1|  gamma-terpinene synthase                                460   3e-150   
gb|AEJ91556.1|  alpha-thujene synthase/sabinene synthase                460   6e-150   
gb|AID51198.1|  gamma-terpinene synthase                                459   6e-150   
gb|AID51202.1|  gamma-terpinene synthase                                459   7e-150   
ref|XP_011090122.1|  PREDICTED: (+)-epi-alpha-bisabolol synthase-...    457   3e-149   
gb|KHG19407.1|  Myrcene synthase, chloroplastic                         457   3e-149   
ref|NP_001233805.1|  monoterpene synthase 1                             459   4e-149   
ref|XP_011090121.1|  PREDICTED: (+)-epi-alpha-bisabolol synthase-...    456   5e-149   
sp|Q5SBP0.1|TPSD_OCIBA  RecName: Full=Terpinolene synthase, chlor...    458   5e-149   Ocimum basilicum [basil]
gb|KEH38236.1|  monoterpene synthase                                    458   7e-149   
gb|EYU19469.1|  hypothetical protein MIMGU_mgv1a021922mg                455   9e-149   
gb|AID51194.1|  gamma-terpinene synthase                                456   2e-148   
gb|AGN72805.1|  alpha pinene                                            455   8e-148   
gb|AGN72802.1|  alpha pinene                                            455   9e-148   
ref|XP_004488753.1|  PREDICTED: myrcene synthase, chloroplastic-l...    455   1e-147   
ref|XP_010514206.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    455   1e-147   
gb|AEJ91554.1|  trans-ocimene synthase                                  454   1e-147   
ref|XP_008460931.1|  PREDICTED: terpene synthase 10-like isoform X2     454   2e-147   
gb|AEJ91555.1|  alpha-thujene synthase                                  453   3e-147   
gb|ABD77417.1|  linalool synthase                                       453   6e-147   Lavandula latifolia
sp|Q5SBP1.1|MYRS_OCIBA  RecName: Full=Beta-myrcene synthase, chlo...    453   6e-147   Ocimum basilicum [basil]
gb|AGN72799.1|  alpha pinene                                            453   7e-147   
gb|AGN72804.1|  alpha fenchol                                           452   7e-147   
gb|AGN72801.1|  alpha fenchol                                           452   1e-146   
gb|AGN72798.1|  alpha fenchol                                           452   1e-146   
gb|AGN90903.1|  limonene synthase                                       452   1e-146   
ref|XP_008460928.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    450   2e-146   
sp|Q2XSC6.1|LALIM_LAVAN  RecName: Full=(R)-limonene synthase; Sho...    452   2e-146   Lavandula angustifolia [lavender]
ref|XP_010425235.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    451   3e-146   
gb|ACN42010.1|  geraniol synthase                                       451   4e-146   Perilla setoyensis
gb|ABB30218.1|  geraniol synthase                                       451   4e-146   Perilla frutescens [beefsteak-mint]
dbj|BAA08367.1|  limonene cyclase                                       451   5e-146   Perilla frutescens var. acuta
gb|AAG31435.1|  limonene synthase                                       451   5e-146   Perilla citriodora
gb|AGN90911.1|  limonene synthase                                       450   8e-146   
ref|XP_008775412.1|  PREDICTED: terpene synthase 10-like                449   8e-146   
gb|AAF76186.1|  mercene synthase                                        450   9e-146   Perilla frutescens [beefsteak-mint]
gb|AAF65545.1|  limonene synthase                                       450   9e-146   Perilla citriodora
gb|AAY88965.1|  geraniol synthase                                       450   1e-145   Perilla citriodora
gb|AAG31437.1|  limonene synthase                                       450   1e-145   Perilla frutescens [beefsteak-mint]
gb|ABW86881.1|  limonene synthase                                       449   2e-145   Mentha x piperita
gb|AAC37366.1|  4S-limonene synthase                                    449   2e-145   Mentha spicata
ref|XP_008460932.1|  PREDICTED: terpene synthase 10-like isoform X3     449   2e-145   
gb|AGN90902.1|  limonene synthase                                       449   2e-145   
gb|AAK06663.1|  limonene synthase                                       449   2e-145   Perilla frutescens var. frutescens
gb|AGN90905.1|  limonene synthase                                       449   2e-145   
gb|AAG31438.1|  limonene synthase                                       449   3e-145   Perilla frutescens [beefsteak-mint]
gb|AFZ41794.1|  putative cineole synthase                               448   3e-145   
ref|XP_009602963.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    444   4e-145   
gb|KDP25062.1|  hypothetical protein JCGZ_22597                         464   6e-145   
gb|AGS42396.1|  terpene synthase 3                                      447   9e-145   
ref|NP_189212.1|  1,8-cineole synthase                                  447   9e-145   Arabidopsis thaliana [mouse-ear cress]
gb|AGN90908.1|  limonene synthase                                       447   1e-144   
gb|AAD50304.1|AF175323_1  limonene synthase                             447   1e-144   Mentha longifolia
ref|XP_006487820.1|  PREDICTED: gamma-terpinene synthase, chlorop...    448   1e-144   
ref|NP_001268188.1|  uncharacterized protein LOC100243167               447   2e-144   
emb|CAN65805.1|  hypothetical protein VITISV_042691                     447   2e-144   Vitis vinifera
pdb|2ONG|A  Chain A, Crystal Structure Of Of Limonene Synthase Wi...    444   2e-144   
sp|A7IZZ2.1|TPS2_CANSA  RecName: Full=(+)-alpha-pinene synthase, ...    446   4e-144   Cannabis sativa [marijuana]
gb|AGN90915.1|  limonene synthase                                       446   4e-144   
ref|XP_006471091.1|  PREDICTED: (R)-limonene synthase 1-like isof...    446   4e-144   
sp|Q5SBP2.1|FES_OCIBA  RecName: Full=(-)-endo-fenchol synthase, c...    446   5e-144   Ocimum basilicum [basil]
gb|AAL17636.1|  d-limonene synthase                                     446   5e-144   Agastache rugosa
gb|AGS42397.1|  terpene synthase 4                                      444   9e-144   
ref|XP_006471085.1|  PREDICTED: (R)-limonene synthase 1-like            445   1e-143   
ref|XP_010109567.1|  Isoprene synthase                                  444   1e-143   
gb|ACI32638.1|  MTS2                                                    444   2e-143   Humulus lupulus [common hop]
sp|A7IZZ1.1|TPS1_CANSA  RecName: Full=(-)-limonene synthase, chlo...    445   2e-143   Cannabis sativa [marijuana]
ref|XP_002878732.1|  predicted protein                                  443   2e-143   
gb|ABI20515.1|  cinenol synthase                                        443   4e-143   Rosmarinus officinalis
ref|XP_002875284.1|  predicted protein                                  443   4e-143   
gb|ACM89961.1|  1,8 cineole synthase 2                                  443   5e-143   Salvia fruticosa
gb|ABH07677.1|  cineole synthase                                        442   5e-143   Salvia fruticosa
ref|XP_004150683.1|  PREDICTED: (-)-alpha-terpineol synthase-like       441   8e-143   
dbj|BAD91046.1|  (E)-beta-ocimene synthase                              442   1e-142   Citrus unshiu [satsuma mandarin]
gb|AAM89254.1|AF527416_1  3-carene synthase                             442   1e-142   Salvia stenophylla
ref|XP_010514210.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    441   2e-142   
ref|XP_002275273.1|  PREDICTED: probable terpene synthase 9             441   3e-142   Vitis vinifera
gb|AII32470.1|  terpene synthase                                        440   3e-142   
gb|ACN42012.1|  geraniol synthase                                       441   4e-142   Perilla frutescens var. hirtella
ref|XP_003596036.1|  (R)-limonene synthase                              440   4e-142   
ref|XP_007040296.1|  Myrcene synthase, chloroplastic, putative          439   5e-142   
ref|XP_011003243.1|  PREDICTED: probable terpene synthase 12            440   5e-142   
pdb|2J5C|A  Chain A, Rational Conversion Of Substrate And Product...    439   6e-142   
emb|CDX90785.1|  BnaA03g24650D                                          440   6e-142   
dbj|BAD27257.1|  d-limonene synthase                                    440   7e-142   Citrus unshiu [satsuma mandarin]
ref|XP_008460930.1|  PREDICTED: terpene synthase 10-like isoform X1     440   9e-142   
ref|XP_009388290.1|  PREDICTED: terpene synthase 10-like                439   9e-142   
ref|XP_011096132.1|  PREDICTED: trans-alpha-bergamotene synthase-...    437   9e-142   
gb|AFZ41786.1|  putative gamma-terpinene synthase                       439   1e-141   
sp|Q2XSC5.1|LALIN_LAVAN  RecName: Full=R-linalool synthase; Short...    438   1e-141   Lavandula angustifolia [lavender]
gb|AAM53946.1|AF514289_1  (+)-limonene synthase 2                       439   1e-141   Citrus limon [lemon]
ref|XP_009152106.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    439   1e-141   
ref|XP_010267843.1|  PREDICTED: alpha-terpineol synthase, chlorop...    439   2e-141   
dbj|BAD27256.1|  d-limonene synthase                                    439   2e-141   Citrus unshiu [satsuma mandarin]
gb|AGT29345.1|  putative gamma-terpinene synthase                       439   2e-141   
gb|AFP23130.1|  monoterpene synthases                                   436   2e-141   
gb|AGK88252.1|  gamma-terpinene synthase                                438   2e-141   
gb|AFZ41787.1|  putative gamma-terpinene synthase                       438   3e-141   
gb|AGS42395.1|  terpene synthase 2                                      438   3e-141   
ref|XP_002275106.1|  PREDICTED: probable terpene synthase 9             438   5e-141   Vitis vinifera
gb|AGK88255.1|  gamma-terpinene                                         437   7e-141   
ref|XP_010429386.1|  PREDICTED: tricyclene synthase, chloroplasti...    437   9e-141   
gb|AEV93493.1|  gamma-terpinene synthase                                437   1e-140   
emb|CDY13590.1|  BnaA06g33330D                                          440   1e-140   
gb|AGK88254.1|  gamma-terpinene                                         437   1e-140   
gb|AFZ41788.1|  putative gamma-terpinene synthase                       437   1e-140   
gb|AIE41601.1|  1,8-cineole synthase                                    436   1e-140   
gb|AGT29348.1|  putative gamma-terpinene synthase                       436   1e-140   
gb|AGK88253.1|  gamma-terpinene synthase                                436   2e-140   
gb|AGK88262.1|  gamma-terpinene                                         436   2e-140   
sp|E2E2P0.1|GTPS_ORIVU  RecName: Full=Gamma-terpinene synthase, c...    436   3e-140   
ref|XP_003526313.2|  PREDICTED: tricyclene synthase EBOS, chlorop...    436   3e-140   
ref|XP_010425234.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    436   3e-140   
sp|Q8L5K3.1|RLC1_CITLI  RecName: Full=(R)-limonene synthase 1; Al...    436   4e-140   Citrus limon [lemon]
ref|XP_006484975.1|  PREDICTED: gamma-terpinene synthase, chlorop...    435   4e-140   
gb|AEV93498.1|  gamma-terpinene synthase                                435   4e-140   
gb|AAG01140.2|  (+)-4R-limonene synthase                                436   5e-140   Schizonepeta tenuifolia
ref|XP_009410989.1|  PREDICTED: terpene synthase 10-like                434   6e-140   
sp|J7LQ09.1|TPS7_PHYDL  RecName: Full=Trans-alpha-bergamotene syn...    433   6e-140   
gb|AGK88258.1|  gamma-terpinene                                         433   7e-140   
ref|XP_006487821.1|  PREDICTED: gamma-terpinene synthase, chlorop...    435   7e-140   
ref|XP_010417167.1|  PREDICTED: tricyclene synthase, chloroplasti...    434   7e-140   
ref|XP_010417168.1|  PREDICTED: tricyclene synthase, chloroplasti...    434   9e-140   
gb|ABR15422.1|  limonene synthase                                       434   9e-140   
ref|XP_004488750.1|  PREDICTED: myrcene synthase, chloroplastic-l...    434   1e-139   
ref|XP_009396629.1|  PREDICTED: terpene synthase 10-like                434   1e-139   
emb|CDO97389.1|  unnamed protein product                                431   1e-139   
gb|AGK88263.1|  gamma-terpinene                                         432   1e-139   
gb|AIE41599.1|  beta-myrcene synthase                                   433   2e-139   
gb|KDP35333.1|  hypothetical protein JCGZ_09492                         430   2e-139   
ref|XP_010528838.1|  PREDICTED: tricyclene synthase, chloroplasti...    433   3e-139   
dbj|BAG74774.1|  limonene synthase                                      433   4e-139   
ref|XP_010645662.1|  PREDICTED: (-)-alpha-terpineol synthase            431   4e-139   
gb|ADK73620.1|  terpene synthase 2                                      432   5e-139   
ref|XP_006357106.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    429   5e-139   
gb|AGS42398.1|  terpene synthase 5                                      432   5e-139   
ref|XP_010502464.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    432   5e-139   
ref|XP_006292532.1|  hypothetical protein CARUB_v10018762mg             432   5e-139   
ref|XP_006467491.1|  PREDICTED: gamma-terpinene synthase, chlorop...    430   6e-139   
gb|AGZ58667.1|  putative monoterpene synthase                           432   7e-139   
sp|O81191.1|SCS_SALOF  RecName: Full=1,8-cineole synthase, chloro...    432   7e-139   
ref|XP_010545503.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    432   9e-139   
gb|AEV93496.1|  gamma-terpinene synthase                                432   1e-138   
emb|CDP10952.1|  unnamed protein product                                431   1e-138   
gb|AEV93497.1|  gamma-terpinene synthase                                431   1e-138   
gb|ABY65110.1|  beta-ocimene synthase                                   431   1e-138   
ref|XP_007132584.1|  hypothetical protein PHAVU_011G107200g             431   2e-138   
ref|XP_006369785.1|  hypothetical protein POPTR_0001s31580g             427   2e-138   
ref|XP_002515689.1|  (R)-limonene synthase, putative                    431   2e-138   
gb|AEV93499.1|  gamma-terpinene synthase                                431   2e-138   
gb|AEV93492.1|  gamma-terpinene synthase                                431   2e-138   
gb|AGK88261.1|  gamma-terpinene synthase                                431   3e-138   
gb|AGT29347.1|  putative gamma-terpinene synthase                       430   3e-138   
sp|O81193.1|SSS_SALOF  RecName: Full=(+)-sabinene synthase, chlor...    430   5e-138   
ref|XP_006293874.1|  hypothetical protein CARUB_v10022869mg             429   6e-138   
gb|EYU27851.1|  hypothetical protein MIMGU_mgv1a023119mg                427   7e-138   
gb|EPS65936.1|  mercene synthase                                        427   1e-137   
gb|AEO27879.1|  putative gamma-terpinene synthase                       427   1e-137   
ref|XP_010528836.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    428   2e-137   
ref|XP_010109569.1|  Isoprene synthase                                  426   3e-137   
gb|AAG09310.1|AF178535_1  myrcene/ocimene synthase                      426   3e-137   
gb|KEH38237.1|  monoterpene synthase                                    427   4e-137   
gb|ACD70404.1|  putative chloroplast isoprene synthase                  426   5e-137   
gb|AGB14628.1|  (E)-beta-ocimene synthase                               426   5e-137   
gb|AGK88260.1|  alpha-terpineol                                         426   5e-137   
ref|XP_010103875.1|  Myrcene synthase                                   426   5e-137   
emb|CAL69918.1|  isoprene synthase                                      427   6e-137   
ref|NP_179998.1|  terpene synthase 10                                   427   6e-137   
gb|ABK95568.1|  unknown                                                 427   7e-137   
gb|AFL03421.1|  1,8-cineole synthase                                    426   8e-137   
gb|ADK73622.1|  terpene synthase 1                                      427   8e-137   
gb|ABV04402.1|  chloroplast isoprene synthase 1                         427   8e-137   
gb|AGT29349.1|  putative gamma-terpinene synthase                       427   9e-137   
gb|AEI52904.1|  terpene synthase 4                                      424   1e-136   
ref|XP_006469736.1|  PREDICTED: probable terpene synthase 9-like ...    426   2e-136   
ref|XP_010528837.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    426   2e-136   
ref|XP_009152109.1|  PREDICTED: LOW QUALITY PROTEIN: 1,8-cineole ...    426   2e-136   
sp|Q8GUE4.2|GERS_CINTE  RecName: Full=Geraniol synthase, chloropl...    426   2e-136   
gb|EYU27853.1|  hypothetical protein MIMGU_mgv1a019544mg                424   2e-136   
sp|Q8H2B4.1|LLOS_MENAQ  RecName: Full=R-linalool synthase, chloro...    426   2e-136   
gb|AEK70964.1|  isoprene synthase                                       426   2e-136   
ref|XP_010425238.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    426   2e-136   
gb|AEK70967.1|  isoprene synthase                                       425   3e-136   
ref|XP_006373002.1|  hypothetical protein POPTR_0017s06920g             425   3e-136   
gb|AFL03423.1|  1,8-cineole synthase                                    425   3e-136   
ref|XP_006293887.1|  hypothetical protein CARUB_v10022874mg             424   4e-136   
gb|AGK88257.1|  alpha-terpineol                                         425   4e-136   
ref|XP_003540856.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    427   6e-136   
emb|CDX76827.1|  BnaC08g34130D                                          423   6e-136   
ref|NP_189209.2|  beta-myrcene/(E)-beta-ocimene synthase 2              424   6e-136   
ref|XP_009411231.1|  PREDICTED: terpene synthase 10-like                424   8e-136   
ref|XP_002309854.2|  hypothetical protein POPTR_0007s02920g             424   8e-136   
sp|Q6EJ97.1|ISPS_PUEML  RecName: Full=Isoprene synthase, chloropl...    424   1e-135   
gb|AEK70965.1|  isoprene synthase                                       424   1e-135   
ref|NP_001268009.1|  myrcene synthase, chloroplastic-like               424   1e-135   
ref|XP_011003225.1|  PREDICTED: probable terpene synthase 9 isofo...    424   1e-135   
gb|ACM92062.1|  linalool synthase                                       423   1e-135   
gb|AEV93495.1|  gamma-terpinene synthase                                424   1e-135   
ref|NP_001267945.1|  isoprene synthase, chloroplastic-like              423   1e-135   
gb|AGK88259.1|  alpha-terpineol                                         422   2e-135   
gb|AGU13712.1|  9-epi-caryophyllene synthase                            421   2e-135   
gb|AEX07418.1|  monoterpene synthase                                    423   2e-135   
sp|Q50L36.1|ISPS_POPAL  RecName: Full=Isoprene synthase, chloropl...    423   2e-135   
emb|CAN62153.1|  hypothetical protein VITISV_032405                     424   2e-135   
ref|XP_010514205.1|  PREDICTED: beta-myrcene/(E)-beta-ocimene syn...    423   2e-135   
ref|XP_009626311.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    417   3e-135   
gb|AEV93494.1|  gamma-terpinene synthase                                423   3e-135   
gb|ADG96473.1|  chloroplast isoprene synthase 2                         422   3e-135   
gb|AEK70966.1|  isoprene synthase                                       422   4e-135   
pdb|3N0F|A  Chain A, Crystal Structure Of Isoprene Synthase From ...    421   5e-135   
ref|XP_010502465.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    422   5e-135   
ref|XP_006469735.1|  PREDICTED: probable terpene synthase 9-like ...    422   6e-135   
ref|XP_010261300.1|  PREDICTED: terpene synthase 10-like                422   6e-135   
sp|J7LH11.1|TPS8_PHYDL  RecName: Full=(+)-epi-alpha-bisabolol syn...    420   8e-135   
sp|Q7XAS7.1|ISPS_POPTM  RecName: Full=Isoprene synthase, chloropl...    421   9e-135   
ref|XP_009356064.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    420   1e-134   
ref|XP_009410988.1|  PREDICTED: terpene synthase 10-like                421   1e-134   
gb|AHB60732.1|  isoprene synthase                                       421   1e-134   
gb|AEX07421.1|  monoterpene synthase                                    421   1e-134   
ref|XP_002515692.1|  (R)-limonene synthase, putative                    421   1e-134   
gb|AGK88256.1|  alpha-terpineol                                         421   2e-134   
ref|XP_002309850.2|  hypothetical protein POPTR_0007s02810g             419   2e-134   
gb|AAO85532.1|  monoterpene synthase                                    421   2e-134   
ref|XP_010051775.1|  PREDICTED: monoterpene synthase-like               420   2e-134   
gb|KDP30235.1|  hypothetical protein JCGZ_17017                         420   3e-134   
ref|XP_009395678.1|  PREDICTED: (-)-alpha-terpineol synthase-like       418   3e-134   
ref|XP_011006403.1|  PREDICTED: isoprene synthase, chloroplastic-...    420   3e-134   
sp|Q672F7.1|TPS2_LOTJA  RecName: Full=Tricyclene synthase EBOS, c...    419   5e-134   
gb|AIK19222.1|  monoterpene synthase                                    419   5e-134   
ref|XP_010417166.1|  PREDICTED: tricyclene synthase, chloroplasti...    419   5e-134   
gb|EYU19535.1|  hypothetical protein MIMGU_mgv1a004140mg                417   5e-134   
gb|ADK73623.1|  terpene synthase 1                                      419   6e-134   
gb|AGT29346.1|  putative gamma-terpinene synthase                       419   1e-133   
sp|Q9AR86.1|ISPS_POPCN  RecName: Full=Isoprene synthase, chloropl...    419   1e-133   
ref|XP_011006402.1|  PREDICTED: isoprene synthase, chloroplastic        418   1e-133   
sp|Q9SPN0.1|LLOS1_ARTAN  RecName: Full=R-linalool synthase QH1, c...    417   2e-133   
gb|EYU27857.1|  hypothetical protein MIMGU_mgv1a020580mg                416   2e-133   
gb|AGA96120.1|  terpene synthase 7                                      418   2e-133   
gb|ADQ73631.1|  beta-phellandrene synthase                              417   2e-133   
ref|XP_009388168.1|  PREDICTED: terpene synthase 10-like                421   3e-133   
gb|KEH29582.1|  (E)-beta-ocimene/myrcene synthase                       417   3e-133   
gb|AET02882.2|  monoterpene synthase                                    417   4e-133   
gb|ADG96474.1|  chloroplast isoprene synthase 3                         417   5e-133   
gb|AIE41600.1|  camphene synthase                                       417   5e-133   
ref|XP_010040556.1|  PREDICTED: beta-bisabolene synthase-like           416   8e-133   
gb|KHG04389.1|  Myrcene synthase, chloroplastic                         414   1e-132   
gb|ACI32637.1|  MTS1                                                    416   1e-132   
ref|XP_004488751.1|  PREDICTED: myrcene synthase, chloroplastic-l...    413   1e-132   
gb|AEX07420.1|  monoterpene synthase                                    416   2e-132   
sp|Q5UB07.1|TPS4_MEDTR  RecName: Full=Tricyclene synthase TPS4, c...    415   2e-132   
ref|XP_006469777.1|  PREDICTED: probable terpene synthase 9-like        414   2e-132   
gb|AGT29350.1|  putative gamma-terpinene synthase                       414   5e-132   
gb|AAN65379.1|  E-beta-ocimene synthase                                 412   5e-132   
ref|XP_010472424.1|  PREDICTED: tricyclene synthase, chloroplasti...    414   6e-132   
ref|XP_010545879.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    414   7e-132   
ref|NP_567511.3|  tricyclene synthase                                   413   7e-132   
gb|AGK88250.1|  alpha-terpineol synthase                                414   9e-132   
ref|XP_009356063.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    412   1e-131   
gb|AEX07419.1|  monoterpene synthase                                    414   1e-131   
ref|XP_002878731.1|  myrcene/ocimene synthase                           410   1e-131   
gb|AGB05611.1|  sesquiterpene synthase 2                                411   1e-131   
ref|XP_004305993.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    412   2e-131   
gb|AEK70969.1|  isoprene synthase                                       410   2e-131   
gb|AFP23421.1|  linalool synthase                                       412   3e-131   
gb|ADK73614.1|  terpene synthase 7                                      412   3e-131   
emb|CBZ41766.1|  myrcene synthase                                       410   3e-131   
ref|XP_002534394.1|  (R)-limonene synthase, putative                    412   3e-131   
gb|KDP35334.1|  hypothetical protein JCGZ_09493                         408   3e-131   
gb|AEX07425.1|  monoterpene synthase                                    412   5e-131   
ref|XP_009133984.1|  PREDICTED: tricyclene synthase, chloroplasti...    411   7e-131   
sp|Q5SBP4.1|AZIS_OCIBA  RecName: Full=Alpha-zingiberene synthase        409   7e-131   
gb|AEX07424.1|  monoterpene synthase                                    411   8e-131   
dbj|BAM29049.1|  geraniol synthase                                      411   1e-130   
dbj|BAH03282.1|  +limonene synthase                                     410   1e-130   
dbj|BAM24404.1|  +limonene synthase                                     410   1e-130   
gb|KDP27310.1|  hypothetical protein JCGZ_20298                         410   1e-130   
gb|AEX07423.1|  monoterpene synthase                                    410   2e-130   
sp|P0CJ43.1|OCISB_ARATH  RecName: Full=(E)-beta-ocimene synthase,...    410   2e-130   
emb|CDX83208.1|  BnaA03g22980D                                          410   2e-130   
gb|AGA96119.1|  terpene synthase 6                                      410   2e-130   
gb|EYU31378.1|  hypothetical protein MIMGU_mgv1a017722mg                408   3e-130   
gb|AGK88251.1|  alpha-terpineol                                         410   3e-130   
sp|Q9SPN1.1|LLOS5_ARTAN  RecName: Full=R-linalool synthase QH5, c...    409   4e-130   
ref|XP_010038638.1|  PREDICTED: isoprene synthase, chloroplastic-...    409   4e-130   
emb|CDP11842.1|  unnamed protein product                                409   1e-129   
ref|XP_010440109.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    408   2e-129   
emb|CDY21487.1|  BnaC03g27100D                                          407   2e-129   
gb|AGB05615.1|  sesquiterpene synthase 6                                404   2e-129   
gb|KDO59881.1|  hypothetical protein CISIN_1g044890mg                   406   2e-129   
ref|XP_010046513.1|  PREDICTED: beta-bisabolene synthase-like           407   2e-129   
gb|AHC54050.1|  gamma-terpinene synthase                                407   5e-129   
ref|XP_010449725.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    407   6e-129   
sp|Q2XSC4.1|LABER_LAVAN  RecName: Full=Exo-alpha-bergamotene synt...    404   6e-129   
gb|KHN24142.1|  Isoprene synthase, chloroplastic                        406   9e-129   
ref|XP_010666655.1|  PREDICTED: tricyclene synthase TPS4, chlorop...    405   2e-128   
ref|XP_011009237.1|  PREDICTED: terpene synthase 10-like                403   3e-128   
ref|XP_009395679.1|  PREDICTED: (-)-alpha-terpineol synthase-like       401   4e-128   
gb|AEX07422.1|  monoterpene synthase                                    404   5e-128   
ref|XP_006447458.1|  hypothetical protein CICLE_v10017785mg             403   7e-128   
ref|XP_010046462.1|  PREDICTED: beta-bisabolene synthase-like           403   1e-127   
ref|XP_009602964.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    398   1e-127   
gb|KDP41018.1|  hypothetical protein JCGZ_03550                         401   2e-127   
ref|XP_007010143.1|  3R-linalool synthase, putative isoform 1           400   3e-127   
ref|XP_010550150.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    401   7e-127   
ref|XP_010038637.1|  PREDICTED: isoprene synthase, chloroplastic-...    400   8e-127   
gb|ADX01382.1|  limonene synthase                                       400   1e-126   
gb|AEK70968.1|  isoprene synthase                                       397   2e-126   
ref|XP_010109849.1|  Myrcene synthase                                   392   3e-126   
ref|XP_010550139.1|  PREDICTED: tricyclene synthase, chloroplasti...    399   3e-126   
gb|KFK22267.1|  hypothetical protein AALP_AAs66747U002400               398   4e-126   
dbj|BAF02832.1|  monoterpene synthase                                   398   5e-126   
sp|Q94G53.1|QH6_ARTAN  RecName: Full=(-)-beta-pinene synthase,chl...    398   6e-126   
dbj|BAF02831.1|  monoterpene synthase                                   398   6e-126   
ref|XP_010035623.1|  PREDICTED: isoprene synthase, chloroplastic-...    397   1e-125   
gb|AHC54051.1|  S-linalool synthase                                     397   1e-125   
ref|XP_004306033.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    396   2e-125   
ref|XP_009411232.1|  PREDICTED: (-)-alpha-terpineol synthase-like       395   2e-125   
ref|XP_010673967.1|  PREDICTED: tricyclene synthase TPS4, chlorop...    397   2e-125   
gb|EYU27855.1|  hypothetical protein MIMGU_mgv1a022512mg                394   6e-125   
ref|XP_010051282.1|  PREDICTED: monoterpene synthase-like isoform X1    396   7e-125   
ref|XP_010434776.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    395   1e-124   
ref|XP_010434777.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    395   2e-124   
ref|XP_010109558.1|  Myrcene synthase                                   394   3e-124   
emb|CDX83558.1|  BnaC07g22980D                                          394   4e-124   
ref|XP_010544282.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    393   5e-124   
ref|XP_010069678.1|  PREDICTED: alpha-terpineol synthase, chlorop...    392   7e-124   
ref|XP_008341964.1|  PREDICTED: LOW QUALITY PROTEIN: tricyclene s...    391   1e-123   
ref|XP_010039959.1|  PREDICTED: (-)-alpha-terpineol synthase-like       392   1e-123   
emb|CBI40171.3|  unnamed protein product                                384   1e-123   
ref|XP_011082473.1|  PREDICTED: isoprene synthase, chloroplastic-...    391   3e-123   
gb|AGY49283.1|  chloroplast terpene synthase                            392   3e-123   
sp|F6M8I0.1|MTPS2_SANAL  RecName: Full=Monoterpene synthase; Shor...    391   3e-123   
sp|E3W205.2|SAUBS_SANAS  RecName: Full=Beta-bisabolene synthase; ...    391   3e-123   
gb|ADO87003.1|  b-bisabolene synthase                                   391   3e-123   
sp|B5A434.1|MTPS1_SANAL  RecName: Full=(+)-alpha-terpineol syntha...    390   5e-123   
gb|AAP40638.1|  putative monoterpene synthase                           390   8e-123   
ref|XP_009152110.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    390   1e-122   
gb|KDP32240.1|  hypothetical protein JCGZ_13847                         388   2e-122   
ref|NP_193406.3|  terpene synthase 02                                   387   3e-122   
ref|XP_010440107.1|  PREDICTED: tricyclene synthase, chloroplasti...    387   4e-122   
gb|AIV42941.1|  beta-bisabolene synthase                                388   5e-122   
gb|ADP37189.1|  (-)-beta-bisabolene synthase                            387   7e-122   
dbj|BAG82825.1|  linalool synthase                                      387   9e-122   
ref|XP_010544281.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    387   1e-121   
gb|AHJ57305.1|  chloroplast monoterpene synthase                        387   1e-121   
ref|XP_007025905.1|  E,E-alpha-farnesene synthase, putative             389   2e-121   
ref|XP_010046521.1|  PREDICTED: monoterpene synthase-like               387   2e-121   
ref|XP_010053652.1|  PREDICTED: monoterpene synthase-like               387   2e-121   
ref|XP_006283393.1|  hypothetical protein CARUB_v10004436mg             386   3e-121   
gb|KFK35063.1|  hypothetical protein AALP_AA5G230300                    384   3e-121   
emb|CDX83560.1|  BnaC07g23000D                                          385   4e-121   
ref|XP_006843914.1|  hypothetical protein AMTR_s00007p00269050          383   6e-121   



>ref|XP_002266808.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=590

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/550 (53%), Positives = 388/550 (71%), Gaps = 30/550 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             TT RR+ANY  P WDY Y+QSL +  Y  E  + R D+LK  VK ML   E + ++++E+
Sbjct  49    TTVRRTANYQAPIWDYDYVQSLRS-DYTGETCIGRFDQLKREVKMMLGKVE-KPLDQLEL  106

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG SY FE+EI   L  IY             ++++L+ATALEFR+LRQNG++I
Sbjct  107   IDLLQRLGISYQFEDEIKRLLNSIYCNHNIDDKW----KKENLHATALEFRILRQNGYSI  162

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              QDVF  F D +  GF A LSED +G+L LYE+S+LS+EGE+ LE ARDF+ KHL+    
Sbjct  163   PQDVFSSFKD-EMGGFKACLSEDIQGILCLYEASYLSIEGESILEEARDFTKKHLEGCLR  221

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++PLHWRM RLEAR FI++Y++ +    N ILLE AKLD+N+VQA
Sbjct  222   QNIDENLAILVSHALELPLHWRMLRLEARWFIDAYERRQDM--NPILLEFAKLDYNMVQA  279

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              H EDLK  SRWW+ + + E+L+FARDR++ENFLWT+G+   P++  CR M  K+ + I 
Sbjct  280   KHQEDLKYASRWWRSTRLGEKLSFARDRLMENFLWTVGVIFEPQFGYCRRMLTKVNALIT  339

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTL+EL+LFTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD+LKE 
Sbjct  340   TIDDVYDVYGTLEELELFTDAVDRW-DINAMDQLPEYMKICFLALYNSTNEMAYDLLKEQ  398

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G  I+ +LRK WADLCK+YL EAKWY + YTPT +EY+ NAWI+IS P IL H FF+V N
Sbjct  399   GSHIIAYLRKAWADLCKSYLLEAKWYHARYTPTLQEYLSNAWISISAPTILVHAFFFVTN  458

Query  699   -LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
              + EDA  L+C+  Y  IIR SSIILRL++D GTS  E+KRGDVPK+IQCYM E   S  
Sbjct  459   PITEDA--LECVEQYCNIIRWSSIILRLSDDLGTSSDELKRGDVPKSIQCYMHETGASEE  516

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             +AR+ I   + E WKKMN+  +   SPFS TFI +A+N+ARMAQCMYQ+GDGHG+ + ET
Sbjct  517   DAREHIKCLIGETWKKMNEDRV-MESPFSQTFIGIAINLARMAQCMYQYGDGHGVQDRET  575

Query  342   QTRIQTLLFE  313
             + R+ +LL E
Sbjct  576   KDRVLSLLIE  585



>ref|XP_010645642.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=566

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/550 (53%), Positives = 387/550 (70%), Gaps = 30/550 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             TT RR+ANY  PTWDY Y+QSL T+ Y  E  + R D+LK  VK ML   E + ++++E+
Sbjct  25    TTVRRTANYQAPTWDYDYVQSL-TSDYRGETCIGRFDQLKREVKMMLGKVE-QPLDQLEV  82

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG SY FE+EI      +      + N     E+++L+ATALEFR+LRQNG++I
Sbjct  83    IDLLQRLGISYQFEDEIKR----LSNSMYCNHNIDDKWEKENLHATALEFRILRQNGYSI  138

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              QDVF  F D +  GF A LSED +G+L LYE+S+LS+EGE+ LE AR  + KHL+    
Sbjct  139   PQDVFSSFKD-EMGGFKACLSEDIQGVLCLYEASYLSIEGESILEEARVLAKKHLEACLQ  197

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++PLHWRM RLEAR FI++Y++ +    N ILLE AKLD+N+VQA
Sbjct  198   QNIDENLAILVSHALELPLHWRMLRLEARWFIDAYERSQDM--NPILLEFAKLDYNMVQA  255

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              H EDLK  SRWW+ + + E+L+FARDR++ENFLWT+G    P++  CR M  K+ + I 
Sbjct  256   KHQEDLKYASRWWRSTRLGEKLSFARDRLMENFLWTVGEIFEPQFGYCRRMLTKVNAMIT  315

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTL+EL+LFTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD+LKE 
Sbjct  316   TIDDVYDVYGTLEELELFTDAVDRW-DINAMDQLPEYMKICFLALYNSTNEMAYDLLKEQ  374

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G  I+ +LRK WADLCK+YL EAKWY + YTPT +EY+ NAWI+IS P+IL H FF+V N
Sbjct  375   GSHIIAYLRKAWADLCKSYLLEAKWYHARYTPTLKEYLSNAWISISAPVILVHAFFFVTN  434

Query  699   -LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
              + EDA  L+CL  Y  IIR SSIILRL++D GTS  E+KRGDVPK+IQCYM E      
Sbjct  435   PITEDA--LECLEQYCNIIRWSSIILRLSDDLGTSSDELKRGDVPKSIQCYMHETGACEE  492

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             +AR+ I   + E WKKMN+  +   SPFS TFI +A+N+ARM+QCMYQ+GDGHG+ + ET
Sbjct  493   DAREHIKCLIGETWKKMNEDRV-MESPFSQTFIGIAINLARMSQCMYQYGDGHGVQDRET  551

Query  342   QTRIQTLLFE  313
             + R+ +LL E
Sbjct  552   KDRVLSLLIE  561



>sp|Q93X23.1|MYRS_QUEIL RecName: Full=Myrcene synthase, chloroplastic; Flags: Precursor 
[Quercus ilex]
 emb|CAC41012.1| putative chloroplast terpene synthase [Quercus ilex]
Length=597

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/546 (53%), Positives = 373/546 (68%), Gaps = 28/546 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRSANY P  W++ YI+SL    Y  E    + + LKE+V+ ML ++ +  +E++E+I+ 
Sbjct  57    RRSANYQPSIWNHDYIESLRI-EYVGETCTRQINVLKEQVRMML-HKVVNPLEQLELIEI  114

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHFEEEI   L  +Y             + ++LYATAL+FR+LRQ+G+++SQ+
Sbjct  115   LQRLGLSYHFEEEIKRILDGVYNNDHGGD----TWKAENLYATALKFRLLRQHGYSVSQE  170

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------  1384
             VF+ F D +R  F A L EDTKG+L+LYE+SF  +EGE  LE ARDFS KHL+       
Sbjct  171   VFNSFKD-ERGSFKACLCEDTKGMLSLYEASFFLIEGENILEEARDFSTKHLEEYVKQNK  229

Query  1383  ---------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHL  1231
                      H L+ PLHWRMPRLEAR FI  Y   +    N ILLE A+LDFNIVQA H 
Sbjct  230   EKNLATLVNHSLEFPLHWRMPRLEARWFINIYRHNQDV--NPILLEFAELDFNIVQAAHQ  287

Query  1230  EDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVD  1051
              DLK VS WWK + + E L+FARDR VENF WT+GL   P++  CR M  K+++ I  +D
Sbjct  288   ADLKQVSTWWKSTGLVENLSFARDRPVENFFWTVGLIFQPQFGYCRRMFTKVFALITTID  347

Query  1050  DIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVF  871
             D+YD+YGTLDEL+LFTD +ERW D+  ++ LPDYM+ C+L L+N VNE+A D +KE    
Sbjct  348   DVYDVYGTLDELELFTDVVERW-DINAMDQLPDYMKICFLTLHNSVNEMALDTMKEQRFH  406

Query  870   ILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAE  691
             I+ +L+K W DLC+ YL EAKWY++ Y P+ +EYIENAWI+I  P IL H +F+V N   
Sbjct  407   IIKYLKKAWVDLCRYYLVEAKWYSNKYRPSLQEYIENAWISIGAPTILVHAYFFVTNPIT  466

Query  690   DAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARD  511
               A LDCL +YP IIR SSII RLA+D GTS  E+KRGDVPKAIQCYM+E   S   AR+
Sbjct  467   KEA-LDCLEEYPNIIRWSSIIARLADDLGTSTDELKRGDVPKAIQCYMNETGASEEGARE  525

Query  510   FIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRI  331
             +I   ++  WKKMNK      SPFS  FIE+A+N+ARMAQC+YQHGDGHG+ N ET+ RI
Sbjct  526   YIKYLISATWKKMNK-DRAASSPFSHIFIEIALNLARMAQCLYQHGDGHGLGNRETKDRI  584

Query  330   QTLLFE  313
              +LL +
Sbjct  585   LSLLIQ  590



>ref|XP_011088140.1| PREDICTED: terpene synthase 10-like [Sesamum indicum]
Length=598

 Score =   538 bits (1387),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 394/582 (68%), Gaps = 28/582 (5%)
 Frame = -3

Query  2004  AKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAA  1825
             +K + +  +C    +       SF++ +H  T  RRS NYGPP WD++YIQSLNT HYA 
Sbjct  22    SKRYCSAISCATSLLILRPRCCSFQLQHHVPTP-RRSGNYGPPLWDFNYIQSLNT-HYAE  79

Query  1824  EGFVMRRDELKERVKDMLKNEE--MREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymk  1651
             EG++ R  ELK  VK ML  E+  +  VE++E+IDEL+RLG SYHF++EI + L  +Y +
Sbjct  80    EGYLRRVSELKVEVKKMLVQEKEVVSRVEELELIDELQRLGISYHFDDEINQILGCLYDE  139

Query  1650  kkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGL  1471
             K    N+    +E DLY TALEFR+LRQ+GF + Q++FD F + K   F+ SL+ DTKGL
Sbjct  140   KYGGKNSE--GKEWDLYTTALEFRLLRQHGFIVPQEIFDCFRNEK-GDFDPSLAHDTKGL  196

Query  1470  LNLYESSFLSMEGETNLELARDFSAKHL----------------KHELKMPLHWRMPRLE  1339
               LYE+SFLS   E  L+LAR+F+   L                +H L++P+HWR+ R  
Sbjct  197   FQLYEASFLSKPNEKTLDLAREFATNFLQKNPNAKVDESLSILVRHALELPIHWRVQRPN  256

Query  1338  ARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARD  1159
             AR FIE+Y++   ++ N ++LELAKLDFNIVQA H E+LK V  WWK++ IAE L FARD
Sbjct  257   ARWFIEAYER--RSNVNPLVLELAKLDFNIVQATHQEELKHVYGWWKQTGIAENLPFARD  314

Query  1158  RVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDD  979
             R+VE + WT G+  +P+Y   RIM +KL + +  +DDI+DIY T  E+QLF + I+RWD 
Sbjct  315   RMVECYFWTTGVFSHPQYSYPRIMTSKLNALVTVIDDIFDIYATHQEMQLFYNAIQRWD-  373

Query  978   VTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYA  799
             V  ++ LP+YM+ CYLAL NF+NE+AYD+LK+ G+ I+ HLRK WADLC+ YLQEA+WY 
Sbjct  374   VEAIDQLPNYMQICYLALYNFINEMAYDVLKQQGLVIIPHLRKSWADLCRTYLQEAEWYL  433

Query  798   SGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrL  619
              GYTPT EEY+ NAWI+IS P++L+H +F V N  E   V+  L  Y +++R S+ +LRL
Sbjct  434   RGYTPTLEEYMNNAWISISAPVVLSHAYFLVANPIE-KEVIPSLYKYHDLVRYSATVLRL  492

Query  618   ANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEG-GSP  442
             A+D  TSP E+KRGDV K+IQCYM+E+  S  EA ++I   + E WK MN+    G  SP
Sbjct  493   ADDIATSPDEVKRGDVQKSIQCYMNESGGSGEEAVEYIRFVIGETWKNMNQEAFAGDDSP  552

Query  441   FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             F   F+ +A ++ RMAQ MYQ+GDGHG+ N + +TRI + LF
Sbjct  553   FPQDFVRIAADLGRMAQYMYQYGDGHGVQNCDIKTRISSSLF  594



>ref|XP_006351725.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum tuberosum]
Length=592

 Score =   538 bits (1386),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 280/556 (50%), Positives = 374/556 (67%), Gaps = 33/556 (6%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             +    RRS NY P  WDY++IQSL   HY  E F+ RR+ELK  VK ML +  M+++E++
Sbjct  22    SNVPIRRSGNYQPSIWDYNHIQSL-KNHYPDEKFMRRRNELKMEVKIMLSDRNMKQLEQL  80

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E+ID+L+RLG S+HFE+EI   L ++  K          ++   LYA ALEFR+LRQ+GF
Sbjct  81    EIIDDLQRLGLSHHFEDEIYSILNNLSDKN---------SKRDHLYAKALEFRLLRQHGF  131

Query  1557  NI-SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             NI SQ++FDGF D          +EDTKG+L LYE+SFL++EGE  LELAR+ + KHL+ 
Sbjct  132   NIISQEIFDGFYDNTTGFGEIHHNEDTKGMLYLYEASFLAIEGEKELELARNLTEKHLRE  191

Query  1383  -------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKL  1261
                                H L++PLHWRM RLE + FI  Y K +       +LELA L
Sbjct  192   YLADKNKNDMDQNLVELVHHALEVPLHWRMLRLETKWFINYYKKRQDMMI-PFMLELATL  250

Query  1260  DFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGA  1081
             DFNIVQ  H++DLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  
Sbjct  251   DFNIVQETHIKDLKYVARWWKETCLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIAT  310

Query  1080  KLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIA  901
             K+ + +  +DD+YD++GTLDELQ+FT  I+RW+ + +++ LPD M+ CY AL+NF+N++A
Sbjct  311   KVNALVTTIDDVYDVFGTLDELQIFTHAIQRWN-IKELDKLPDNMKMCYYALDNFINQVA  369

Query  900   YDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAH  721
              D  +E G+FIL +LR  W DLCK+YL+EAKWY S Y P+ EEYI+NAWI+IS P+IL H
Sbjct  370   ADAFEEQGIFILPYLRNAWRDLCKSYLREAKWYHSQYIPSMEEYIDNAWISISAPVILVH  429

Query  720   VFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
              +F V N     A+     +Y EIIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E
Sbjct  430   AYFLVANPVNKEALHYLENNYHEIIRCSALILRLANDLGTSSDELKRGDVPKSIQCYMNE  489

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
              + S  EAR +I + +++ WKK+N+       PF   F+  AMN+ARMAQCMYQHGDGHG
Sbjct  490   TQASEEEARQYIRVIISQTWKKLNEAHDLAAHPFPKIFVTCAMNLARMAQCMYQHGDGHG  549

Query  360   INNFETQTRIQTLLFE  313
              NN  T+  I  LLFE
Sbjct  550   GNNSTTKNHIMALLFE  565



>emb|CDP21453.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   539 bits (1388),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 293/580 (51%), Positives = 383/580 (66%), Gaps = 32/580 (6%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGF  1816
             F+TF    + +   + A+   +         RRS NY  P W++ YIQSL    YA + +
Sbjct  36    FTTFRAAAMRNATMAAANVREQSGQKQQLINRRSGNYEAPLWEFDYIQSLKN-EYAGDIY  94

Query  1815  VMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkss  1636
             V R +ELKE+VK ML   +M+ ++ ME++D L+RLG +YHFE  I   L       K   
Sbjct  95    VSRANELKEQVKMMLDEGDMKLLDCMELVDGLERLGLAYHFEGRINRLL---SSAYKAIH  151

Query  1635  nnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFM--DGKRCGFNASLSEDTKGLLNL  1462
                    ++DLYA ALEFR+ RQNGFN+ QD F+ F+  DG+   F+ SLSED  G+L+L
Sbjct  152   EGNHKRNKEDLYAAALEFRIFRQNGFNVPQDTFNDFITEDGE---FDESLSEDIMGMLSL  208

Query  1461  YESSFLSMEGETNLELARDFSAKHLKH-----------------ELKMPLHWRMPRLEAR  1333
             YE+SFLS+EGE  L+LAR+F+ KHL +                  L++PL WR PR+EAR
Sbjct  209   YEASFLSLEGEATLDLAREFTTKHLNNYLGKENTDQNLRILVYRALELPLRWRAPRIEAR  268

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              +I++Y++  + + N  LLELAK+DFNIVQA+H +DLK VS WW    IAE+LTF RDR+
Sbjct  269   WYIDAYER--SPNMNPTLLELAKIDFNIVQAIHQQDLKHVSWWWNNIRIAEKLTFIRDRI  326

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             VENF WTIG    P+Y +CR M AK++  I  +DDIYD+YGTLDEL+LFTD ++RW DV 
Sbjct  327   VENFFWTIGAVFEPQYGSCRRMLAKVFVLITMIDDIYDVYGTLDELELFTDAVDRW-DVK  385

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              ++ LPDYMR  YL   N +NE+AYD LKE GV I+ +LRK+WADLCKAYL+EAKWY +G
Sbjct  386   AIDQLPDYMRVGYLGFFNSINEMAYDALKEQGVHIVEYLRKVWADLCKAYLREAKWYYAG  445

Query  792   YTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAN  613
             YTPT EEY+ENAW++IS P++L HV+  V N     A +D L D  +I+R SS +LRLA+
Sbjct  446   YTPTVEEYLENAWVSISVPVMLMHVYAGVTNPMNKEA-MDVL-DTHDIVRWSSYLLRLAD  503

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSG  433
             D GTSP EMKRGDVPK +QCYM EA  S  E+R+ +   + E WKKMNK      SPFS 
Sbjct  504   DLGTSPGEMKRGDVPKLVQCYMKEAGCSEEESREHVWFLLRETWKKMNKDSEWAESPFSK  563

Query  432   TFIEVAMNIARMAQCMYQHGDGHGIN-NFETQTRIQTLLF  316
             TF+  A N  R+A  MYQ+GDGHG+N N E + RI   LF
Sbjct  564   TFVTAAKNFGRVALVMYQYGDGHGLNSNPEAKDRILASLF  603



>emb|CCM43927.1| limonene synthase [Coffea arabica]
Length=566

 Score =   537 bits (1384),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 287/550 (52%), Positives = 372/550 (68%), Gaps = 32/550 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRS NY  P W++ YIQSL    YA + +V R +ELKE+VK ML  E+M+ ++ ME++D
Sbjct  23    NRRSGNYEAPLWEFDYIQSLKN-EYAGDIYVSRANELKEQVKMMLDEEDMKLLDCMELVD  81

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG +YHFE  I   L       K          ++DLYA ALEFR+ RQNGFN+ Q
Sbjct  82    GLERLGLAYHFEGRINRLL---SSDYKAIHEGNHQRNKEDLYAAALEFRIFRQNGFNVPQ  138

Query  1545  DVFDGFM--DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
             D+F+ F+  DG+   F+ SLSEDT GLL+LYE+SFLS+EGE  L+LAR+F+ KHL     
Sbjct  139   DIFNDFITEDGE---FDESLSEDTMGLLSLYEASFLSLEGEATLDLAREFTTKHLNNYLG  195

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++PL WR PR+EAR +I++Y++      N  LLELAK+DFNIVQ
Sbjct  196   KENTDQNLRILVYHALELPLRWRAPRIEARWYIDAYERSPNV--NPTLLELAKIDFNIVQ  253

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A+H +DLK VS WWK   IAE+LTF RDR+VENF W IG    P+Y +CR M  K+++ I
Sbjct  254   AIHQQDLKHVSWWWKNIRIAEKLTFIRDRIVENFFWAIGAVFEPQYGSCRRMLTKVFALI  313

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
               +DDIYD+YGTL+EL+LFTD ++RW DV  ++ LPDYMR  YL   N +NE+AYD LKE
Sbjct  314   TMIDDIYDVYGTLEELELFTDAVDRW-DVKAIDQLPDYMRVGYLGFFNSINEMAYDALKE  372

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              GV I+ +L+K+WADLCKAYLQEAKWY +GYTPT EEY+ENAW+++S P++L H +  V 
Sbjct  373   QGVHIVEYLKKVWADLCKAYLQEAKWYYAGYTPTVEEYLENAWVSMSVPVMLMHAYAGVT  432

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
             N     A +D L D  +I+R SS +LR A+D GTSP EMKRGDVPK +QCYM EA  S  
Sbjct  433   NPMNKEA-MDVL-DTHDIVRCSSYLLRFADDLGTSPGEMKRGDVPKLVQCYMKEAGCSEE  490

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI-NNFE  346
             E+R+ +   + E WKKMNK      SPFS TF+  A N  R+A  MYQ+GDGHG+ +N E
Sbjct  491   ESREHVWFLLRETWKKMNKDSEWAESPFSKTFVTAAKNFGRVALVMYQYGDGHGLHSNPE  550

Query  345   TQTRIQTLLF  316
              + RI   LF
Sbjct  551   AKDRILASLF  560



>ref|XP_010088018.1| Myrcene synthase [Morus notabilis]
 gb|EXB31237.1| Myrcene synthase [Morus notabilis]
Length=614

 Score =   537 bits (1383),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 287/559 (51%), Positives = 382/559 (68%), Gaps = 37/559 (7%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERV-KDMLKNEEMREV  1747
             + ++   RRSANY PP W + Y+QSL +  Y  + +  R + LKE V + + K  E   +
Sbjct  62    HESSIIARRSANYQPPIWHFDYVQSLES-EYNGKPYAERVENLKEEVIRAIFKKLEHDHL  120

Query  1746  EKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQ  1567
              +++ ID L+RLG SYHFE+E+   L  IY            +    LYATALEFR+LRQ
Sbjct  121   TQLKHIDLLQRLGLSYHFEDEVKSILKGIYTNTSYHK----TSNNNSLYATALEFRLLRQ  176

Query  1566  NGFNISQDVFDGFMD--GKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAK  1393
             +G+ + Q+VF  F D  GK   F A +S+D  GL++LYE+SFL +EGE+ LE ARDF+ K
Sbjct  177   HGYFVPQEVFTSFKDETGK---FMACMSDDPIGLVSLYEASFLMVEGESILEEARDFATK  233

Query  1392  HLK---------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILL  1276
              L+                     H L++PL WRM RLE+R FI+ Y++ +    N  LL
Sbjct  234   CLEEYIIKKENIDENNDHISLLVSHALELPLQWRMLRLESRWFIDLYERMEDM--NPCLL  291

Query  1275  ELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNC  1096
             ELAKLDFNIVQ+ H EDLK  SRWW+ + + ++L FARDR++ENFLWT+G+   P++  C
Sbjct  292   ELAKLDFNIVQSTHQEDLKYASRWWRNTGLGQKLEFARDRLMENFLWTVGVVFEPQFGYC  351

Query  1095  RIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNF  916
             R M  K+ + I  +DDIYD+YGTLDEL+LFTD ++RW DV  ++ LPDYM+ C+LAL+N 
Sbjct  352   RRMSTKVNALITVIDDIYDVYGTLDELELFTDVVDRW-DVNDMDQLPDYMKMCFLALHNS  410

Query  915   VNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCP  736
             +N+IA+ +LKE G+ I+ +L+K+WAD+CK+YLQEAKWY SGYTPT +EYIENAWI+IS P
Sbjct  411   INDIAFTVLKEQGLSIVKYLKKVWADICKSYLQEAKWYYSGYTPTLQEYIENAWISISAP  470

Query  735   LILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQ  556
             +IL H +F+V N       L CL +YP IIR SSI+LRLA+D GTS  E+KRGDVPK+IQ
Sbjct  471   VILVHAYFFVTNPITKEG-LACLEEYPSIIRQSSILLRLADDLGTSSDEIKRGDVPKSIQ  529

Query  555   CYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQH  376
             CYM EA VS +EAR  I   ++E WK+MN   I   SPFS TF E+A N+ARMAQCMYQH
Sbjct  530   CYMHEAGVSEDEARQHIKWLISETWKQMNADRI-ADSPFSETFTEIATNLARMAQCMYQH  588

Query  375   GDGHGINNFETQTRIQTLL  319
             GDGHGI + ET+ R+ +LL
Sbjct  589   GDGHGIQDRETKDRVLSLL  607



>ref|XP_004231365.1| PREDICTED: terpene synthase 10 [Solanum lycopersicum]
 gb|AEM05857.1| cineol synthase [Solanum lycopersicum]
Length=597

 Score =   536 bits (1381),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 281/556 (51%), Positives = 371/556 (67%), Gaps = 33/556 (6%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             +    RRS NY P  WDY++IQSL   HY+ E F+ RR+ELK  VK ML +  M+++E++
Sbjct  27    SNVPIRRSGNYQPSIWDYNHIQSL-KNHYSDEKFMRRRNELKMEVKIMLSDRNMKQLEQL  85

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E+ID L+RLG SYHFE+EI   L ++  K          ++   LYA ALEFR+LRQ+GF
Sbjct  86    EIIDNLQRLGLSYHFEDEIYSILNNLSDK---------GSKRDHLYAKALEFRLLRQHGF  136

Query  1557  NI-SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             NI SQ+ F GF D          +EDTKG+L LYE+SFL++EGE  LELAR+ + +HL+ 
Sbjct  137   NIVSQETFGGFYDNTTGFGEIHHNEDTKGMLYLYEASFLAIEGEKELELARNLTEEHLRE  196

Query  1383  -------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKL  1261
                                H L++PLHWRM RLE + FI  Y K +       LLELA L
Sbjct  197   YLADQNKNDVDQNLVELVHHALELPLHWRMLRLETKWFINYYKK-RQDKMIPFLLELATL  255

Query  1260  DFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGA  1081
             DFNIVQA H+EDLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  
Sbjct  256   DFNIVQAAHIEDLKYVARWWKETCLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIAT  315

Query  1080  KLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIA  901
             K+ + +  +DD+YD++GTLDELQ+FT  IERW  + +++ LPD M+ CY AL+NF+N++A
Sbjct  316   KVNALVTTIDDVYDVFGTLDELQIFTHAIERWS-IDELDRLPDNMKMCYYALDNFINQLA  374

Query  900   YDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAH  721
              D  +E G+FI  +LR  W DLCK+YL+EAKWY S Y P+ EEY++NAWI+IS P+IL H
Sbjct  375   DDAFEEQGIFISPYLRNSWRDLCKSYLREAKWYHSQYIPSMEEYMDNAWISISAPVILVH  434

Query  720   VFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
              +F V N     A+     +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E
Sbjct  435   AYFLVANPVNKEALHYLENNYHDIIRCSALILRLANDLGTSSDELKRGDVPKSIQCYMNE  494

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
              + S  EAR +I L +++ WKK+N+       PF   F+  AMN+ARMAQCMYQHGDGHG
Sbjct  495   TQASEEEARQYIRLLISQTWKKLNEAHWLAADPFPKIFVTCAMNLARMAQCMYQHGDGHG  554

Query  360   INNFETQTRIQTLLFE  313
              NN  T+  I  LLFE
Sbjct  555   GNNSTTKNHIMALLFE  570



>gb|ADR74206.1| (E)-beta-ocimene/myrcene synthase [Vitis vinifera]
Length=589

 Score =   536 bits (1381),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 291/593 (49%), Positives = 397/593 (67%), Gaps = 38/593 (6%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIHRSHASSSF-----RMCYHTT---TTTRRSANYGPPTWDYS  1861
             ++++A + +  T  +LP I RS +  +       M  ++T      RR+ANY PP WDY 
Sbjct  3     ISMLASIPNLITHTRLPIIRRSSSCKASPPGNQSMIGNSTCEEIIVRRTANYHPPIWDYD  62

Query  1860  YIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEI  1681
             Y+QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID L+RLG  YHF++ I
Sbjct  63    YVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELIDVLQRLGLYYHFKDAI  120

Query  1680  MEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFN  1501
                L  IY +  +  +     ++ DLYATALEFR+LR++G+++ +DVF  F D +   F 
Sbjct  121   KRILDSIYNQYNQHEDW----KKDDLYATALEFRLLRRHGYDVPEDVFSRFKD-ETGSFK  175

Query  1500  ASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----------------KHELKM  1369
             A L ED KGLL LYE+S+L ++GE+ LE ARDF+ +HL                 H L++
Sbjct  176   ACLCEDMKGLLCLYEASYLCVQGESTLEQARDFAHRHLGKGLEHNIDQNLAIEVNHALEL  235

Query  1368  PLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSY  1189
             PLHWRMPRLEAR FI+ Y+K +    N ILLE AKLDFN+VQA H EDLK +S WW+ + 
Sbjct  236   PLHWRMPRLEARWFIDIYEKRQDM--NPILLEFAKLDFNMVQATHQEDLKHMSSWWRSTR  293

Query  1188  IAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQL  1009
             + E+L FARDR++ENFLWT+G+   P+Y  CR M  K+ +FI  +DD+YD+YGTLDEL+L
Sbjct  294   LGEKLKFARDRLMENFLWTVGVIFEPQYGYCRRMLTKVGTFITIIDDVYDVYGTLDELEL  353

Query  1008  FTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCK  829
             FTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD LKEHG+ I+ +LRK+W+DLCK
Sbjct  354   FTDAVDRW-DINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGLHIISYLRKVWSDLCK  412

Query  828   AYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEi  649
             ++L EAKWY SGY PT +EYI NAWI++S P++L H +F+V N     A L  L  Y  I
Sbjct  413   SFLLEAKWYYSGYKPTLQEYISNAWISMSGPVVLVHAYFFVTNPITKEA-LQSLERYHNI  471

Query  648   irlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN  469
             IR SS+I RL++D GTS  E+KRGDVPK+IQCYM E   S  +AR  I   +   WKK+N
Sbjct  472   IRWSSMISRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHISYLIEGTWKKLN  531

Query  468   KVG-IEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             + G +E  SPF   FI +A N ARMAQCMYQHGDGHGI + ET+ R+ +LL E
Sbjct  532   EDGAVE--SPFPEIFIRIATNFARMAQCMYQHGDGHGIEDGETKDRVLSLLIE  582



>emb|CDP15198.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   536 bits (1381),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 275/547 (50%), Positives = 389/547 (71%), Gaps = 29/547 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P TWD+ Y++SL +  Y+ + ++ R   LKE+VK ML +EE+  + ++++ID+
Sbjct  59    RRSGNYQPSTWDFCYVESL-SNQYSGKRYINRCLVLKEQVKMML-DEEVDLLIQLKLIDD  116

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG +YHF+ +I   L  +Y +    +     + EKDLYATALEFR+LRQ+GF++SQ+
Sbjct  117   LQRLGIAYHFQNKIQSILSGVYKENHLGN----TSREKDLYATALEFRLLRQHGFDVSQE  172

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             VF+ F + K   F A+L ED KG+L+LYE+SFL +E E+ LE+AR+FS++ L        
Sbjct  173   VFNCFKNEKG-NFKANLCEDIKGMLHLYEASFLLVESESTLEMAREFSSECLENVLNHEG  231

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                      +H L++PLHWRM RLEAR FI+ Y+K    + N  LL+LAK+DFN+VQA H
Sbjct  232   ISEELILLVQHSLELPLHWRMQRLEARWFIDMYEK--RANRNPTLLDLAKIDFNLVQATH  289

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              +DL+  SRWW+ + +AE L FARDR+VENF WT+G+  +P+   CR M  ++ + +  +
Sbjct  290   QDDLQYASRWWQSTCLAENLAFARDRLVENFFWTVGVIFDPQQGYCRRMSTRVNALVTTI  349

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD+YGTLDEL+LFT  +ERW D+  ++ LP Y++ CY AL N +NE+AYD++KE GV
Sbjct  350   DDVYDVYGTLDELELFTAAVERW-DLGVMDQLPSYLKLCYFALYNSINEMAYDVMKEQGV  408

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              ++ +L+  W DLCKAYLQEAKWY SGY PT +EY++NAWI+IS P+IL H +F+V++  
Sbjct  409   HVISYLKNSWTDLCKAYLQEAKWYHSGYVPTLQEYLDNAWISISAPVILVHAYFFVSSPI  468

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
              + A L+CL  Y  IIR S++ILRLA+D GTS  E++RGDVPK+IQCYM+E+  S  EAR
Sbjct  469   TNEA-LECLDRYHNIIRCSAMILRLADDLGTSTDELQRGDVPKSIQCYMNESGASEEEAR  527

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
             +     + E WK+MNK  +   SPFS TFI +AMN+ RMAQCMYQ+GDGHG +N +T+ R
Sbjct  528   EHTRFLIGEAWKQMNKERV-ADSPFSQTFIGMAMNLGRMAQCMYQYGDGHGSSNSQTKDR  586

Query  333   IQTLLFE  313
             I+ LL +
Sbjct  587   IRALLLD  593



>gb|AHI50308.2| limonene-myrcene synthase [Erythranthe lewisii]
 gb|AHI50309.2| limonene-myrcene synthase [Erythranthe lewisii]
Length=615

 Score =   535 bits (1379),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 281/563 (50%), Positives = 386/563 (69%), Gaps = 28/563 (5%)
 Frame = -3

Query  1932  RMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMR  1753
             ++C  + T  RRS NY PP WD+ ++QSL+T  YA E +  R +EL ++VK ML  E++ 
Sbjct  51    QVCDQSPTVDRRSGNYEPPLWDFDFVQSLSTAKYAEERYSKRANELIKQVKKMLVGEQIM  110

Query  1752  E-VEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRV  1576
             E + ++E+ID+L  LG SYHF++EI   L  +Y +    ++ Y    ++DLY+T+L FR+
Sbjct  111   EPIHQLELIDDLHSLGISYHFDDEIDVILNSVYHQLFNGNDKYY--HQRDLYSTSLGFRL  168

Query  1575  LRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSA  1396
             LRQ+GF++SQ VFDGF + ++  F  SL +DTKGLL LYE+SFL  +GE  LELAR++S 
Sbjct  169   LRQHGFSVSQGVFDGFKN-EKGEFKESLGDDTKGLLQLYEASFLMTQGEKTLELAREYST  227

Query  1395  KHL--------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTS--NNAI  1282
               L                    +  L++P+HWR+ R  AR FIE Y   + +    N I
Sbjct  228   SLLHKKLDERIDDNDDDVLVLMIRRALELPVHWRIQRPNARWFIEEYSNERRSQIMKNPI  287

Query  1281  LLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYV  1102
             LLELAKLDFNIVQA H ++LK VS WW+++ +A+ L FARDR+VE +LWTIG    P+Y 
Sbjct  288   LLELAKLDFNIVQATHQQELKHVSSWWEQTGLAKTLPFARDRLVECYLWTIGGLFEPQYG  347

Query  1101  NCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALN  922
               RIM  K+ +FI  +DDI+D+YGTL+EL LF D I+RWD +  V+ LP YM+ C+LALN
Sbjct  348   YSRIMSTKVNAFITVIDDIFDVYGTLEELLLFNDVIQRWD-IEAVDKLPHYMQMCFLALN  406

Query  921   NFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITIS  742
             NFV+E+AY++LK+ G  I+ HLRK WA+LCKAYLQEAKWY+ GYTPT EEYI NAWI+IS
Sbjct  407   NFVDELAYNVLKQQGFLIIPHLRKSWANLCKAYLQEAKWYSKGYTPTLEEYINNAWISIS  466

Query  741   CPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKA  562
              P++L+H +F V N  ++ AV   L +Y  I+R S+++LRL+ND GTSP EMKRGDVPK+
Sbjct  467   APVMLSHEYFLVANPIDNEAV-QSLYEYHNIVRCSAMVLRLSNDLGTSPDEMKRGDVPKS  525

Query  561   IQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMY  382
             +QCYM+E      +A+ +I   + E WKKMN+  +   S F   F+  A+++ RMAQ MY
Sbjct  526   VQCYMNETGGDTEDAQTYIRTVIYETWKKMNEERVAADSLFQKDFVRSAVDLGRMAQYMY  585

Query  381   QHGDGHGINNFETQTRIQTLLFE  313
             QHGDGHGI+  E + RI +LLFE
Sbjct  586   QHGDGHGIHFPEMKDRISSLLFE  608



>emb|CAN62729.1| hypothetical protein VITISV_003091 [Vitis vinifera]
Length=606

 Score =   534 bits (1376),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 291/591 (49%), Positives = 394/591 (67%), Gaps = 38/591 (6%)
 Frame = -3

Query  2010  IMAKMFSTFTTCKLPSIHRSHASSSF-----RMCYHTT---TTTRRSANYGPPTWDYSYI  1855
             ++A + +  T  +LP + RS +  +       M  ++T      RR+ANY PP WDY Y+
Sbjct  1     MLASIPNLITHTRLPIMRRSSSCKASPPGNQSMIGNSTCEEIIVRRTANYHPPIWDYDYV  60

Query  1854  QSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID L+RLG  YHF++ I  
Sbjct  61    QSLRSD-YVGEIYTRRLDKLKREVKPMLGKVK-KPLDQLELIDVLQRLGLYYHFKDAIKR  118

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNAS  1495
              L  IY +  +        ++ DLYATALEFR+LRQ+G+++ +DVF  F D     F A 
Sbjct  119   ILDSIYNQYNQHEEW----KKDDLYATALEFRLLRQHGYDVPEDVFSRFKDETGI-FKAC  173

Query  1494  LSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----------------KHELKMPL  1363
             L ED KG+L LYE+S+L ++GE+ LE ARDF+ +HL                 H L++PL
Sbjct  174   LCEDMKGVLCLYEASYLCVQGESTLEQARDFAHRHLGKGLEHNIDQNLAIEVNHALELPL  233

Query  1362  HWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIA  1183
             HWRMPRLEAR FI+ Y+K +    N ILLE AKLDFN+VQA H EDLK +S WW+ + + 
Sbjct  234   HWRMPRLEARWFIDVYEKRQDM--NPILLEFAKLDFNMVQATHQEDLKHMSSWWRSTRLG  291

Query  1182  ERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFT  1003
             E+L FARDR++ENFLWT+G+   P+Y  CR M  K+ +FI  +DD+YD+YGTLDEL+LFT
Sbjct  292   EKLKFARDRLMENFLWTVGVIFEPQYGYCRRMLTKVGTFITIIDDVYDVYGTLDELELFT  351

Query  1002  DTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAY  823
             D ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD LKEHG+ I+ +LRK+W+DLCK++
Sbjct  352   DAVDRW-DINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGLQIISYLRKVWSDLCKSF  410

Query  822   LQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiir  643
             L EAKWY SGY PT +EYI NAWI++S P++L H +F+V N     A L  L  Y  IIR
Sbjct  411   LLEAKWYYSGYKPTLQEYISNAWISMSGPVVLVHAYFFVTNPITKEA-LQSLERYHNIIR  469

Query  642   lssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKV  463
              SS+I RL++D GTS  E+KRGDVPK+IQCYM E   S  +AR  I   +   WKK+N+ 
Sbjct  470   WSSMISRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHISYLIXGTWKKLNED  529

Query  462   G-IEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             G +E  SPF  TFI +A N ARMAQCMYQHGDGHGI + ET+ R+ +LL E
Sbjct  530   GAVE--SPFPETFIRIATNFARMAQCMYQHGDGHGIEDGETKDRVLSLLIE  578



>ref|NP_001268216.1| (-)-alpha-terpineol synthase [Vitis vinifera]
 gb|AAS79352.1| (-)-a-terpineol synthase [Vitis vinifera]
Length=590

 Score =   531 bits (1369),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 284/548 (52%), Positives = 375/548 (68%), Gaps = 30/548 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+ANY P  WDY Y+QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID
Sbjct  48    VRRTANYHPTIWDYDYVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELID  105

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG  YHF++EI   L  IY +  +        ++ DLYATALEFR+LRQ+G+++ Q
Sbjct  106   VLQRLGIYYHFKDEIKRILNSIYNQYNRHEEW----QKDDLYATALEFRLLRQHGYDVPQ  161

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             DVF  F D     F A L ED KG+L LYE+S+L ++GE+ +E ARDF+ +HL       
Sbjct  162   DVFSRFKDDT-GSFKACLCEDMKGMLCLYEASYLCVQGESTMEQARDFAHRHLGKGLEQN  220

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                      KH L++PLHWRMPRLEAR FI+ Y+K +    N ILLE AKLDFN+VQA H
Sbjct  221   IDQNLAIEVKHALELPLHWRMPRLEARWFIDVYEKRQDM--NPILLEFAKLDFNMVQATH  278

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              EDL+ +S WW  + + E+L FARDR++ENFLWT+G+   P+Y  CR M  K+ + I  +
Sbjct  279   QEDLRHMSSWWSSTRLGEKLNFARDRLMENFLWTVGVIFEPQYGYCRRMSTKVNTLITII  338

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD+YGT+DEL+LFTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD LKEHG+
Sbjct  339   DDVYDVYGTMDELELFTDVVDRW-DINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGL  397

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LRK W+DLCK+YL EAKWY S YTP+ +EYI N+WI+IS P+IL H +F V N  
Sbjct  398   HIVSYLRKAWSDLCKSYLLEAKWYYSRYTPSLQEYISNSWISISGPVILVHAYFLVANPI  457

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L  Y  IIR SS+ILRL++D GTS  E+KRGDVPK+IQCYM E   S  +AR
Sbjct  458   TKEA-LQSLERYHNIIRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDAR  516

Query  513   DFIDLEMNELWKKMNKVG-IEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
                   + E WKK+N+ G +E  SPF  TFI +AMN+ARMAQCMYQHGDGHGI   ET+ 
Sbjct  517   KHTSYLIGETWKKLNEDGAVE--SPFPETFIGIAMNLARMAQCMYQHGDGHGIEYGETED  574

Query  336   RIQTLLFE  313
             R+ +LL E
Sbjct  575   RVLSLLVE  582



>sp|Q6PWU2.1|ATESY_VITVI RecName: Full=(-)-alpha-terpineol synthase [Vitis vinifera]
 gb|AAS79351.1| (-)-a-terpineol synthase [Vitis vinifera]
Length=590

 Score =   531 bits (1368),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 284/548 (52%), Positives = 375/548 (68%), Gaps = 30/548 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+ANY P  WDY Y+QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID
Sbjct  48    VRRTANYHPTIWDYDYVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELID  105

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG  YHF++EI   L  IY +  +        ++ DLYATALEFR+LRQ+G+++ Q
Sbjct  106   VLQRLGIYYHFKDEIKRILNGIYNQYNRHEEW----QKDDLYATALEFRLLRQHGYDVPQ  161

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             DVF  F D     F A L ED KG+L LYE+S+L ++GE+ +E ARDF+ +HL       
Sbjct  162   DVFSRFKDDT-GSFKACLCEDMKGMLCLYEASYLCVQGESTMEQARDFAHRHLGKGLEQN  220

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                      KH L++PLHWRMPRLEAR FI+ Y+K +    N ILLE AKLDFN+VQA H
Sbjct  221   IDQNLAIEVKHALELPLHWRMPRLEARWFIDVYEKRQDM--NPILLEFAKLDFNMVQATH  278

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              EDL+ +S WW  + + E+L FARDR++ENFLWT+G+   P+Y  CR M  K+ + I  +
Sbjct  279   QEDLRHMSSWWSSTRLGEKLNFARDRLMENFLWTVGVIFEPQYGYCRRMSTKVNTLITII  338

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD+YGT+DEL+LFTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD LKEHG+
Sbjct  339   DDVYDVYGTMDELELFTDVVDRW-DINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGL  397

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LRK W+DLCK+YL EAKWY S YTP+ +EYI N+WI+IS P+IL H +F V N  
Sbjct  398   HIVSYLRKAWSDLCKSYLLEAKWYYSRYTPSLQEYISNSWISISGPVILVHAYFLVANPI  457

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L  Y  IIR SS+ILRL++D GTS  E+KRGDVPK+IQCYM E   S  +AR
Sbjct  458   TKEA-LQSLERYHNIIRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDAR  516

Query  513   DFIDLEMNELWKKMNKVG-IEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
                   + E WKK+N+ G +E  SPF  TFI +AMN+ARMAQCMYQHGDGHGI   ET+ 
Sbjct  517   KHTSYLIGETWKKLNEDGAVE--SPFPETFIGIAMNLARMAQCMYQHGDGHGIEYGETED  574

Query  336   RIQTLLFE  313
             R+ +LL E
Sbjct  575   RVLSLLVE  582



>gb|KDP35323.1| hypothetical protein JCGZ_09482 [Jatropha curcas]
Length=602

 Score =   531 bits (1369),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 287/550 (52%), Positives = 384/550 (70%), Gaps = 34/550 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSANY PP WDY+++QSL T+ +  E +  R  +LKE V  +L N+ M  ++++E+ID
Sbjct  56    VRRSANYQPPIWDYNFVQSL-TSEFKGEMYAKRISKLKEDVTVIL-NQPMNTLDQLELID  113

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKD-LYATALEFRVLRQNGFNIS  1549
              L+RLG +YHFE EI   LM IY     +      T+ K+ LYATAL+FR+LRQ+G+ I 
Sbjct  114   TLQRLGLAYHFEHEITRILMVIYGHNSDN------TQIKECLYATALKFRLLRQHGYRIP  167

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL------  1387
             Q++F+ F D K   F  SL ED +G+L+LYE+S+LS EGE  L++AR+F++  L      
Sbjct  168   QEIFNSFQDEKG-NFKTSLCEDIEGILSLYEASYLSEEGENVLQVAREFASNCLNKYVER  226

Query  1386  ----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLDFN VQA 
Sbjct  227   NKDQYLSILISHALELPLHWRMLRLEARWFIDVYERKQGM--NPILLELAKLDFNHVQAT  284

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H +DLK VS WWK + + E+L+FARDR++ENF WT+G+   P++  CR M  K+ + I  
Sbjct  285   HQDDLKYVSSWWKNTGLGEKLSFARDRLMENFFWTVGVIFEPQFGYCRRMSTKVNALITT  344

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFTD +ERW DV  +E LP+YM+ C+L L+N +NEIAYD LKE G
Sbjct  345   IDDVYDVYGTLDELELFTDAVERW-DVKAIEELPEYMKICFLCLHNSINEIAYDALKEQG  403

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN-  700
               I+ +L+K WAD+CK+YL EAKWY SGYTPT +EYI+NAWI+IS P+IL H +F +   
Sbjct  404   FHIISYLKKAWADICKSYLLEAKWYYSGYTPTLQEYIDNAWISISAPVILVHGYFLLKTP  463

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
             +  DA  L  L +YP IIR SS+ILRLA+D GTS  E+KRGDVPK+IQCYM E   S  +
Sbjct  464   ITTDA--LKALNEYPSIIRWSSMILRLADDLGTSSDELKRGDVPKSIQCYMHETGASEAK  521

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGIN-NFET  343
             AR+ I   ++++WKKMNK  +   S FS TFI +A+N+ RMAQCMYQHGDGHG   + ET
Sbjct  522   AREHIQDLISKIWKKMNKERV-VDSLFSKTFIGIAINLGRMAQCMYQHGDGHGNQADQET  580

Query  342   QTRIQTLLFE  313
             + R+ +LL E
Sbjct  581   KDRVLSLLIE  590



>gb|AHK23027.1| leucoplast 1,8-cineole synthase, partial [Nicotiana noctiflora]
Length=524

 Score =   526 bits (1354),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 372/547 (68%), Gaps = 45/547 (8%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID 
Sbjct  1     RRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELIDN  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR++GF+ISQ+
Sbjct  60    LQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREHGFHISQE  110

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK---  1372
             +FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+  LK   
Sbjct  111   IFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQARNWTEKHLREYLKNKN  162

Query  1371  --------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                           +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA H
Sbjct  163   IDQNVAKLVHRALELPLHWRMLRLEARWFIRFYKKSQDMI--PLLLELAILDFNIVQAAH  220

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             ++DLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y + R +  K+ + +  +
Sbjct  221   IQDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGHFRRIETKVNALVTTI  280

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L     
Sbjct  281   DDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL-----  334

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N  
Sbjct  335   -IVPYLRNAWTDLCKSYLIEAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPV  393

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EAR
Sbjct  394   NKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEAR  452

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ R
Sbjct  453   QHIRLLISETWKKLNEAHDVAAHPFPKMFVKSAMNLARMAQCMYQHGDGHGGQNSETQNR  512

Query  333   IQTLLFE  313
             I  LLFE
Sbjct  513   IMALLFE  519



>ref|XP_010659051.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=551

 Score =   526 bits (1354),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 283/548 (52%), Positives = 376/548 (69%), Gaps = 33/548 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+ANY PP WDY Y+QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID
Sbjct  12    VRRTANYHPPIWDYDYVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELID  69

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG    F++EI   L  IY +  +        ++ DLYATALEFR+LRQ+G+++ +
Sbjct  70    VLQRLGL---FKDEIKRILDSIYNQYNQHEEW----KKDDLYATALEFRLLRQHGYDVPE  122

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             DVF  F D +   F A L ED KG+L LYE+S+L ++GE+ LE ARDF+ +HL       
Sbjct  123   DVFSRFKD-ETGSFKACLCEDMKGMLCLYEASYLCVQGESTLEQARDFAHRHLGKGLEHN  181

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                       H L++PLHWRMPRLEAR FI+ Y+K +    N ILLE AKLDFN+VQA H
Sbjct  182   IDQNLAIEVNHALELPLHWRMPRLEARWFIDVYEKRQDM--NPILLEFAKLDFNMVQATH  239

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              EDL+ +S WW+ + + E+L FARDR++ENFLWT+G+   P+Y  CR M  KL +F+  +
Sbjct  240   QEDLRHMSSWWRSTRLGEKLNFARDRLMENFLWTVGMIFEPQYGYCRRMLTKLGTFVTII  299

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD+YGTLDEL+LFTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD LKEHG+
Sbjct  300   DDVYDVYGTLDELELFTDAVDRW-DINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGL  358

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LRK W+DLCK+YL EAKWY SGY PT +EYI NAWI+IS P++L H +F+V N  
Sbjct  359   HIISYLRKAWSDLCKSYLLEAKWYYSGYKPTLQEYISNAWISISGPVLLVHSYFFVANPI  418

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
              + A L  L  Y  II  SS+ILRL++D GTS  E+KRGDVPK+IQCYM E   S  +AR
Sbjct  419   TEEA-LQSLERYHNIIHWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDAR  477

Query  513   DFIDLEMNELWKKMNK-VGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
               I   + E WKK+N+   +E  SPF  TFI +A N+ARMAQCMYQHGDGHGI   ET+ 
Sbjct  478   KHISYLIGETWKKLNEDRAVE--SPFPETFIGIATNLARMAQCMYQHGDGHGIEYGETKD  535

Query  336   RIQTLLFE  313
             R+ +LL E
Sbjct  536   RVLSLLVE  543



>gb|AFO59753.1| chloroplast cineole synthase, partial [Nicotiana mutabilis]
Length=524

 Score =   524 bits (1350),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 282/547 (52%), Positives = 370/547 (68%), Gaps = 45/547 (8%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID 
Sbjct  1     RRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELIDN  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR+ GF+ISQ+
Sbjct  60    LQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREQGFHISQE  110

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK---  1372
             +FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+  LK   
Sbjct  111   IFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQARNWTEKHLREYLKNKN  162

Query  1371  --------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                           +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA H
Sbjct  163   IDQNEAKLVHRALELPLHWRMLRLEARWFISFYKKRQDMF--PLLLELAILDFNIVQAAH  220

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              EDLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + +  +
Sbjct  221   TEDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIETKVNALVTTI  280

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L     
Sbjct  281   DDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL-----  334

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL+EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N  
Sbjct  335   -IVPYLRNAWTDLCKSYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPV  393

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EAR
Sbjct  394   NKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEAR  452

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ R
Sbjct  453   QHIRLLISETWKKLNEAHDIAAHPFPKMFVKSAMNLARMAQCMYQHGDGHGGQNSETQNR  512

Query  333   IQTLLFE  313
             I  LLFE
Sbjct  513   IMALLFE  519



>gb|AFO63173.1| chloroplast cineolsynthase, partial [Nicotiana bonariensis]
Length=524

 Score =   523 bits (1348),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 280/547 (51%), Positives = 371/547 (68%), Gaps = 45/547 (8%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID 
Sbjct  1     RRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELIDN  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHF+ E+M+ L  I            +T    LYATAL+FR+LR++GF+ISQ+
Sbjct  60    LQRLGVSYHFKHEVMQILSSIKQH---------STRADSLYATALKFRLLREHGFHISQE  110

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK---  1372
             +FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+  LK   
Sbjct  111   IFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQARNWTEKHLREYLKNKN  162

Query  1371  --------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                           +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA H
Sbjct  163   IDQNVAKLVHRALELPLHWRMLRLEARWFIGFYKKRQDMI--PLLLELAILDFNIVQAAH  220

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             ++DLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + +  +
Sbjct  221   IQDLKYVARWWKETALAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIETKVNALVTTI  280

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L     
Sbjct  281   DDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL-----  334

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL+EAKWY S Y PT EEY +NAWI+IS P+IL H +F + N  
Sbjct  335   -IVPYLRNAWRDLCKSYLREAKWYFSKYIPTMEEYTDNAWISISAPVILVHAYFLIANPV  393

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EAR
Sbjct  394   NKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEAR  452

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ R
Sbjct  453   QHIRLLISETWKKLNEAHNIAAHPFPKMFVKTAMNLARMAQCMYQHGDGHGGQNSETQNR  512

Query  333   IQTLLFE  313
             I  LLFE
Sbjct  513   IMALLFE  519



>gb|ABP88782.1| plastid 1,8-cineol synthase precursor [Nicotiana suaveolens]
Length=610

 Score =   526 bits (1356),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 281/550 (51%), Positives = 372/550 (68%), Gaps = 41/550 (7%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             TRRS NYGP  WD+ YIQS++   Y  + ++ R ++LKE +K M+  E  +E+EK+E+ID
Sbjct  78    TRRSGNYGPTMWDFEYIQSIHND-YTEKKYMNRLNKLKEEMKKMIMAEGSQELEKLELID  136

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+ R+ GF+ISQ
Sbjct  137   NLQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLFREYGFHISQ  187

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             ++F G  +        + +EDTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+      
Sbjct  188   EIFGGLSE--------THTEDTKGMLYLYEASFLATEGESELEKARNWTEKHLREYLENK  239

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PLHWRM R+EAR FI  Y K +      +LLELA LDFNIVQA 
Sbjct  240   NDDQNVAELVHHALELPLHWRMLRIEARWFINFYKKKQDMI--PLLLELAILDFNIVQAA  297

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H+EDLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + +  
Sbjct  298   HIEDLKYVARWWKETCLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIETKVNALVTT  357

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD++GT+DELQ FT   +RW ++ ++++LPD M+ CY AL+NF+NE+A D  +EH 
Sbjct  358   IDDVYDVFGTMDELQCFTHAFQRW-NIDELDNLPDNMKMCYFALDNFINEVAGDAFEEHR  416

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
             V IL +LR  W DLCKAYL+EAKWY S Y PT EEY++NAWI+IS P+IL H +F V N 
Sbjct  417   VPILSYLRNAWTDLCKAYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLVANP  476

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
               +  VL  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EA
Sbjct  477   V-NKEVLHYLENYHDIIRWSALILRLANDLGTSSEELKRGDVPKSIQCYMNEKKVSEEEA  535

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGIN--NFET  343
             R  I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG    N ET
Sbjct  536   RQHIRLLISETWKKLNEAHNVAAHPFPKMFVKCAMNLARMAQCMYQHGDGHGHGDLNSET  595

Query  342   QTRIQTLLFE  313
                I  LLFE
Sbjct  596   TNHIMALLFE  605



>gb|AFO59752.1| chloroplast cineole synthase, partial [Nicotiana longiflora]
Length=524

 Score =   523 bits (1347),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 371/547 (68%), Gaps = 45/547 (8%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID 
Sbjct  1     RRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELIDN  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR++GF+ISQ+
Sbjct  60    LQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREHGFHISQE  110

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK---  1372
             +FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+  LK   
Sbjct  111   IFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQARNWTEKHLREYLKNKN  162

Query  1371  --------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                           +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA H
Sbjct  163   IDQNEAKLVHRALELPLHWRMLRLEARWFISFYKKRQDMI--PLLLELAILDFNIVQAAH  220

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             +EDLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + +  +
Sbjct  221   IEDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIETKVNALVTTI  280

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L     
Sbjct  281   DDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL-----  334

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL+EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N  
Sbjct  335   -IVPYLRNAWTDLCKSYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPV  393

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EAR
Sbjct  394   NKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEAR  452

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ  
Sbjct  453   QHIRLLISETWKKLNEAHNIAAHPFPKMFVKSAMNLARMAQCMYQHGDGHGGQNSETQNS  512

Query  333   IQTLLFE  313
             I  LLFE
Sbjct  513   IMALLFE  519



>gb|AFO63172.1| chloroplast cineolsynthase, partial [Nicotiana forgetiana]
Length=524

 Score =   522 bits (1345),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 280/547 (51%), Positives = 371/547 (68%), Gaps = 45/547 (8%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID 
Sbjct  1     RRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELIDN  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR++GF+ISQ+
Sbjct  60    LQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREHGFHISQE  110

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK---  1372
             +FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+  LK   
Sbjct  111   IFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQARNWTEKHLREYLKNKN  162

Query  1371  --------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                           +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA H
Sbjct  163   IDQNEAKLVHRALELPLHWRMLRLEARWFISFYKKRQDMI--PLLLELAILDFNIVQAAH  220

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             +EDLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + +  +
Sbjct  221   IEDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIETKVNALVTTI  280

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L     
Sbjct  281   DDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL-----  334

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL+EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N  
Sbjct  335   -IVPYLRNAWTDLCKSYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPV  393

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EAR
Sbjct  394   NKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEAR  452

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ  
Sbjct  453   QHIRLLISETWKKLNEAHNIAAHPFPKMFVKSAMNLARMAQCMYQHGDGHGGQNSETQNS  512

Query  333   IQTLLFE  313
             I  L+FE
Sbjct  513   IMALVFE  519



>ref|XP_009773702.1| PREDICTED: terpene synthase 10-like isoform X1 [Nicotiana sylvestris]
Length=568

 Score =   522 bits (1345),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 287/583 (49%), Positives = 374/583 (64%), Gaps = 47/583 (8%)
 Frame = -3

Query  2010  IMAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHY  1831
             +MA + S     K   I       S  +        RRS NY P  W+Y+ I+SL    Y
Sbjct  2     VMATIISASIISKPILIWTLQVPKSCNISNAQAAPLRRSGNYQPSIWEYTQIRSLKN-RY  60

Query  1830  AAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymk  1651
             + E F+ RRDELK  VK ML +  M+ ++++E+ID L+RLG SY+FE+EI   L  +  K
Sbjct  61    SGEKFIRRRDELKMEVKIMLSDRNMKPLDQLEIIDNLQRLGLSYNFEDEIYSILNYVCDK  120

Query  1650  kkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGL  1471
                      +    DLYA AL FR+LRQ+GFNISQ++FDG  +        + +EDTKG+
Sbjct  121   I--------SKSNGDLYAKALSFRLLRQHGFNISQEIFDGLSE--------THTEDTKGM  164

Query  1470  LNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPRL  1342
             L LYE+SFL+ EGE+ LE AR+++ KHL+                 H L++PLHWRM RL
Sbjct  165   LYLYEASFLATEGESELEQARNWTEKHLREYLENKNNNQNVAELVHHALELPLHWRMLRL  224

Query  1341  EARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFAR  1162
             EAR FI  Y K + T    +LLELA LDFNIVQA H++DLK V+RWWK++ +AE L FAR
Sbjct  225   EARWFINFYKKRQDTI--PLLLELAILDFNIVQAAHIQDLKYVARWWKETGLAENLPFAR  282

Query  1161  DRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWD  982
             DR+VENF WTIG+   P+Y   R +  K+ + I  +DD+YD++GTLDELQ FT  I+RW+
Sbjct  283   DRLVENFFWTIGVNFLPQYGYFRRISTKVNALITTIDDVYDVFGTLDELQCFTHAIQRWN  342

Query  981   DVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWY  802
                  + LPD M+ CY AL+NF+NE+A D L      I+ +LR  W DLCK+YL+EAKWY
Sbjct  343   ----ADDLPDNMKMCYFALDNFINEVACDAL------IVPYLRNAWTDLCKSYLREAKWY  392

Query  801   ASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilr  622
              S Y PT EEY++NAWI+IS P+IL H +F + N     A L  L +Y +IIR S++ILR
Sbjct  393   FSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPVNKEA-LHYLKNYHDIIRWSALILR  451

Query  621   LANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSP  442
             LAND GTS  E+KRGDVPK+IQCYM+E KV   +AR  I L ++E WKK+N+       P
Sbjct  452   LANDLGTSSEELKRGDVPKSIQCYMNEKKVCEEDARQHIKLLISETWKKLNEAHNVAAHP  511

Query  441   FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             F   F+  AMN+ARMAQCMYQHGDGHG  N ET+ RI  LLFE
Sbjct  512   FPKMFVTSAMNLARMAQCMYQHGDGHGGQNSETKNRIIALLFE  554



>gb|AEQ27769.1| sesquiterpene synthase [Ricinus communis]
Length=551

 Score =   521 bits (1342),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 279/547 (51%), Positives = 378/547 (69%), Gaps = 27/547 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             T  RRSANY PP WD+ ++QSL +  +  E  + R D+LKE VK ML N+ M   +++E+
Sbjct  10    TIIRRSANYRPPIWDFDFVQSLKS-EFVGELNIKRIDKLKEDVKMML-NKTMAPSDQLEL  67

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHF +EI   +  IY   +  +       ++DL+  AL+FR+LRQ+G+NI
Sbjct  68    IDTLQRLGLAYHFGDEIKRIVKSIYNSHRNDNTWM----KEDLHTIALQFRLLRQHGYNI  123

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
             SQ++FD F D +   F   L ED +G+L+LYE+S+L  EGE  LE+AR+F+A  LK    
Sbjct  124   SQEIFDIFRD-ELGNFKECLHEDIEGMLSLYEASYLLEEGENILEVAREFAASCLKKYIQ  182

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++PLHWRMPRLE R FI+ Y+K +    N +LLELAKLDFN VQA
Sbjct  183   VNKDQLLSMIVSHSLEVPLHWRMPRLETRWFIDIYEKKQGM--NPLLLELAKLDFNNVQA  240

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              + EDLK V+ WW+ + + E+L+FARDR++ENFLWT+G+   P++   R +  K+ S I 
Sbjct  241   TYHEDLKYVTSWWRNTGLGEKLSFARDRLMENFLWTVGVNFPPQFGYFRRISTKVNSLIT  300

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DDIYD+YGTLDELQLFT+ +ERW DV  ++ LP+YM+ C+LAL+N +NE+AYD L+E 
Sbjct  301   VIDDIYDVYGTLDELQLFTNAVERW-DVNAMDQLPEYMKLCFLALHNSINEMAYDALREQ  359

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G  I+ +L+K WADLCK+YL EAKWY  GYTPT +EY++NAWI+IS P+IL H +F   +
Sbjct  360   GFHIIPYLKKAWADLCKSYLVEAKWYYIGYTPTLQEYMDNAWISISAPVILVHAYFLEGS  419

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
                + A L  L +YP+II+ SS+ILR A+D GTS  E+KRGD PK+IQCY+ E  VS  +
Sbjct  420   PITNEA-LKSLKEYPDIIQWSSMILRFADDLGTSSDELKRGDNPKSIQCYIYETGVSELK  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR+ I   + E WKK+NK      SPFS  FIEVA N+ARMAQCMYQHGDGHGI + ET+
Sbjct  479   AREHIQYLIGETWKKINKEREYIDSPFSKIFIEVATNLARMAQCMYQHGDGHGIEDGETK  538

Query  339   TRIQTLL  319
               + +LL
Sbjct  539   DHVLSLL  545



>ref|XP_009773708.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=613

 Score =   523 bits (1347),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 280/550 (51%), Positives = 369/550 (67%), Gaps = 35/550 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P TWD+ YIQS++   YA + ++   +ELKE +K ++  E + E+EK+E+ID
Sbjct  75    SRRSGNYQPTTWDFEYIQSIHND-YAGDKYMKHFNELKEEMKKIIMAEGLEELEKLELID  133

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF +EIM+ L  I            +T    LYATAL+FR+LR++ F+ISQ
Sbjct  134   NLQRLGVSYHFRDEIMQILSSINQH---------STSADSLYATALKFRLLREHVFHISQ  184

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             D+F+ F D +      S+  DTKGLL LYE+SFL+ E ET L  A  F+  HLK      
Sbjct  185   DIFNNFKD-ENDNLKQSICNDTKGLLQLYEASFLATETETTLNYATRFTTTHLKNYVDNH  243

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++P HW MPRLE   ++  Y++   +S+N +LLELAKLDFNIVQ
Sbjct  244   CGDEENLMVALVQHALELPRHWMMPRLETEWYLSIYER--MSSSNPLLLELAKLDFNIVQ  301

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A H +DL+ +SRWWK +Y+AE+L+F+RDRVVE F WT+GL   P+Y  CR M  K+  FI
Sbjct  302   AAHQKDLRILSRWWKSTYLAEKLSFSRDRVVEAFFWTVGLLFEPQYSYCRRMLTKVIVFI  361

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
               +DDIYD++GTLDEL++FTD +ERW D+  +E LPDYM+ CYLAL N  NE+AYD+LKE
Sbjct  362   VVLDDIYDVFGTLDELEIFTDAVERW-DIKAMEQLPDYMKICYLALFNSTNEMAYDILKE  420

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              G+ +L +  + WADLCKAYLQEA+WY  GY PT EEYI+NAWI+I+ PLIL H FF+V 
Sbjct  421   KGINVLPYFTRQWADLCKAYLQEARWYYKGYKPTLEEYIDNAWISIATPLILVHAFFFVT  480

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
             N     A L+ L  YP+IIR  +II R  +D GTS  E+KRGDV K+IQC+M+E  VS  
Sbjct  481   NPITKEA-LESLNKYPDIIRRCAIINRFLDDLGTSSEELKRGDVSKSIQCFMNEKGVSEE  539

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             EA++ I + + E W+ MNK  +E    FS TFI +A+N +R + CMYQHGDGHGI N   
Sbjct  540   EAKEGIRILIKETWELMNKDQMEELL-FSETFIGIALNFSRASHCMYQHGDGHGIQNSHI  598

Query  342   QTRIQTLLFE  313
               RI  LLFE
Sbjct  599   INRISKLLFE  608



>ref|XP_002533355.1| (R)-limonene synthase, putative [Ricinus communis]
 sp|B9T536.1|TPS10_RICCO RecName: Full=Terpene synthase 10; Short=RcSeTPS10 [Ricinus communis]
 gb|EEF29028.1| (R)-limonene synthase, putative [Ricinus communis]
Length=551

 Score =   520 bits (1339),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 279/547 (51%), Positives = 377/547 (69%), Gaps = 27/547 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             T  RRSANY PP WD+ ++QSL +  +  E  + R D+LKE VK ML N+ M   ++ E+
Sbjct  10    TIIRRSANYRPPIWDFDFVQSLKS-EFVGELNIKRIDKLKEDVKMML-NKTMAPSDQFEL  67

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHF +EI   +  IY   +  +       ++DL+  AL+FR+LRQ+G+NI
Sbjct  68    IDTLQRLGLAYHFGDEIKRIVKSIYNSHRNDNTWM----KEDLHTIALQFRLLRQHGYNI  123

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
             SQ++FD F D +   F   L ED +G+L+LYE+S+L  EGE  LE+AR+F+A  LK    
Sbjct  124   SQEIFDIFRD-ELGNFKECLHEDIEGMLSLYEASYLLEEGENILEVAREFAASCLKKYIQ  182

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++PLHWRMPRLE R FI+ Y+K +    N +LLELAKLDFN VQA
Sbjct  183   VNKDQLLSMIVSHSLEVPLHWRMPRLETRWFIDIYEKKQGM--NPLLLELAKLDFNNVQA  240

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              + EDLK V+ WW+ + + E+L+FARDR++ENFLWT+G+   P++   R +  K+ S I 
Sbjct  241   TYHEDLKYVTSWWRNTGLGEKLSFARDRLMENFLWTVGVNFPPQFGYFRRISTKVNSLIT  300

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DDIYD+YGTLDELQLFT+ +ERW DV  ++ LP+YM+ C+LAL+N +NE+AYD L+E 
Sbjct  301   VIDDIYDVYGTLDELQLFTNAVERW-DVNAMDQLPEYMKLCFLALHNSINEMAYDALREQ  359

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G  I+ +L+K WADLCK+YL EAKWY  GYTPT +EY++NAWI+IS P+IL H +F   +
Sbjct  360   GFHIIPYLKKAWADLCKSYLVEAKWYYIGYTPTLQEYMDNAWISISAPVILVHAYFLEGS  419

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
                + A L  L +YP+II+ SS+ILR A+D GTS  E+KRGD PK+IQCY+ E  VS  +
Sbjct  420   PITNEA-LKSLKEYPDIIQWSSMILRFADDLGTSSDELKRGDNPKSIQCYIYETGVSELK  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR+ I   + E WKK+NK      SPFS  FIEVA N+ARMAQCMYQHGDGHGI + ET+
Sbjct  479   AREHIQYLIGETWKKINKEREYIDSPFSKIFIEVATNLARMAQCMYQHGDGHGIEDGETK  538

Query  339   TRIQTLL  319
               + +LL
Sbjct  539   DHVLSLL  545



>emb|CAK55186.1| pinene synthase [Quercus ilex]
Length=597

 Score =   521 bits (1343),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 288/546 (53%), Positives = 377/546 (69%), Gaps = 28/546 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRSANY P  W++ YI+SL    +  E    + + LKE+V+ ML ++ +  +E++E+I+ 
Sbjct  57    RRSANYQPSIWNHDYIESLRI-EFVGETCTRQINVLKEQVRMML-HKVVNPLEQLELIEI  114

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHFEEEI   L  +Y             + ++LYATAL+FR+LRQ+G+++SQ+
Sbjct  115   LQRLGLSYHFEEEIKRILDGVYNNDHGGD----TWKAENLYATALKFRLLRQHGYSVSQE  170

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------  1384
             VF+ F D +R  F A L EDTKG+L+LYE+SF  +EGE  LE ARDFS KHL+       
Sbjct  171   VFNSFKD-ERGSFKACLCEDTKGMLSLYEASFFLIEGENILEEARDFSTKHLEEYVKQNK  229

Query  1383  ---------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHL  1231
                      H L++PLHWRM RLEAR FI  Y   +    N ILLE A+LDFNIVQA H 
Sbjct  230   EKNLATLVNHSLELPLHWRMLRLEARWFINIYRHNQDV--NPILLEFAELDFNIVQAAHQ  287

Query  1230  EDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVD  1051
              DLK VS WWK + + E L+FARDR VENF WT+GL   P++  CR M  K+++ I  +D
Sbjct  288   ADLKQVSTWWKSTGLVENLSFARDRPVENFFWTVGLIFQPQFGYCRRMFTKVFALITTID  347

Query  1050  DIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVF  871
             D+YD+YGTLDEL+LFTD +ERW D+  ++ LPDYM+ C+L L+N VNE+A D +KE    
Sbjct  348   DVYDVYGTLDELELFTDVVERW-DINAMDQLPDYMKICFLTLHNSVNEMALDTMKEQRFH  406

Query  870   ILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAE  691
             I+ +L+K W DLC++YL EAKWY + YTP+ +EYIENAWI+IS P IL HV+F+V N   
Sbjct  407   IIKYLKKAWVDLCRSYLLEAKWYYNKYTPSLQEYIENAWISISAPTILVHVYFFVTNPIT  466

Query  690   DAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARD  511
               A LDCL +YP IIR SS ILRLA+D GTS  E+KRGDVPKAIQCYM+E   S  +AR+
Sbjct  467   KEA-LDCLEEYPNIIRWSSTILRLADDLGTSTDELKRGDVPKAIQCYMNETGASEEDARE  525

Query  510   FIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRI  331
             +I   ++  WKKMN+  +   SPFS  FIE+A+N+ARMAQCMYQHGDGHG  N ET+ RI
Sbjct  526   YIKYLISATWKKMNEDRV-ASSPFSHIFIEIALNLARMAQCMYQHGDGHGHGNHETKDRI  584

Query  330   QTLLFE  313
              +LL +
Sbjct  585   LSLLIQ  590



>gb|AEX09186.1| plastid terpineol synthase [Nicotiana langsdorffii]
Length=522

 Score =   518 bits (1334),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 370/547 (68%), Gaps = 47/547 (9%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID 
Sbjct  1     RRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELIDN  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR++GF+ISQ+
Sbjct  60    LQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREHGFHISQE  110

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK---  1372
             +FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE A  ++ KHL+  LK   
Sbjct  111   IFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQA--WTEKHLREYLKNKN  160

Query  1371  --------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                           +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA H
Sbjct  161   IDQNVAKLVHRALELPLHWRMLRLEARWFISFYKKRQDMI--PLLLELAILDFNIVQAAH  218

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             ++DLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + + A+
Sbjct  219   IQDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGYSRRIETKVNALVTAI  278

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L     
Sbjct  279   DDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL-----  332

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N  
Sbjct  333   -IVPYLRNAWTDLCKSYLIEAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPV  391

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EAR
Sbjct  392   NKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEAR  450

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ R
Sbjct  451   QHIRLLISETWKKLNEAHNVAAHPFPKMFVKSAMNLARMAQCMYQHGDGHGGQNSETQNR  510

Query  333   IQTLLFE  313
             I  LLFE
Sbjct  511   IMALLFE  517



>ref|XP_009773703.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Nicotiana 
sylvestris]
Length=547

 Score =   519 bits (1336),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 365/547 (67%), Gaps = 47/547 (9%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  W+Y+ I+SL    Y+ E F+ RRDELK  VK ML +  M+ ++++E+ID 
Sbjct  17    RRSGNYQPSIWEYTQIRSL-KNRYSGEKFIRRRDELKMEVKIMLSDRNMKPLDQLEIIDN  75

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SY+FE+EI   L  +  K         +    DLYA AL FR+LRQ+GFNISQ+
Sbjct  76    LQRLGLSYNFEDEIYSILNYVCDKI--------SKSNGDLYAKALSFRLLRQHGFNISQE  127

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------  1384
             +FDG  +        + +EDTKG+L LYE+SFL+ EGE+ LE AR+++ KHL+       
Sbjct  128   IFDGLSE--------THTEDTKGMLYLYEASFLATEGESELEQARNWTEKHLREYLENKN  179

Query  1383  ----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                       H L++PLHWRM RLEAR FI  Y K + T    +LLELA LDFNIVQA H
Sbjct  180   NNQNVAELVHHALELPLHWRMLRLEARWFINFYKKRQDTI--PLLLELAILDFNIVQAAH  237

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             ++DLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + I  +
Sbjct  238   IQDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRISTKVNALITTI  297

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD++GTLDELQ FT  I+RW+     + LPD M+ CY AL+NF+NE+A D L     
Sbjct  298   DDVYDVFGTLDELQCFTHAIQRWN----ADDLPDNMKMCYFALDNFINEVACDAL-----  348

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LR  W DLCK+YL+EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N  
Sbjct  349   -IVPYLRNAWTDLCKSYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANPV  407

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KV   +AR
Sbjct  408   NKEA-LHYLKNYHDIIRWSALILRLANDLGTSSEELKRGDVPKSIQCYMNEKKVCEEDAR  466

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               I L ++E WKK+N+       PF   F+  AMN+ARMAQCMYQHGDGHG  N ET+ R
Sbjct  467   QHIKLLISETWKKLNEAHNVAAHPFPKMFVTSAMNLARMAQCMYQHGDGHGGQNSETKNR  526

Query  333   IQTLLFE  313
             I  LLFE
Sbjct  527   IIALLFE  533



>gb|AFB82540.1| plastid monoterpene synthase [Nicotiana alata]
Length=543

 Score =   518 bits (1335),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 281/548 (51%), Positives = 370/548 (68%), Gaps = 47/548 (9%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             TRRS NY P  WD+ YIQS++   YA + ++ R +ELKE +K M+  E  +E+EK+E+ID
Sbjct  21    TRRSGNYQPTMWDFEYIQSIHND-YAGDKYMKRFNELKEEMKKMIMAEGSQELEKLELID  79

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR++GF+ISQ
Sbjct  80    NLQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREHGFHISQ  130

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK--  1372
             ++FDG  +        + ++DTKG+L LYE+SFL+ EGE+ LE A  ++ KHL+  LK  
Sbjct  131   EIFDGLSE--------THTKDTKGMLYLYEASFLATEGESELEQA--WTEKHLREYLKNK  180

Query  1371  ---------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                            +PLHWRM RLEAR FI  Y K +      +LLELA LDFNIVQA 
Sbjct  181   NIDQNVAKLVHRALELPLHWRMLRLEARWFISFYKKRQDMI--PLLLELAILDFNIVQAA  238

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H++DLK V+RWWK++ +AE L FARDR+VENF WTIG+   P+Y   R +  K+ + +  
Sbjct  239   HIQDLKYVARWWKETGLAENLPFARDRLVENFFWTIGVNFLPQYGYFRRIETKVNALVTT  298

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD++GTLDELQ FTD I+RW +  ++++LPD M+ CY AL++F+NE+A D L    
Sbjct  299   IDDVYDVFGTLDELQCFTDAIQRW-NTDELDNLPDNMKMCYFALDDFINEVACDAL----  353

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
               I+ +LR  W DLCK+YL EAKWY S Y PT EEY++NAWI+IS P+IL H +F + N 
Sbjct  354   --IVPYLRNAWTDLCKSYLIEAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLIANP  411

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
                 A L  L +Y +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM+E KVS  EA
Sbjct  412   VNKEA-LHYLRNYHDIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEA  470

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             R  I L ++E WKK+N+       PF   F++ AMN+ARMAQCMYQHGDGHG  N ETQ 
Sbjct  471   RQHIRLLISETWKKLNEAHNVAAHPFPKMFVKSAMNLARMAQCMYQHGDGHGGQNSETQN  530

Query  336   RIQTLLFE  313
             RI  LLFE
Sbjct  531   RIMALLFE  538



>ref|XP_009609201.1| PREDICTED: terpene synthase 10-like [Nicotiana tomentosiformis]
Length=567

 Score =   519 bits (1336),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 283/584 (48%), Positives = 382/584 (65%), Gaps = 48/584 (8%)
 Frame = -3

Query  2013  AIMAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTH  1834
             +I++K F  +T  ++P    S+A ++           RRS NY P  W+Y+ IQSL    
Sbjct  10    SIISKPFLIWT-LQVPKSCISNAQAA---------PLRRSGNYQPSIWEYTQIQSLKN-Q  58

Query  1833  YAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIym  1654
             Y+ E F+ RRDELK  VK ML +  M+ ++++E+ID L+RLG SY+FE+EI   L  +  
Sbjct  59    YSGEKFIRRRDELKMEVKIMLSDRNMKPLDQLEIIDLLQRLGLSYNFEDEIYSILNYVCD  118

Query  1653  kkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKG  1474
             K         +    DLYA AL FR+LRQ+GFN+SQ++FDG  +          +EDTKG
Sbjct  119   KS--------SKSNGDLYAKALSFRLLRQHGFNVSQEIFDGLSETH--------TEDTKG  162

Query  1473  LLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPR  1345
             +  LYE+SFL+ EGE+ LE  R++S K L+                 H L++PLHW+M R
Sbjct  163   MQYLYEASFLATEGESELEQTRNWSEKQLREYLENKNIDQNVAELVHHALELPLHWKMLR  222

Query  1344  LEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFA  1165
             LEAR FI  Y K +      +LLELA LDFN+VQA H+EDLK V+RWWK++ +AE L FA
Sbjct  223   LEARWFINFYKKRQDMI--PLLLELAILDFNVVQAAHIEDLKYVARWWKETGLAENLPFA  280

Query  1164  RDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERW  985
             RDR+VENF WTIG+   PKY   R +  K+ + +  +DD+YD++GTLDELQ FTD I+RW
Sbjct  281   RDRLVENFFWTIGVNFLPKYGYFRRIATKVNALVTTIDDVYDVFGTLDELQCFTDAIQRW  340

Query  984   DDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKW  805
              ++ ++++LPD M+ CY  L+NF+NE+A D  +E  + I+ +LR  W DLCK+YL+EAKW
Sbjct  341   -NIDELDNLPDNMKLCYFTLDNFINEVACDAFEEQRILIVPYLRNAWRDLCKSYLREAKW  399

Query  804   YASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiil  625
             Y S Y PT EEY++NAWI+IS P+IL H +F + N   +   L  L +Y +IIR S++IL
Sbjct  400   YFSQYIPTMEEYMDNAWISISAPVILVHAYFLIANPV-NKEDLHYLKNYHDIIRWSALIL  458

Query  624   rLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGS  445
             RLAND GTS  E+KRGDVPK+IQCYM+E KVS  +A   I L ++E WKK+N+       
Sbjct  459   RLANDLGTSSEELKRGDVPKSIQCYMNEKKVSEEDAHQHIRLLISETWKKLNEAHNVAAH  518

Query  444   PFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             PF   FI  AMN+ARMAQCMYQHGDGHG +N ET+  I  LLFE
Sbjct  519   PFPKMFIWSAMNLARMAQCMYQHGDGHGGHNSETKNHIMALLFE  562



>gb|KDP35321.1| hypothetical protein JCGZ_09480 [Jatropha curcas]
Length=593

 Score =   519 bits (1337),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 280/552 (51%), Positives = 374/552 (68%), Gaps = 31/552 (6%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             T    RRSANY PP WD  + QSL T+ +  E +  R ++LKE V+ ML N+ +  + ++
Sbjct  47    TENIVRRSANYQPPIWDNDFAQSL-TSEFKGEVYGKRINKLKEDVRVML-NQPINTLNQL  104

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E+ID L+RLG  YHFE+EI   LM IY K+            +D++A ALEFR+LRQ+G+
Sbjct  105   ELIDTLQRLGIGYHFEDEIERQLMGIYSKRTG------VAGTEDIHAIALEFRLLRQHGY  158

Query  1557  NISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK--  1384
             +ISQDVF  F D +   F   L E+ +G+L+LYE+SFL  EGE+ L++ARDF+  +L   
Sbjct  159   SISQDVFSNFQD-EMGNFKTCLGENLEGMLSLYEASFLEEEGESILQVARDFTTGYLNGY  217

Query  1383  ---------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNI  1249
                            H L+MPLHWRMPRLE R FI+ Y   +    +++LLELA LDFN 
Sbjct  218   IKRNKNDKYTSMLITHALEMPLHWRMPRLETRWFIDIY--ARKQGMDSLLLELAMLDFNY  275

Query  1248  VQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYS  1069
             VQA+H EDLK  SRWW  + +AE+L+FARDR++ENFLWTIG+   P++   R M AKL++
Sbjct  276   VQAIHQEDLKYSSRWWMNTGLAEKLSFARDRIMENFLWTIGMIFEPQFGYYRRMTAKLFA  335

Query  1068  FICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDML  889
                 +DDIYD+YGTLDEL+LFTD ++RW DV  +E LPDYM+ C+LAL+N +NEIA+D L
Sbjct  336   LATTIDDIYDVYGTLDELELFTDAVKRW-DVNAMEQLPDYMKICFLALHNSINEIAFDTL  394

Query  888   KEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFY  709
             KE G+ I+ +L+K WADLCKA+L EAKWY  GYTPT EEYI+NA I+I+ PL+L H +F 
Sbjct  395   KEQGLNIIPYLKKSWADLCKAFLLEAKWYNDGYTPTLEEYIDNALISIAGPLLLVHGYFL  454

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
             + N     A L  L +Y  IIR S+II RLA+D  TS  E+KRGDVPK+IQCYM E   S
Sbjct  455   LKNPVTIDA-LKVLKEYSNIIRSSAIIFRLADDLATSSDEIKRGDVPKSIQCYMHETGAS  513

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
                AR+ I   +++ W+ MNK  +   SPFS  F+ +A N+ RMAQCMYQ+GDGHGI + 
Sbjct  514   EVRAREHIQYLISQTWRNMNKERVV-DSPFSKPFVGLANNLTRMAQCMYQYGDGHGIEDQ  572

Query  348   ETQTRIQTLLFE  313
             ET+ R+ +LL +
Sbjct  573   ETKDRVLSLLIQ  584



>gb|AII32477.1| terpene synthase [Populus trichocarpa]
Length=589

 Score =   517 bits (1331),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 276/548 (50%), Positives = 378/548 (69%), Gaps = 29/548 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSANY    W+Y ++QSL T+ Y  E +  R ++LK  ++ ML N   + ++++E+ID
Sbjct  52    VRRSANYQTSIWEYDFVQSL-TSKYKGEPYTARSEKLKANIRMMLANAS-KPLDQLELID  109

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF +EI   L  ++ K    +         DLYATALEFR+LRQ+G+ + Q
Sbjct  110   ALQRLGLSYHFVDEIKSTLKSLFYKNHIENTKTV----HDLYATALEFRLLRQHGYKVPQ  165

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF+ F D ++  F A + +D KG+L LYE+S+  +EGE+ LE ARDF+ K+L+      
Sbjct  166   EVFNHFKD-EQGNFRAWIHDDLKGMLFLYEASYFLVEGESILEDARDFTTKNLEKYFKKC  224

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PL WRM RLE+  FI  Y+    T    +LLELAKLDFN+VQA+
Sbjct  225   NPSEYLSKMVSHALELPLAWRMLRLESNWFINVYET--KTDMEPVLLELAKLDFNMVQAL  282

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H EDLK  SRWWK++ + E+L FARDR+VENFLWT+G+   P++ NCR M  K+ S I  
Sbjct  283   HQEDLKHSSRWWKRTGLGEKLDFARDRLVENFLWTVGVIFEPQFGNCRRMLTKVNSLITT  342

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFTD + RW D+  ++ LPDYM+ C+LAL N VNE+AY++LK  G
Sbjct  343   IDDVYDVYGTLDELELFTDAVVRW-DLNYMDRLPDYMKLCFLALFNSVNEMAYNILKYQG  401

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
             V IL +L+K WADLCK+YL EAKWY SGYTPT +EY++NAWI+IS P+IL H +FYV+N 
Sbjct  402   VDILPYLKKAWADLCKSYLLEAKWYFSGYTPTLQEYMDNAWISISAPVILVHAYFYVSNP  461

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
               + A    + +YP+IIR SS+ILRLA+D GTS  E+KRGD+ K+IQCYM EA VS  +A
Sbjct  462   TTEEAS-QFMEEYPDIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAGVSEEKA  520

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             R+ I   +   WKK+N    +     S TFI +AMN+ARMAQCMYQ+GDGHG+ + ET+ 
Sbjct  521   REHIRNLIENTWKKINDYQFDNPR-ISQTFIGIAMNLARMAQCMYQYGDGHGVGHLETKD  579

Query  336   RIQTLLFE  313
             R+++LL +
Sbjct  580   RVKSLLIK  587



>ref|XP_004230563.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=591

 Score =   516 bits (1329),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 280/597 (47%), Positives = 390/597 (65%), Gaps = 43/597 (7%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIH---RSHASSSFRMCYHT--TTTTRRSANYGPPTWDYSYIQ  1852
             ++I++ +     T K PS+    R HA+++  +  H+   + TRRS NY P  WD+ +I+
Sbjct  2     VSILSNIRMIMVTYKRPSLFTSLRRHAANNIIITKHSHPISATRRSGNYKPTLWDFQFIE  61

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDML---KNEEMREVEKMEMIDELKRLGCSYHFEEEI  1681
             SL+   YA + ++ R +ELK+ VK M+   +  +  E+EK+E+ID L+RLG SYHF++EI
Sbjct  62    SLHNP-YAGDKYMKRLNELKKEVKKMMMTVEGSQDEELEKLELIDNLERLGVSYHFKDEI  120

Query  1680  MEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFN  1501
             M+ L  I+ +K         + +  LY+TAL+FR+LRQ+GF+ISQD+ + F D +   F 
Sbjct  121   MQILKSIHEQKI-------TSTDNSLYSTALKFRLLRQHGFHISQDILNDFKDDQ-GNFK  172

Query  1500  ASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK--------------------H  1381
              S  EDTKGLL LYE+SFLS E ET LE A  F+  HLK                    H
Sbjct  173   QSHCEDTKGLLQLYEASFLSTESET-LESANTFATSHLKDYLHNLKGDDQENWRIELVRH  231

Query  1380  ELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWW  1201
              L++PL  +M R+E R +I+ Y+K    + N +L ELAKLDFNI+QA H +DLK++SRWW
Sbjct  232   ALELPLRCKMLRVETRWYIDIYEK--IPNANPLLPELAKLDFNILQATHQQDLKNLSRWW  289

Query  1200  KKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN-CRIMGAKLYSFICAVDDIYDIYGTL  1024
              KS +AE+L F RDR+VE+ LW  G+   P+  + CR M  K+ + +  +DDIYD+YGTL
Sbjct  290   NKSLLAEKLPFTRDRIVESLLWIAGMMFEPQKNDYCRTMLTKVLAMVTVIDDIYDVYGTL  349

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMW  844
             DEL++FTD ++RW+ V  V+ LPDYM+ CYLAL N   EI Y++LKE G+ ++ +L K W
Sbjct  350   DELEIFTDAVQRWN-VKAVDQLPDYMKICYLALFNTTTEIVYEVLKEQGINVVIYLTKSW  408

Query  843   ADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLT  664
             +DLCK+YL+EA+WY SGY P+ EEY+EN WITI  P++L H  F V N     A L+ LT
Sbjct  409   SDLCKSYLREARWYHSGYKPSLEEYMENGWITIGAPVVLVHTLFLVTNPITKEA-LESLT  467

Query  663   DYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNEL  484
              YP+II+ S+ I+RL +D GTS  EM+RGDVPK+IQCYM+E  VS  +AR  I+L + E 
Sbjct  468   SYPDIIQCSATIIRLTDDLGTSSDEMERGDVPKSIQCYMNEKGVSEEDARKHINLLIKET  527

Query  483   WKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             WK MN    +  S FS TFI  A+N AR +  +YQHGDG+GI N  T+ RI+ L FE
Sbjct  528   WKLMNTALQKENSLFSETFIACAVNGARTSHTIYQHGDGYGIQNLHTKNRIRQLFFE  584



>ref|XP_004161807.1| PREDICTED: LOW QUALITY PROTEIN: (-)-alpha-terpineol synthase-like 
[Cucumis sativus]
Length=598

 Score =   516 bits (1330),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 269/575 (47%), Positives = 383/575 (67%), Gaps = 31/575 (5%)
 Frame = -3

Query  1986  FTTCKLPSIHRS-HASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVM  1810
             F    +P I +    +++ RMC  + T  RRS NY PP W + +IQSL +  +  E +V 
Sbjct  23    FNPSFIPRIVKVISKTTATRMC--SQTIVRRSGNYQPPFWKHEFIQSLRS-EFGGEIYVG  79

Query  1809  RRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnn  1630
             R +ELK  ++ ++ N+    ++++E+ID L+RLG SYHFE EI   L        + S  
Sbjct  80    RFNELKREIR-LIINQIDDPLKQLELIDTLQRLGISYHFENEIKNVL----KTTYEKSYE  134

Query  1629  yKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESS  1450
                 +  +LYAT+LEFR+LRQ+GFN+SQDVF+ F   +   FN  + +D  G+L LYE+S
Sbjct  135   NDYWKNXNLYATSLEFRLLRQHGFNLSQDVFNNFYSSETKSFNTQMYQDLNGMLFLYEAS  194

Query  1449  FLSMEGETNLELARDFSAKHL----------------KHELKMPLHWRMPRLEARSFIES  1318
             FLS+EGE  LE A+ F+ K+L                +H L++PLHWRMPRLE R FI+ 
Sbjct  195   FLSIEGENILETAKHFTVKYLEKYMKSSKDEKEVAIVRHALELPLHWRMPRLETRWFIDI  254

Query  1317  YDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFL  1138
             Y++      N ILLE AKLDFN VQ++H +DLK  S WW+ +   E+L FARDR++ENFL
Sbjct  255   YER--KVDMNPILLEFAKLDFNRVQSIHQQDLKYASSWWRSTGFGEKLRFARDRLMENFL  312

Query  1137  WTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHL  958
             WT+G    PK+ + R M  K+ +FI  +DD+YD+YGTLDELQLFTD IERW DV  ++ L
Sbjct  313   WTVGFGYEPKFSSYRRMATKINAFITTIDDVYDVYGTLDELQLFTDAIERW-DVDALDQL  371

Query  957   PDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTF  778
             PDYM+ C+ AL+N +NE+A+++L++ G+ ++ +L+K W DLCK+Y+ EAKWY + + PT 
Sbjct  372   PDYMKICFFALHNSINEMAFEVLRDKGINVIQYLKKAWVDLCKSYMLEAKWYHTNHKPTL  431

Query  777   EEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTS  598
             EEY++NAWI+IS P++L H + +V +   +   ++ L  Y +++R SS ILRLA+D GTS
Sbjct  432   EEYLDNAWISISGPVVLIHAYVFVTSPTLEN--MESLKQYVDMVRWSSTILRLADDLGTS  489

Query  597   PFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEV  418
               E+ RGDVPK+IQCYM +   S ++AR  I   ++E WKK+NKV +E  S F   FIE 
Sbjct  490   SNELARGDVPKSIQCYMKDTGGSESDARKHIRHLIDETWKKLNKVQVE-NSIFPKVFIER  548

Query  417   AMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             A N+ARMAQCMYQ+GDGHGI + ET+ R+ +LL +
Sbjct  549   AKNVARMAQCMYQYGDGHGIVHQETKDRVMSLLIQ  583



>ref|XP_009779942.1| PREDICTED: (-)-alpha-terpineol synthase-like [Nicotiana sylvestris]
Length=545

 Score =   514 bits (1325),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 277/546 (51%), Positives = 370/546 (68%), Gaps = 25/546 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  W+  Y+QS   T YA E    R   LKE V+ ML  + +   E++E++D 
Sbjct  4     RRSGNYKPSIWEDGYVQS-RATFYAEEKHFERAAGLKEEVRRML-GKTIDPFEQLELVDI  61

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHFEEEI   L  +Y+    ++ N     E DLYATALEFR+LR+ G+++ Q+
Sbjct  62    LQRLGLSYHFEEEIDRVLKQMYVNIYTTNRNDGQKSE-DLYATALEFRLLRREGYHVPQE  120

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             +F  FM+ K   F  SL  DTKGLL+LYE+ +LSMEGE+ LE+ARDF+  +L        
Sbjct  121   MFCTFMN-KEGKFKTSLVVDTKGLLSLYEACYLSMEGESILEIARDFATNYLTESLKKKI  179

Query  1386  --------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHL  1231
                      H L+MPLHWRM RLEAR FIE Y K +    N +LLELAKLD+N+VQA +L
Sbjct  180   DENLTEQVSHALEMPLHWRMQRLEARWFIEVYHKRENM--NPLLLELAKLDYNMVQATYL  237

Query  1230  EDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVD  1051
             E+LK +SRW K   + ++++F RDR+VE FLW +G TPNP++  CR    K+   + A+D
Sbjct  238   EELKEMSRWDKNIKLVKKMSFVRDRLVEGFLWAVGFTPNPQFGYCRKFSTKMSVLLTAID  297

Query  1050  DIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVF  871
             DIYD+YGT+DEL+LFTD ++RW D+  +E LPDYM+ C+LAL N +NE+AYD+LKE G  
Sbjct  298   DIYDVYGTMDELELFTDIVDRW-DINAIERLPDYMKICFLALFNSMNELAYDILKEQGFS  356

Query  870   ILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAE  691
             I+ H+RK WA+LCKAYL E KWY S YTP+  E++ NAWIT + P+++ H +F + N  +
Sbjct  357   IISHIRKQWANLCKAYLLEVKWYQSRYTPSLNEFLRNAWITNTGPVLIMHAYFCITNPIK  416

Query  690   DAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARD  511
             +   L+CL +YP II+  S+ILRLAND  TSP E+K+GD  K+I CYM E+  S   AR+
Sbjct  417   EEE-LECLKNYPAIIQSPSLILRLANDLATSPDEIKKGDYLKSIHCYMHESGRSEENARN  475

Query  510   FIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRI  331
             +I   +++ WKKMNK  I  GS FS  F   AMN+AR+AQCMYQHGDG GI + ET+ RI
Sbjct  476   YIKKLIDQTWKKMNK-DILRGSSFSKDFRTAAMNLARIAQCMYQHGDGFGIPDRETKDRI  534

Query  330   QTLLFE  313
              +L FE
Sbjct  535   CSLFFE  540



>ref|XP_011009233.1| PREDICTED: terpene synthase 10-like [Populus euphratica]
Length=589

 Score =   516 bits (1328),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 276/549 (50%), Positives = 376/549 (68%), Gaps = 31/549 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSANY    W+Y +IQSL T+ Y  E +  RR++LK  ++ ML N   + ++++E+ID
Sbjct  52    VRRSANYQTSIWEYDFIQSL-TSKYKGEPYTARREKLKANIRMMLANAS-KPLDQLELID  109

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF +EI   L          ++        DLYATALEFR+LRQ+G+ + Q
Sbjct  110   ALQRLGLSYHFVDEIKSTL----KSSFYKNHIENTKTVHDLYATALEFRLLRQHGYKVPQ  165

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF+ F D ++  F A + +D KGLL LYE+S+  +EGE+ LE ARDF+ K+L+      
Sbjct  166   EVFNHFKD-EQGNFRAWIHDDLKGLLYLYEASYFLVEGESILEDARDFTTKNLEKYVKKC  224

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PL WRMPRLE+  FI  Y+    T    +LLELAKLDFN+VQA+
Sbjct  225   NPSEYLSKMVSHALELPLAWRMPRLESNWFINVYET--KTDMEPVLLELAKLDFNMVQAI  282

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H EDLK  SRWWK+  + E+L FARDR+VENFLWT+G+   P++ NCR M  K+ S I  
Sbjct  283   HQEDLKHSSRWWKRIGLGEKLDFARDRLVENFLWTVGIIFEPQFGNCRRMLTKVNSLITT  342

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFT+ I RW D+  ++ LPDYM+ C+LAL N VNE+AYD+LK  G
Sbjct  343   IDDVYDVYGTLDELELFTNAIVRW-DLNFMDRLPDYMKLCFLALYNSVNEMAYDILKYQG  401

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
             V  L +L+K WADLCK+YL EAKWY SGYTPT +EY++NAWI++S P+IL H +FYV+N 
Sbjct  402   VDFLPYLKKAWADLCKSYLLEAKWYFSGYTPTLQEYMDNAWISVSAPVILVHTYFYVSNP  461

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
               + A    + +Y +IIR SS+I RLA+D GTS  E+KRGD+ K+IQCYM EA VS  +A
Sbjct  462   TTEEAS-QFMEEYRDIIRWSSMIFRLADDLGTSTDELKRGDISKSIQCYMHEAGVSEEKA  520

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPF-SGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             RD I   +  +WKK+N    +  +P  S TFI +AMN+ARMAQCMYQ+GDGHG+ + ET+
Sbjct  521   RDHIRNLIGNIWKKINDY--QFVNPLISQTFIGIAMNLARMAQCMYQYGDGHGVGHLETK  578

Query  339   TRIQTLLFE  313
              ++++L  +
Sbjct  579   DKVKSLFIK  587



>ref|XP_004230556.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum lycopersicum]
 gb|AEM05856.1| beta myrcene/limonene synthase [Solanum lycopersicum]
Length=592

 Score =   514 bits (1325),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 276/584 (47%), Positives = 373/584 (64%), Gaps = 44/584 (8%)
 Frame = -3

Query  1980  TCKLPSIHRSHASSSFRMCYHTTTT----TRRSANYGPPTWDYSYIQSLNTTHYAAEGFV  1813
             TC   S+H  H S S R   +  +T    TRRS NY P  WD+ +IQSL+   Y  + ++
Sbjct  21    TC-FSSLH--HYSISARGAINNISTPISATRRSGNYKPTMWDFQFIQSLHNP-YEGDKYM  76

Query  1812  MRRDELKERVKDMLKNEEM---REVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkk  1642
              R +ELK+ VK M+   E     E+EK+E+ID L+RLG SYHF++EIM+ L  I +    
Sbjct  77    KRLNELKKEVKKMMMTVEGSHDEELEKLELIDNLERLGVSYHFKDEIMQILRSINININ-  135

Query  1641  ssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
                         LY T+L+FR+LRQ+GF+ISQDV   F D +      S+ +DTKG+L L
Sbjct  136   ------IAPPDSLYTTSLKFRLLRQHGFHISQDVLKDFKD-ENGNLKQSICKDTKGMLEL  188

Query  1461  YESSFLSMEGETNLELARDFSAKHLK---------------------HELKMPLHWRMPR  1345
             YE+SFLS E E  L+ A  F+  HLK                     H L++P HW MP+
Sbjct  189   YEASFLSTETENTLKSATRFTMSHLKNYVDNHSCGNQDDDIIVELVVHALELPRHWMMPK  248

Query  1344  LEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFA  1165
             LE   +I  Y  G+  + N +LLELAKLDFNIVQA H +DLK +SRWWK   +AE+L+F+
Sbjct  249   LETEWYIRIY--GRMPNANPLLLELAKLDFNIVQAAHQQDLKILSRWWKSMSLAEKLSFS  306

Query  1164  RDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERW  985
             RDR+VE+F W++GL   P++  CR M AK  +FI  +DDIYD+YG+LDEL++FT  +ERW
Sbjct  307   RDRLVEDFFWSVGLAFEPQHSLCRRMLAKNVAFIIVIDDIYDVYGSLDELEIFTHAVERW  366

Query  984   DDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKW  805
              D+  +E LPDYM+ CYL+L N  NE+AY +LK+ G+ +L +L K W DLCK+YLQEAKW
Sbjct  367   -DIKAMEQLPDYMKICYLSLFNTTNEMAYHILKQQGINVLPYLTKQWTDLCKSYLQEAKW  425

Query  804   YASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiil  625
             Y +G+ P  EEY++NAWI+I+ PL+L H F ++ N     A L+ L +YP+IIR  +II 
Sbjct  426   YHNGHKPRLEEYMDNAWISIATPLVLLHAFIFLTNPITQEA-LESLNNYPDIIRRCAIIN  484

Query  624   rLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGS  445
             R  +D GTS  E+KRGDVPK+IQCYM++   S  EAR+ I+L + E+W+ MNK  I    
Sbjct  485   RFVDDLGTSSDELKRGDVPKSIQCYMNDTGASEEEAREHINLLIKEMWEVMNKDQISKQV  544

Query  444   PFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              FS  FI++  N +R + C+YQHGDGHGI N     RI  LLFE
Sbjct  545   LFSEEFIKIVFNFSRTSHCVYQHGDGHGIQNSHITNRISKLLFE  588



>ref|XP_006388684.1| terpene synthase/cyclase family protein [Populus trichocarpa]
 gb|ERP47598.1| terpene synthase/cyclase family protein [Populus trichocarpa]
Length=548

 Score =   511 bits (1316),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 273/548 (50%), Positives = 376/548 (69%), Gaps = 29/548 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSANY    W+Y ++QSL T+ Y  E +  R ++LK  ++ ML N   + ++++E+ID
Sbjct  11    VRRSANYQTSIWEYDFVQSL-TSKYKGEPYTARSEKLKANIRMMLANAS-KPLDQLELID  68

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF +EI   L  ++ K    +         DLYATALEFR+LRQ+G+ + Q
Sbjct  69    ALQRLGLSYHFVDEIKSTLKSLFYKNHIENTKTV----HDLYATALEFRLLRQHGYKVPQ  124

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF+ F D ++  F A + +D KG+L LYE+S+  +EGE+ LE ARDF+ K+L+      
Sbjct  125   EVFNHFKD-EQGNFRAWIHDDLKGMLFLYEASYFLVEGESILEDARDFTTKNLEKYVKKC  183

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PL WRM RLE+  FI  Y+    T    +LLELAKLDFN+VQA+
Sbjct  184   NPSEYLSKMVSHALELPLAWRMLRLESNWFINVYET--KTDMEPVLLELAKLDFNMVQAI  241

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H EDLK  SRWWK++ + E+L FARDR+VENFLWT+G+   P++ NCR M  K+ S I  
Sbjct  242   HQEDLKHSSRWWKRTGLGEKLDFARDRLVENFLWTVGVIFEPQFGNCRRMLTKVNSLITT  301

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFTD + RW D+  ++ LPDYM+ C+LA  N VNE+AY++LK  G
Sbjct  302   IDDVYDVYGTLDELELFTDAVVRW-DLNFMDRLPDYMKLCFLAFYNSVNEMAYNILKYQG  360

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
             + IL +L+K WADLCK+YL EAKWY SGYTPT +EY++NAWI+IS P+IL H +FYV+N 
Sbjct  361   IDILPYLKKEWADLCKSYLLEAKWYFSGYTPTLQEYMDNAWISISAPVILVHAYFYVSNP  420

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
               + A    + +Y +IIR SS+ILRLA+D GTS  E+KRGD+ K+IQCYM EA+VS  +A
Sbjct  421   TTEEAS-QFMEEYLDIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAEVSEEKA  479

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             R+ I   +   WKK+N          S TFI +AMN+ARMAQCMYQ+GDGHG+ + ET+ 
Sbjct  480   REHIKSLIGNTWKKINDYQFVNPR-ISQTFIGIAMNLARMAQCMYQYGDGHGVGHLETKD  538

Query  336   RIQTLLFE  313
             R+++LL +
Sbjct  539   RVKSLLIK  546



>ref|XP_007048227.1| Myrcene synthase, chloroplastic, putative isoform 2 [Theobroma 
cacao]
 gb|EOX92384.1| Myrcene synthase, chloroplastic, putative isoform 2 [Theobroma 
cacao]
Length=595

 Score =   511 bits (1316),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 269/545 (49%), Positives = 373/545 (68%), Gaps = 30/545 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+ANY PP W + YIQSL +  +  E    R  +L   V+ ML +  +  +EK+E++D
Sbjct  51    ARRTANYHPPIWTHDYIQSLQSD-FVGESCDERAMKLVAEVRTML-DRVLDPLEKLELVD  108

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYH+E +    L  +  ++          ++ +LYATALEFR+LRQ+G+ ++ 
Sbjct  109   TLQRLGLSYHYENDTKRILESVNAEESNV-----VWKKGNLYATALEFRLLRQHGYKVTP  163

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF  FMD +   F A L ED KGLLNLYE+S+  +EGE+ LE ARDF+AKHLK      
Sbjct  164   EVFSSFMD-EMGNFKAGLCEDCKGLLNLYEASYHLVEGESILENARDFAAKHLKQCLKQN  222

Query  1383  ----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                       H L++PLHWR+ RLEAR FI+ Y++ +      ILLELAKLDFNIVQAVH
Sbjct  223   KDEYQFMLVEHALELPLHWRIERLEARWFIDVYERRE--DKIPILLELAKLDFNIVQAVH  280

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              +DL+  S+WW    + E+LTFARDR++ NFLWT+G+  +P++ + R    K+ + I  +
Sbjct  281   QDDLRYASKWWTDLGLGEKLTFARDRLMGNFLWTVGVASDPQFGHARRTLTKINALITII  340

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DD+YD+YGTLDEL+LFT+ +ERW DV  +E LP+YM+ C+LAL N +NE+A+D +KE G 
Sbjct  341   DDVYDVYGTLDELELFTEAVERW-DVNAMELLPEYMKICFLALYNSINEMAFDTIKEQGF  399

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
               +  L++MWADLCKAYL EAKWY  GYTPT +EYI+NAWI+IS P+IL+H +F  N++ 
Sbjct  400   DSIPFLKEMWADLCKAYLVEAKWYYGGYTPTLKEYIDNAWISISAPVILSHAYFLTNSIR  459

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
             ++   L+CL ++ +++  +S+ILRL ND  TS  E++RGDVPK+IQCYM E   S  EAR
Sbjct  460   KEC--LECLKEHSQVVYCTSMILRLVNDLETSSDELERGDVPKSIQCYMHETGFSKEEAR  517

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
              +I   ++  WK MN+  I   SPFS TFI++A+N+ARMAQCMYQ+GDGHGI   ET  R
Sbjct  518   HYIRNLIDATWKMMNENRI-AQSPFSQTFIQIALNLARMAQCMYQYGDGHGIEVNETNNR  576

Query  333   IQTLL  319
             + +LL
Sbjct  577   VLSLL  581



>ref|XP_006370878.1| terpene synthase/cyclase family protein [Populus trichocarpa]
 gb|ERP48675.1| terpene synthase/cyclase family protein [Populus trichocarpa]
Length=589

 Score =   510 bits (1314),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 274/548 (50%), Positives = 375/548 (68%), Gaps = 29/548 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSANY    W+Y ++QSL T+ Y  E +  R ++LK  ++ ML N   + ++++E+ID
Sbjct  52    VRRSANYQTSIWEYDFVQSL-TSKYKGEPYTARSEKLKANIRMMLANAS-KPLDQLELID  109

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF +EI   L  ++ K    +         DLYATALEFR+LRQ+G+ + Q
Sbjct  110   ALQRLGLSYHFVDEIKSTLKSLFYKNHIENTKTV----HDLYATALEFRLLRQHGYKVPQ  165

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF+ F D ++  F A + +D KG+L LYE+S+  +EGE+ LE ARDF+ K+L+      
Sbjct  166   EVFNHFKD-EQGNFRAWIHDDLKGMLFLYEASYFLVEGESILEDARDFTTKNLEKYFKKC  224

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PL WRM RLE+  FI  Y+    T    +LLELAKLDFN+VQA+
Sbjct  225   NPSEYLSKMVSHALELPLAWRMLRLESNWFINVYET--KTDMEPVLLELAKLDFNMVQAL  282

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H EDLK  SRWWK++ + E+L FARDR+VENFLWT+G+   P++ NCR M  K+ S I  
Sbjct  283   HQEDLKHSSRWWKRTGLGEKLDFARDRLVENFLWTVGVIFEPQFGNCRRMLTKVNSLITT  342

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFTD + RW D+  ++ L DYM+ C+LA  N VNE+ YD+LK  G
Sbjct  343   IDDVYDVYGTLDELELFTDAVVRW-DLNFMDRLLDYMKLCFLAFYNSVNEMTYDILKYQG  401

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
             V IL +L+K WADLCK+YL EAKWY SGYTPT +EY+ENAWI+IS P+IL H +FYV+N 
Sbjct  402   VDILPYLKKAWADLCKSYLLEAKWYFSGYTPTLQEYMENAWISISAPVILVHAYFYVSNP  461

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
               + A    + +YP+IIR SS+ILRLA+D GTS  E+KRGD+ K+IQCYM EA VS  +A
Sbjct  462   TTEEAS-QFMEEYPDIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAGVSEEKA  520

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             R+ I   +   WKK+N    +     S TFI +A+N+ARMAQCMYQ+GDGHG+ + ET+ 
Sbjct  521   REHIRNLIENTWKKINDYQFDNPR-ISQTFIGIAINLARMAQCMYQYGDGHGVGHLETKD  579

Query  336   RIQTLLFE  313
             R+++LL +
Sbjct  580   RVKSLLIK  587



>ref|XP_009600964.1| PREDICTED: (-)-alpha-terpineol synthase-like [Nicotiana tomentosiformis]
Length=546

 Score =   509 bits (1310),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 273/546 (50%), Positives = 371/546 (68%), Gaps = 24/546 (4%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  W+  Y+QS   T YA E    R   LKE V+ ML+ + +  +E++E++D 
Sbjct  4     RRSGNYKPSIWEDGYVQS-RATFYAEEKHYERAAGLKEEVRRMLE-KTIHPLEQLELVDI  61

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SY+FEEEI   L ++Y+    ++ N     E DLYATALEFR+LRQ G+++ Q+
Sbjct  62    LQRLGLSYYFEEEIDRVLKEMYVNIYTTNRNDGQKSE-DLYATALEFRLLRQEGYHVPQE  120

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFS------------  1399
             +F  FM+ K   F  SL  DT GLL+LYE+ +L MEGE+ LE+ARDF+            
Sbjct  121   MFCTFMN-KEGKFKTSLVVDTNGLLSLYEACYLCMEGESILEIARDFTTHFLTESLKKKT  179

Query  1398  ----AKHLKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHL  1231
                 A+ + H L+MPLHWRM RLEAR FIE     K  + N ++LELAKLD+N+VQA +L
Sbjct  180   DKNLAEQVNHALEMPLHWRMQRLEARWFIEEV-YHKRENMNPLILELAKLDYNMVQATYL  238

Query  1230  EDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVD  1051
             E+LK +SRW K   + ++++F RDR+VE FLW +G TPNP++  CR    KL  F+  +D
Sbjct  239   EELKQMSRWDKNIKLVKKMSFVRDRLVEGFLWAVGFTPNPQFGYCRKFSTKLSVFLTTID  298

Query  1050  DIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVF  871
             DIYD+YGT+DEL+LFTD ++RW D+  +E LPDYM+ C+LAL N +NE+AYD+LKE G  
Sbjct  299   DIYDVYGTMDELELFTDIVDRW-DINAIERLPDYMKICFLALFNSMNELAYDILKEQGFS  357

Query  870   ILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAE  691
             I+ H+RK WA+LCKAYL E KWY S YTP+  E++ NAWIT + P+++ H +F + N  +
Sbjct  358   IISHIRKQWANLCKAYLLEVKWYQSRYTPSLNEFLRNAWITNTGPVLIMHAYFCITNPIK  417

Query  690   DAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARD  511
             +   L+CL +YP II+  S+ILRLAND  TSP E+K+GD  K+I CYM E+  S   AR+
Sbjct  418   EEE-LECLKNYPAIIQSPSLILRLANDLATSPDEIKKGDYLKSIHCYMHESGRSEENARN  476

Query  510   FIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRI  331
             +I   +++ WKKMNK  I   S FS  F   AMN+AR+AQCMYQHGDG GI + ET+ RI
Sbjct  477   YIKQLIDQTWKKMNK-DILRDSSFSKDFRTTAMNLARIAQCMYQHGDGFGIPDRETKDRI  535

Query  330   QTLLFE  313
             ++L FE
Sbjct  536   RSLFFE  541



>gb|KHG23712.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=597

 Score =   510 bits (1314),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 279/596 (47%), Positives = 392/596 (66%), Gaps = 47/596 (8%)
 Frame = -3

Query  1998  MFSTFTTCKLPSIHR----SHASSSFRMCYHT---------------TTTTRRSANYGPP  1876
             MF++F+ C  P   +    S+  SSFR  + +                T  RRSA+Y PP
Sbjct  5     MFNSFSICSFPIQSKWKRFSYDGSSFRRLFVSFASRCEATNKISVEDNTVIRRSADYHPP  64

Query  1875  TWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYH  1696
              WDY Y+Q L       E +  +  +LKE V+ M +N  +  +EK+E+ID ++RLG SYH
Sbjct  65    IWDYDYVQLLRNDFVQDESYKEQSSKLKEEVRMMFENV-VDPLEKLELIDTIQRLGLSYH  123

Query  1695  FEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGK  1516
             F +EI + L +I +++  +     A+ + +LYATALEFR+LRQ+G+ ++QDVF  FMD +
Sbjct  124   FGDEIKKTLKNISIERGSTV----ASNKDNLYATALEFRLLRQHGYKVNQDVFACFMD-E  178

Query  1515  RCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----------------  1384
                  AS ++D KGLLNLYE+S+ S+EGET LE AR  +AK LK                
Sbjct  179   VGDIKASHNQDCKGLLNLYEASYHSLEGETMLENARKLAAKLLKQCLKENNDHQYLLMLV  238

Query  1383  -HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSR  1207
              H L++PLHWRMPRLEAR FI+ Y+K +    N I+LELA LD+NIVQ++H  DL+  S 
Sbjct  239   EHALELPLHWRMPRLEARWFIDVYEKKE--DKNPIILELAILDYNIVQSMHQNDLRYAST  296

Query  1206  WWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGT  1027
             WWK+  + + L+FARDR++ENFLW++G+   P+    R +  K+ + I  +DD+YD+YGT
Sbjct  297   WWKELGLGKTLSFARDRLMENFLWSVGMINTPQDGKGRRIQTKVNALITVIDDVYDVYGT  356

Query  1026  LDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKM  847
             LDEL+LFTD +ERW D+ ++++LP YM+ CY AL N VNE+A+D LKE G+ +L  L+K+
Sbjct  357   LDELELFTDAVERW-DINEIQNLPYYMKICYHALYNSVNEMAFDTLKEQGIDVLPFLKKV  415

Query  846   WADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCL  667
             W +LCK+YL EAKWY  GYTPT  EYI+NAWI+IS  ++L H +   + + E+  +    
Sbjct  416   WTNLCKSYLLEAKWYYIGYTPTLREYIDNAWISISGSVMLGHSYLATDLITEE-GLHHIQ  474

Query  666   TDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNE  487
               YP+II  SSII+RL +D GTS +E++RGDVPK+IQCYM+E+  S  EARD I   ++ 
Sbjct  475   KYYPDIIYWSSIIVRLTDDLGTSSYELQRGDVPKSIQCYMNESGASEEEARDHIRKLIDA  534

Query  486   LWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
              WKKMNK  +   SPFS TFIEVAMN+AR++  MYQ+GDGH I + ET+ R+ +L 
Sbjct  535   AWKKMNKDQM-AKSPFSYTFIEVAMNLARISLLMYQNGDGHAIEDKETKDRVLSLF  589



>ref|XP_008461028.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=598

 Score =   509 bits (1312),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 266/574 (46%), Positives = 382/574 (67%), Gaps = 29/574 (5%)
 Frame = -3

Query  1986  FTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMR  1807
             F    +P I ++ + ++  MC  + T  RRS NY PP W + +IQSL +  +A E +V R
Sbjct  23    FNPSFMPRIVKAISVTTRIMC--SRTIVRRSGNYQPPIWKHEFIQSLRS-EFAEEIYVGR  79

Query  1806  RDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnny  1627
              +ELK  ++ ++       + ++E++D L+RLG SYHFE EI   L        + S   
Sbjct  80    FNELKREIRLIVNQIIDDPLRQLELVDTLQRLGISYHFENEIKNVL----KTAFEKSYEN  135

Query  1626  KATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSF  1447
                ++K+LYAT+LEFR+LRQ+GFN+SQDVF+ F   +   F+  L E+  G+L L+E+SF
Sbjct  136   DYWKKKNLYATSLEFRLLRQHGFNLSQDVFNNFYSDETKSFSTQLYEELNGILCLHEASF  195

Query  1446  LSMEGETNLELARDFSAKHL----------------KHELKMPLHWRMPRLEARSFIESY  1315
             LS+EGE  LE A+ F+ ++L                +H L++PLHWRMPRLE R FI+ Y
Sbjct  196   LSIEGENILETAKHFTMEYLEKYIKSSKDENEVAIVRHALELPLHWRMPRLETRWFIDIY  255

Query  1314  DKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLW  1135
             ++      N ILLE AKLDFN VQ++H +DLK  S WW+ +   E+L+FARDRV+ENFLW
Sbjct  256   ERK--VDMNPILLEFAKLDFNKVQSIHQQDLKYASSWWRSTGFGEKLSFARDRVMENFLW  313

Query  1134  TIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLP  955
             T+G    P++   R M  K+ +FI  +DD+YD+YGTLDELQLFTD IERW DV  ++ LP
Sbjct  314   TVGFGYEPEFSFYRRMATKINAFITTIDDVYDVYGTLDELQLFTDAIERW-DVDALDQLP  372

Query  954   DYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFE  775
             DYM+ C+LAL+N +NE+A+++L++ G+ ++ +L+K W DLCK+Y+ EAKWY + Y PT E
Sbjct  373   DYMKICFLALHNSINEMAFEVLRDKGINVIQYLKKAWVDLCKSYMLEAKWYHTNYKPTLE  432

Query  774   EYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSP  595
             EY++NAWI+IS P++L H + +V     +   ++ L  Y ++IR SS ILRLA+D GTS 
Sbjct  433   EYLDNAWISISGPVVLVHAYVFVTTPTLEN--MESLKQYVDVIRWSSTILRLADDLGTSS  490

Query  594   FEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVA  415
              E+ RGDVPK+IQCYM++   S ++AR  I   ++E WKK+NKV ++  S F   FIE A
Sbjct  491   DELARGDVPKSIQCYMNDTGSSESDARKHIRHLIDETWKKLNKVQVQ-NSIFPQVFIERA  549

Query  414   MNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              N+AR AQ MYQ+GDGHGI + ET+ R+ +LL +
Sbjct  550   KNVARTAQFMYQYGDGHGIGHQETKDRVMSLLIQ  583



>gb|EYU18419.1| hypothetical protein MIMGU_mgv1a0036601mg, partial [Erythranthe 
guttata]
Length=563

 Score =   508 bits (1307),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 280/564 (50%), Positives = 372/564 (66%), Gaps = 35/564 (6%)
 Frame = -3

Query  1914  TTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKME  1735
             T   RRS NY PP W + ++QSLNT  Y  E ++ R  EL E+VK ML  +E   + K+E
Sbjct  1     TIVNRRSGNYEPPVWSFDFVQSLNTK-YKEERYLKRGSELVEQVKKMLLVDEQILIHKLE  59

Query  1734  MIDELKRLGCSYHFEEEI---MEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             +ID L  LG SYHFE+EI   +  L +  +     +NN       +LY+ AL FR+ RQ+
Sbjct  60    LIDNLYMLGISYHFEDEINQILNYLYNQLINGNIFNNNKYYDVRDNLYSAALAFRLFRQH  119

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSED---TKGLLNLYESSFLSMEGETNLELARDFSAK  1393
             GF +SQDVFD F +     F ASL +D   TKGLL LYE+SF    GE  LELAR+FSA 
Sbjct  120   GFRVSQDVFDTFKNETGDSFKASLGDDINSTKGLLQLYEASFFMTRGEKTLELAREFSAN  179

Query  1392  HLK---------------------HELKMPLHWRMPRLEARSFIES-YDKGKTTSNNAIL  1279
              L+                     H L++P+HWR+ R  A  FIE  Y+K +    N IL
Sbjct  180   LLRKKLDDDRIDDDKGDTLLLMVRHALELPIHWRVQRPNAGWFIEQVYEKSQHM--NPIL  237

Query  1278  LELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN  1099
             LELAKLDFN+VQ+ H ++LK +S WW++  +A+ L FARDR+VEN+LWTIG    P+Y  
Sbjct  238   LELAKLDFNVVQSTHQQELKHLSSWWEQIGLAKTLPFARDRLVENYLWTIGGLFEPRYGY  297

Query  1098  CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNN  919
              RIM  K+  FI  +DDI+D+YGTL+EL++F D I+RWD +  ++ LP YM+ C+LALNN
Sbjct  298   SRIMATKVNVFITIIDDIFDVYGTLEELEIFNDVIQRWD-IEGMDKLPHYMQMCFLALNN  356

Query  918   FVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISC  739
             FV+E++Y +LK+ G  ++ HLRK WADLC AY+QEAKWY+ GY PT EEYI NAWI+IS 
Sbjct  357   FVDELSYHVLKQQGFLVVPHLRKSWADLCMAYMQEAKWYSKGYAPTLEEYINNAWISISA  416

Query  738   PLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
             P+IL+H FF V N  +  AV   L +Y  I+RLS++ILRLAND GTSP EMKRGDVPK+I
Sbjct  417   PVILSHAFFLVTNPIKKEAV-RSLYEYHNIVRLSAMILRLANDLGTSPDEMKRGDVPKSI  475

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP-FSGTFIEVAMNIARMAQCM  385
             +CYM+E+     EA+D++   +NE WK+MN ++ +   SP F   F+  A+++ RMAQ M
Sbjct  476   ECYMNESGAGREEAQDYVRCLINETWKEMNEELRVITESPLFERDFVRSAVDLGRMAQYM  535

Query  384   YQHGDGHGINNFETQTRIQTLLFE  313
             YQ+GDGHGI   E + RI +LLFE
Sbjct  536   YQYGDGHGIQFPEMKDRIISLLFE  559



>gb|AID55337.1| terpene synthase [Actinidia chinensis]
Length=603

 Score =   507 bits (1306),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 274/549 (50%), Positives = 368/549 (67%), Gaps = 33/549 (6%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRSA Y P  WDY+Y+QSLN+  YA + +V     LKE VK ML ++ +  ++ + +ID+
Sbjct  62    RRSAFYQPSIWDYNYVQSLNS-EYAGDMYVKWATMLKEDVKRML-DKVVDPLDGLGLIDD  119

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG  YHFE+EI   L     +   +        ++DL AT+L+FR+LRQ+G+ IS+D
Sbjct  120   LQRLGVFYHFEDEIHRIL-----ESTYNHIIEGWNTDEDLQATSLKFRLLRQHGYTISED  174

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             VF  FMD +   F   L ED KGLL LYE+S+ S+EGE  LE ARDF+ K+L        
Sbjct  175   VFKNFMD-EIGNFKTCLCEDVKGLLYLYEASYFSLEGERILEEARDFTTKNLNKILKRKD  233

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++P HWRM RLEAR FI+ Y++    S    L++LAKLDFN+VQA
Sbjct  234   MIDDEDLAILVSHALEVPTHWRMQRLEARWFIDMYERRPNLS--PTLIQLAKLDFNMVQA  291

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              H EDLK VSRWW K+ + ++L+FARDR++ENFLWTIG+   P+    R       S I 
Sbjct  292   THQEDLKHVSRWWNKTGLGQKLSFARDRLMENFLWTIGMDFKPQMSYFRKNITIFISLIA  351

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDEL+ FT+ +ERWD ++++EHLP YM+ C+LAL N +NEI YD LKE 
Sbjct  352   IIDDVYDVYGTLDELERFTNAVERWD-LSEMEHLPAYMKICFLALFNSINEIGYDTLKEQ  410

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             GV I+ +L+KMWADLCK+YL EAKWY S +TP+FEEY+ NAWI+I+ P+ LAH +    N
Sbjct  411   GVHIIPYLQKMWADLCKSYLVEAKWYYSRHTPSFEEYMNNAWISIAAPVALAHAYVLCTN  470

Query  699   -LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
              +A++   L C+  YP +IR S+ I RLA+D GTS  EM+RGD+PK+IQCYM E   S  
Sbjct  471   PIAKEG--LKCVEKYPNLIRCSATIFRLADDLGTSTDEMERGDIPKSIQCYMHETGASEK  528

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             +AR  +   + E WKKMN+  +E GS FS T I VA N+ARM+QCMYQ+GDGHG    ET
Sbjct  529   DARKHMKYLIGEAWKKMNEARVEDGSLFSRTIIGVAENLARMSQCMYQYGDGHGAQGPET  588

Query  342   QTRIQTLLF  316
             + R+++LL 
Sbjct  589   RDRVKSLLI  597



>ref|XP_008460926.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=597

 Score =   506 bits (1304),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 269/565 (48%), Positives = 378/565 (67%), Gaps = 30/565 (5%)
 Frame = -3

Query  1953  SHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDM  1774
             ++ +S  RMC  + T  RRS NY PPTW + +IQSL ++ +A E +V R +ELK  V+ +
Sbjct  35    NNVTSGARMC--SQTIVRRSGNYQPPTWKHEFIQSL-SSEFAGEIYVGRFNELKGEVRVV  91

Query  1773  L-KNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             + K      ++++E ID L+RLG SYHFE EI     D+     K        +  +LYA
Sbjct  92    MNKIANDDPLKQLEFIDILQRLGISYHFENEIK----DMLTTTYKKCCENDDWKCNNLYA  147

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             T+LEFR+LRQ+GFNI QD+F+ F   +   FN  L ED KG+L LYE+SFLS+EGE  LE
Sbjct  148   TSLEFRLLRQHGFNIPQDIFNPFFFNETKSFNVQLYEDLKGMLYLYEASFLSIEGENILE  207

Query  1416  LARDFSAKHL----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNA  1285
              A+ F+ ++L                +H L++PLHWRMPRLE R FI+ Y++      N 
Sbjct  208   TAKHFTREYLEKYMKSSKDENEVAIVRHALELPLHWRMPRLETRWFIDIYER--KVDMNP  265

Query  1284  ILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKY  1105
             ILLE AKLDFN VQ++H +DLK  SRWW++S + E+L+FARDR++ENF WT+G+   P+ 
Sbjct  266   ILLEFAKLDFNKVQSIHQQDLKYASRWWRRSGLGEKLSFARDRLMENFFWTVGVGFEPEL  325

Query  1104  VNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLAL  925
                R M  K+ + I  +DD+YD+YG+LDEL+LFT  +ERW DV  +E LPDYM+ C+LAL
Sbjct  326   SYFRRMTTKVNALITTIDDVYDVYGSLDELELFTSAVERW-DVAAMEELPDYMKICFLAL  384

Query  924   NNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITI  745
             +N +NE+ ++ L++ G+ ++ +L+K W DLCK+Y+ EAKWY + Y PT EEY++NAWI+I
Sbjct  385   HNSINEMGFEALRDKGINVIQYLKKAWIDLCKSYMLEAKWYHTNYKPTLEEYLDNAWISI  444

Query  744   SCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPK  565
             S P IL H + +V +   +   ++ L  Y ++IR SS ILRLA+D GTS  E++RGDVPK
Sbjct  445   SGPAILVHAYVFVTSPTLEN--MESLKQYVDMIRWSSTILRLADDLGTSSDELERGDVPK  502

Query  564   AIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG-SPFSGTFIEVAMNIARMAQC  388
             +IQCYM++   S N AR++I   ++E WKK+NK   E   S +   FIE A N+ARMAQC
Sbjct  503   SIQCYMNDTGASENIAREYIGHLIDETWKKLNKTEFENNYSIYPRVFIERAKNLARMAQC  562

Query  387   MYQHGDGHGINNFETQTRIQTLLFE  313
             MYQ+GDGHG+   ET+ R+ +LL E
Sbjct  563   MYQYGDGHGMGYQETKDRVMSLLIE  587



>ref|XP_009791335.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=613

 Score =   507 bits (1305),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 269/549 (49%), Positives = 370/549 (67%), Gaps = 35/549 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+ YIQS++   YA + ++ R ++LKE +K M+  E  +E+EK+E+ID
Sbjct  75    SRRSGNYQPTMWDFEYIQSIHND-YAGKKYMNRFNKLKEEMKKMIMAEGSQELEKLELID  133

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF+ EIM+ L  I            +T    LYATAL+FR+LR++GF+ISQ
Sbjct  134   NLQRLGVSYHFKHEIMQILSSIKQH---------STPADSLYATALKFRLLREHGFHISQ  184

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGE-TNLELA----RDFSAKHL--  1387
             D+ + F D ++     SL +DTKGLL LYE+SFLS E E T LE A    +++   HL  
Sbjct  185   DILNDFKD-EQGNLKQSLCKDTKGLLQLYEASFLSTETERTFLESAISHLQNYLNNHLYG  243

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSN-NAILLELAKLDFNIVQAV  1237
                       H L++PL+W M R+E   ++   +  +  SN N +LLELAKLDFNIVQA 
Sbjct  244   EDNVTVSLVSHALELPLYWMMLRVETSWYL---NINENISNANPLLLELAKLDFNIVQAT  300

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H EDL+ +SRWWK +++AE+L F+RDR+VE   + +G+   P++  CR M  K+ +F+  
Sbjct  301   HQEDLRILSRWWKSTHLAEKLPFSRDRLVEALFFAVGIIFEPQHSYCRRMLTKVIAFVAV  360

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DDIYD+YGT DEL++FT+ IERW+ V  +E LPDYM+ CYLAL N  NE+AY++LKE G
Sbjct  361   IDDIYDVYGTPDELEVFTNAIERWE-VKAMEQLPDYMKVCYLALFNITNEMAYEILKEQG  419

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN-  700
             + +L +L K WADLCK+YLQEA+WY +GYTPT EEY++NAWI+++ P++L H F  V N 
Sbjct  420   INVLPYLTKSWADLCKSYLQEARWYYNGYTPTLEEYMDNAWISVAVPMVLVHAFPLVTNP  479

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
             + +DA   + L+ YP+IIR S+ I R A+D GTS  E++RGDVPK+IQCYM+E   +  E
Sbjct  480   VTKDA--FESLSKYPDIIRWSATIFRFADDLGTSSEELRRGDVPKSIQCYMNEKGATEEE  537

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR+ I + + E WK +        S FS TFI  A+NIAR  Q +YQHGDGHGI NFE +
Sbjct  538   AREHISICIKEKWKLLINTAQRENSLFSETFIGCAINIARTGQSIYQHGDGHGIQNFEIK  597

Query  339   TRIQTLLFE  313
              RI  L FE
Sbjct  598   NRISKLFFE  606



>gb|AIU39888.1| terpene synthase [Gossypium hirsutum]
Length=598

 Score =   506 bits (1302),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 280/599 (47%), Positives = 384/599 (64%), Gaps = 52/599 (9%)
 Frame = -3

Query  1998  MFSTFTTCKLPSIHR-----SHASSSFRM---------------CYHTTTTTRRSANYGP  1879
             +FS+F  C  P IH      S+  SSFR                       TRRSANY P
Sbjct  5     LFSSFPMCSFP-IHSKWKSFSYNRSSFRRLTIFSALQSDAANKNSTEDAIITRRSANYHP  63

Query  1878  PTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSY  1699
             P WDY Y+QSL       E +  +   LKE V+ ML  + +  +EK+E+ID L+RLG SY
Sbjct  64    PIWDYGYVQSLRNDFVQDESYKEQARNLKEEVRMML-GDVVDPLEKLELIDTLQRLGLSY  122

Query  1698  HFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDG  1519
             HFE EI + + +I      ++    A ++ +LYATALEFR+LRQ+G+ + Q+VF  FMD 
Sbjct  123   HFEAEINKTMKNISTNHISTA----AWKKDNLYATALEFRLLRQHGYKVDQEVFTCFMDD  178

Query  1518  KRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---------------  1384
                   +SL++D KGLLNLYE+S+L +EGET LE AR+  +K LK               
Sbjct  179   V-GNIKSSLNQDFKGLLNLYEASYLLLEGETMLENARELVSKLLKQYLKENNDHQYLWTL  237

Query  1383  --HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVS  1210
               H L++PLHWRMPRLEAR FIE+Y+K K    N I+LELA LD+NIVQ++H EDL++VS
Sbjct  238   VDHALELPLHWRMPRLEARWFIEAYEKNK--DRNPIVLELAILDYNIVQSMHQEDLRNVS  295

Query  1209  RWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYG  1030
              WWK+  I +R +FARDR++ENFLW  G+   P+    RI+  K+ + I  +DD+YD+YG
Sbjct  296   TWWKELGIGQRFSFARDRLMENFLWGAGMIIAPQDGKSRIILTKVNALITVIDDVYDVYG  355

Query  1029  TLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRK  850
             TLDEL+LFTD +ERW D+ +++ LPDYM+  Y AL N VNE+A+D +KE G+ ++  L+K
Sbjct  356   TLDELELFTDVVERW-DINEIQRLPDYMKIYYHALYNSVNEMAFDTIKEQGIDVIPFLKK  414

Query  849   MWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDC  670
             +W DLCKAYL EAKWY  GYTPT +EYI+NAWI+I C L+LAH +   +++ E+   L  
Sbjct  415   VWTDLCKAYLVEAKWYYIGYTPTLKEYIDNAWISIGCYLMLAHAYLVTSHITEEG--LHN  472

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
             + +    +   SII RL+ND GTS +E+KRGDVPK++QCYM E+  S  EAR+ I   ++
Sbjct  473   IQENYIGVYQPSIITRLSNDLGTSSYELKRGDVPKSVQCYMYESGASEEEAREHIRKLID  532

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGD--GHGINNFETQTRIQTLL  319
               WKK+N+  +    PFS TFIE   NIAR++  MYQ+GD  GHG+ + E + R+ +L 
Sbjct  533   AAWKKINEDQM-AKLPFSPTFIESTKNIARVSLLMYQNGDGHGHGMEDKEYKKRVLSLF  590



>ref|XP_009586876.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=620

 Score =   506 bits (1304),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 282/589 (48%), Positives = 379/589 (64%), Gaps = 40/589 (7%)
 Frame = -3

Query  2007  MAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYA  1828
             M+K  ST    + P    SH+S    M  H     RRS NY PPTW + YIQS+N   Y 
Sbjct  34    MSKANSTSPKAEPP---LSHSSIPTNMNTH-----RRSGNYKPPTWHFEYIQSINND-YV  84

Query  1827  AEGFVMRRDELKERVKDMLK---NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIy  1657
              E +  R ++LKE ++  LK   + +  E++K+E+ID L+RLG SYHF+EEI + L  I+
Sbjct  85    GENYTKRLNKLKEEMRKKLKMMDDVDGEELDKLELIDNLQRLGLSYHFKEEIFQILRSIH  144

Query  1656  mkkkkssn--nyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSED  1483
              +        N  A E   LYATAL+F++LR++ F+ISQD+ + F   +   F  SL +D
Sbjct  145   QQHILQKEGRNIIAGEYSLLYATALKFKLLREHDFDISQDILNSF-KIENGNFKESLGKD  203

Query  1482  TKGLLNLYESSFLSMEGETNLELA-------------------RDFSAKHLKHELKMPLH  1360
              KG+L LYE+SF + E E  L+ A                    + +A  ++H L++P H
Sbjct  204   PKGMLQLYEASFFATETENTLKSATRVTKSELKNYLENYEHGEENITATLVRHALELPSH  263

Query  1359  WRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAE  1180
             W M RLE R FI  Y+K    + N +LLELAKLDFNIVQA H E+L+ VSRWWK + +AE
Sbjct  264   WMMLRLETRWFINVYEK--MPNANPLLLELAKLDFNIVQATHQEELRDVSRWWKTTCLAE  321

Query  1179  RLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTD  1000
             +L F+RDR+ E F W +G+   P+  +CR+M  K+ +F+ ++DDIYDIYGT  EL LFTD
Sbjct  322   KLPFSRDRLAEAFFWGVGIVFEPQQGHCRVMLTKIIAFVTSIDDIYDIYGTYPEL-LFTD  380

Query  999   TIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYL  820
              +ERW+ +T +E LP+YM+  YLAL N +NE+AY++LKE G+ IL +L K WADLCKAYL
Sbjct  381   AVERWE-LTAMEQLPEYMKVMYLALFNTINEMAYEVLKEQGINILPYLSKSWADLCKAYL  439

Query  819   QEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirl  640
             +EA+WY +G+ PT +EY++NAWI+IS P+IL H FF V N       L+ L+ YP+IIR 
Sbjct  440   REARWYYNGHKPTLQEYMDNAWISISIPMILIHAFFLVTNPITKEE-LESLSKYPDIIRW  498

Query  639   ssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVG  460
             SS I R  +D GTS  E+KRGDVPK+IQCY++E  VS  EAR+ I   + E W+ MNK  
Sbjct  499   SSTIFRFVDDLGTSSDELKRGDVPKSIQCYINEKGVSEEEARERIQHLIKETWEMMNKAQ  558

Query  459   IEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              E    FSGTF+E+A NIAR AQCMY HGDGHGI N E +  I  +LFE
Sbjct  559   RENLL-FSGTFVEIAKNIARTAQCMYLHGDGHGIQNAEIKNSISKILFE  606



>ref|XP_004165181.1| PREDICTED: myrcene synthase, chloroplastic-like [Cucumis sativus]
Length=561

 Score =   504 bits (1298),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 261/555 (47%), Positives = 373/555 (67%), Gaps = 29/555 (5%)
 Frame = -3

Query  1929  MCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMRE  1750
             MC  + T  RRS NY P  W + +IQSL +  +A E ++ R ++LK  ++ ++       
Sbjct  15    MC--SKTVIRRSGNYQPSIWKHEFIQSLRS-EFAEEIYMRRFNQLKGEIRVIMNTIIDDP  71

Query  1749  VEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLR  1570
             ++++E+ID L+RLG SYHFE EI   L  IY K  +  +     +  +LYAT+LEFR+LR
Sbjct  72    LKQLELIDMLQRLGISYHFENEIKNVLKTIYDKSYEQEHW----KNNNLYATSLEFRLLR  127

Query  1569  QNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKH  1390
             Q+GFN+SQDVF+ F   +   FN  + +D  G+L LYE+SFLS+EGE  LE A+ F+ ++
Sbjct  128   QHGFNLSQDVFNNFYSSETKSFNTQMYQDLNGMLFLYEASFLSIEGENILETAKHFTVEY  187

Query  1389  L----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLD  1258
             L                +H L++PLHWRMPRL+ R FI+ Y++      N ILLE AKLD
Sbjct  188   LEKYMKSSKDENEVAIVRHALELPLHWRMPRLDTRWFIDIYER--KVDMNPILLEFAKLD  245

Query  1257  FNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAK  1078
             FN VQ++H +DLK  S WWK S + E+L+FAR+R++ENFLWT+G    P++   R M  K
Sbjct  246   FNRVQSIHQQDLKYTSSWWKSSGLGEKLSFARNRLMENFLWTVGFGYEPQFSYYRRMATK  305

Query  1077  LYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAY  898
             +  FI  +DD+YD+YGTLDELQLFTD IERW DV  ++ LPDYM+ C+LAL+N +NE+A+
Sbjct  306   INVFITTIDDVYDVYGTLDELQLFTDAIERW-DVAAMDELPDYMKICFLALHNSINEMAF  364

Query  897   DMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHV  718
             D+L++ G+ ++ +L+K W DLCK Y+ EA WY +GY PT +EY++NAW +IS P+IL H 
Sbjct  365   DVLRDQGINVIQYLKKGWVDLCKTYMVEATWYHNGYKPTLKEYLDNAWTSISGPVILVHA  424

Query  717   FFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEA  538
             + +V   +     ++ L  Y ++IR SS ILRLA+D GTS  E+KRGDVPK+IQCYM++ 
Sbjct  425   YVFVT--SPTLKDMENLKHYVDLIRYSSTILRLADDLGTSSDELKRGDVPKSIQCYMNDT  482

Query  537   KVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI  358
               S + AR +I   ++E WKK+NK+ +E  S     F++ A N+ARMAQCMYQ+GDGHG 
Sbjct  483   GASESNARKYIKHLIDETWKKINKIEVE-NSIIPQVFVDRAKNLARMAQCMYQYGDGHGT  541

Query  357   NNFETQTRIQTLLFE  313
              + ET+ R+ +LL +
Sbjct  542   AHEETKDRVMSLLIQ  556



>ref|XP_006365871.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum tuberosum]
Length=551

 Score =   503 bits (1295),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 272/555 (49%), Positives = 367/555 (66%), Gaps = 31/555 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y +T   RRS NY P  W+  Y+QS     YA E +  R ++LKE V+ ML+      +E
Sbjct  5     YISTMDIRRSGNYKPSIWEDGYVQS-RPNLYAEEKYCKRAEKLKEEVRRMLEKIMTNSLE  63

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG  YHFEEEI   L  IY+   K  +      +++LYATALEFR+LRQ+
Sbjct  64    QLELIDILQRLGIYYHFEEEIDTVLKHIYVNYNKRDH-----HDEELYATALEFRLLRQH  118

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-  1387
             G+++ Q++F  FM+ +   F   L EDTKGLL+LYE+S+L ME E  +E ARDF+  HL 
Sbjct  119   GYHVPQEIFCSFMN-EEGKFKTVLVEDTKGLLSLYEASYLCMEDENIMENARDFATYHLM  177

Query  1386  ----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDF  1255
                              H L+MP+HWRM RLEAR FIE Y   KT + N +LLELAKLD+
Sbjct  178   ESLKKKKMEENVGEQVSHALEMPVHWRMERLEARWFIEIY--HKTENMNPLLLELAKLDY  235

Query  1254  NIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKL  1075
             N+VQA +LE+LK +SRW K   + ++++F RDR+VE F W +G TPNP +  CR +  KL
Sbjct  236   NMVQATYLEELKQMSRWDKNIKLVKKMSFVRDRLVEGFFWAVGFTPNPLFGYCRKLSTKL  295

Query  1074  YSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYD  895
                +  +DDIYD+YGTLDEL+LFTD ++RW D+  +E LP+YM+  +LAL N +NE+AYD
Sbjct  296   SVLLTTIDDIYDVYGTLDELELFTDIVDRW-DINAIEQLPEYMKISFLALFNSMNELAYD  354

Query  894   MLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF  715
             +LKE G  I+  +RK WA+LCKAYL E KWY  GYTPT +E++ NAWIT + P+++ H +
Sbjct  355   ILKEQGFSIISQIRKQWANLCKAYLLEVKWYQRGYTPTLDEFLRNAWITNTGPVLIMHAY  414

Query  714   FYVNN-LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEA  538
             F + N + ED   L+CL  YP II   S+ILRL ND  TSP E+K+GD  K+IQCYM + 
Sbjct  415   FCITNPINEDE--LECLNHYPAIIYSPSLILRLVNDLATSPDEIKKGDYLKSIQCYMHDF  472

Query  537   KVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI  358
             K S   AR++I   +++ WKKMN+  I     FS  F   +MN+AR+AQCMYQHGDG GI
Sbjct  473   KCSEENARNYIKKLIDQTWKKMNR-DILRDQSFSKDFRRTSMNLARIAQCMYQHGDGFGI  531

Query  357   NNFETQTRIQTLLFE  313
              + ET+ RI +L FE
Sbjct  532   PDRETKDRILSLFFE  546



>gb|KHG18659.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=598

 Score =   503 bits (1296),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 280/599 (47%), Positives = 383/599 (64%), Gaps = 52/599 (9%)
 Frame = -3

Query  1998  MFSTFTTCKLPSIHR-----SHASSSFRM---------------CYHTTTTTRRSANYGP  1879
             +FS+F  C  P IH      S+  SSFR                       TRRSANY P
Sbjct  5     LFSSFPMCSFP-IHSKWKSFSYNRSSFRRLTIFSALQSDAANKNSTEDAIITRRSANYHP  63

Query  1878  PTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSY  1699
             P WDY Y+QSL       E +  +  +LKE V+ ML N  +  +EK+E+ID L+RLG SY
Sbjct  64    PIWDYGYVQSLRNDFVQDESYKEQARKLKEEVRMMLGNV-VDPLEKLELIDTLQRLGLSY  122

Query  1698  HFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDG  1519
             HFE EI + L +I      ++    A ++ +LYATALEFR+LRQ+G+ + Q+VF  FMD 
Sbjct  123   HFEAEINKTLKNISTNHISTA----AWKKDNLYATALEFRLLRQHGYKVDQEVFTCFMDD  178

Query  1518  KRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---------------  1384
                   +S ++D KGLLNLYE+S+L +EGET LE AR+  +K LK               
Sbjct  179   V-GNIKSSPNQDFKGLLNLYEASYLLLEGETMLENARELVSKLLKQYLKENNDHQYLWTL  237

Query  1383  --HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVS  1210
               H L++PLHWRMPRLEAR FIE+Y+K K    N I+LELA LD+NIVQ++H EDL++VS
Sbjct  238   VDHALELPLHWRMPRLEARWFIEAYEKNK--DRNPIVLELAILDYNIVQSMHQEDLRNVS  295

Query  1209  RWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYG  1030
              WWK+  I +R +FARDR++ENFLW  G+   P+    RI+  K+ + I  +DD+YD+YG
Sbjct  296   TWWKELGIGQRFSFARDRLMENFLWGAGMIIAPQDGKSRIILTKVNALITVIDDVYDVYG  355

Query  1029  TLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRK  850
             TLDEL+LFTD +ERW D+ +++ LPDYM+  Y AL N VNE+A+D +KE G+ ++  L+K
Sbjct  356   TLDELELFTDVVERW-DINEIQRLPDYMKIYYHALYNSVNEMAFDTIKEQGIDVIPFLKK  414

Query  849   MWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDC  670
             +W DLCKAYL EAKWY  GYTPT +EYI+N WI+I C L+LAH +   +++ E+   L  
Sbjct  415   VWTDLCKAYLVEAKWYYIGYTPTLKEYIDNTWISIGCYLMLAHAYLVTSHITEEG--LHN  472

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
             + +    +   SII RL+ND GTS +E+KRGDVPK++QCYM E+  S  EAR+ I   ++
Sbjct  473   IQENYIGVYQPSIITRLSNDLGTSSYELKRGDVPKSVQCYMYESGASEEEAREHIRKLID  532

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGD--GHGINNFETQTRIQTLL  319
               WKK+N+  +    PFS TFIE   NIAR++  MYQ+GD  GHG+ + E + R+ +L 
Sbjct  533   AAWKKINEDQM-AKLPFSPTFIESTKNIARVSLLMYQNGDGHGHGMEDKEYKKRVLSLF  590



>ref|XP_006351729.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=594

 Score =   503 bits (1295),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 276/585 (47%), Positives = 371/585 (63%), Gaps = 45/585 (8%)
 Frame = -3

Query  1980  TCKLPSIHRSHASSSFRMCYHTT---TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVM  1810
             TC L SI     SSS  +   +T   TT RRS NY P  WD+ YIQS+N   YA + ++ 
Sbjct  20    TC-LFSISGGEPSSSLVVSKASTPNPTTIRRSGNYKPTMWDFQYIQSVNN-RYAGDNYME  77

Query  1809  RRDELKERVKD---MLKNEEMREVE-KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkk  1642
             R D++K+ +K    M+    + E++ K+E+ID L+RLG SYHF+ EIM+ L  +  +   
Sbjct  78    RLDKVKKEMKKNLMMMVEGSIEELDVKLELIDNLERLGVSYHFKNEIMQILKSVRDQI--  135

Query  1641  ssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
                   +  +  LY+TAL+FR+LRQ+GF+ISQD+F+ F D        S+  D KGLL L
Sbjct  136   ------SCSDNSLYSTALKFRLLRQHGFHISQDIFNNFKDVN-GDVKQSICNDIKGLLEL  188

Query  1461  YESSFLSMEGE--TNLELARDFSAKHLK---------------------HELKMPLHWRM  1351
             YE+SFLS E E  T L     F+  HLK                     H L++P HW M
Sbjct  189   YETSFLSTESESETTLRNVTRFTEAHLKNYVCNHSCGDQYNNIMMELVVHALELPRHWMM  248

Query  1350  PRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLT  1171
             PRLE R +I  Y++   ++ N +LLELAKLDFNIVQA H  DLK +SRWWK   +AE+L+
Sbjct  249   PRLETRWYISIYER--MSNANPLLLELAKLDFNIVQATHQHDLKILSRWWKNICLAEKLS  306

Query  1170  FARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIE  991
             F+R+R+VEN  W +G    P++   R +  K+ +F+  +DDIYD+YGTLDEL+LFT  ++
Sbjct  307   FSRNRLVENLFWAVGTNFEPQHSYFRRLITKIIAFVGIIDDIYDVYGTLDELELFTLAVQ  366

Query  990   RWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEA  811
             RW D   +E+LPDYM+ CYLAL N  NE+AY++LK+H + +L +L K W DLCK+YLQEA
Sbjct  367   RW-DTKAMENLPDYMKVCYLALINTTNEVAYEVLKKHDINVLPYLTKSWTDLCKSYLQEA  425

Query  810   KWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssi  631
             +WY +GY P+ EEYI+N WI+I+ P++L H  F V N     A LD LT+YP+IIR S+ 
Sbjct  426   RWYYNGYKPSLEEYIDNGWISIAVPMVLVHALFLVTNQITKEA-LDSLTNYPDIIRWSAT  484

Query  630   ilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEG  451
             I R  ND GTS  E+KRGDVPK+IQCYM+E  VS  EAR+ I   + E W+ MN    + 
Sbjct  485   IFRFNNDLGTSSDELKRGDVPKSIQCYMNEKGVSEEEAREHIRFLIKETWELMNSSAHKE  544

Query  450   GSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
              S FS TFIE+A NIAR A CMY  GD HGI N + ++ I  +LF
Sbjct  545   NSLFSETFIEIAKNIARTAHCMYLKGDSHGIQNTDIKSSISNILF  589



>ref|XP_008461030.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=592

 Score =   502 bits (1292),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 268/594 (45%), Positives = 382/594 (64%), Gaps = 42/594 (7%)
 Frame = -3

Query  2007  MAKMFSTFTTCKLPSIHR---------SHASSSFRMCYHTT----TTTRRSANYGPPTWD  1867
             + ++F+TF+    P I R          H   +F++    T    T  RRS NY PP W 
Sbjct  3     LHQLFATFSIS--PFIQRISFNFDHLCVHVPRTFKVIGAATMCNKTIVRRSGNYRPPIWK  60

Query  1866  YSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEE  1687
             + +IQSL +  +  E ++ R +ELK  ++ ++       ++++E+ID L+RLG SYHFE 
Sbjct  61    HEFIQSLRS-EFEEEIYIGRFNELKGEIRVIMNTIIDDPLKQLELIDMLQRLGISYHFEN  119

Query  1686  EIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCG  1507
             EI   L         +S   +  +  +LYAT+LEFR+LRQ+GFN+SQDVF+ F   +   
Sbjct  120   EIKNVL----KTTYDTSYEKEHWKNNNLYATSLEFRLLRQHGFNLSQDVFNHFFSDETKS  175

Query  1506  FNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----------------KHEL  1375
             FN  L ED  G+L LYE+SFLS E E  LE A+ F+ ++L                +H L
Sbjct  176   FNVQLYEDLNGVLYLYEASFLSTEDEYILETAKHFTMEYLEKYMKSSKDENEVAIVRHAL  235

Query  1374  KMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKK  1195
             ++PLHWRMPRLE R FI+ Y++      N ILLE AKLDFN VQ++H +DLK  S WWK 
Sbjct  236   ELPLHWRMPRLETRWFIDIYER--KVDMNPILLEFAKLDFNRVQSIHQQDLKYTSSWWKS  293

Query  1194  SYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDEL  1015
             S + E+L+FAR+R++ENFLW++G    P++   R M  K+  FI  +DD+YD+YGTLDEL
Sbjct  294   SGLGEKLSFARNRLMENFLWSVGFGYEPEFSYYRRMATKINVFITTIDDVYDVYGTLDEL  353

Query  1014  QLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADL  835
             QLFTD IERW DV  ++ LPDYM+ C+LAL+N +NE+A+D+L++ G+ ++ +L+K+W DL
Sbjct  354   QLFTDAIERW-DVAAMDELPDYMKICFLALHNSINEMAFDVLRDQGINVIQYLKKVWVDL  412

Query  834   CKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYP  655
             CK Y+ EA WY  GY PT +EY++NAW +IS P+IL H + +V   +     ++ L  Y 
Sbjct  413   CKTYMVEATWYHDGYKPTLKEYLDNAWTSISGPVILVHAYVFVT--SPTLKDMENLKQYF  470

Query  654   EiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKK  475
             ++IR SS ILRLA+D GTS  E+KRGDVPK+IQCYM++   S + AR +I   ++E WKK
Sbjct  471   DLIRYSSTILRLADDLGTSSDELKRGDVPKSIQCYMNDTGASESNARKYIKHLIDETWKK  530

Query  474   MNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             MNK+ +E        F++ A N+ARMAQCMYQ+GDGHG  + ET+ R+ +LL +
Sbjct  531   MNKIEVE-NPIIPRVFVDRAKNLARMAQCMYQYGDGHGTAHEETKDRVMSLLIQ  583



>gb|AIU39887.1| terpene synthase [Gossypium hirsutum]
Length=590

 Score =   502 bits (1292),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 269/549 (49%), Positives = 361/549 (66%), Gaps = 34/549 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSANY PPTWDY YIQSL +  Y  E F  +   L   V+ ML+ + M  +EK+E+ID
Sbjct  51    VRRSANYHPPTWDYDYIQSLKSD-YLGESFNEQAIRLVGEVRMMLE-KVMDPLEKLELID  108

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF++E    L DI+ +  +S   +   +E +LYATALEFR+LRQ+G+N++Q
Sbjct  109   TLQRLGLSYHFQDETKRILEDIHTRADQSKALW---KEDNLYATALEFRLLRQHGYNLTQ  165

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF GFMD +   F +SL ED KGLLNLYE+S LSME E  L+ AR F+AK L+      
Sbjct  166   EVFSGFMD-EMGNFKSSLCEDCKGLLNLYEASHLSMEDEGILDTARHFAAKQLQQYLKQK  224

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PLHWR+ RLEAR FI+ Y+K +    N ILLELAKLDFNIVQAV
Sbjct  225   KLDEYVRMLVEHALELPLHWRVSRLEARWFIDVYEKRE--KRNPILLELAKLDFNIVQAV  282

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             + +DL   S+WW+   + E+L FARD ++ENFLWT+G+  +P + N R    K+ + I +
Sbjct  283   YQDDLIYASKWWRDIGLGEKLPFARDMLMENFLWTVGIAFDPHFGNLRRTLTKVIALITS  342

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFT  +ERW D+  +E LP+YM+ C+ AL N +NEIA+D LKEHG
Sbjct  343   IDDVYDVYGTLDELELFTQAVERW-DINAMELLPEYMKICFFALYNSINEIAFDNLKEHG  401

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
                +  L+K WA+LCKAYL EAKWY SGY PT  EY++NAWI+I+ PL+++HVF   N  
Sbjct  402   FHTIPLLKKAWAELCKAYLVEAKWYYSGYIPTLNEYMDNAWISIAVPLVISHVFSSSN--  459

Query  696   AEDAAVLDCLTDYPEiirlssiilr---LANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
                     CL  + E   L         LA+D GTS  E+KRGDVPK+IQCYM E   S 
Sbjct  460   ---LTTKKCLEYWKEDSNLIYSSAIIFRLADDLGTSMDELKRGDVPKSIQCYMHETGCSE  516

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              +AR+++   ++  WK+MN   +   SP S  F  +A+N+ R+AQCMYQ+GD HGI + +
Sbjct  517   VKAREYVKKLIDATWKRMNGEYLMSQSPLSLPFKHIALNLVRIAQCMYQYGDNHGIEDQK  576

Query  345   TQTRIQTLL  319
             T   +  LL
Sbjct  577   TNDHVLLLL  585



>ref|XP_006344475.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=601

 Score =   501 bits (1290),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 273/589 (46%), Positives = 374/589 (63%), Gaps = 37/589 (6%)
 Frame = -3

Query  2004  AKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAA  1825
             A  F +F   K  S+  S AS       +  T  RRS NY P  WD+ YIQS+N   YA 
Sbjct  21    ATCFFSFNRRKPSSLVVSKASMKSPDEPNPNTIQRRSGNYKPTMWDFQYIQSVNN-RYAG  79

Query  1824  EGFVMRRDELKERVKD---MLKNEEMREVE-KMEMIDELKRLGCSYHFEEEIMEALMDIy  1657
             + ++ R D+LK+ +K    M+    ++E++ K+E+ID L+RLG SYHF++EIM+ L  ++
Sbjct  80    DKYMERFDKLKKEIKRNLMMIVEGSIQELDAKLELIDNLERLGVSYHFKDEIMQILRSVH  139

Query  1656  mkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTK  1477
              +         AT +  LY+ AL+FR+LRQ+ F+ISQD+FD F D +      S+ +DTK
Sbjct  140   DQTSTI-----ATGDS-LYSIALKFRLLRQHHFHISQDIFDDFKD-ENGNLKQSICKDTK  192

Query  1476  GLLNLYESSFLSMEGETNLELARDFSAKHLK---------------------HELKMPLH  1360
              LL LYE SFLS E ET L+ A  F+  HLK                     H LK+P H
Sbjct  193   SLLELYEVSFLSTETETTLKYATRFTMAHLKNYVDNYGGDQDNDILMMELIQHALKIPRH  252

Query  1359  WRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAE  1180
             W MPRLE   +I  Y++    + N ++LELAKLDFNIVQA + +DL+ +S WWK + +AE
Sbjct  253   WMMPRLETEWYISIYER--MPNANPLMLELAKLDFNIVQATYQQDLRILSTWWKSTCLAE  310

Query  1179  RLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTD  1000
             +L+F+RDR+VE F W++GL   P++  CR M  K  + I  +DDIYD+YGTLDEL++FT 
Sbjct  311   KLSFSRDRLVECFFWSVGLVFEPQHSLCRRMLTKNIALITVIDDIYDVYGTLDELEIFTH  370

Query  999   TIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYL  820
              +ERW DV  +E LPDYM+ CYL+L N  NE+AY +LKE G+ +L +L K +ADLCK YL
Sbjct  371   AVERW-DVKAMEQLPDYMKICYLSLFNTTNEMAYHILKEQGINVLPYLTKQFADLCKTYL  429

Query  819   QEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirl  640
             QEAKWY +GY PT +EY++NAWI+I+  ++L H F +V+N     A L+ L  YP+IIR 
Sbjct  430   QEAKWYYNGYKPTLQEYMDNAWISIAVAVMLLHAFIFVSNPITIEA-LESLNKYPDIIRR  488

Query  639   ssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVG  460
             S+ I R  +D GTS +E+ RGDVPK++QCYM+E   S  EAR  I+L + E+W+ MNK  
Sbjct  489   SATISRFVDDLGTSSYELNRGDVPKSMQCYMNEKSASEEEARKHINLLIKEMWELMNKDQ  548

Query  459   IEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             I     FS  FI + +N +R   CMYQHGDGHGI N   + +I  LLFE
Sbjct  549   IRKEVLFSEEFIRIVLNFSRTTHCMYQHGDGHGIQNSHIKNQISKLLFE  597



>emb|CAN74705.1| hypothetical protein VITISV_032402 [Vitis vinifera]
Length=576

 Score =   500 bits (1287),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 280/580 (48%), Positives = 378/580 (65%), Gaps = 26/580 (4%)
 Frame = -3

Query  2010  IMAKMFSTFTTCKLPSIHRSHASSSF-----RMCYHTT---TTTRRSANYGPPTWDYSYI  1855
             ++A +    T  +LP I RS +  +       M  ++T      RR+ANY PP WDY Y+
Sbjct  1     MLASIPBLITHTRLPIIRRSSSXKASPPGNQSMIGNSTCEEIIXRRTANYHPPIWDYDYV  60

Query  1854  QSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID L+RLG  YHF++ I  
Sbjct  61    QSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELIDVLQRLGLYYHFKDXIKR  118

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNAS  1495
              L  IY +  +        ++ DLYATALEFR+LRQ+G+++ +DVF  F D +   F A 
Sbjct  119   ILDSIYNQYNQHEEW----KKDDLYATALEFRLLRQHGYDVPEDVFSRFKD-ETGSFKAC  173

Query  1494  LSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELKMPLHWRMP-----RLEARS  1330
             L ED KG+L LYE+S+L ++GE+  E ARDF+ +HL   L+      +       L A  
Sbjct  174   LCEDMKGMLCLYEASYLCVQGESTXEQARDFAHRHLGKGLEQNXDQNLAIEVNHALRASI  233

Query  1329  FIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVV  1150
              +E+  K +    N ILLE AKLDFN+VQA H EDL+ VS WW+ + + E+L FARDR++
Sbjct  234   ALEN-AKVRGKDMNPILLEFAKLDFNMVQATHQEDLRHVSSWWRSTRLGEKLNFARDRLM  292

Query  1149  ENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTK  970
             ENFLWT+G+   P+Y  CR M  K+ +FI  +DDIYD+YGTLDEL+LFTD ++RW D+  
Sbjct  293   ENFLWTVGMIFEPQYGYCRRMSTKVITFINIIDDIYDVYGTLDELELFTDAVDRW-DINA  351

Query  969   VEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGY  790
             ++ LP+YM+ C+LAL N  NE+AYD LKEHG+ I+ +LRK+W+ LCK+YL EAKWY SGY
Sbjct  352   MDPLPEYMKLCFLALYNSTNEMAYDALKEHGLHIISYLRKVWSXLCKSYLLEAKWYYSGY  411

Query  789   TPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAND  610
              PT +EYI NAWI+IS P++L H +F+V N     A L  L  Y  IIR SS+I RL++D
Sbjct  412   XPTLQEYISNAWISISGPVVLXHAYFFVTNPITXEA-LQXLERYHNIIRWSSMIXRLSDD  470

Query  609   KGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVG-IEGGSPFSG  433
              GTS  E+KRGDVPK+IQCYM E   S  EAR  I   +   WKK+N+ G +E  SPF  
Sbjct  471   LGTSLDELKRGDVPKSIQCYMXETGASEEEARKHISYLIGXTWKKLNEDGAVE--SPFPE  528

Query  432   TFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             TFI +A N+ARMAQCMYQHGDG GI   ET+ R+ +LL E
Sbjct  529   TFIGIATNLARMAQCMYQHGDGXGIEYGETKDRVLSLLVE  568



>gb|KHG20211.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=597

 Score =   500 bits (1288),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 274/598 (46%), Positives = 385/598 (64%), Gaps = 51/598 (9%)
 Frame = -3

Query  1995  FSTFTTCKLP-------------SIHR------SHASSSFRMCYHTTTTTRRSANYGPPT  1873
             FS+F  C  P             S HR      SH  ++ ++        RRSANY P  
Sbjct  6     FSSFPICTFPIHSKLKCFSYDGSSFHRLIISFASHREATNKISAEDDIVIRRSANYDPSI  65

Query  1872  WDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHF  1693
             WDY YIQSL       E +  R  +LKE V+ ML+NE +  +EK+E+ID +++LG SY F
Sbjct  66    WDYDYIQSLKNDFVQDESYKERASKLKEEVRMMLENE-VDPLEKLELIDTIQKLGLSYDF  124

Query  1692  EEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKR  1513
              +EI + L +I + +        A ++ +LYATALEFR+LRQ+G+ ++QDVF  FMD   
Sbjct  125   GDEIKKTLKNISIDRSTIV----AWDKDNLYATALEFRLLRQHGYKVNQDVFACFMDDV-  179

Query  1512  CGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------  1384
                 ASL++D KGLLNLYE+S+  +EGET LE AR+ +AK LK                 
Sbjct  180   GNIKASLNQDYKGLLNLYEASYHLLEGETMLENARELAAKLLKKCLKENNDNQYLWMLMK  239

Query  1383  HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRW  1204
             H L++PLHWR+PR EAR FI+ Y+K K    N I+LELA LD+NIVQ++H +DL+ VS W
Sbjct  240   HALELPLHWRIPRFEARWFIDVYEKNK--EKNPIILELAILDYNIVQSMHQDDLRYVSAW  297

Query  1203  WKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTL  1024
             WK+  + +R++FARDR++ENFLW++G+  +P+    R +  K+ S I  +DD+YD+YGTL
Sbjct  298   WKELGLYKRMSFARDRLMENFLWSVGMIISPQNGKGRRIQTKVNSLITIIDDVYDVYGTL  357

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMW  844
             DEL+LFTD +ERW D+  ++ LP+YM+ CY AL N +NE+A+D LKE G+ +L  L K+W
Sbjct  358   DELELFTDVVERW-DINAIQKLPNYMKICYHALYNSINEMAFDTLKEQGIDVLPFLIKLW  416

Query  843   ADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAA--VLDC  670
              +LCK+YL EAKWY +GYTPT +EY+ NAWI++S  +IL + +     + E+    + +C
Sbjct  417   TNLCKSYLVEAKWYYTGYTPTLQEYMNNAWISVSGCVILGYSYLATGCITEEGLHHIQEC  476

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
                +P II  S II+RLA+D GTS +E+KRGDVPK+IQCYM+++  S  EARD I   ++
Sbjct  477   ---HPNIIYWSCIIVRLADDLGTSSYELKRGDVPKSIQCYMNDSGASEEEARDHIKKLID  533

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
               WKKMN+      SPFS TFIE+ M   R+A  +YQ+GDG GI + ET+ R+ +L  
Sbjct  534   ATWKKMNEEQT-TKSPFSHTFIEIVMGFTRVALLLYQNGDGFGIEDNETKDRVLSLFI  590



>ref|XP_006365869.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X1 [Solanum 
tuberosum]
Length=553

 Score =   498 bits (1282),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 269/555 (48%), Positives = 364/555 (66%), Gaps = 29/555 (5%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y +T   RRS NY P  W+  Y+QS     YA E F  R ++LKE V+ ML       +E
Sbjct  5     YISTMDIRRSGNYKPSIWEDGYVQS-RPNLYAEEKFCERAEKLKEEVRRMLDKIMTNSLE  63

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG  YHF EEI  AL   Y+    +  +    E   +YA ALEFR+LRQ 
Sbjct  64    QLELIDILQRLGIYYHFAEEIDTALKQTYVNYNYNKRDLNNEE---VYAVALEFRLLRQQ  120

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-  1387
             G+++ Q++F  FM+ K   F  +L EDTKGLL+LYE+S+L ME E  +E ARDF+  +L 
Sbjct  121   GYHVPQEIFCSFMN-KEGKFKTALVEDTKGLLSLYEASYLCMEDENIMENARDFATHYLM  179

Query  1386  ----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDF  1255
                              H L+MP+HWRM RLEAR FIE Y K  T + N +LLELAKLD+
Sbjct  180   ESLKKKKMDENVGEQVSHALEMPVHWRMERLEARWFIEIYHK--TENMNPLLLELAKLDY  237

Query  1254  NIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKL  1075
             N+VQA +LE+LK +SRW K   + ++++F RDR+VE F W +G TPNP++  CR +  KL
Sbjct  238   NMVQATYLEELKQMSRWDKNIKLVKKMSFVRDRLVEGFFWAVGFTPNPQFGFCRKLSTKL  297

Query  1074  YSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYD  895
                I  +DDIYD+YGTLDEL+LFTD ++RW D+   E LP+YM+  +LAL N +NE+AYD
Sbjct  298   AVLITTIDDIYDVYGTLDELELFTDIVDRW-DINATEQLPEYMKISFLALFNSMNELAYD  356

Query  894   MLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF  715
             +LKE G  I+  +RK WA+LCKAYL E KWY  GYTPT  E++ NAWI+ + P+++ H +
Sbjct  357   ILKEQGFSIISQIRKQWANLCKAYLLEVKWYQRGYTPTLNEFLRNAWISNTGPVLIMHAY  416

Query  714   FYVNN-LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEA  538
             F + N + ED   L+CL  YP II   S+ILRLAND GTSP E+K+GD  K+IQCYM ++
Sbjct  417   FCITNPIKEDE--LECLNHYPPIIYSPSLILRLANDLGTSPDEIKKGDHLKSIQCYMHDS  474

Query  537   KVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI  358
             K S   AR++I   +++ W KMN+  +   S FS  F   +MN+AR++QC+YQHGDG GI
Sbjct  475   KCSEENARNYIQKLIDQTWMKMNRDILRDQS-FSKDFRRTSMNLARISQCIYQHGDGFGI  533

Query  357   NNFETQTRIQTLLFE  313
              + ET+ RI +L FE
Sbjct  534   PDRETKDRILSLFFE  548



>ref|XP_011088139.1| PREDICTED: LOW QUALITY PROTEIN: terpene synthase 10-like [Sesamum 
indicum]
Length=592

 Score =   499 bits (1285),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 275/567 (49%), Positives = 376/567 (66%), Gaps = 33/567 (6%)
 Frame = -3

Query  1938  SFRM-CYHTTTTTRRSANYGPPTWD-YSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKN  1765
             +FR+ C  ++ T   +A   P   + + YIQSLNT  YA E ++ R  ELK  VK ML  
Sbjct  31    TFRLRCISSSGTAAATACCSPSFXNCFDYIQSLNT-EYAEERYLRRASELKVEVKKMLVQ  89

Query  1764  EE--MREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATA  1591
             E+  +  VE++E++D+ +RLG SYHFE+EI + L  +Y  K    N+    + KDLY+TA
Sbjct  90    EKEVLSTVEELELVDDFQRLGISYHFEDEINQILASVYDHKYAGKNSE--GKAKDLYSTA  147

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             LEFR+LRQ+GF +SQ+ FD F + K   F+++L+ DTKGLL LYE+SFLS  GE  L+LA
Sbjct  148   LEFRLLRQHGFAVSQETFDTFRNEK-GDFDSNLAHDTKGLLQLYEASFLSKPGEKTLDLA  206

Query  1410  RDFSAKHL-----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAI  1282
             R+F+   L                 +H L++P+HWR+ R  AR FIE+Y++      N +
Sbjct  207   REFATNFLQKKFDENIDDENLAILVRHALELPIHWRVERPNARWFIEAYERRPDV--NPL  264

Query  1281  LLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYV  1102
             +LELAKLDFNIVQA H ++LK V  WWK++ IAE L FARDR+VE + WT+G   +P++ 
Sbjct  265   VLELAKLDFNIVQATHQQELKHVYGWWKQTGIAENLPFARDRMVECYFWTVGYFFHPEHR  324

Query  1101  NCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALN  922
               R+M AKL + I  +DDI+D+YGTL ELQLF + I RWD V  ++ LP+YM+ CYLAL 
Sbjct  325   YPRMMIAKLNALITVIDDIFDVYGTLQELQLFNNAIRRWD-VEAIDKLPNYMQICYLALY  383

Query  921   NFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITIS  742
             N +NE AYD+LK+ G+ I+ HLRK WADLC+ YLQEA+WY  GYTPT EEY+ NAWI++S
Sbjct  384   NLINETAYDVLKQQGLVIIPHLRKSWADLCRTYLQEAEWYFRGYTPTLEEYMNNAWISVS  443

Query  741   CPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKA  562
              PL L+HV+F   N  E+  V+  L  Y +I+R S +I+RLA+D  TSP EMKRGDV KA
Sbjct  444   APLTLSHVYFAAANRIEN-EVVGSLHKYQDIVRYSGMIMRLADDIATSPAEMKRGDVAKA  502

Query  561   IQCYMDEAKVSANEARDFIDLEMNELWKKMNK----VGIEGGSPFSGTFIEVAMNIARMA  394
             ++CYM+E   S  EA +++   ++E WKKMN+          SPF   F+ +A ++ R A
Sbjct  503   VECYMNERGGSREEAEEYVRYLIDETWKKMNEGAAVAVAADDSPFLEDFVRIAADLGRTA  562

Query  393   QCMYQHGDGHGINNFETQTRIQTLLFE  313
             Q  YQHGDGHGI   + + RI TLLF+
Sbjct  563   QYFYQHGDGHGIQTPQIKERIPTLLFQ  589



>gb|AEP82768.1| terpene synthase [Solanum lycopersicum]
Length=546

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 265/548 (48%), Positives = 364/548 (66%), Gaps = 26/548 (5%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             +T   RRS NY P  W+  Y+QS     YA E +  R ++LKE V+ ML+      +E++
Sbjct  7     STMDIRRSGNYKPSIWEDGYVQS-RPNLYAEEKYCERAEKLKEEVRKMLQKRMTNSLEQL  65

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E++D L+RLG  YHFEEEI   L  IY+   K  +       ++LY TALEFR+LRQ+G+
Sbjct  66    ELVDILQRLGIYYHFEEEIDTVLKQIYVNYNKRDH-----HNEELYDTALEFRLLRQHGY  120

Query  1557  NISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL---  1387
             ++ Q++F  FM+ +   F  +L EDTKGLL+LYE+S+L ME E  +E ARDF+  +L   
Sbjct  121   HLPQEIFCSFMN-EEGKFKTALVEDTKGLLSLYEASYLCMEDENIMENARDFATHYLMEN  179

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                       H L+MP+HWRM RLEAR FIE Y K +    N +LLELAKLD+N+VQA +
Sbjct  180   VKKKMDEQVSHALEMPVHWRMERLEARWFIEIYHKKENM--NPLLLELAKLDYNMVQATY  237

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
             LE+LK +SRW K   + ++++F RDR+VE F W +G TPNP++  CR +  KL   +  +
Sbjct  238   LEELKQMSRWDKNMKLVKKMSFVRDRLVEGFFWAVGFTPNPQFGYCRKLSTKLSVLLTTI  297

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DDIYD+YGTLDEL+LFTD ++RW D+  +E LP+YM+  +LAL N +NE+AYD+LKE G 
Sbjct  298   DDIYDVYGTLDELELFTDIVDRW-DINAIEQLPEYMKISFLALFNSMNELAYDILKEQGF  356

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN-L  697
              I+ H+RK WA+LCKAYL E KWY  GYTP+ +E++ NAWIT + P+++ H +F + N +
Sbjct  357   SIISHIRKQWANLCKAYLLEVKWYQRGYTPSLDEFLRNAWITNTGPVLIMHAYFCITNPI  416

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
              ED   L  L  YP II   S+ILRLAND  TSP E+K+GD  K+IQCYM ++K     A
Sbjct  417   KEDE--LQRLNHYPAIIYSPSLILRLANDLATSPDEIKKGDYLKSIQCYMHDSKSCEENA  474

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             R++I   ++E WKKMN+  I      S  F   +MN+AR+AQCMYQHGDG GI + ET+ 
Sbjct  475   RNYIKKLIDETWKKMNR-DILRDESLSKDFRRTSMNLARIAQCMYQHGDGFGIPDRETKD  533

Query  336   RIQTLLFE  313
             RI +L F+
Sbjct  534   RILSLFFQ  541



>gb|EYU18417.1| hypothetical protein MIMGU_mgv1a003023mg [Erythranthe guttata]
Length=614

 Score =   498 bits (1282),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 267/562 (48%), Positives = 359/562 (64%), Gaps = 40/562 (7%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMRE--VEKME  1735
             T RR+ NY P  W + Y+QSLN+  Y  E ++ R  EL E+VK +++ + M    V +++
Sbjct  60    TVRRTGNYKPSLWGFDYLQSLNSK-YKEERYLKRAFELTEQVKMVMEEQVMLMDFVHQLD  118

Query  1734  MIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN  1555
              ID L RL  SY F+ EI + L  +Y    K         EKDLY+ AL FR+LRQ+GF+
Sbjct  119   FIDNLHRLNISYLFDREIEQILNSLYHNCYKYF------HEKDLYSVALGFRLLRQHGFS  172

Query  1554  ISQDVFDGFMDGKRCGFNASLSED--TKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +SQDVFD F + +   F  SL ++  TKGLL LYE+SFL   GE  LELARDFS   L+ 
Sbjct  173   VSQDVFDSFKNERGDSFKESLGDNMNTKGLLQLYEASFLMTCGEITLELARDFSTNLLRK  232

Query  1383  ----------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLEL  1270
                                   H L++P+HWR PRL AR FI+ Y+K   +  + ++LEL
Sbjct  233   ILDDHDRIYDDDEGDVLLLMVRHALELPIHWRTPRLNARCFIDLYEK--KSDMDPLVLEL  290

Query  1269  AKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRI  1090
             AKLDFNIVQA H ++LK VS WWK++ +AE+L FARDRVVE+++ TIG    P+Y   RI
Sbjct  291   AKLDFNIVQAAHQQELKHVSSWWKETRLAEKLPFARDRVVESYILTIGEMFQPQYGYSRI  350

Query  1089  MGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVN  910
             MG K+ S +  +DD++D+YGTL+ELQLF D I+RWD +  ++ LP+YM+ C+LALNNFVN
Sbjct  351   MGTKVNSLVTVIDDMFDVYGTLEELQLFNDVIQRWD-IGAIDQLPEYMQICFLALNNFVN  409

Query  909   EIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLI  730
             E+AYD+LK+ G  I+ +LRK WADLC  YLQEAKWY  GY PT EEY+  AWI+IS P+I
Sbjct  410   EMAYDVLKQQGFLIIPYLRKSWADLCATYLQEAKWYWRGYKPTLEEYMSKAWISISVPVI  469

Query  729   LAHVFFYVNNLAEDAAVLDCLTD---YPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
             L+H +F V N  +         +   Y  ++R S  I RLAND GTSP EM+RGDVPKAI
Sbjct  470   LSHAYFLVTNPIQKVGAQSLYDEDQLYHNVVRFSGTIARLANDLGTSPDEMERGDVPKAI  529

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             QCYM+E      EAR++I   + E WKKMN+  +   SP     + +A+++ R+A  +YQ
Sbjct  530   QCYMNETGARREEAREYIRFLIYETWKKMNEERVITDSPLPRNLVRIAVDLGRIAHYIYQ  589

Query  378   HGDGHGINNFETQTRIQTLLFE  313
             HGDG+G  +   + R   LLFE
Sbjct  590   HGDGYGTQHCRVKNRFSDLLFE  611



>ref|XP_002512868.1| (R)-limonene synthase, putative [Ricinus communis]
 gb|EEF49371.1| (R)-limonene synthase, putative [Ricinus communis]
Length=599

 Score =   497 bits (1280),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 268/549 (49%), Positives = 359/549 (65%), Gaps = 30/549 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             T  RRS N+ P ++DY ++QSL T+ Y  E +  R +ELKE VK ML       ++++EM
Sbjct  56    TIVRRSGNWKPSSFDYKFVQSL-TSQYLGEPYSTRMEELKEMVKLMLTQTSNNILDQLEM  114

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHFE+EI E ++ I      S         KDLY+TALEFR+LRQ G+N 
Sbjct  115   IDALQRLGIAYHFEDEI-ETILKIIYVSNNSQL------RKDLYSTALEFRLLRQQGYNA  167

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              Q+VF+ F D ++  F A+L  D KGLLNLYE+SFLS++GE+ LE AR+F+  +L+    
Sbjct  168   HQEVFNSFKD-EQGNFKANLCGDIKGLLNLYEASFLSVKGESILEDAREFATNNLRKYVS  226

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++PL WRM  LEA  FI  Y+K +      I LELAKL+FN++QA
Sbjct  227   KNNGEYFSMIVSHALELPLDWRMQWLEANWFIHVYEKSRDM--RPIFLELAKLNFNMIQA  284

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
             VH EDLK  + WWK + + E+L F R R +E FLWT+G      +   R   A++ S I 
Sbjct  285   VHQEDLKHSTSWWKNTNLGEKLGFVRSRPMEIFLWTVGGMYELPFGYSRRTLARVGSLIT  344

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YDIYGTLDELQL TD +ERWD +  ++ LPDYM+ C+LAL+N +NE+A D+LK  
Sbjct  345   VIDDVYDIYGTLDELQLLTDAVERWD-INAMDQLPDYMKLCFLALHNSINEMALDVLKNQ  403

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
              + I+ +L+K W DLCK+YL EAKWY SGYTPT EEY+ENAWI+I+ PL+L H +F + N
Sbjct  404   DLHIIPYLKKAWVDLCKSYLLEAKWYYSGYTPTLEEYLENAWISIAGPLLLVHAYFTITN  463

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
                    +DCL DYP IIRLS  I RL +D GT+  E KRGDVPKA+QCYM E  VS   
Sbjct  464   EITSEG-MDCLKDYPNIIRLSGTISRLTDDLGTASHESKRGDVPKAMQCYMHETGVSEEV  522

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR+ I+  + E WKK+N+    G S FS TF+ +A N+ RM+ CMY++GDG G  N  T+
Sbjct  523   AREHIESLIRETWKKINEEHF-GNSVFSQTFMRLAKNLGRMSHCMYENGDGFGAQNRHTK  581

Query  339   TRIQTLLFE  313
              R+ +LL +
Sbjct  582   ERVVSLLIQ  590



>ref|XP_004233802.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum lycopersicum]
Length=538

 Score =   494 bits (1272),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 264/543 (49%), Positives = 362/543 (67%), Gaps = 26/543 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  W+  Y+QS     YA E +  R ++LKE V+ ML+      +E++E++D 
Sbjct  4     RRSGNYKPSIWEDGYVQS-RPNLYAEEKYCERAEKLKEEVRKMLQKRMTNSLEQLELVDI  62

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG  YHFEEEI   L  IY+   K  +       ++LY TALEFR+LRQ+G+++ Q+
Sbjct  63    LQRLGIYYHFEEEIDTVLKQIYVNYNKRDH-----HNEELYDTALEFRLLRQHGYHLPQE  117

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             +F  FM+ +   F  +L EDTKGLL+LYE+S+L ME E  +E ARDF+  +L        
Sbjct  118   IFCSFMN-EEGKFKTALVEDTKGLLSLYEASYLCMEDENIMENARDFATHYLMENVKKKM  176

Query  1386  ----KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLK  1219
                  H L+MP+HWRM RLEAR FIE Y K +    N +LLELAKLD+N+VQA +LE+LK
Sbjct  177   DEQVSHALEMPVHWRMERLEARWFIEIYHKKENM--NPLLLELAKLDYNMVQATYLEELK  234

Query  1218  SVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYD  1039
              +SRW K   + ++++F RDR+VE F W +G TPNP++  CR +  KL   +  +DDIYD
Sbjct  235   QMSRWDKNMKLVKKMSFVRDRLVEGFFWAVGFTPNPQFGYCRKLSTKLSVLLTTIDDIYD  294

Query  1038  IYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHH  859
             +YGTLDEL+LFTD ++RW D+  +E LP+YM+  +LAL N +NE+AYD+LKE G  I+ H
Sbjct  295   VYGTLDELELFTDIVDRW-DINAIEQLPEYMKISFLALFNSMNELAYDILKEQGFSIISH  353

Query  858   LRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN-LAEDAA  682
             +RK WA+LCKAYL E KWY  GYTP+ +E++ NAWIT + P+++ H +F + N + ED  
Sbjct  354   IRKQWANLCKAYLLEVKWYQRGYTPSLDEFLRNAWITNTGPVLIMHAYFCITNPIKEDE-  412

Query  681   VLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFID  502
              L  L  YP II   S+ILRLAND  TSP E+K+GD  K+IQCYM ++K     AR++I 
Sbjct  413   -LQRLNHYPAIIYSPSLILRLANDLATSPDEIKKGDYLKSIQCYMHDSKSCEENARNYIK  471

Query  501   LEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTL  322
               ++E WKKMN+  I      S  F   +MN+AR+AQCMYQHGDG GI + ET+ RI +L
Sbjct  472   KLIDETWKKMNR-DILRDESLSKDFRRTSMNLARIAQCMYQHGDGFGIPDRETKDRILSL  530

Query  321   LFE  313
              F+
Sbjct  531   FFQ  533



>ref|XP_006370889.1| hypothetical protein POPTR_0019s014601g, partial [Populus trichocarpa]
 gb|ERP48686.1| hypothetical protein POPTR_0019s014601g, partial [Populus trichocarpa]
Length=513

 Score =   493 bits (1269),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 263/522 (50%), Positives = 359/522 (69%), Gaps = 28/522 (5%)
 Frame = -3

Query  1827  AEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkk  1648
              E +  R ++LK  ++ ML N   + ++++E+ID L+RLG SYHF +EI   L  ++ + 
Sbjct  1     GEPYTARSEKLKANIRMMLANAS-KTLDQLELIDALQRLGLSYHFVDEIKSTLKSLFYQN  59

Query  1647  kkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLL  1468
                +         DLYATALEFR+LRQ+G+ + Q+VF+ F D ++  F A + +D KG+L
Sbjct  60    HIENTKTV----HDLYATALEFRLLRQHGYKVPQEVFNHFKD-EQGNFRAWIHDDLKGML  114

Query  1467  NLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPRLE  1339
              LYE+S+  +EGE+ LE ARDF+ K+L+                 H L++PL WRM RLE
Sbjct  115   FLYEASYFLVEGESILEDARDFTTKNLEKYVEKCNPSEYLSKMVSHALELPLAWRMLRLE  174

Query  1338  ARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARD  1159
             +  FI  Y+    T    +LLELAKLDFN+VQA+H EDLK  SRWWK++ + E+L FARD
Sbjct  175   SNWFINVYET--KTDMEPVLLELAKLDFNMVQAIHQEDLKHSSRWWKRTGLGEKLDFARD  232

Query  1158  RVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDD  979
             R+VENFLWT+G+   P++ NCR M  K+ S I  +DD+YD+YGTLDEL+LFTD + RW D
Sbjct  233   RLVENFLWTVGVIFEPQFGNCRRMLTKVNSLITTIDDVYDVYGTLDELELFTDAVVRW-D  291

Query  978   VTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYA  799
             +  ++ LPDYM+ C+LAL N VNE+AYD+LK  GV IL +L+K WADLCK+YL EAKWY 
Sbjct  292   LNCMDRLPDYMKLCFLALFNSVNEMAYDILKYQGVDILPYLKKAWADLCKSYLLEAKWYF  351

Query  798   SGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrL  619
             SGYTPT +EY++NAWI+IS P+IL H +FYV+N   + A    + +YP+IIR SS+ILRL
Sbjct  352   SGYTPTLQEYMDNAWISISAPVILVHAYFYVSNPTTEEAS-QFMDEYPDIIRWSSMILRL  410

Query  618   ANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPF  439
             A+D GTS  E+KRGD+ K+IQCYM EA VS  +ARD I   +   WKK+N          
Sbjct  411   ADDLGTSSDELKRGDISKSIQCYMHEAGVSEEKARDHIRNLIGNTWKKINDYQF-ANPHI  469

Query  438   SGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             S TFI +AMN+ RMAQCMYQ+GDGHG+ + ET+ R+++LL +
Sbjct  470   SQTFIGIAMNLTRMAQCMYQYGDGHGVGHLETKDRVKSLLIK  511



>ref|XP_009757423.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=616

 Score =   496 bits (1277),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 271/573 (47%), Positives = 372/573 (65%), Gaps = 40/573 (7%)
 Frame = -3

Query  1953  SHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDM  1774
             SH+S    M      T RRS NY P TW + YI+S+ +  Y  + +  R +ELKE ++  
Sbjct  49    SHSSIPTNM-----NTDRRSGNYKPATWPFEYIESI-SNDYVGKNYTKRFNELKEEMRKK  102

Query  1773  LK---NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn--nyKATEEK  1609
             LK   + +  E+EK+E+ID L+RLG SYHF++EI + L  I+ ++       N  + E  
Sbjct  103   LKMMDDVDGEELEKLELIDNLQRLGLSYHFKDEIFQILRSIHQQQILQQQGRNIVSGEYS  162

Query  1608  DLYATALEFRVLRQNGFNISQDVFDGFM--DGKRCGFNASLSEDTKGLLNLYESSFLSME  1435
              LYATAL+F++LR+ GF+ISQD+ + F   DG    F  S  +D KGLL LYE+SF + E
Sbjct  163   LLYATALKFKLLREYGFDISQDILNSFKIEDG---NFKESHGKDLKGLLQLYEASFFATE  219

Query  1434  GETNLELA-------------------RDFSAKHLKHELKMPLHWRMPRLEARSFIESYD  1312
              E  L+ A                    + +A  + H L++P HW M RLE R ++  Y+
Sbjct  220   TENTLKSATIVTKLELKNYLENYEHNEENVTATLVHHALELPSHWMMLRLETRWYLNVYE  279

Query  1311  KGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWT  1132
             K    + N +LLELAKLDFNIVQA H EDL+ VSRWWK + +AE+L F+RDR+VE+F W 
Sbjct  280   K--MPNANPLLLELAKLDFNIVQATHQEDLRDVSRWWKNTCLAEKLPFSRDRLVESFFWG  337

Query  1131  IGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPD  952
             +G    P+  +CRIM  KL + +  +DDIYDIYGT  ELQLFTD +ERW ++  +E LPD
Sbjct  338   VGTVFEPQQRHCRIMITKLIALVSTIDDIYDIYGTYHELQLFTDAVERW-ELRAMEQLPD  396

Query  951   YMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEE  772
             YM+  YLAL N +NE+AY++LKE  + +L +L K W +LCK YLQEA+W+ +G+ PT +E
Sbjct  397   YMKVMYLALFNTINEMAYEVLKEQDINVLPYLTKPWTELCKTYLQEARWFYNGHKPTLQE  456

Query  771   YIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPF  592
             Y++NAWI+IS P+IL H FF V N       L+ ++ YP+IIR S+ I+RLA+D GTSP+
Sbjct  457   YMDNAWISISMPMILIHAFFSVTNPITKEE-LESISKYPDIIRWSATIIRLADDLGTSPY  515

Query  591   EMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAM  412
             E+KRGDVPK+IQCY++E  VS  EAR+ I   + E W+ +N+   E    FSGTF+EVA 
Sbjct  516   ELKRGDVPKSIQCYINEKGVSEEEAREHIQFLIKETWEMLNRAQRENLL-FSGTFVEVAK  574

Query  411   NIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             NIAR  QCMY HGDGHGI N +++  I  +LFE
Sbjct  575   NIARTGQCMYLHGDGHGIQNADSENSISKILFE  607



>emb|CAN64328.1| hypothetical protein VITISV_027228 [Vitis vinifera]
Length=570

 Score =   494 bits (1273),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 279/592 (47%), Positives = 375/592 (63%), Gaps = 56/592 (9%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTT--------TTRRSANYGPPTWDYS  1861
             ++++A + +  T  +LP I +S +  +                 T RR+ANY P  WDY 
Sbjct  3     LSMLASIPNLITHTRLPIITKSSSCKASPRGIKVKIGNSNCEEITVRRTANYQPTIWDYD  62

Query  1860  YIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEI  1681
             Y++SL +  Y  E +  R D+LK  VK ML   + + ++++E+ID L+RLG  YHF++EI
Sbjct  63    YVRSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELIDVLQRLGIYYHFKDEI  120

Query  1680  MEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFN  1501
                L  IY +  +        ++ DLY TALEFR+LRQ+G+++ QDVF  F D +   F 
Sbjct  121   KRILNSIYNQYNRHEEW----QKDDLYTTALEFRLLRQHGYDVPQDVFSRFKD-ETGSFK  175

Query  1500  ASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----------------KHELKM  1369
             A L ED KGLL LYE+S+L ++GE+ LE ARDF+ +HL                 H L++
Sbjct  176   ACLCEDIKGLLCLYEASYLCVQGESTLEQARDFAHRHLGKGLEQNIDQNLAIEVNHALEL  235

Query  1368  PLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSY  1189
             PLHWRMPRLEAR FI+ Y+K +    N ILLE AKLDFN+VQA H EDL+ +S WW+ + 
Sbjct  236   PLHWRMPRLEARWFIDVYEKRQDM--NPILLEFAKLDFNMVQATHQEDLRHMSSWWRSTR  293

Query  1188  IAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQL  1009
             + E+L FARDR++ENFLWT+G    P+Y   R M  K+ + I  +DD+YD+YGTLDEL+L
Sbjct  294   LGEKLKFARDRLMENFLWTVGEIFEPQYGYYRRMSTKVNTLITIIDDVYDVYGTLDELEL  353

Query  1008  FTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCK  829
             FTD ++RW D+  ++ LPDY++ C+LAL N  NE+AYD LKEHG+ I+ +LRK WADLCK
Sbjct  354   FTDAVDRW-DINAMDPLPDYIKLCFLALYNSTNEMAYDALKEHGLHIIFYLRKAWADLCK  412

Query  828   AYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEi  649
             +YL EAKWY SGYTP+ +EYI N+WI+IS P+IL H +F V N     A L  L  Y  I
Sbjct  413   SYLLEAKWYYSGYTPSLQEYISNSWISISGPVILVHAYFLVANPITKEA-LQSLERYHNI  471

Query  648   irlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN  469
             IR SS+ILRL++D GTS  E+KRGDVPK+IQCYM E   S  EAR  I   + + WKK+N
Sbjct  472   IRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEEARKHISYLIVDTWKKLN  531

Query  468   KVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
                 E G+ F                 MYQHGDGHGI   ET+ R+ +LL E
Sbjct  532   ----EDGAVF-----------------MYQHGDGHGIEYGETEDRVLSLLVE  562



>gb|ADR74202.1| terpene synthase [Vitis vinifera]
Length=593

 Score =   494 bits (1273),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 270/553 (49%), Positives = 366/553 (66%), Gaps = 29/553 (5%)
 Frame = -3

Query  1920  HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
              T    RR+A+Y P  WD+ YI+SL T+ Y  E +  + ++LK  VK ML  +    + +
Sbjct  48    QTAVIVRRTASYQPSIWDHDYIRSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQ  105

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G
Sbjct  106   LELIDTLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHG  161

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +++ QDVF  F++ K    N  L+ED KG+L LYE+S+LS++GE  LE ARDF+   L+ 
Sbjct  162   YHVPQDVFHIFIN-KMGTVNPWLNEDIKGILCLYEASYLSVKGENILEEARDFTRNFLEE  220

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N
Sbjct  221   YLERTVDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQ--GMNPILLELAKLDYN  278

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             +VQA + EDLK  S WW+ + + E+ +F+RDR+VENFLW +G    P++  CR M  KL 
Sbjct  279   MVQATYQEDLKHASMWWRSTRLPEKSSFSRDRLVENFLWAVGFIFEPQFGYCRRMLTKLI  338

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDM  892
             S I  +DD+YD+YGTLDEL+LFTD ++RW D   +E LP YM+ C+LAL NF NE AYD+
Sbjct  339   SLITTIDDVYDVYGTLDELELFTDAVDRW-DTNAMEQLPQYMKICFLALYNFTNETAYDV  397

Query  891   LKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFF  712
             LKEH + I+ +LRK WADL K+YL EAKWY  GY P+ +EYI NA I+IS PL L H +F
Sbjct  398   LKEHDLNIISYLRKAWADLSKSYLVEAKWYHEGYMPSLQEYINNAMISISGPLTLVHAYF  457

Query  711   YVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKV  532
             ++ N   + A L CL  + +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM E   
Sbjct  458   FITNPMTEEA-LGCLERFRDIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSA  516

Query  531   SANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINN  352
             S ++AR +I   ++E WKKMN+      SPFS TFI +AM+I RMAQC+Y + DG+G+ +
Sbjct  517   SEDDARKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQD  575

Query  351   FETQTRIQTLLFE  313
              ET+  ++TL  E
Sbjct  576   RETKDHVKTLFIE  588



>ref|NP_001268167.1| (+)-alpha-phellandrene synthase [Vitis vinifera]
 gb|ADR74203.1| (+)-alpha-pinene synthase [Vitis vinifera]
Length=593

 Score =   494 bits (1272),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 270/553 (49%), Positives = 366/553 (66%), Gaps = 29/553 (5%)
 Frame = -3

Query  1920  HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
              T    RR+A+Y P  WD+ YI+SL T+ Y  E +  + ++LK  VK ML  +    + +
Sbjct  48    QTAVIVRRTASYQPSIWDHDYIRSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQ  105

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G
Sbjct  106   LELIDTLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHG  161

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +++ QDVF  F++ K    N  L+ED KG+L LYE+S+LS++GE  LE ARDF+   L+ 
Sbjct  162   YHVPQDVFHIFIN-KMGTVNPWLNEDIKGILCLYEASYLSVKGENILEEARDFTRNFLEE  220

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N
Sbjct  221   YLERTVDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQ--GMNPILLELAKLDYN  278

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             +VQA + EDLK  S WW+ + + E+ +F+RDR+VENFLW +G    P++  CR M  KL 
Sbjct  279   MVQATYQEDLKHASMWWRSTRLPEKSSFSRDRLVENFLWAVGFIFEPQFGYCRRMLTKLI  338

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDM  892
             S I  +DD+YD+YGTLDEL+LFTD ++RW D   +E LP YM+ C+LAL NF NE AYD+
Sbjct  339   SLITTIDDVYDVYGTLDELELFTDAVDRW-DTNAMEQLPQYMKICFLALYNFTNETAYDV  397

Query  891   LKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFF  712
             LKEH + I+ +LRK WADL K+YL EAKWY  GY P+ +EYI NA I+IS PL L H +F
Sbjct  398   LKEHDLNIISYLRKAWADLSKSYLVEAKWYHEGYMPSLQEYINNAMISISGPLTLVHAYF  457

Query  711   YVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKV  532
             ++ N   + A L CL  + +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM E   
Sbjct  458   FITNPMTEEA-LGCLERFRDIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSA  516

Query  531   SANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINN  352
             S ++AR +I   ++E WKKMN+      SPFS TFI +AM+I RMAQC+Y + DG+G+ +
Sbjct  517   SEDDARKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQD  575

Query  351   FETQTRIQTLLFE  313
              ET+  ++TL  E
Sbjct  576   RETKDHVKTLFIE  588



>sp|B3TPQ7.1|ATESY_MAGGA RecName: Full=Alpha-terpineol synthase, chloroplastic; Short=Mg17; 
Flags: Precursor [Magnolia grandiflora]
 gb|ACC66282.1| alpha-terpineol synthase [Magnolia grandiflora]
Length=592

 Score =   494 bits (1271),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 268/590 (45%), Positives = 382/590 (65%), Gaps = 36/590 (6%)
 Frame = -3

Query  2022  C*MAIMAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTT----TRRSANYGPPTWDYSYI  1855
             C  + +A +       + PS   + A  + R C  T  T     RRSANY P  WDY  +
Sbjct  12    CSPSSLAPLQPVLVLVRPPS--GAKARRNLRCCASTQVTELMTARRSANYHPNIWDYDSV  69

Query  1854  QSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             QSL T+ Y A  ++ R ++LKE V+  L+ E +  ++++E++D + RLG  YHF++EI E
Sbjct  70    QSL-TSDYKAYTYLERVEKLKEDVRRTLQ-EAVGLLDQLELVDCIHRLGVGYHFDKEIKE  127

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNAS  1495
              L  I  +            + DLYA AL FR+LRQ+G+ + Q VF+ FMD     F AS
Sbjct  128   ILKTISTEPNNMGLI-----DGDLYAMALYFRLLRQHGYEVPQGVFNRFMDDS-SSFKAS  181

Query  1494  LSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---------------HELKMPLH  1360
             L  D KG+L+LYE+S+L++EGET L+ A+ F+ +HL+               H L++PLH
Sbjct  182   LCNDVKGMLSLYEASYLALEGETTLDEAKAFTYRHLRGLKGNIDSNLKGLVEHALELPLH  241

Query  1359  WRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAE  1180
             WR+ RLEAR +I++Y++ +    N +LLELAKLDFNIVQ V+   ++ +S WWK   + +
Sbjct  242   WRVLRLEARWYIDTYERMEDM--NPLLLELAKLDFNIVQNVYQGQVRKMSGWWKDLGLGQ  299

Query  1179  RLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTD  1000
             +L FARDR++E FLWTIG+   P++  CR +  K+   I  +DD+YD+YG+L+EL+LFT 
Sbjct  300   KLGFARDRLMEGFLWTIGVKFEPQFAQCREVLTKINQLITTIDDVYDVYGSLEELELFTK  359

Query  999   TIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYL  820
              ++RWD    +E LP+YM+ C+LAL N VNEIAYD LKE GV ++ +L+K WADLCKAYL
Sbjct  360   AVDRWD-TNAMEELPEYMKICFLALYNTVNEIAYDTLKEQGVDVIPYLQKSWADLCKAYL  418

Query  819   QEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirl  640
              EA+WY SGYTPT +EY+ NAWI+I+ P+IL H +  +  +    A+LDC+  Y  I++ 
Sbjct  419   VEARWYYSGYTPTLDEYLNNAWISIAGPVILVHAYVSMIQMITKEALLDCVGSYESIMQW  478

Query  639   ssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNK-V  463
             SS+ILRLA+D  TS  E++RGDVPK+IQCYM E   S   AR+ +   ++++WKKMNK V
Sbjct  479   SSMILRLADDLATSTDELERGDVPKSIQCYMHENTASEVVAREQMRARISDIWKKMNKDV  538

Query  462   GIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              +   SP    F   A+N+ARMAQCMYQHGDGHG  + E++  I +L+ E
Sbjct  539   AL---SPLPQPFKAAAVNLARMAQCMYQHGDGHGNPHRESKDHILSLVVE  585



>ref|XP_006351844.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=590

 Score =   494 bits (1271),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 271/557 (49%), Positives = 370/557 (66%), Gaps = 42/557 (8%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD---MLKNEEMREVE-KME  1735
             RR+ NY PP WD+ +IQSL+   Y  + ++ R + LKE +K    ++    + E++ K+E
Sbjct  42    RRTGNYQPPIWDFQFIQSLHNP-YVGDKYMNRFNNLKEEMKKNLMLMVEGSIEELDVKLE  100

Query  1734  MIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             +ID L+RLG SYHF++EIM+ L  I+ +         ++ +  LY+TAL+FR+LRQ+GF+
Sbjct  101   LIDNLERLGVSYHFKDEIMQILKSIHDQI--------SSTDNSLYSTALKFRLLRQHGFH  152

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETN--LELARDFSAKHLK-  1384
             ISQD+ + F D ++  F  SL ED KGLL LYE+S LS E ET+  LE A  F+  HLK 
Sbjct  153   ISQDILNDFKD-EQGNFKQSLCEDIKGLLQLYEASILSTESETSTLLESANTFATSHLKN  211

Query  1383  -------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKL  1261
                                H L++PLH +M R+E R +I+ Y+K    + N +LLELAKL
Sbjct  212   YLHNLNGDHPDNPTVEQVRHALELPLHCKMLRVETRWYIDIYEK--IPNANPLLLELAKL  269

Query  1260  DFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNP-KYVNCRIMG  1084
             DFNIVQA   +DLK++SRWWK S++AE+L F RDR+VE+FLW  G+   P K   CR M 
Sbjct  270   DFNIVQATDQQDLKNLSRWWKTSWLAEKLPFTRDRIVESFLWIAGMMFEPQKNEYCRTML  329

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
              K+ + +  +DDIYD+YGTLDEL++FT  ++R D V  V+ LPDYM+ CYLAL N   EI
Sbjct  330   TKVIAMVTVIDDIYDVYGTLDELEIFTHAVQRMD-VKAVDQLPDYMKVCYLALFNTFTEI  388

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
             AY++LKE G+ ++ ++ K WADLC++YL+EA+WY +GY P+ EEY+EN WI+I  P++L 
Sbjct  389   AYEVLKEQGINVMPYVTKSWADLCESYLREARWYHNGYKPSLEEYMENGWISIGGPVVLV  448

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMD  544
             H  F V N     A LD LT+YP+IIR SS ++RLA+D GTS  EM+RGDVPK+IQCYM+
Sbjct  449   HTLFLVTNPITKEA-LDSLTNYPDIIRWSSTVIRLADDLGTSSDEMERGDVPKSIQCYMN  507

Query  543   EAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGH  364
             E  VS  +AR  I+L + E WK MN V     S FS TFI  A+N AR +Q +YQHGDG+
Sbjct  508   EKDVSEEDARKHINLLIKETWKLMNTVQ-NNNSLFSETFIGCAVNGARTSQTIYQHGDGY  566

Query  363   GINNFETQTRIQTLLFE  313
             GI N  T+ RI  L FE
Sbjct  567   GIQNSHTKNRICKLFFE  583



>emb|CAN64943.1| hypothetical protein VITISV_001721 [Vitis vinifera]
Length=593

 Score =   494 bits (1271),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 270/553 (49%), Positives = 365/553 (66%), Gaps = 29/553 (5%)
 Frame = -3

Query  1920  HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
              T    RR+A+Y P  WD+ YI+SL T+ Y  E +  + ++LK  VK ML  +    + +
Sbjct  48    QTAVIVRRTASYQPSIWDHDYIRSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQ  105

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G
Sbjct  106   LELIDTLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHG  161

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +++ QDVF  F++ K    N  L+ED KG+L LYE+S+LS+ GE  LE ARDF+   L+ 
Sbjct  162   YHVPQDVFHIFIN-KMGTVNPWLNEDIKGILCLYEASYLSVXGENILEEARDFTRNFLEE  220

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N
Sbjct  221   YLERTVDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQ--GMNPILLELAKLDYN  278

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             +VQA + EDLK  S WW+ + + E+ +F+RDR+VENFLW +G    P++  CR M  KL 
Sbjct  279   MVQATYQEDLKHASMWWRSTRLPEKSSFSRDRLVENFLWAVGFIFEPQFGYCRRMLTKLI  338

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDM  892
             S I  +DD+YD+YGTLDEL+LFTD ++RW D   +E LP YM+ C+LAL NF NE AYD+
Sbjct  339   SLITTIDDVYDVYGTLDELELFTDAVDRW-DTNAMEQLPQYMKICFLALYNFTNETAYDV  397

Query  891   LKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFF  712
             LKEH + I+ +LRK WADL K+YL EAKWY  GY P+ +EYI NA I+IS PL L H +F
Sbjct  398   LKEHDLNIISYLRKAWADLSKSYLVEAKWYHEGYMPSLQEYINNAMISISGPLTLVHAYF  457

Query  711   YVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKV  532
             ++ N   + A L CL  + +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM E   
Sbjct  458   FITNPMTEEA-LGCLERFRDIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSA  516

Query  531   SANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINN  352
             S ++AR +I   ++E WKKMN+      SPFS TFI +AM+I RMAQC+Y + DG+G+ +
Sbjct  517   SEDDARKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQD  575

Query  351   FETQTRIQTLLFE  313
              ET+  ++TL  E
Sbjct  576   RETKDHVKTLFIE  588



>ref|XP_010090242.1| Myrcene synthase [Morus notabilis]
 gb|EXB39111.1| Myrcene synthase [Morus notabilis]
Length=591

 Score =   493 bits (1270),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 267/558 (48%), Positives = 365/558 (65%), Gaps = 39/558 (7%)
 Frame = -3

Query  1932  RMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMR  1753
             R+        RRSANY PP W++ ++QSL T  Y  E +  R + LKE V+++L N E  
Sbjct  51    RISNDEKIIARRSANYQPPIWNFDFVQSLQT-QYTRESYAERFENLKEVVREILSNLEDD  109

Query  1752  EVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVL  1573
              + ++E ID L+RLG SYHF+EEI   L +IY           + +  DLYA ALEFR+L
Sbjct  110   PLAQLEHIDMLQRLGISYHFDEEIKCVLEEIYNNN--------SKKNNDLYAIALEFRLL  161

Query  1572  RQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAK  1393
             RQ+G+++ Q+VF+ F D        + S DT  +L+LYE+SF  ++GE+ LE ARD S K
Sbjct  162   RQHGYSMPQEVFNAFRDEM-----GNFSADTVAMLSLYEASFHMIKGESILEEARDLSIK  216

Query  1392  HLK------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELA  1267
              L+                  H L++PLHWRMPRLE+R FI+ Y++      N  LLE A
Sbjct  217   CLEEYIKTNKVQNDVLSLLVSHALELPLHWRMPRLESRWFIDLYERRH--DKNPFLLEFA  274

Query  1266  KLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIM  1087
             KLDFNIVQ+ H EDLK  SRWW+ + + E+L FARDR+VENFLWT+G    P++   R  
Sbjct  275   KLDFNIVQSTHQEDLKHASRWWRNTGL-EKLDFARDRLVENFLWTVGFAYEPQFGYYRRT  333

Query  1086  GAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNE  907
             G ++ +FI  +DDIYD+YGTLDEL+LFT+ +ERWD    ++ LPDYM+ C+LA  N VN+
Sbjct  334   GTEVIAFITLIDDIYDVYGTLDELELFTNAVERWD-TDAMDELPDYMKMCFLAFYNSVND  392

Query  906   IAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLIL  727
             +A+ +LKE G+ I+ +L+K WADLCK +L EAKWY SGYTPTF+EYI+NAWI+IS P+IL
Sbjct  393   MAFHLLKEQGIHIIKYLKKGWADLCKGFLVEAKWYYSGYTPTFQEYIDNAWISISIPMIL  452

Query  726   AHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYM  547
              H + +  N  ++A  L+ L +Y  I R S I+ RL +D GTS  E+KRGDVPK+IQCYM
Sbjct  453   VHAYLFAANPTKEA--LNYLEEYSSIFRHSGILFRLLDDLGTSSNELKRGDVPKSIQCYM  510

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDG  367
              EA+V   +A   I L ++E WK +N+  +   SPFS TFIE+AMN+ R  Q  YQ+GDG
Sbjct  511   YEARVLEEKACQDIKLLIHEKWKHVNEERV-ADSPFSKTFIEIAMNVVRTGQFFYQYGDG  569

Query  366   HGINNFETQTRIQTLLFE  313
             + I + ET+  I +L  +
Sbjct  570   YAIQDRETKEHIVSLFVD  587



>gb|ADR74201.1| (+)-alpha-phellandrene synthase [Vitis vinifera]
Length=593

 Score =   493 bits (1270),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 268/553 (48%), Positives = 364/553 (66%), Gaps = 29/553 (5%)
 Frame = -3

Query  1920  HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
              T    RR+A+Y P  WD+ YI+SL T+ Y  E +  + ++LK  VK ML  +    + +
Sbjct  48    QTAVIVRRTASYQPSIWDHDYIRSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQ  105

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G
Sbjct  106   LELIDTLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHG  161

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +++ QDVF  F++ K       L+ED KG+L LYE+S+LS+EGE  LE ARDF+   L+ 
Sbjct  162   YHVPQDVFHIFIN-KMGTVKPWLNEDIKGILCLYEASYLSVEGENILEEARDFTRNFLEE  220

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N
Sbjct  221   YLERTVDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQ--GMNPILLELAKLDYN  278

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             +VQA + EDLK  S WW+ + + E+ +FARDR+VENFLW +G    P++  CR M  KL 
Sbjct  279   MVQATYQEDLKHASMWWRSTRLPEKSSFARDRLVENFLWAVGFIFEPQFGYCRRMLTKLI  338

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDM  892
             S I  +DD+YD+YGTLDEL+LFTD ++RW D   +E LP YM+ C+LAL NF NE AYD+
Sbjct  339   SLITTIDDVYDVYGTLDELELFTDAVDRW-DTNAMEQLPQYMKICFLALYNFTNETAYDV  397

Query  891   LKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFF  712
             LKEH + I+ +LR  WAD+ K+ L EAKWY  GY P+ +EYI NAWI++S PL L H +F
Sbjct  398   LKEHDLNIISYLRNAWADITKSQLVEAKWYHEGYKPSLQEYINNAWISVSGPLTLVHAYF  457

Query  711   YVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKV  532
             ++ N   + A L CL  + +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM E   
Sbjct  458   FITNPMTEEA-LGCLERFRDIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSA  516

Query  531   SANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINN  352
             S ++AR +I   ++E WKKMN+      SPFS TFI +AM+I RMAQC+Y + DG+G+ +
Sbjct  517   SEDDARKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQD  575

Query  351   FETQTRIQTLLFE  313
              ET+  ++TL  E
Sbjct  576   RETKDHVKTLFIE  588



>ref|XP_002267453.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=594

 Score =   493 bits (1270),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 272/549 (50%), Positives = 365/549 (66%), Gaps = 30/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+A+Y P  WD+ YIQSL T+ Y  E +  + ++LK  VK ML  +    + ++E+ID
Sbjct  53    VRRTASYQPSIWDHDYIQSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQLELID  110

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G+++ Q
Sbjct  111   TLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHGYHVPQ  166

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
              VF  F++ K       L+ED KG+L LYE+S+LS+EGE  LE ARDF+   L+      
Sbjct  167   GVFHIFIN-KIGTVKPWLNEDIKGILCLYEASYLSVEGENILEEARDFTRNFLEEYLERT  225

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N+VQA 
Sbjct  226   VDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQGM--NPILLELAKLDYNMVQAT  283

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             + EDLK  S WW  + + E+ +FARDR+VENFLW +G    P++  CR M  KL S I  
Sbjct  284   YQEDLKHASMWWTSTRLPEKSSFARDRLVENFLWAVGFIFEPQFGYCRRMLTKLISLITT  343

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFTD ++RW D+  +E LP YM+ C+LAL NF NE AYD+LKEH 
Sbjct  344   IDDVYDVYGTLDELELFTDAVDRW-DINAMEQLPQYMKICFLALYNFTNETAYDVLKEHD  402

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
             + I+ +LRK WADL K+YL EAKWY  GY P+ +EYI NAWI+IS PL L H +F++ N 
Sbjct  403   LNIISYLRKAWADLSKSYLVEAKWYHEGYMPSLQEYINNAWISISGPLTLVHAYFFITNP  462

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
               + A L CL  + +IIR SS+I RL++D GTS  E+KRGDVPK+IQCYM E   S ++A
Sbjct  463   MTEEA-LGCLERFSDIIRWSSMIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDA  521

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMY-QHGDGHGINNFETQ  340
             R +I   ++E WKKMN+      SPFS TFI +AM+I RMAQCMY  + DG+G+ + ET+
Sbjct  522   RKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCMYLYYRDGYGVQDRETK  580

Query  339   TRIQTLLFE  313
               ++TL  E
Sbjct  581   DHVKTLFIE  589



>gb|AID55338.1| terpene synthase [Actinidia arguta]
Length=604

 Score =   492 bits (1267),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 274/582 (47%), Positives = 374/582 (64%), Gaps = 37/582 (6%)
 Frame = -3

Query  1989  TFTTCKLPSIHRSHASSSFRMCYHTTTTT------RRSANYGPPTWDYSYIQSLNTTHYA  1828
             ++    LP+  R H  + FR        T      RRSA Y P  WDY+Y+QSL ++ YA
Sbjct  27    SYAQANLPNHRRVHMRT-FRCTISEPFQTNDQKIDRRSAFYQPSIWDYNYVQSL-SSKYA  84

Query  1827  AEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkk  1648
              + +V     LKE VK ML ++ +  ++ + +ID+L+RLG  YHFE+EI   L     + 
Sbjct  85    GDMYVKWAAMLKEDVKRML-DQVVDPLDGLGIIDDLQRLGVFYHFEDEIKRIL-----ES  138

Query  1647  kkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLL  1468
               +  N     ++DL AT+L+FR+LRQ+G+ IS+DVF  F D +   F   L ED +GLL
Sbjct  139   TYNHINEGWNTDEDLQATSLKFRLLRQHGYTISEDVFKNFKD-EIGNFKTCLCEDVEGLL  197

Query  1467  NLYESSFLSMEGETNLELARDFSAKHLK------------------HELKMPLHWRMPRL  1342
              LYE+S+ S+EGE  LE ARDF+ K+LK                  H L++P+HWR+ RL
Sbjct  198   YLYEASYFSLEGERILEEARDFTTKNLKKILKRKDMIDDDLAILVSHALEIPIHWRVQRL  257

Query  1341  EARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFAR  1162
             EAR FI+ Y++    S    LL LAKLDFN+VQA H EDLK +SRWW  + + ++L+FAR
Sbjct  258   EARWFIDMYERRPNLS--PTLLLLAKLDFNMVQATHQEDLKHMSRWWNNTRLGQKLSFAR  315

Query  1161  DRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWD  982
             DR++ENFLWT+G+   P++   R     + S I  +DD+YD+YGTLDEL+ FT+ +ERWD
Sbjct  316   DRLMENFLWTVGMDFKPRFSYFRKNMTIVNSLITIIDDVYDVYGTLDELERFTNAVERWD  375

Query  981   DVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWY  802
              ++++EHLP YM+ C+LAL N +NE+AYD LKE GV ++ +L+KMWADLCK+YL EAKWY
Sbjct  376   -LSEMEHLPAYMKICFLALFNSINEMAYDTLKEQGVHVIPYLQKMWADLCKSYLVEAKWY  434

Query  801   ASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilr  622
              S YTP+FEEY+ NAWI+IS  ++LAH +    NL      L C+  YP +IR S+ ILR
Sbjct  435   YSRYTPSFEEYMNNAWISISASVMLAHAYVLCTNLISYEG-LKCVEKYPNLIRCSATILR  493

Query  621   LANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSP  442
             LA+D  TS  EM+RGD+PK+IQCYM E   S  EAR  +   + E  KKMN+  +E G  
Sbjct  494   LADDLATSTDEMERGDIPKSIQCYMHETGTSEEEARKHMKYLIGEALKKMNEARVEDGPF  553

Query  441   FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             FS  FI V  N+ RM QCMYQ+GDGHG    ET+ R+++LL 
Sbjct  554   FSRAFIGVVENLVRMTQCMYQYGDGHGAQGPETRDRVKSLLI  595



>ref|XP_004150681.1| PREDICTED: myrcene synthase, chloroplastic-like [Cucumis sativus]
Length=600

 Score =   492 bits (1266),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 261/571 (46%), Positives = 373/571 (65%), Gaps = 30/571 (5%)
 Frame = -3

Query  1971  LPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELK  1792
             +P +  +      RMC  + T  RRS NY P TW Y +IQSL ++ +  E +V   +ELK
Sbjct  32    VPRVINNVTGGGARMC--SQTVVRRSGNYQPSTWKYEFIQSL-SSEFEGEIYVGLFNELK  88

Query  1791  ERVKDML-KNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATE  1615
               V+ ++ K      ++++E ID L+RLG SYHFE EI     D+     K+       +
Sbjct  89    GEVRVIMNKIANDDPLKQLEFIDILQRLGISYHFENEIK----DMLTMTYKNHCENDDWK  144

Query  1614  EKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSME  1435
               +LYAT+LEFR+LRQ GFNI QDVF+ F   +   FN  L ED  G+L LYE+SFLS+E
Sbjct  145   INNLYATSLEFRLLRQYGFNIQQDVFNHFFSNETKSFNVQLYEDLNGMLCLYEASFLSIE  204

Query  1434  GETNLELARDFSAKHL----------------KHELKMPLHWRMPRLEARSFIESYDKGK  1303
             GE  LE A+ F+ ++L                +H L++PLHWRMPRLE R FI+ Y++  
Sbjct  205   GENILETAKHFTMEYLEKYMKSSTDENEVAIVRHALELPLHWRMPRLETRWFIDIYER--  262

Query  1302  TTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGL  1123
                 N ILLE AKLDFN VQ +H +DLK  SRWWK S + ++L+FARDR++E+F WT+G+
Sbjct  263   KVDMNPILLEFAKLDFNKVQFIHQQDLKYASRWWKSSGLGQKLSFARDRLIESFFWTVGI  322

Query  1122  TPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMR  943
                P++   R    K+ + I  +DD+YD+YG+LDEL+LFT+ +ERW DV  +E LPDYM+
Sbjct  323   GFEPEFSYFRRSLTKINALITIIDDVYDVYGSLDELELFTNAVERW-DVAAMEELPDYMK  381

Query  942   FCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIE  763
              C+LAL+N +NE+ ++ L++ G+ ++ +L+K W DLCK+Y+ EAKWY + Y PT EEY++
Sbjct  382   ICFLALHNSINEMGFEALRDKGINVIQYLKKAWVDLCKSYMLEAKWYHTNYKPTLEEYLD  441

Query  762   NAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMK  583
             NAWI+IS  ++L H + +V   +     ++ L  + ++IR SS ILRLA+D GTS  E++
Sbjct  442   NAWISISGTVLLVHTYVFVT--SSTLENMESLKQHIDMIRWSSTILRLADDLGTSSDELE  499

Query  582   RGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG-SPFSGTFIEVAMNI  406
             RGDVPK+IQCYM++   S + AR++I   ++E WKK+NK  +E   S F   F+E A N+
Sbjct  500   RGDVPKSIQCYMNDTGASESNAREYIRHLIDETWKKLNKTEVENNYSIFPRVFVERAKNL  559

Query  405   ARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             ARMAQCMYQ+GDGHG+   ET+ R+ +LL E
Sbjct  560   ARMAQCMYQYGDGHGMGYQETKDRVMSLLIE  590



>ref|XP_006371106.1| hypothetical protein POPTR_0019s03980g [Populus trichocarpa]
 gb|ERP48903.1| hypothetical protein POPTR_0019s03980g [Populus trichocarpa]
Length=584

 Score =   490 bits (1262),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 276/586 (47%), Positives = 376/586 (64%), Gaps = 38/586 (6%)
 Frame = -3

Query  1995  FSTFTTCKLPS---IHRSHASSSFRMCYHTT----TTTRRSANYGPPTWDYSYIQSLNTT  1837
             FST  T   PS   +    + +S   C   T       RRS NY    W+Y ++QSL T+
Sbjct  10    FSTLPTLASPSRSLVESVSSKNSKGRCMVATGDDDQIVRRSGNYQTSMWEYDFVQSL-TS  68

Query  1836  HYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIy  1657
              Y  E ++ R + LK  ++ ML N   + ++++E+ID L+RLG SYHF +EI   L  ++
Sbjct  69    KYKGEPYIARSEMLKANIRMMLANAS-KPLDQLELIDTLERLGLSYHFVDEIKSTLKSLF  127

Query  1656  mkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTK  1477
              +    +         DLYATALEFR+ RQ G+++ Q+VF+ F D ++  F A + +D K
Sbjct  128   DENHIENTETV----HDLYATALEFRLSRQRGYHVPQEVFNHFKD-EQGNFRAWIHDDLK  182

Query  1476  GLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMP  1348
             G+LNLYE+S+  +EGE  LE ARDF+ K+L+                 H L++PL WRM 
Sbjct  183   GMLNLYEASYFLVEGENILEDARDFTTKNLENYVKKCNTTEYLSELASHALELPLAWRML  242

Query  1347  RLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTF  1168
             RLEA  FI  Y+    T    +LLELAKLDFN+VQAV  EDLK  SRWWK + + E+L F
Sbjct  243   RLEAHWFINLYET--KTDMEPVLLELAKLDFNMVQAVLQEDLKDSSRWWKMTGLGEKLDF  300

Query  1167  ARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIER  988
             ARDR++ENFLW+ G+   P++ NCR M  KL S +  VDDIYD++GTLDEL+LFTD I R
Sbjct  301   ARDRLMENFLWSAGIIFEPQFGNCRRMLTKLNSLVTTVDDIYDVHGTLDELELFTDAIVR  360

Query  987   WDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAK  808
             W D+  ++ LPDYM+ C+ AL N +NE+AYD+L++ GV  L +L+K WADLCK+YL EAK
Sbjct  361   W-DLNFMDVLPDYMKLCFFALFNSINEVAYDILRDQGVDSLPYLKKAWADLCKSYLLEAK  419

Query  807   WYASGYTPTFEEYIENAWITISCPLILAHVFFYV-NNLAEDAAVLDCLTDYPEiirlssi  631
             WY SGYTPT +EY++NAWI+I  PL + H +FY  N  AE+A+      +YP+IIR SS+
Sbjct  420   WYYSGYTPTLQEYLDNAWISIGVPLAIVHAYFYAPNPTAEEASHF--TEEYPDIIRWSSM  477

Query  630   ilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEG  451
             I+RLA+D GTS  E+KRGDV K+IQCYM E + S  EARD I   ++  WKK+N      
Sbjct  478   IVRLADDLGTSSDEIKRGDVSKSIQCYMHETEASEEEARDHIKKLISYAWKKLNASQF-S  536

Query  450   GSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
                 S T I VA+N+ R AQC+YQ+GDGH I + ET+ R+ +LL +
Sbjct  537   NPHISQTIIGVAVNLPRTAQCIYQYGDGHAIEHLETKDRVMSLLIK  582



>ref|XP_007048226.1| Myrcene synthase, chloroplastic, putative isoform 1 [Theobroma 
cacao]
 gb|EOX92383.1| Myrcene synthase, chloroplastic, putative isoform 1 [Theobroma 
cacao]
Length=633

 Score =   492 bits (1266),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 269/583 (46%), Positives = 372/583 (64%), Gaps = 68/583 (12%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+ANY PP W + YIQSL +  +  E    R  +L   V+ ML +  +  +EK+E++D
Sbjct  51    ARRTANYHPPIWTHDYIQSLQSD-FVGESCDERAMKLVAEVRTML-DRVLDPLEKLELVD  108

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYH+E +    L  +  ++          ++ +LYATALEFR+LRQ+G+ ++ 
Sbjct  109   TLQRLGLSYHYENDTKRILESVNAEESNV-----VWKKGNLYATALEFRLLRQHGYKVTP  163

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             +VF  FMD +   F A L ED KGLLNLYE+S+  +EGE+ LE ARDF+AKHLK      
Sbjct  164   EVFSSFMD-EMGNFKAGLCEDCKGLLNLYEASYHLVEGESILENARDFAAKHLKQCLKQN  222

Query  1383  ----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                       H L++PLHWR+ RLEAR FI+ Y++ +      ILLELAKLDFNIVQAVH
Sbjct  223   KDEYQFMLVEHALELPLHWRIERLEARWFIDVYERREDKI--PILLELAKLDFNIVQAVH  280

Query  1233  LEDLKSVSR--------------------------------------WWKKSYIAERLTF  1168
              +DL+  S                                       WW    + E+LTF
Sbjct  281   QDDLRYASNYAQQHDKMNYHLARGHQNNFLLSTANFAKKIANLKKSGWWTDLGLGEKLTF  340

Query  1167  ARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIER  988
             ARDR++ NFLWT+G+  +P++ + R    K+ + I  +DD+YD+YGTLDEL+LFT+ +ER
Sbjct  341   ARDRLMGNFLWTVGVASDPQFGHARRTLTKINALITIIDDVYDVYGTLDELELFTEAVER  400

Query  987   WDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAK  808
             W DV  +E LP+YM+ C+LAL N +NE+A+D +KE G   +  L++MWADLCKAYL EAK
Sbjct  401   W-DVNAMELLPEYMKICFLALYNSINEMAFDTIKEQGFDSIPFLKEMWADLCKAYLVEAK  459

Query  807   WYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssii  628
             WY  GYTPT +EYI+NAWI+IS P+IL+H +F  N++ ++   L+CL ++ +++  +S+I
Sbjct  460   WYYGGYTPTLKEYIDNAWISISAPVILSHAYFLTNSIRKEC--LECLKEHSQVVYCTSMI  517

Query  627   lrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG  448
             LRL ND  TS  E++RGDVPK+IQCYM E   S  EAR +I   ++  WK MN+  I   
Sbjct  518   LRLVNDLETSSDELERGDVPKSIQCYMHETGFSKEEARHYIRNLIDATWKMMNENRI-AQ  576

Query  447   SPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
             SPFS TFI++A+N+ARMAQCMYQ+GDGHGI   ET  R+ +LL
Sbjct  577   SPFSQTFIQIALNLARMAQCMYQYGDGHGIEVNETNNRVLSLL  619



>gb|EYU43517.1| hypothetical protein MIMGU_mgv1a020175mg, partial [Erythranthe 
guttata]
Length=531

 Score =   488 bits (1256),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 267/563 (47%), Positives = 364/563 (65%), Gaps = 63/563 (11%)
 Frame = -3

Query  1926  CYHT---TTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEM  1756
             C HT   TT  RRS NY PP W + ++QSL + +                          
Sbjct  3     CDHTRLLTTVNRRSGNYEPPVWGFDFVQSLTSKY--------------------------  36

Query  1755  REVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRV  1576
                +K+E+ID L+RLG SYHFEE+I + L  +Y    K         ++DLY+ AL FR+
Sbjct  37    ---KKLELIDNLQRLGISYHFEEQIHQILSCLYNDGNKYYY------QRDLYSAALGFRL  87

Query  1575  LRQNGFNISQDVFDGFMDGKRCGFNASLSE--DTKGLLNLYESSFLSMEGETNLELARDF  1402
             LRQ+GF++SQDVF+ F +     F ASL +  +T+GLL LYE+SFL   GE+ LE+AR+F
Sbjct  88    LRQHGFSVSQDVFNSFKNESGDSFKASLGDNINTEGLLQLYEASFLMRRGESTLEVAREF  147

Query  1401  SAKHL------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILL  1276
             +A  L                  +H L++P+HWR+ R  AR FI+ +   K    N  +L
Sbjct  148   AANLLRKKLDRVDDEDVLLLMAVRHALELPIHWRVQRPNARWFIKQF-YAKKPDMNPTML  206

Query  1275  ELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNC  1096
             ELAKLDFNIVQA H ++LK +S WW+++ +A+ L FARDR++EN+LWTIG    P+Y   
Sbjct  207   ELAKLDFNIVQAKHQKELKHLSSWWEETGLAKILPFARDRLIENYLWTIGGLFEPQYGYS  266

Query  1095  RIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNF  916
             RIM  K+  FI  +DDI+D+YGTL+EL++F D I+RW D+  ++ LP YM+ C+LALNNF
Sbjct  267   RIMATKVNVFITIIDDIFDVYGTLEELEIFNDVIQRW-DIEGIDKLPHYMQMCFLALNNF  325

Query  915   VNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCP  736
             V+E++Y++LK+    ++ HLRK WADLC AYL EAKWY+ GYTPT EEYI NAWI+IS P
Sbjct  326   VDELSYNVLKQQRFLVIPHLRKSWADLCMAYLLEAKWYSKGYTPTLEEYINNAWISISAP  385

Query  735   LILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQ  556
             +IL+H FF V N     AV   L +Y  I+R S++ILRLAND GTSP EMKRGDVPK+I+
Sbjct  386   VILSHAFFLVTNPINKEAV-RSLYEYHNIVRFSAMILRLANDLGTSPDEMKRGDVPKSIE  444

Query  555   CYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP-FSGTFIEVAMNIARMAQCMY  382
             CYM+E+ V   EA +++   +NE WK+MN ++ +   SP F   F+  A+++ RMAQ MY
Sbjct  445   CYMNESGVGREEAEEYVRCLINETWKEMNEELRVITDSPLFERDFVRSAVDLGRMAQYMY  504

Query  381   QHGDGHGINNFETQTRIQTLLFE  313
             QHGDGHGI   + + RI +LLFE
Sbjct  505   QHGDGHGIQFPQMKERIISLLFE  527



>ref|XP_010645660.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=597

 Score =   490 bits (1261),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 274/557 (49%), Positives = 370/557 (66%), Gaps = 33/557 (6%)
 Frame = -3

Query  1920  HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
              T    RR+AN+ P  WDY YIQSL T+ Y  + +  + ++LK  VK ML   E + + +
Sbjct  48    QTAVIVRRTANFQPSIWDYDYIQSL-TSDYVGQTYTRQLEKLKGDVKMMLGEAE-KLLHQ  105

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G
Sbjct  106   LELIDTLQRLGIHYHFGEEIRRILHGIYNNYNRND----TWKNGDLYATALEFRLLRQHG  161

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +++ QDVF  F++ K       L+ED KG+L LYE+S+LS+EGE  LE ARD +   L+ 
Sbjct  162   YHVPQDVFHIFIN-KMGTVKPWLNEDIKGILCLYEASYLSVEGENILEEARDVTRNSLEE  220

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H +++PLHWRMPRLEAR FI++Y++ +    N ILLELAKLD+N
Sbjct  221   YLKRTVDQNDLTMIINHAMELPLHWRMPRLEARWFIDAYERSQ--GMNPILLELAKLDYN  278

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             +VQA + EDLK  S WW+ + + E+L+F RDR+VENFLWT+G    P++  CR +  ++ 
Sbjct  279   MVQATYQEDLKHASMWWRSAVLPEKLSFVRDRLVENFLWTVGFVFEPQFGYCRRILTRVN  338

Query  1071  SFICAVDDIYDIY---GTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIA  901
             S I  +DD+YD+Y   GTLDEL+LFTD ++RWD +  +E LP YM+ C+LAL NF +E+A
Sbjct  339   SLITTIDDVYDVYDVYGTLDELELFTDAVDRWD-INAMEQLPRYMKICFLALYNFTSEMA  397

Query  900   YDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAH  721
             YD+LKE G  I+ +LRK WADLCK+YL EAKWY  GY P+ +EY+ NAWI++S P+IL H
Sbjct  398   YDVLKEQGFHIIPYLRKAWADLCKSYLVEAKWYHEGYMPSLQEYMNNAWISMSSPVILVH  457

Query  720   VFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
              +F + N     A L C   Y +IIR SSII R ++D GTS  E+KRGD PK+IQCYM E
Sbjct  458   AYFSITNPVTKEA-LGCFERYHDIIRWSSIIFRFSDDLGTSSGELKRGDAPKSIQCYMHE  516

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVA-MNIARMAQCMYQHGDGH  364
                S ++AR +I   ++E WKKMN+      SPF  TFI +A MN+ARMAQCMYQ+GDG+
Sbjct  517   TGASEDDARKYIGFLIDETWKKMNE-DRNLNSPFPQTFIGIALMNVARMAQCMYQYGDGY  575

Query  363   GINNFETQTRIQTLLFE  313
             G+ + ET+ RI TL  E
Sbjct  576   GVQDRETKDRIMTLFIE  592



>ref|XP_004161822.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=600

 Score =   490 bits (1262),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 262/571 (46%), Positives = 373/571 (65%), Gaps = 30/571 (5%)
 Frame = -3

Query  1971  LPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELK  1792
             +P +  +      RMC  + T  RRS NY P TW Y +IQSL ++ +  E +V   +ELK
Sbjct  32    VPRVINNVTGGGARMC--SQTVVRRSGNYQPSTWKYEFIQSL-SSEFEGEIYVGLFNELK  88

Query  1791  ERVKDML-KNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATE  1615
               V+ ++ K      ++++E ID L+RLG SYHFE EI     D+     K+       +
Sbjct  89    GEVRVIMNKIANDDPLKQLEFIDILQRLGISYHFENEIK----DMLTMTYKNHCENDDWK  144

Query  1614  EKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSME  1435
               +LYAT+LEFR+LRQ GFNI QDVF+ F   +   FN  L ED  G+L LYE+SFLS+E
Sbjct  145   INNLYATSLEFRLLRQYGFNIQQDVFNHFFSNETKSFNVQLYEDLNGMLCLYEASFLSIE  204

Query  1434  GETNLELARDFSAKHL----------------KHELKMPLHWRMPRLEARSFIESYDKGK  1303
             GE  LE A+ F+ ++L                +H L++PLHWRMPRLE R FI+ Y++  
Sbjct  205   GENILETAKHFTMEYLEKYMKSSTDENEVAIVRHALELPLHWRMPRLETRWFIDIYER--  262

Query  1302  TTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGL  1123
                 N ILLE AKLDFN VQ +H +DLK  SRWWK S + ++L+FARDR++E+F WT+G+
Sbjct  263   KVDMNPILLEFAKLDFNKVQFIHQQDLKYASRWWKSSGLGQKLSFARDRLMESFFWTVGI  322

Query  1122  TPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMR  943
                P++   R    K+ + I  +DD+YD+YG+LDEL+LFT+ +ERW DV  +E LPDYM+
Sbjct  323   GFEPEFSYFRRSLTKINALITIIDDVYDVYGSLDELELFTNAVERW-DVAAMEELPDYMK  381

Query  942   FCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIE  763
              C+LAL+N +NE+ ++ L++ G+ ++ +L+K W DLCK+Y+ EAKWY + Y PT EEY++
Sbjct  382   ICFLALHNSINEMGFEALRDKGINVIQYLKKAWVDLCKSYMLEAKWYHTSYKPTLEEYLD  441

Query  762   NAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMK  583
             NAWI+IS  ++L H + +V +   +   ++ L  Y ++IR SS ILRLA+D GTS  E++
Sbjct  442   NAWISISGTVLLLHTYVFVTSPTLEN--MESLKQYIDMIRWSSTILRLADDLGTSSDELE  499

Query  582   RGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG-SPFSGTFIEVAMNI  406
             RGDVPK+IQCYM++   S + AR+ I   ++E WKK+NK  +E   S F   F+E A N+
Sbjct  500   RGDVPKSIQCYMNDTGASESNAREHIRHLIDETWKKLNKTEVENNYSIFPRVFVERAKNL  559

Query  405   ARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             ARMAQCMYQ+GDGHG+   ET+ R+ +LL E
Sbjct  560   ARMAQCMYQYGDGHGMGYQETKDRVMSLLIE  590



>ref|XP_010109851.1| Myrcene synthase [Morus notabilis]
 gb|EXC24794.1| Myrcene synthase [Morus notabilis]
Length=584

 Score =   489 bits (1260),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 267/573 (47%), Positives = 361/573 (63%), Gaps = 35/573 (6%)
 Frame = -3

Query  2004  AKMFSTFTTCKLPSIHRSHASSSFRMCYHTT---------TTTRRSANYGPPTWDYSYIQ  1852
             A  F T +  +L S  R  ASS  +     +            RRSANY PP W + Y+Q
Sbjct  30    AAPFPTSSIQRLRSTTRVLASSRVQCVADNSKQVSNINGENIARRSANYQPPLWKFDYVQ  89

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEA  1672
             SL T +     +  R + LK+  +++LK  E   + ++E ID L+RLG SYHFE EI   
Sbjct  90    SLGTQYTKESLYAERVENLKDEEREILKTLEGDHIAQLEHIDILQRLGISYHFEAEIQSV  149

Query  1671  LMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASL  1492
             L +IY           + +  +LYATALEFR+LRQ+G+ I Q+VF+ F D K   F+   
Sbjct  150   LEEIYTNYNNMY----SKKNMNLYATALEFRILRQHGYQIPQEVFNAFRDEKTGKFSTD-  204

Query  1491  SEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELKMPLHWRMPRLEARSFIESYD  1312
                   +L+LYE+SF  +E               + H L++PLHWR PRLE+R FI+ Y+
Sbjct  205   DHTMAAMLSLYEASFHMVE---------------VSHALELPLHWRTPRLESRWFIDMYE  249

Query  1311  KGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWT  1132
             + +    N  LLELAKLDFNIVQ+ H EDLK   RWW+K+ +  +L FARDR++EN L T
Sbjct  250   RRQDM--NPSLLELAKLDFNIVQSTHQEDLKHAYRWWRKTGLG-KLEFARDRLMENLLLT  306

Query  1131  IGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPD  952
             +G    P++ + R +G K+ +F+  +DDIYD+YGTLDEL+LFTD +ERWD  + ++ LPD
Sbjct  307   LGFAFEPQFSSYRRLGTKVNAFVTLIDDIYDVYGTLDELELFTDAVERWD-TSGMDQLPD  365

Query  951   YMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEE  772
             YMR C+LA +NFVN+ A + LKEHG+  + +L+K WADLCK+YL EAKWY SGYTPTF+E
Sbjct  366   YMRMCFLAFHNFVNDTALEFLKEHGIHYIKYLKKAWADLCKSYLVEAKWYYSGYTPTFQE  425

Query  771   YIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPF  592
             YI+NAWI+ S P+IL +V+ +  N     A L CL +YP IIR S I+ R  ND  TS  
Sbjct  426   YIDNAWISFSVPVILVNVYVFAANPTTKEA-LTCLEEYPSIIRQSGILCRFLNDLETSLD  484

Query  591   EMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAM  412
             E+KRGDVPK+IQCYM EA VS  +AR  I L + E WKK+N+  +   S FS TF E+A 
Sbjct  485   EIKRGDVPKSIQCYMHEAGVSEEKARQHIKLLIRETWKKINEDRV-ADSSFSKTFTEIAT  543

Query  411   NIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             N+ RMAQ MY HGDG+ I + ET+  + +LL +
Sbjct  544   NVVRMAQSMYLHGDGYAIQDRETKELVMSLLVD  576



>emb|CAN60797.1| hypothetical protein VITISV_016813 [Vitis vinifera]
Length=605

 Score =   489 bits (1260),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 273/559 (49%), Positives = 366/559 (65%), Gaps = 39/559 (7%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RR+A+Y P  WD+ YIQSL T+ Y  E +  + ++LK  VK ML  +    + ++E+ID
Sbjct  53    VRRTASYQPSIWDHDYIQSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQLELID  110

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G+++ Q
Sbjct  111   TLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHGYHVPQ  166

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
              VF  F++ K       L+ED KG+L LYE+S+LS+EGE  LE ARDF+   L+      
Sbjct  167   GVFHIFIN-KIGTVKPWLNEDIKGILCLYEASYLSVEGENILEEARDFTRNFLEEYLERT  225

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N+VQA 
Sbjct  226   VDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQ--GMNPILLELAKLDYNMVQAT  283

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             + EDLK  S WW  + + E+ +FARDR+VENFLW +G    P++  CR M  KL S I  
Sbjct  284   YQEDLKHASMWWTSTRLPEKSSFARDRLVENFLWAVGFIFEPQFGYCRXMLTKLISLITT  343

Query  1056  VDDIYDIYGTLDELQLFTDTIER-WD---------DVTKVEHLPDYMRFCYLALNNFVNE  907
             +DD+YD+YGTLDEL+LFTD ++R WD         D+  +E LP YM+ C+LAL NF NE
Sbjct  344   IDDVYDVYGTLDELELFTDAVDRGWDASFVSTVRWDINAMEQLPQYMKICFLALYNFTNE  403

Query  906   IAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLIL  727
              AYD+LKEH + I+ +LRK WADL K+YL EAKWY  GY P+ +EYI NAWI+IS PL L
Sbjct  404   TAYDVLKEHDLNIISYLRKAWADLSKSYLVEAKWYHEGYMPSLQEYINNAWISISGPLTL  463

Query  726   AHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYM  547
              H +F++ N   + A L CL  + +IIR SS+I RL++D GTS  E+KRGDVPK+IQCYM
Sbjct  464   VHAYFFITNPMTEEA-LGCLERFSDIIRWSSMIFRLSDDLGTSSDELKRGDVPKSIQCYM  522

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMY-QHGD  370
              E   S ++AR +I   ++E WKKMN+      SPFS TFI +AM+I RMAQCMY  + D
Sbjct  523   YETSASEDDARKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCMYLYYRD  581

Query  369   GHGINNFETQTRIQTLLFE  313
             G+G+ + ET+  ++TL  E
Sbjct  582   GYGVQDRETKDHVKTLFIE  600



>emb|CAN82665.1| hypothetical protein VITISV_017009 [Vitis vinifera]
Length=604

 Score =   489 bits (1260),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 270/563 (48%), Positives = 365/563 (65%), Gaps = 38/563 (7%)
 Frame = -3

Query  1920  HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
              T    RR+A+Y P  WD+ YIQSL T+ Y  E +  + ++LK  VK ML  +    + +
Sbjct  48    QTAVIVRRTASYQPSIWDHDYIQSL-TSDYVGETYTRQLEKLKGDVKIML-GQVGEPLHQ  105

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG  YHF EEI   L  IY    ++       +  DLYATALEFR+LRQ+G
Sbjct  106   LELIDTLQRLGIHYHFGEEIKRILHSIYNNYNRND----TWKNGDLYATALEFRLLRQHG  161

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             +++ QDVF  F++ K       L+ED KG+L LYE+S+LS+EGE  LE ARDF+   L+ 
Sbjct  162   YHVPQDVFHIFIN-KMGTVKPWLNEDIKGILCLYEASYLSVEGENILEEARDFTRNFLEE  220

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H +++PLHWRM RLEAR FI+ Y++ +    N ILLELAKLD+N
Sbjct  221   YLERTVDQNDLTAIINHAMELPLHWRMLRLEARWFIDVYERSQ--GMNPILLELAKLDYN  278

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             +VQA + EDLK  S WW+ + + E+ +FARDR+VENFLW +G    P++  CR M  KL 
Sbjct  279   MVQATYQEDLKHASMWWRSTRLPEKSSFARDRLVENFLWAVGFIFEPQFGYCRRMLTKLI  338

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIER-WD---------DVTKVEHLPDYMRFCYLALN  922
             S I  +DD+YD+YGTLDEL+LFTD ++R WD         D   +E LP YM+ C+LAL 
Sbjct  339   SLITTIDDVYDVYGTLDELELFTDAVDRGWDASFVSTVRWDTNAMEQLPQYMKICFLALY  398

Query  921   NFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITIS  742
             NF NE AYD+LKEH + I+ +LR  WAD+ K+ L EAKWY  GY P+ +EYI NAWI++S
Sbjct  399   NFTNETAYDVLKEHDLNIISYLRNAWADITKSQLVEAKWYHEGYKPSLQEYINNAWISVS  458

Query  741   CPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKA  562
              PL L H +F++ N   + A L CL  + +IIR SS I RL++D GTS  E+KRGDVPK+
Sbjct  459   GPLTLVHAYFFITNPMTEEA-LGCLERFRDIIRWSSTIFRLSDDLGTSSDELKRGDVPKS  517

Query  561   IQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMY  382
             IQCYM E   S ++AR +I   ++E WKKMN+      SPFS TFI +AM+I RMAQC+Y
Sbjct  518   IQCYMYETSASEDDARKYIGFLIDETWKKMNEER-NLNSPFSQTFIGMAMDIPRMAQCIY  576

Query  381   QHGDGHGINNFETQTRIQTLLFE  313
              + DG+G+ + ET+  ++TL  E
Sbjct  577   LYRDGYGVQDRETKDHVKTLFIE  599



>gb|AFQ23190.1| alpha-pinene synthase [Gossypium hirsutum]
 gb|AGX84977.1| terpene synthase [Gossypium hirsutum]
Length=595

 Score =   489 bits (1258),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 269/600 (45%), Positives = 378/600 (63%), Gaps = 46/600 (8%)
 Frame = -3

Query  2007  MAKMFSTFTTCKLPSIHRSHASSSFRMCYH---------TTTTT---------RRSANYG  1882
             MA + ++   C  P   +    S+ R  YH         +  TT         RRSA+Y 
Sbjct  1     MASLLTSSPICSFPKQAQWKRFSNNRSSYHILNVFSPSQSEATTEISVENDIVRRSADYH  60

Query  1881  PPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCS  1702
             PP WDY  +QSL   H   E +  R  +LKE V+ M  N  +  +EK+E+ID L+RLG S
Sbjct  61    PPIWDYDSLQSLGLHHVEDELYKERASKLKEEVRMMFDNV-VDPLEKLELIDALQRLGLS  119

Query  1701  YHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMD  1522
             Y+FE+EI + L +I      +     A ++ +LYAT+LEFR+LR++G+ ++QDVF  FMD
Sbjct  120   YYFEDEIRKTLKNISNNLSSNV----AWKKDNLYATSLEFRLLRKHGYEVNQDVFTSFMD  175

Query  1521  GKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK--------------  1384
              K     AS + D KGLLNLYE+S+  +EGET LE AR+ +AK LK              
Sbjct  176   -KDGNIKASFTHDCKGLLNLYEASYHLVEGETMLENARELAAKLLKQCLKQNNDQYLSML  234

Query  1383  --HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVS  1210
               H L++PLHWRM RLEAR FI++Y+K K    N I+LELA LD+NIVQA+H EDL+  S
Sbjct  235   VEHALELPLHWRMLRLEARWFIDAYEKNK--DKNPIILELAILDYNIVQAMHQEDLRYAS  292

Query  1209  RWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYG  1030
              WWK   I ERLTFARDR++ENFLW++G+   P++   R +  K+ + I  +DD+YD+YG
Sbjct  293   GWWKDLGIGERLTFARDRLMENFLWSVGIIGAPQFERGRRIQTKVNALITYIDDVYDVYG  352

Query  1029  TLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRK  850
             T+DEL+LFTD +ERW DV   + LP+YM+ C+ AL++ +N++A+  LKE G+ +L  L+ 
Sbjct  353   TMDELELFTDAVERW-DVNATQKLPNYMKLCFHALHSSINDMAFHTLKEQGIDVLPFLKN  411

Query  849   MWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDC  670
             +WA+LCK+Y+ EA+WY  GY P  +EYI+NAWI+IS P++L H +   N++ ++   L  
Sbjct  412   LWANLCKSYMLEARWYYIGYKPNLQEYIDNAWISISGPVLLGHAYLETNHVTKEG--LQT  469

Query  669   LTDY-PEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEM  493
               +Y P IIR SS +LRLAND  TS +E+KRGD+PK+IQCYM E   S  EAR+ I   +
Sbjct  470   FEEYHPNIIRWSSTVLRLANDLATSSYEIKRGDIPKSIQCYMHETGRSEEEAREHIKKLI  529

Query  492   NELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             +  WK MN+  +   S  S  F E AMN+AR++  +YQ+ DGHGI + E + R   L  +
Sbjct  530   DATWKNMNRDRMAAKSLSSQMFFETAMNLARVSMLVYQNDDGHGIEDGEPKERALRLFIQ  589



>ref|XP_006351730.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=609

 Score =   488 bits (1256),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 276/579 (48%), Positives = 366/579 (63%), Gaps = 42/579 (7%)
 Frame = -3

Query  1968  PSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKE  1789
             P+I  +  SSS  +    T   RRS NY P  W+Y YIQS +  HY  E ++ R +ELKE
Sbjct  39    PNISTNLISSSNGI----TNPIRRSGNYEPTMWNYEYIQSTHN-HYVGEKYMKRFNELKE  93

Query  1788  RVKD---MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKAT  1618
               K    M+ +EE +E+EK+E+ID L+RLG SYHF++EIM+ L  I+ +         A 
Sbjct  94    ETKKNLMMMVHEESQELEKLELIDNLQRLGVSYHFKDEIMQILRSIHDQSSSE-----AM  148

Query  1617  EEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSM  1438
                 LY TAL+FR+LRQ+GF ISQD+ + F D ++  F  SL  DTKGLL LYE+SFLS 
Sbjct  149   SANSLYYTALKFRILRQHGFYISQDILNDFKD-EQGHFKQSLCNDTKGLLQLYEASFLST  207

Query  1437  EGETN--LELARDFSAKHLK--------------------HELKMPLHWRMPRLEARSFI  1324
             + ET+  LE A  F+  HLK                    H L++PLH  M R+E R +I
Sbjct  208   KSETSTLLESANTFAMSHLKNYLHNLNGDYQENWRVELVRHALEVPLHCMMLRVETRWYI  267

Query  1323  ESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVEN  1144
             + Y+K    + N +L+ELAKLDFN VQA+H +DL+++SRWWKKS +AE+L F RDR+VE 
Sbjct  268   DIYEK--IPNANPLLIELAKLDFNFVQAMHQQDLRNLSRWWKKSLLAEKLPFTRDRIVEA  325

Query  1143  FLWTIGLTPNPKYVN-CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKV  967
             F W  G+   PK    CRIM  K+      +DDIYD+YGT+DEL++FT  IER + +  +
Sbjct  326   FQWIAGMMFEPKKKGYCRIMLTKVTPMATVIDDIYDVYGTIDELEIFTHAIERME-IKAM  384

Query  966   EHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYT  787
             + LP YM+ CYLAL N   E AY++LKE G+ ++ +L K WADLCKAYLQEA+WY +GYT
Sbjct  385   DELPCYMKLCYLALFNTSTETAYEVLKEQGINVMPYLTKSWADLCKAYLQEARWYYNGYT  444

Query  786   PTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTD-YPEiirlssiilrLAND  610
             P+ +EY+ENAWI++   +++ + FF V N      +    ++ YP+IIR S+ I+RL +D
Sbjct  445   PSVDEYMENAWISVGSLVMVVNAFFLVTNPITKEVLEYVFSNKYPDIIRWSATIIRLTDD  504

Query  609   KGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGT  430
               TS  EMKRGDVPK+IQCYM E   S  EAR  I+L MNE WK +N       S F   
Sbjct  505   LATSSNEMKRGDVPKSIQCYMKENGASEEEARKHINLMMNETWKMIN-TAQHDNSLFCEK  563

Query  429   FIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             F+  A+N+AR  Q MYQHGDGHGI N E Q RI  L FE
Sbjct  564   FMGCAVNVARTGQTMYQHGDGHGIQNSEIQNRISKLFFE  602



>emb|CCM43928.1| linalool/myrcene synthase [Coffea arabica]
Length=547

 Score =   486 bits (1250),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 270/552 (49%), Positives = 358/552 (65%), Gaps = 42/552 (8%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  ++S    P +WD+  +QSL    YA E ++ R   L         ++EM  V  +E+
Sbjct  13    SPLKQSEKDHPVSWDFKLVQSLRN-EYADERYISRSAML---------DQEMNVVNLLEL  62

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG SYHFE++I   L  IY   K           + LYATALEFR+ RQ+GF +
Sbjct  63    IDNLQRLGLSYHFEDKIRSILSGIYNTIKM-------RNPEGLYATALEFRLRRQHGFYV  115

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              Q++F+ F D +   FN SL ED KGLL LYE+S+L  E E+NLE+AR+F+AKHLK    
Sbjct  116   PQEIFESFKD-ENGDFNHSLCEDLKGLLYLYEASYLEKENESNLEMAREFTAKHLKKILK  174

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++PLHWRM RLEAR FI+ Y+    +  N ILLELAKLDFNIVQ
Sbjct  175   EKRIDQELEALVQHALELPLHWRMMRLEARWFIDIYEA--RSDRNPILLELAKLDFNIVQ  232

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A+H  DL+   RWW  + +AE+L+FARD +VENF WT+G   +P++ N R +  K+ + +
Sbjct  233   AIHQNDLECTLRWWSSTGLAEKLSFARDIMVENFFWTVGTISDPQHGNARRLLTKVAALV  292

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
              A+DD+YD YGT DEL+LFT  +ERWD V  ++ LPDYM+ C+LAL NFVNE+AYD LKE
Sbjct  293   TAIDDVYDQYGTEDELELFTSVVERWD-VNSIDQLPDYMKICFLALFNFVNEMAYDALKE  351

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              GV I+ +LRK WADLCKAYLQEAKW+ SG+ PT ++Y+ NAW +IS PL++ H +F V+
Sbjct  352   EGVNIIPYLRKAWADLCKAYLQEAKWFFSGHIPTLQQYLNNAWTSISAPLVVVHAYFCVD  411

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFE--MKRGDVPKAIQCYMDEAKVS  529
                    V + L    +IIR SS+I+RLAND GTSP    +K  DVPK+IQCY+ E    
Sbjct  412   YPINKDHV-EYLEKCHKIIRCSSMIIRLANDLGTSPESEVLKSADVPKSIQCYVKETGAC  470

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
               +AR+++   + E WK+MN+      SPFS TF   A+N+ARM QCMYQHGDGH   N 
Sbjct  471   EEKAREYLRFLIIEAWKQMNEAQT-VDSPFSSTFKGFAVNVARMGQCMYQHGDGHAHQNS  529

Query  348   ETQTRIQTLLFE  313
             E + RI +LLFE
Sbjct  530   EPRDRILSLLFE  541



>gb|KDP35332.1| hypothetical protein JCGZ_09491 [Jatropha curcas]
Length=511

 Score =   484 bits (1245),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 258/516 (50%), Positives = 348/516 (67%), Gaps = 29/516 (6%)
 Frame = -3

Query  1809  RRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnn  1630
             R ++LKE V+ ML N+ +  ++K+E+ID L+RLG +YHFE+EI   LM IY ++      
Sbjct  5     RINKLKEEVRVML-NQPINTLDKLELIDTLQRLGLAYHFEDEIKRQLMGIYNRRCAD---  60

Query  1629  yKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESS  1450
                +  + L+A ALEFR+LRQ+G+ IS+D F  F+D +   F   L E  +G+L+LYE+S
Sbjct  61    --VSGTEGLHAIALEFRLLRQHGYTISKDFFSNFLD-EMGNFKIHLCESLEGMLSLYEAS  117

Query  1449  FLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLEARSFIE  1321
             FLS E +  L++ARDF+  +L                  H L++PLHWR PRLE R FI+
Sbjct  118   FLSEEDDNILQVARDFTTSYLNNYIKQNNNNKYMSMLITHALELPLHWRPPRLETRWFID  177

Query  1320  SYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENF  1141
              Y++      N++LLELAKLDFN VQA+H EDLKS SRWWK +   E+L+FARDR++EN 
Sbjct  178   VYER--KLGMNSLLLELAKLDFNYVQAIHQEDLKSTSRWWKNTGFGEKLSFARDRIMENL  235

Query  1140  LWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEH  961
             +WTIG+T  P++  CR M  K+ + +  +DD+YD+YGTLDEL+LFTD +ERW DV  ++ 
Sbjct  236   MWTIGMTFEPEFGYCRRMSTKVNALLTTIDDVYDVYGTLDELELFTDAVERW-DVNAMKQ  294

Query  960   LPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPT  781
             LPDYM+ C+L L N +NEIA+D LKE G  I+ +L+K WAD+C AYL EAKWY SGYTPT
Sbjct  295   LPDYMKICFLGLQNSINEIAFDTLKEQGFDIIPYLKKSWADVCNAYLLEAKWYNSGYTPT  354

Query  780   FEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGT  601
              +EY++NAWI+I   ++L H +F       + A L  L +Y  IIR S +I RL +D GT
Sbjct  355   LQEYLDNAWISIGNSVVLIHGYFVSKTPITNDA-LKALNEYHNIIRCSCLIFRLTDDLGT  413

Query  600   SPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIE  421
             S  E+KRGDVPK+IQCYM E   S   AR+ I    +E+WK MNK  +   SPFS TFI 
Sbjct  414   SSDELKRGDVPKSIQCYMHETGASEARAREHIRYLTSEMWKTMNK-ELLVDSPFSKTFIH  472

Query  420   VAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             +A+N ARMA CMYQHGDGHGI + ET  R+ +LL +
Sbjct  473   IAINQARMAHCMYQHGDGHGIEDRETNGRVLSLLVQ  508



>emb|CDP10957.1| unnamed protein product [Coffea canephora]
Length=544

 Score =   484 bits (1247),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 271/552 (49%), Positives = 360/552 (65%), Gaps = 45/552 (8%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  ++S  + P +WD   +QSL    YA E ++ R   LKE VK ML ++EM+ V ++E+
Sbjct  13    SPLKQSEKHHPVSWDLKLVQSLRN-EYADERYISRSAMLKENVKMML-DQEMKVVNQLEL  70

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG SYHFE++I   L  IY   +           + LYATALEFR+LRQ+GF +
Sbjct  71    IDNLQRLGLSYHFEDKIRSILSGIYNTIQM-------RNPEGLYATALEFRLLRQHGFYV  123

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              Q++F+ F D +   F  SL ED KGLL LYE+S+L  E E+NLE+AR+F+AKHLK    
Sbjct  124   PQEIFESFKD-ENGDFKHSLCEDLKGLLYLYEASYLEKENESNLEMAREFTAKHLKEILK  182

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++PLHWRM RLEAR FI+ Y+    +  N ILLELAKLDFNIVQ
Sbjct  183   EKRIDQELEALVQHALELPLHWRMMRLEARWFIDIYEA--RSDRNPILLELAKLDFNIVQ  240

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A+H  DL+S           E+L+FARD +VENF WT+G   +P++   R +  K+ + +
Sbjct  241   AIHQNDLES-----------EKLSFARDIMVENFFWTVGTISDPEHGYARRLLTKVAALV  289

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
              A+DD+YD YGT DEL+LFT  +ERWD V  ++ LPDYM+ C+LAL NF+NE+AYD LKE
Sbjct  290   TAIDDVYDQYGTEDELELFTSVVERWD-VNSIDQLPDYMKICFLALFNFINEMAYDALKE  348

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              GV I+ +LRK WADLCKAYLQEAKW+ SG+ PT ++Y+ NAW +IS PL++ H +F V+
Sbjct  349   EGVNIIPYLRKAWADLCKAYLQEAKWFFSGHIPTLQQYLNNAWTSISAPLVVVHAYFCVD  408

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFE--MKRGDVPKAIQCYMDEAKVS  529
                    V + L    + IR SS+I+RLAND GTSP    +K  DVPK+IQCYM E    
Sbjct  409   YPINKDHV-EYLEKCHKTIRCSSMIIRLANDLGTSPESEVLKSADVPKSIQCYMKETGAC  467

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
               +AR+++   + E WK+MN+      SPFS TF   A+N+ARM QCMYQHGDGHG  N 
Sbjct  468   EEKAREYLRFLIIEAWKQMNEAQT-VDSPFSSTFKGFAVNVARMGQCMYQHGDGHGHQNS  526

Query  348   ETQTRIQTLLFE  313
             E + RI +LLFE
Sbjct  527   EPRDRILSLLFE  538



>gb|ACN42009.1| linalool synthase [Perilla setoyensis]
Length=603

 Score =   486 bits (1252),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 270/552 (49%), Positives = 360/552 (65%), Gaps = 28/552 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRS NY P  WD++Y+QSLNTTHY     + R  EL E+VK ML  EEM  V+++E++
Sbjct  57    TARRSGNYQPSLWDFNYLQSLNTTHYKEVRHLKREAELIEQVK-MLLEEEMEAVQQLELV  115

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkk--kssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             D+LK LG SY FE++I + L  IY + K   S++  +A E +DLY TAL FR+LRQ+GF 
Sbjct  116   DDLKNLGLSYFFEDQIKQILTFIYNEHKCFHSNSIIEAEEIRDLYFTALGFRLLRQHGFQ  175

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---  1384
             ISQ+VFD F + +   F A L +DTKGLL LYE+SFL  EGE  LELAR ++ K L+   
Sbjct  176   ISQEVFDCFKNEEGSDFKARLGDDTKGLLQLYEASFLLREGEDTLELARQYATKFLQKKV  235

Query  1383  ---------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNI  1249
                            H L++PLHWR+ RLEAR F+++Y   +    N I+LELAKLDFNI
Sbjct  236   DHELIDDNNLLSWILHSLEIPLHWRIQRLEARWFLDAYASRRDM--NQIILELAKLDFNI  293

Query  1248  VQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYS  1069
             +QA   E+LK +SRWWK S +AE+L F RDR+VE++ W I L    +Y   R + AK+ +
Sbjct  294   IQATQQEELKDLSRWWKSSCLAEKLPFVRDRLVESYFWAIALFEPHQYGYHRKIAAKIIT  353

Query  1068  FICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDML  889
              I ++DD+YDIYGTLDELQLFTD I+RW D   +  LP YM+  Y+ L NFV  +AYD L
Sbjct  354   LITSLDDVYDIYGTLDELQLFTDAIQRW-DTESISRLPYYMQLFYMVLYNFVPRLAYDGL  412

Query  888   KEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFY  709
             KE G   + +L++ WADL +AYL+EAKWY +GYTP+ EEY+ NA+I+I    +++ VFF 
Sbjct  413   KEKGFITIPYLQRSWADLVEAYLKEAKWYYNGYTPSMEEYLNNAYISIGATPVISQVFFT  472

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
             +   + D  V+D L +Y  I+RLS I++RL +D GTSPFEMKRGDVPKAIQ YM E   +
Sbjct  473   LAT-SIDKPVIDSLYEYHRILRLSGILVRLPDDLGTSPFEMKRGDVPKAIQLYMKERNAT  531

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
               EA++ +   + E WK+MN        PF+   +  A N+ R AQ MY  GDG   N+ 
Sbjct  532   EIEAQEHVRFLIREAWKEMNTATAAVDCPFTDDLVTAAANLGRAAQFMYLDGDG---NHS  588

Query  348   ETQTRIQTLLFE  313
             +   RI  LLFE
Sbjct  589   QLHQRIACLLFE  600



>ref|NP_001233809.1| monoterpene synthase 2 [Solanum lycopersicum]
 gb|AAX69064.1| monoterpene synthase 2 [Solanum lycopersicum]
 gb|AEM05854.1| beta-phellandrene synthase [Solanum lycopersicum]
Length=590

 Score =   484 bits (1247),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 261/558 (47%), Positives = 359/558 (64%), Gaps = 43/558 (8%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD---MLKNEEMREVE-  1744
             TT RRS NY P  WD+ +IQS+N   YA + ++ R DE+K+ +K    M+    + E++ 
Sbjct  45    TTIRRSGNYKPTMWDFQFIQSVNNL-YAGDKYMERFDEVKKEMKKNLMMMVEGLIEELDV  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             K+E+ID L+RLG SYHF+ EIM+ L  ++ +            +  LY+TAL+FR+LRQ+
Sbjct  104   KLELIDNLERLGVSYHFKNEIMQILKSVHQQI--------TCRDNSLYSTALKFRLLRQH  155

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             GF+ISQD+F+ F D        S+  DTKGLL LYE+SFLS E ET L   ++F+  HLK
Sbjct  156   GFHISQDIFNDFKD-MNGNVKQSICNDTKGLLELYEASFLSTECETTL---KNFTEAHLK  211

Query  1383  ----------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLEL  1270
                                   H L++P HW MPRLE R +I  Y++    + N +LLEL
Sbjct  212   NYVYINHSCGDQYNNIMMELVVHALELPRHWMMPRLETRWYISIYER--MPNANPLLLEL  269

Query  1269  AKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRI  1090
             AKLDFNIVQA H +DLKS+SRWWK   +AE+L+F+R+R+VEN  W +G    P++   R 
Sbjct  270   AKLDFNIVQATHQQDLKSLSRWWKNMCLAEKLSFSRNRLVENLFWAVGTNFEPQHSYFRR  329

Query  1089  MGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVN  910
             +  K+  F+  +DDIYD+YG LDEL+LFT  ++RW D   +E LP YM+ CYLAL N  N
Sbjct  330   LITKIIVFVGIIDDIYDVYGKLDELELFTLAVQRW-DTKAMEDLPYYMQVCYLALINTTN  388

Query  909   EIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLI  730
             ++AY++L++H + +L +L K W DLCK+YLQEA+WY +GY P+ EEY++N WI+I+ P++
Sbjct  389   DVAYEVLRKHNINVLPYLTKSWTDLCKSYLQEARWYYNGYKPSLEEYMDNGWISIAVPMV  448

Query  729   LAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCY  550
             LAH  F V +     A L+ LT+YP+IIR S+ I RL +D GTS  E+KRGDVPK+IQCY
Sbjct  449   LAHALFLVTDPITKEA-LESLTNYPDIIRCSATIFRLNDDLGTSSDELKRGDVPKSIQCY  507

Query  549   MDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGD  370
             M+E  VS  EAR+ I   + E WK MN    +  S F  TF+E+A NIA  A CMY  GD
Sbjct  508   MNEKGVSEEEAREHIRFLIKETWKFMNTAHHKEKSLFCETFVEIAKNIATTAHCMYLKGD  567

Query  369   GHGINNFETQTRIQTLLF  316
              HGI N + +  I  +LF
Sbjct  568   SHGIQNTDVKNSISNILF  585



>ref|XP_006351843.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=739

 Score =   489 bits (1260),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 268/556 (48%), Positives = 366/556 (66%), Gaps = 38/556 (7%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD--MLKNEEMREVEKMEMI  1729
             RRS NY PP WD+ +I SL+ + YA + ++ R +ELK+ +K   M+  E  +E+EK+E+I
Sbjct  189   RRSGNYQPPIWDFQFIHSLHNS-YAGDKYMKRFNELKKDLKKNLMVMVEGSQELEKLEVI  247

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D L+RLG SYHF++EI++ L  ++ +         AT +  LY ++L+FR+LRQ+GF++S
Sbjct  248   DNLERLGVSYHFKDEIIQILRSVHDQIST------ATGDNSLYHSSLKFRLLRQHGFHLS  301

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGET--NLELARDFSAKHLK---  1384
             +D+   F D ++  F  SL  DTKGLL LYE+SFLS + ET  +LE A  F+  HLK   
Sbjct  302   EDILKDFKD-EQGNFKQSLCNDTKGLLQLYEASFLSTKSETPTSLESANTFAMSHLKNYL  360

Query  1383  ------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLD  1258
                               H L++PLH +M R+E R +I+ Y+K    + N +LLELAKLD
Sbjct  361   HNLKGDHDQENWRVELVRHALELPLHCKMLRVETRWYIDIYEK--IPNANPLLLELAKLD  418

Query  1257  FNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNP-KYVNCRIMGA  1081
             FNI+QA H +DLK+V+RWWKKS +AE+L F RDR+VE FLW +G+   P K   C  M  
Sbjct  419   FNILQATHQQDLKNVARWWKKSRLAEKLPFTRDRIVEAFLWIVGMMFEPQKNEYCLTMLT  478

Query  1080  KLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIA  901
             K+ S +  +DDIYD+YGTLDEL+LFT  ++R + V  ++ LPDYM+ CYLAL N   EIA
Sbjct  479   KVISMVTVIDDIYDVYGTLDELELFTLAVQRME-VNAIDELPDYMKACYLALFNTTTEIA  537

Query  900   YDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAH  721
             Y++LKE G+ ++ +L K W DLCK+YL+EA+WY SGY P  EEY+EN WI+I+ P++L H
Sbjct  538   YEVLKEQGINVMPYLTKSWGDLCKSYLREARWYHSGYKPNLEEYMENGWISIAAPMVLVH  597

Query  720   VFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
                 V N     A LD LT+Y +IIR S+ I+RL +D GTS  EM+RGDVPK+IQCYM+E
Sbjct  598   ALLLVTNPITKEA-LDSLTNYSDIIRWSATIIRLTDDLGTSSDEMERGDVPKSIQCYMNE  656

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
               VS  +AR  I+L + E WK MN    +  S FS TFI  A+N AR +Q +YQHGDGHG
Sbjct  657   KGVSEEDARIHINLLIKETWKLMNTTVQKDNSLFSETFIGCAVNGARTSQTIYQHGDGHG  716

Query  360   INNFETQTRIQTLLFE  313
             I N   + R   L FE
Sbjct  717   IQNSHIKHRSFQLFFE  732



>gb|AII32476.1| terpene synthase [Populus trichocarpa]
Length=589

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 279/591 (47%), Positives = 382/591 (65%), Gaps = 43/591 (7%)
 Frame = -3

Query  1995  FSTFTTCKLPS--IHRSHASSSFR------MCYHTT----TTTRRSANYGPPTWDYSYIQ  1852
             FST  T   PS  +  S +S + R       C  TT       RRSANY    WDY ++Q
Sbjct  10    FSTLPTLASPSRPLVESVSSKNSRSVPTKGRCKVTTGDDDQIVRRSANYQTSMWDYDFVQ  69

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEA  1672
             SL T+ Y  E ++ R ++LK  ++ ML N   + ++++E+ID L+RLG SYHF +EI   
Sbjct  70    SL-TSKYKGEPYIARSEKLKANIRMMLANAS-KPLDQLELIDTLERLGLSYHFVDEIKSI  127

Query  1671  LMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASL  1492
             L  ++ +    +         DLYATALEFR+LRQ G+++ Q+VF+ F D ++  F A +
Sbjct  128   LKSLFDENHIENTETV----HDLYATALEFRLLRQRGYHVPQEVFNHFKD-EQGNFRACI  182

Query  1491  SEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPL  1363
              +D KG+LNLYE+S+  ++GE  LE ARDF+ K+L+                 H L++PL
Sbjct  183   HDDLKGMLNLYEASYFLVDGENILEDARDFTTKNLENYVKKCNTTEYLSELVSHALELPL  242

Query  1362  HWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIA  1183
              WRM RLEA  FI  Y+    T    +LLELAKLDFN+VQAV+ EDLK  SRWWK + + 
Sbjct  243   AWRMLRLEAHWFINLYET--KTDMEPVLLELAKLDFNMVQAVYQEDLKDSSRWWKMTGLG  300

Query  1182  ERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFT  1003
             E+L FARDR+V   LW++G+   P++ N R M  KL S I  +DD+YD+YGTLDEL+LFT
Sbjct  301   EKLDFARDRLVVYLLWSVGIIFEPQFGNIRRMITKLNSLITTIDDVYDVYGTLDELELFT  360

Query  1002  DTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAY  823
             D + RW D+  ++HLPDYM+ C+ AL N +NEIAYD+L++ GV  L +L+K WADLCK++
Sbjct  361   DAVVRW-DLNFMDHLPDYMKLCFFALFNSINEIAYDILRDQGVDNLPYLKKTWADLCKSH  419

Query  822   LQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiir  643
             L EAKWY SGYTPT +EY++NAWI++  PL + H +FY +N     A    + +YP+IIR
Sbjct  420   LLEAKWYYSGYTPTLQEYLDNAWISVGAPLAIVHAYFYASNPTTKEAS-HFMEEYPDIIR  478

Query  642   lssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKV  463
              SSIILRLA+D GTS  EMKRGDV K+IQCYM E++ S  EARD I   ++  WKK+N  
Sbjct  479   WSSIILRLADDLGTSSDEMKRGDVSKSIQCYMYESEASEEEARDHIRKLISNAWKKIN--  536

Query  462   GIEGGSP-FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
               +   P  S T I V +N+AR AQC+YQ+GDGH I + ET+ R+ +LL +
Sbjct  537   AYQFSDPHISQTIIGVVVNLARAAQCIYQYGDGHAIEHLETKDRVMSLLIK  587



>ref|XP_006484917.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like [Citrus 
sinensis]
Length=602

 Score =   483 bits (1242),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 276/606 (46%), Positives = 378/606 (62%), Gaps = 55/606 (9%)
 Frame = -3

Query  2022  C*MAIMAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTT-------TRRSANYGPPTWDY  1864
             C    ++   S+     +P I R      +RM   TTT         RRSA+YGP  W +
Sbjct  13    CNFTRLSLRLSSNVNGPVPLITRVQ----YRMAASTTTIKPADQSFIRRSADYGPTIWSF  68

Query  1863  SYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEE----MREVEKMEMIDELKRLGCSYH  1696
              YIQSL++  Y  E +  + ++LKE+V+ ML+ ++    +  + ++E+ID L RLG SYH
Sbjct  69    DYIQSLDSK-YNGESYARQLEKLKEQVRAMLQRDDKVVDLDPLHQLELIDNLHRLGVSYH  127

Query  1695  FEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDG  1519
             FE+EI   L  I  K            EK LY  AL+FR+LRQ G++ S ++ F  FMD 
Sbjct  128   FEDEIKRTLERICNK----------NTEKSLYNVALKFRILRQYGYDTSVKETFSCFMDE  177

Query  1518  KRCGFNASLSEDTKGLLNLYESSFLSMEGETNL---------ELARDFSAKH--------  1390
             K    ++S  +D KG+L LYE+++L +EGE+++            ++++AKH        
Sbjct  178   KGSFKSSSHGDDCKGMLALYEAAYLLVEGESSIFRDAISFTTAYLKEWAAKHDNNKHHNE  237

Query  1389  -----LKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLED  1225
                  + H L++PLHWR  RLEAR FI+ Y  G  T  N ILL+LAKLDFNIVQAVH ED
Sbjct  238   YLCTLVNHALELPLHWRTRRLEARWFIDVYQSGPNT--NPILLDLAKLDFNIVQAVHQED  295

Query  1224  LKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDI  1045
             +K  SRWWKK+ + ERL FARDR++ENF WT+G+   P +  CR M   + + I  +DD+
Sbjct  296   IKYASRWWKKTGLGERLNFARDRIMENFFWTVGVIFEPNFGYCRRMSTMVNALITTIDDV  355

Query  1044  YDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FI  868
             YD+YGTLDEL+LFTD +ER  D T +E LPDYM+ C+ AL+N +NE+A+D L++ GV  +
Sbjct  356   YDVYGTLDELELFTDAVER-GDATTIEQLPDYMKLCFHALHNSINEMAFDALRDQGVGMV  414

Query  867   LHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAED  688
             + +L+K WAD+CK YL EAK Y +GY PT +EY+ENAWI+IS P+IL H + Y  N    
Sbjct  415   ISYLKKAWADICKTYLVEAKSYNNGYIPTLQEYMENAWISISAPVILVHAYTYTANPITK  474

Query  687   AAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDF  508
                L+ + DYP IIR SSIILRLA+D GTS  E+KRGDV K+IQCYM EA VS  EAR+ 
Sbjct  475   EG-LEFVKDYPNIIRWSSIILRLADDLGTSLDELKRGDVHKSIQCYMHEAGVSEREAREH  533

Query  507   IDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE-TQTRI  331
             I   + + W KMN          S  F+ +AMN+ARM+QCMYQ GDGHG    E T+ R+
Sbjct  534   IHDLIAQTWMKMNSDQFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGHGVQEITKARV  593

Query  330   QTLLFE  313
              +L+ +
Sbjct  594   LSLIVD  599



>dbj|BAD91045.1| monoterpene synthase [Citrus unshiu]
Length=602

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 272/585 (46%), Positives = 370/585 (63%), Gaps = 47/585 (8%)
 Frame = -3

Query  1971  LPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRD  1801
             +P I R     A+S+  +     T  RRSA+YGP  W   YIQSL++  Y  + +  +  
Sbjct  30    VPPITRVQYPMAASTTTIKPVDQTIIRRSADYGPTIWSVDYIQSLDS-EYKEKSYARQLQ  88

Query  1800  ELKERVKDMLKNE----EMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn  1633
             +LKE+V  ML+ +    ++  + ++E+ID L RLG SYHFE+EI   L  I+        
Sbjct  89    KLKEQVSAMLQQDNKVVDLDPLHQLELIDNLHRLGVSYHFEDEIKRTLDRIHN-------  141

Query  1632  nyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCGFNASLSEDTKGLLNLYE  1456
                    K LYA AL+FR+LRQ G+N   ++ F  FMD K     +S S+D KG+L LYE
Sbjct  142   ---KNTNKSLYARALKFRILRQYGYNTPVKETFSRFMDEKGSFKLSSHSDDCKGMLALYE  198

Query  1455  SSFLSMEGETNL---------ELARDFSAKH-------------LKHELKMPLHWRMPRL  1342
             +++L +E E+++            +++  KH             +KH L++PLHWRM RL
Sbjct  199   AAYLLVEEESSIFRDAIRFTTAYLKEWVVKHDIDKNDDEYLCTLVKHALELPLHWRMRRL  258

Query  1341  EARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFAR  1162
             EAR FI+ Y+ G     N ILL+LAKLDFNIVQAVH ED+K  SRWWKK  + ERL FAR
Sbjct  259   EARWFIDVYESGPDM--NPILLDLAKLDFNIVQAVHQEDIKYASRWWKKIGLGERLNFAR  316

Query  1161  DRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWD  982
             DR++ENF WT+G+   P +  CR M   + + I  +DD+YD+YGTLDEL+LFTD +ERW 
Sbjct  317   DRIMENFFWTVGVIFEPNFGYCRRMSTMVNALITTIDDVYDVYGTLDELELFTDAVERW-  375

Query  981   DVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHLRKMWADLCKAYLQEAKW  805
             D T +E LPDYM+ C+ AL+N +NE+A+D L++ GV  ++ +L+K WAD+CK YL EAKW
Sbjct  376   DATTIEQLPDYMKLCFHALHNSINEMAFDALRDQGVGMVISYLKKAWADICKTYLVEAKW  435

Query  804   YASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiil  625
             Y +GY PT +EY+ENAWI+IS P+IL H + Y  N       L+ + DYP IIR SSIIL
Sbjct  436   YNNGYIPTLQEYMENAWISISAPVILVHAYTYTANPITKEG-LEFVKDYPNIIRWSSIIL  494

Query  624   rLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGS  445
             RLA+D GTS  E+KRGDV K+IQCYM EA VS  EAR+ I   + + W KMN+       
Sbjct  495   RLADDLGTSSDELKRGDVHKSIQCYMHEAGVSEREAREHIHDLIAQTWMKMNRDRFGNPH  554

Query  444   PFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE-TQTRIQTLLFE  313
               S  F+ +AMN+ARM+QCMYQ GDGHG    E T+ R+ +L+ +
Sbjct  555   FVSDVFVGIAMNLARMSQCMYQFGDGHGHGVQEITKARVLSLIVD  599



>gb|AAL38029.1|AF444798_1 linalool synthase [Perilla frutescens var. crispa]
Length=607

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 265/552 (48%), Positives = 359/552 (65%), Gaps = 28/552 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRS NY P  WD++Y+QSLNTT Y     + R  EL E+VK ML  EEM  V+++E++
Sbjct  61    TARRSGNYQPSLWDFNYLQSLNTTQYKEVRHLKREAELIEQVK-MLLEEEMEAVQQLELV  119

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkk--kssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             D+LK LG SY FE++I + L  IY + K   S++  +A E +DLY TAL FR+LRQ+GF 
Sbjct  120   DDLKNLGLSYFFEDQIKQILTFIYNEHKCFHSNSIIEAEEIRDLYFTALGFRLLRQHGFQ  179

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---  1384
             +SQ+VFD F + +   F A L +DTKGLL LYE+SFL  EGE  LELAR ++ K L+   
Sbjct  180   VSQEVFDCFKNEEGSDFKARLGDDTKGLLQLYEASFLLREGEDTLELARQYATKFLQKKV  239

Query  1383  ---------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNI  1249
                            H L++PLHWR+ RLEAR F++ Y   +    N I+LELAKLDFNI
Sbjct  240   DHELIDDNNLLSWILHSLEIPLHWRIQRLEARWFLDRYATRRDM--NQIILELAKLDFNI  297

Query  1248  VQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYS  1069
             +QA   E+LK +SRWWK + +AE+L F RDR+VE++ W I L    +Y   R + AK+ +
Sbjct  298   IQATQQEELKDLSRWWKSTCLAEKLPFVRDRLVESYFWAIALFEPHQYGYHRKVAAKIIT  357

Query  1068  FICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDML  889
              I ++DD+YDIYGTLDELQLFTD I+RW D   +  LP YM+  Y+ L NFV+E+AYD L
Sbjct  358   LITSLDDVYDIYGTLDELQLFTDAIQRW-DTESISRLPYYMQLFYMVLYNFVSELAYDGL  416

Query  888   KEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFY  709
             KE G   + +L++ WADL +AYL+EAKW+ +GY P+ EEY+ NA+I+I    +++ VFF 
Sbjct  417   KEKGFITIPYLQRSWADLVEAYLKEAKWFYNGYVPSMEEYLNNAYISIGATPVISQVFFT  476

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
             +   + D  V+D L +Y  I+RLS +++RL +D GTSPFEMKRGDVPKAIQ YM E   +
Sbjct  477   LAT-SIDKPVIDSLYEYHRILRLSGMLVRLPDDLGTSPFEMKRGDVPKAIQLYMKERNAT  535

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
               EA++ +   + E WK+MN V      PF+   +    N+ R AQ MY  GDG   N+ 
Sbjct  536   EIEAQEHVRFLIREAWKEMNTVTTAADCPFTDDLVAATRNLGRAAQFMYLDGDG---NHS  592

Query  348   ETQTRIQTLLFE  313
             +   RI  LLFE
Sbjct  593   QLHQRIACLLFE  604



>gb|ABD77416.1| limonene synthase [Rosmarinus officinalis]
Length=594

 Score =   481 bits (1238),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 268/550 (49%), Positives = 365/550 (66%), Gaps = 32/550 (6%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             +TRRS NY P  WD+  IQSLN+  Y  E +  R  EL  +VK +L  E    ++ +E+I
Sbjct  56    STRRSGNYKPTLWDFERIQSLNSV-YTEEKYTTRASELVVQVKKLLLLESNWFLQ-LELI  113

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D+L++LG SY F  EI + L  IY+++K  +       E+DLY+TAL FR+LRQ+G  +S
Sbjct  114   DDLQKLGVSYRFNHEINQILNRIYLEQKYCN-----NSERDLYSTALAFRLLRQHGLKVS  168

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL------  1387
             QDVFD F       F  +L ++TKGLL LYE+SFL  EGE +LE AR FS   L      
Sbjct  169   QDVFD-FFKNDEGEFEPNLGDNTKGLLQLYEASFLLTEGEMSLEQARVFSTNLLQKKLDD  227

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +  L++PLHW + R  +R  I++Y     +  N IL+ELAKLDFNIVQA
Sbjct  228   GIMDEYLSSLVRRSLELPLHWSVQRPNSRWLIDAY--TNRSDVNPILIELAKLDFNIVQA  285

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              + E+LK VSRWWK++ +AE+L FARDRVVEN++W +GL   P+Y   RIM  KL+  I 
Sbjct  286   SYHEELKEVSRWWKETELAEKLPFARDRVVENYIWNVGLLFQPQYGYPRIMTTKLFILIT  345

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD++D+YGTL+E +LF   I  W DV  ++ LP+YM+ CY+AL++F+NE+AY +LKE 
Sbjct  346   VIDDVFDVYGTLEETELFKKAILSW-DVEVLDQLPNYMQICYMALDSFINEMAYHVLKEQ  404

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             GV I+  LRK WADLC AY +EA+WY +G+ PT EEYI+ AWI+IS  LILAHVFF + N
Sbjct  405   GVLIIQDLRKFWADLCVAYAKEAEWYHTGHKPTMEEYIDVAWISISAHLILAHVFFLITN  464

Query  699   -LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
              + ++AA  + L +Y +IIR S++ILRLA+D GTS +EM+RGDVPKA++CYM+E   S  
Sbjct  465   PIGKEAA--ESLRNYDDIIRNSAMILRLADDLGTSSYEMQRGDVPKAVECYMNEMGASVE  522

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             EAR+ +   + E W K +    +  SPFS  FI  A ++ R AQ MYQHGDGHGI N + 
Sbjct  523   EAREHVKCMIREAWMKTSAERFK-ESPFSKDFIRSAADLGRHAQYMYQHGDGHGIRNPQM  581

Query  342   QTRIQTLLFE  313
             + RI TL+F+
Sbjct  582   EERISTLIFQ  591



>ref|XP_002325741.2| hypothetical protein POPTR_0019s01270g [Populus trichocarpa]
 gb|EEF00123.2| hypothetical protein POPTR_0019s01270g [Populus trichocarpa]
Length=589

 Score =   481 bits (1237),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 279/591 (47%), Positives = 381/591 (64%), Gaps = 43/591 (7%)
 Frame = -3

Query  1995  FSTFTTCKLPS--IHRSHASSSFR------MCYHTT----TTTRRSANYGPPTWDYSYIQ  1852
             FST  T   PS  +  S +S + R       C  TT       RRSANY    WDY ++Q
Sbjct  10    FSTLPTLASPSRPLVESVSSKNSRSVPTKGRCKVTTGDDDQIVRRSANYQTSMWDYDFVQ  69

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEA  1672
             SL T+ Y  E ++ R ++LK  ++ ML N   + ++++E+ID L+RLG SYHF +EI   
Sbjct  70    SL-TSKYKGEPYIARSEKLKANIRMMLANAS-KPLDQLELIDTLERLGLSYHFVDEIKSI  127

Query  1671  LMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASL  1492
             L  ++ +    +         DLYATALEFR+LRQ G+++ Q+VF+ F D ++  F A +
Sbjct  128   LKSLFDENHIENTETV----HDLYATALEFRLLRQRGYHVPQEVFNHFKD-EQGNFRACI  182

Query  1491  SEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPL  1363
              +D KG+LNLYE+S+  ++GE  LE ARDF+ K+L+                 H L++PL
Sbjct  183   HDDLKGMLNLYEASYFLVDGENILEDARDFTTKNLENYVKKCNTTEYLSELVSHALELPL  242

Query  1362  HWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIA  1183
              WRM RLEA  FI  Y+    T    +LLELAKLDFN+VQAV+ EDLK  SRWWK +   
Sbjct  243   AWRMLRLEAHWFINLYET--KTDMEPVLLELAKLDFNMVQAVYQEDLKDSSRWWKMTGRG  300

Query  1182  ERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFT  1003
             E+L FARDR+V   LW++G+   P++ N R M  KL S I  +DD+YD+YGTLDEL+LFT
Sbjct  301   EKLDFARDRLVVYLLWSVGIIFEPQFGNIRRMITKLNSLITTIDDVYDVYGTLDELELFT  360

Query  1002  DTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAY  823
             D + RWD +  ++HLPDYM+ C+ AL N +NEIAYD+L++ GV  L +L+K WADLCK++
Sbjct  361   DAVVRWD-LNFMDHLPDYMKLCFFALFNSINEIAYDILRDQGVDNLPYLKKTWADLCKSH  419

Query  822   LQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiir  643
             L EAKWY SGYTPT +EY++NAWI++  PL + H +FY +N     A    + +YP+IIR
Sbjct  420   LLEAKWYYSGYTPTLQEYLDNAWISVGAPLAIVHAYFYASNPTTKEAS-HFMEEYPDIIR  478

Query  642   lssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKV  463
              SSIILRLA+D GTS  EMKRGDV K+IQCYM E++ S  EARD I   ++  WKK+N  
Sbjct  479   WSSIILRLADDLGTSSDEMKRGDVSKSIQCYMYESEASEEEARDHIRKLISNAWKKIN--  536

Query  462   GIEGGSP-FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
               +   P  S T I V +N+AR AQC+YQ+GDGH I + ET+ R+ +LL +
Sbjct  537   AYQFSDPHISQTIIGVVVNLARAAQCIYQYGDGHAIEHLETKDRVMSLLIK  587



>ref|XP_007040297.1| Myrcene synthase, chloroplastic, putative [Theobroma cacao]
 gb|EOY24798.1| Myrcene synthase, chloroplastic, putative [Theobroma cacao]
Length=588

 Score =   480 bits (1236),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 264/544 (49%), Positives = 359/544 (66%), Gaps = 30/544 (6%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRSANY    W  +YIQSL +       +  R ++L   V+ ML ++E+  +E++E+ID 
Sbjct  52    RRSANYHLSIWKDNYIQSLKSECLGKSCY-ERANKLVGEVRMML-DKEINPLEQLELIDT  109

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RLG SYHFE EI   L  +            A ++ +LYATA+EFR+LRQ+G+ ++Q+
Sbjct  110   LQRLGLSYHFENEIKTILDSVSADHIDV-----AWKKDNLYATAIEFRLLRQHGYKVTQE  164

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------  1384
             VF  F D K   F ASL ED KGLLNLYE+S+  +EGE  LE ARDF+AK LK       
Sbjct  165   VFSTFTDEK-GNFKASLCEDCKGLLNLYEASYHLVEGENMLEKARDFAAKRLKEYLKQNK  223

Query  1383  ---------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHL  1231
                      H L++PLHWRMPR EAR FI+ Y+  +    N ILLELAKLDFN+VQA H 
Sbjct  224   DPYLSLLVEHALELPLHWRMPRFEARFFIDVYEGRE--DRNPILLELAKLDFNMVQAAHQ  281

Query  1230  EDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVD  1051
             +DLK  S+WW+   I ++LTFARDR +ENFLWT+G   +P++   R +  K+ +FI  +D
Sbjct  282   DDLKYASKWWRDLGIGKKLTFARDRSMENFLWTVGEASDPQFGYFRRIETKINTFIATID  341

Query  1050  DIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVF  871
             D+YD+YGTLDEL+LFT+ ++RW D   ++ LP+YM+ C+LAL NFVNE+A+D+LK+ G  
Sbjct  342   DVYDVYGTLDELELFTEAVDRW-DTNAMQLLPEYMQICFLALYNFVNEMAFDVLKDKGFD  400

Query  870   ILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAE  691
              +  L K WAD+CK++L EAKWY SGYTPT  EYI+NAWI+++ P+IL+H +   N   +
Sbjct  401   TIPFLTKAWADMCKSFLLEAKWYYSGYTPTLREYIDNAWISVTAPVILSHAYVLTN--LK  458

Query  690   DAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARD  511
                  +   +Y  II  SSII RLAND  TS  E+KRGDVPK+IQCYM E   S  EAR 
Sbjct  459   TNECFESFEEYSNIIYCSSIIFRLANDLATSSDELKRGDVPKSIQCYMHETGASEEEARR  518

Query  510   FIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRI  331
              I   ++  W++MN+  I  GS F   FI++A+N+AR AQ MYQH DG+G+ + ET+ R+
Sbjct  519   HIWKLIDATWRRMNEEQI-VGSRFPRPFIQIAVNLARTAQFMYQHHDGYGVEDGETKERV  577

Query  330   QTLL  319
              +L 
Sbjct  578   LSLF  581



>dbj|BAF73933.1| beta-pinene synthase [Citrus jambhiri]
Length=602

 Score =   480 bits (1236),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 273/586 (47%), Positives = 372/586 (63%), Gaps = 49/586 (8%)
 Frame = -3

Query  1971  LPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRD  1801
             +P I R     A+S+  +     T  RRSA+YGP  W + YIQSL++  Y  E +  + +
Sbjct  30    VPPITRVQYHVAASTTPIKPVDQTIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQSE  88

Query  1800  ELKERVKDMLKNEE----MREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn  1633
             +LKE+V  ML+ ++    +  + ++E+ID L RLG SYHFE+EI   L  I+ K      
Sbjct  89    KLKEQVSAMLQQDDKVVDLDPLHQLELIDNLHRLGVSYHFEDEIKRTLDRIHNK------  142

Query  1632  nyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCGFNASLSEDTKGLLNLYE  1456
                    K LYATAL+FR+LRQ+G+N   ++ F  FMD K     +S S+D KG+L LYE
Sbjct  143   ----NTNKSLYATALKFRILRQHGYNTPVKETFSRFMDEKGIFKLSSHSDDCKGMLALYE  198

Query  1455  SSFLSMEGETNL-ELARDFSAKHLK---------------------HELKMPLHWRMPRL  1342
             +++L +E E+++   A  F+  +LK                     H L++PLHWRMPRL
Sbjct  199   AAYLLVEEESSIFRDATSFTTAYLKEWVIKHDNIKHDDEHLCTLVNHALELPLHWRMPRL  258

Query  1341  EARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFAR  1162
             EAR FI+ Y+ G   S   ILLELAK+DFNIVQAVH E+LK  SRWWKK+ + E L F R
Sbjct  259   EARWFIDVYENGPDMS--PILLELAKVDFNIVQAVHQENLKYASRWWKKTGLGENLNFVR  316

Query  1161  DRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWD  982
             DR+VENFLWT+G    P++   R M   + + I AVDD+YD+YGTLDEL++FTD +ERW 
Sbjct  317   DRIVENFLWTVGEKFEPQFGYFRRMSTMVIALITAVDDVYDVYGTLDELEIFTDAVERW-  375

Query  981   DVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHLRKMWADLCKAYLQEAKW  805
             D T VE LP YM+ C+ AL N +NE+ +D L++ GV  ++ +L K WAD+CKAYL EAKW
Sbjct  376   DATAVEQLPHYMKLCFHALRNSINEMTFDALRDQGVDIVISYLTKAWADICKAYLVEAKW  435

Query  804   YASGYTPTFEEYIENAWITISCPLILAHVF-FYVNNLAEDAAVLDCLTDYPEiirlssii  628
             Y SGY P+ +EY+ENAWI+I   +IL H + F  N + ++   L+ + DYP IIR SS+I
Sbjct  436   YNSGYIPSLQEYMENAWISIGSTVILVHAYTFTANPITKEG--LEFVKDYPNIIRWSSVI  493

Query  627   lrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG  448
             LR A+D GTS  E+KRGDV K+IQCYM EA VS  EAR+ I+  + + W KMN+      
Sbjct  494   LRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQTWMKMNRDRFGNP  553

Query  447   SPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE-TQTRIQTLLFE  313
                S  F+ +AMN+ARM+QCMYQ GDGHG    E T+ R+ +L  +
Sbjct  554   HFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEITKARVLSLFID  599



>ref|XP_010645413.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=552

 Score =   478 bits (1230),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 264/555 (48%), Positives = 360/555 (65%), Gaps = 36/555 (6%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTT--------TTRRSANYGPPTWDYS  1861
             +++++ + +  T  +LP I +S +  +                   RR+ANY P  WDY 
Sbjct  3     LSMLSSIPNLITHTRLPIITKSSSCKASPRGIKVKIGNSNCEEIIVRRTANYHPTIWDYD  62

Query  1860  YIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEI  1681
             Y+QSL +  Y  E +  R D+LK  VK ML   + + ++++E+ID L+RLG  YHF++EI
Sbjct  63    YVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVK-KPLDQLELIDVLQRLGIYYHFKDEI  120

Query  1680  MEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFN  1501
                L  IY +  +        ++ DLY TALEFR+LRQ+G+++ QDVF  F D +   F 
Sbjct  121   KRILNSIYNQYNRHEEW----QKDDLYTTALEFRLLRQHGYDVPQDVFSRFKD-ETGSFK  175

Query  1500  ASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----------------KHELKM  1369
             A L ED KGLL LYE+S+L ++GE+ LE ARDF+ +HL                KH L++
Sbjct  176   ACLCEDIKGLLCLYEASYLCVQGESTLEQARDFAHRHLGKGLEQNIDQNLAIEVKHALEL  235

Query  1368  PLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSY  1189
             PLHWRMPRLEAR FI++Y+K +    N ILLE AKLDFN+VQA H EDL+ +S WW  + 
Sbjct  236   PLHWRMPRLEARWFIDAYEKRQDM--NPILLEFAKLDFNMVQATHQEDLRHMSSWWSSTR  293

Query  1188  IAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQL  1009
             + E+L FARDR++ENFLWT+G+   P+Y  CR M  K+ + I  +DD+YD+YGT+DEL+L
Sbjct  294   LGEKLNFARDRLMENFLWTVGVIFEPQYGYCRRMSTKVNTLITIIDDVYDVYGTMDELEL  353

Query  1008  FTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCK  829
             FTD ++RW D+  ++ LP+YM+ C+LAL N  NE+AYD LKEHG+ I+ +LRK W+DLCK
Sbjct  354   FTDVVDRW-DINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGLHIVSYLRKAWSDLCK  412

Query  828   AYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEi  649
             +YL EAKWY S YTP+ +EYI N+WI+IS P+IL H +F V N     A L  L  Y  I
Sbjct  413   SYLLEAKWYYSRYTPSLQEYISNSWISISGPVILVHAYFLVANPITKEA-LQSLERYHNI  471

Query  648   irlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN  469
             IR SS+ILRL++D GTS  E+KRGDVPK+IQCYM E   S  +AR      + E WKK+N
Sbjct  472   IRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHTSYLIGETWKKLN  531

Query  468   KVGIEGGSPFSGTFI  424
             + G    SPF  TFI
Sbjct  532   EDG-AVESPFPETFI  545



>ref|XP_010324138.1| PREDICTED: monoterpene synthase 2 isoform X1 [Solanum lycopersicum]
Length=593

 Score =   479 bits (1233),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 261/561 (47%), Positives = 359/561 (64%), Gaps = 46/561 (8%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD---MLKNEEMREVE-  1744
             TT RRS NY P  WD+ +IQS+N   YA + ++ R DE+K+ +K    M+    + E++ 
Sbjct  45    TTIRRSGNYKPTMWDFQFIQSVNNL-YAGDKYMERFDEVKKEMKKNLMMMVEGLIEELDV  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             K+E+ID L+RLG SYHF+ EIM+ L  ++ +            +  LY+TAL+FR+LRQ+
Sbjct  104   KLELIDNLERLGVSYHFKNEIMQILKSVHQQI--------TCRDNSLYSTALKFRLLRQH  155

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             GF+ISQD+F+ F D        S+  DTKGLL LYE+SFLS E ET L   ++F+  HLK
Sbjct  156   GFHISQDIFNDFKD-MNGNVKQSICNDTKGLLELYEASFLSTECETTL---KNFTEAHLK  211

Query  1383  ----------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLEL  1270
                                   H L++P HW MPRLE R +I  Y++    + N +LLEL
Sbjct  212   NYVYINHSCGDQYNNIMMELVVHALELPRHWMMPRLETRWYISIYER--MPNANPLLLEL  269

Query  1269  AKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRI  1090
             AKLDFNIVQA H +DLKS+SRWWK   +AE+L+F+R+R+VEN  W +G    P++   R 
Sbjct  270   AKLDFNIVQATHQQDLKSLSRWWKNMCLAEKLSFSRNRLVENLFWAVGTNFEPQHSYFRR  329

Query  1089  MGAKLYSFICAVDDIYDIYGTLDELQLFTDTIE---RWDDVTKVEHLPDYMRFCYLALNN  919
             +  K+  F+  +DDIYD+YG LDEL+LFT  ++   RW D   +E LP YM+ CYLAL N
Sbjct  330   LITKIIVFVGIIDDIYDVYGKLDELELFTLAVQSKFRW-DTKAMEDLPYYMQVCYLALIN  388

Query  918   FVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISC  739
               N++AY++L++H + +L +L K W DLCK+YLQEA+WY +GY P+ EEY++N WI+I+ 
Sbjct  389   TTNDVAYEVLRKHNINVLPYLTKSWTDLCKSYLQEARWYYNGYKPSLEEYMDNGWISIAV  448

Query  738   PLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
             P++LAH  F V +     A L+ LT+YP+IIR S+ I RL +D GTS  E+KRGDVPK+I
Sbjct  449   PMVLAHALFLVTDPITKEA-LESLTNYPDIIRCSATIFRLNDDLGTSSDELKRGDVPKSI  507

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             QCYM+E  VS  EAR+ I   + E WK MN    +  S F  TF+E+A NIA  A CMY 
Sbjct  508   QCYMNEKGVSEEEAREHIRFLIKETWKFMNTAHHKEKSLFCETFVEIAKNIATTAHCMYL  567

Query  378   HGDGHGINNFETQTRIQTLLF  316
              GD HGI N + +  I  +LF
Sbjct  568   KGDSHGIQNTDVKNSISNILF  588



>gb|AAM53945.1|AF514288_1 (-)-beta-pinene synthase [Citrus limon]
Length=602

 Score =   479 bits (1232),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 272/586 (46%), Positives = 372/586 (63%), Gaps = 49/586 (8%)
 Frame = -3

Query  1971  LPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRD  1801
             +P I R     A+S+  +     T  RRSA+YGP  W + YIQSL++  Y  E +  + +
Sbjct  30    VPPITRVQYHVAASTTPIKPVDQTIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQLE  88

Query  1800  ELKERVKDMLKNE----EMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn  1633
             +LKE+V  ML+ +    ++  + ++E+ID L RLG SYHFE+EI   L  I+ K      
Sbjct  89    KLKEQVSAMLQQDNKVVDLDTLHQLELIDNLHRLGVSYHFEDEIKRTLDRIHNK------  142

Query  1632  nyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCGFNASLSEDTKGLLNLYE  1456
                    K LYATAL+FR+LRQ G+N   ++ F  FMD K    ++S S+D KG+L LYE
Sbjct  143   ----NTNKSLYATALKFRILRQYGYNTPVKETFSRFMDEKGSFKSSSHSDDCKGMLALYE  198

Query  1455  SSFLSMEGETNL-ELARDFSAKHLK---------------------HELKMPLHWRMPRL  1342
             +++L +E E+++   A+ F+  +LK                     H L++PLHWRMPRL
Sbjct  199   AAYLLVEEESSIFRDAKSFTTAYLKEWVIEHDNNKHDDEHLCTLVNHALELPLHWRMPRL  258

Query  1341  EARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFAR  1162
             EAR FI+ Y+ G     N ILLELAK+DFNIVQAVH E+LK  SRWWKK+ + E L F R
Sbjct  259   EARWFIDVYENGPHM--NPILLELAKVDFNIVQAVHQENLKYASRWWKKTGLGENLNFVR  316

Query  1161  DRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWD  982
             DR+VENF+WT+G    P++   R M   + + I AVDD+YD+YGTL+EL++FTD +ERW 
Sbjct  317   DRIVENFMWTVGEKFEPQFGYFRRMSTMVNALITAVDDVYDVYGTLEELEIFTDAVERW-  375

Query  981   DVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHLRKMWADLCKAYLQEAKW  805
             D T VE LP YM+ C+ AL N +NE+ +D L++ GV  ++ +L K WAD+CKAYL EAKW
Sbjct  376   DATAVEQLPHYMKLCFHALRNSINEMTFDALRDQGVDIVISYLTKAWADICKAYLVEAKW  435

Query  804   YASGYTPTFEEYIENAWITISCPLILAHV-FFYVNNLAEDAAVLDCLTDYPEiirlssii  628
             Y SGY P  +EY+ENAWI+I   +IL H   F  N + ++   L+ + DYP IIR SS+I
Sbjct  436   YNSGYIPPLQEYMENAWISIGATVILVHANTFTANPITKEG--LEFVKDYPNIIRWSSMI  493

Query  627   lrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG  448
             LR A+D GTS  E+KRGDV K+IQCYM EA VS  EAR+ I+  + + W KMN+      
Sbjct  494   LRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQTWMKMNRDRFGNP  553

Query  447   SPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE-TQTRIQTLLFE  313
                S  F+ +AMN+ARM+QCMYQ GDGHG    E T+ R+ +L F+
Sbjct  554   HFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEITKARVLSLFFD  599



>ref|XP_009791411.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=608

 Score =   478 bits (1229),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 278/595 (47%), Positives = 375/595 (63%), Gaps = 51/595 (9%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFRMCYHTTTTT----------RRSANYGPPTWDYSYIQSL  1846
             F +FT  K  +I   H+ +   + + T +T           RRS NY P TWD+ YIQS+
Sbjct  24    FPSFTPGKSSTI-SCHSKAEPPLNHSTISTNQSSSSDLNPIRRSGNYEPTTWDFEYIQSI  82

Query  1845  NTTHYAAEGFVMRRDELKERVKDMLK---NEEMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             +   Y  E ++ R ++LK+ +K+ +    NE   E++K+E+ID L+RLG SYHF +EIM+
Sbjct  83    HN-DYVGEKYIKRFNKLKKEMKEKMMIMINEGSEELDKLELIDNLQRLGVSYHFNDEIMQ  141

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNAS  1495
              L  IY+          A+    LYATAL+FR+LRQ+GF+ISQD+ + F D ++     S
Sbjct  142   ILRSIYLN---------ASSGDSLYATALKFRLLRQHGFHISQDILNDFKD-EQGNLKQS  191

Query  1494  LSEDTKGLLNLYESSFLSMEGE-TNLELARDFSAKHL-------------------KHEL  1375
             L ++ KGLL LYE+SFLS E E T LE A  F+  HL                   +H L
Sbjct  192   LCKNIKGLLQLYEASFLSTETESTFLECANIFAKSHLQNYLNNQIYDEDDVTVTLVRHAL  251

Query  1374  KMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKK  1195
             ++PLHW M R+E R +I  Y+K      N +LLELAKLDFNIVQA H EDL+++SRWWK 
Sbjct  252   ELPLHWMMLRVETRWYINIYEKMPNA--NPLLLELAKLDFNIVQATHQEDLRNLSRWWKN  309

Query  1194  SYIAERLTFARDRVVENFLWTIGLTPNP-KYVNCRIMGAKLYSFICAVDDIYDIYGTLDE  1018
             S +A+RL F RDR+VE FLW  G+   P K   CR +  ++ +    +DDIYD+YGTLDE
Sbjct  310   SCLAQRLPFTRDRIVEAFLWIAGMMFEPQKNQLCRTLLTRVTAMATVIDDIYDVYGTLDE  369

Query  1017  LQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWAD  838
             L+LFT  +ER D +  ++HLPDYM+ CYLAL N + EIAY++LKE G+ I+ +L+K W D
Sbjct  370   LELFTRAVERMD-LKAIDHLPDYMKVCYLALFNTLTEIAYEVLKEQGINIIPYLQKSWGD  428

Query  837   LCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDY  658
             LCKAYLQEA+WY  GY PT EEY++NAWI++   +I+ + FF+V N     A L+ L+ Y
Sbjct  429   LCKAYLQEARWYYKGYIPTLEEYMDNAWISVGSLVIVFNAFFFVTNPITKEA-LEYLSKY  487

Query  657   PEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWK  478
             P+IIR S+ I+RLA+D  T+  EMKRGDV K+IQCYM+E  VS  +AR  I   +NE WK
Sbjct  488   PDIIRWSATIIRLADDLATTSDEMKRGDVAKSIQCYMNEKGVSEEDARKHISSLINETWK  547

Query  477   KMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              +N    E  S FS  FI   +NIAR  Q +YQ+GDGHGI N   + R   L FE
Sbjct  548   LINTAQRE-NSIFSEAFIRCGVNIARTGQSIYQYGDGHGIQNSMIENRNSELFFE  601



>ref|XP_008460927.1| PREDICTED: terpene synthase 10-like isoform X1 [Cucumis melo]
Length=602

 Score =   477 bits (1228),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 257/554 (46%), Positives = 363/554 (66%), Gaps = 28/554 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEM--REVEKME  1735
               RR ANY PP W Y ++QSL T+ +  +  ++RRD L +RVK ML  E +    ++ +E
Sbjct  53    VVRRCANYQPPIWKYEFVQSL-TSEFMDDRCLIRRDMLIKRVKMMLNKEPLVGDSLKGLE  111

Query  1734  MIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             +IDEL+RLG SYHF+ EI + L  I  +        +    + LYAT+L FR+LRQ+G++
Sbjct  112   VIDELQRLGISYHFQMEINQMLEIINERFNNGEEGLEWNNNRSLYATSLHFRILRQHGYH  171

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFS----AKHL  1387
             I QDVF  F +      +    E  KG+L  YE+SFL+M+GE+ ++ AR F+    +K+L
Sbjct  172   IPQDVFKEFKNEIE-NLDCICEEKAKGMLTFYEASFLAMKGESFVDEARQFAIQRLSKYL  230

Query  1386  K-------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
             K             H L++P HWRMPRLEAR FI++  + K  SN  +LL+LAKLDFNIV
Sbjct  231   KSNNNDQIICTMISHALQLPFHWRMPRLEARWFIDNVYRTKPNSN-PVLLDLAKLDFNIV  289

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             Q++H  DLK VSRWWK + + E+L FARDR++ NF W++G+   P     R M  K  S 
Sbjct  290   QSIHQNDLKDVSRWWKSTGLGEKLEFARDRLMANFFWSVGMGCEPHLQYLRTMSTKTASL  349

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I  +DD+YD+YGTLDEL+LFTD +ERW ++  ++ LP+YM+ C++AL+N +N++A+D +K
Sbjct  350   ITIIDDVYDVYGTLDELELFTDAVERW-NIGAIDSLPNYMQICFIALHNTINDMAFDAIK  408

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF-FY  709
              HGV ++ +LRK W DLCK +L EAKWY + Y PTFEEY+ENAWI++S  L+L H + F 
Sbjct  409   NHGVNVIPYLRKTWTDLCKTFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFT  468

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
              N+L  +A  L+CL  YP IIR SSII RLAND  +S  E KRG+V K+IQCYM++   S
Sbjct  469   TNSLTIEA--LECLQLYPNIIRYSSIIFRLANDLASSSEEAKRGEVAKSIQCYMNDTGAS  526

Query  528   ANEARDFIDLEMNELWKKMN-KVGIEGGSP-FSGTFIEVAMNIARMAQCMYQHGDGHGIN  355
               EAR +I   + E WKK+N +V     SP     FIE+A+N+AR++  +YQH DGH + 
Sbjct  527   EQEARRYIKDLIMESWKKLNEEVQTLNNSPLLLKDFIEIALNLARISHTVYQHRDGHTVE  586

Query  354   NFETQTRIQTLLFE  313
             + ET+ R+ +L  +
Sbjct  587   DHETKDRVLSLFMK  600



>dbj|BAD27260.1| beta-pinene synthase [Citrus unshiu]
Length=602

 Score =   476 bits (1226),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 272/599 (45%), Positives = 377/599 (63%), Gaps = 49/599 (8%)
 Frame = -3

Query  2010  IMAKMFSTFTTCKLPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNT  1840
             I++   S+     +P I R     A+S+  +     T  RRSA+YGP  W + YIQSL++
Sbjct  17    ILSLPLSSKVNGFVPPITRVQYPMAASTTXIKPVDQTIIRRSADYGPTIWSFDYIQSLDS  76

Query  1839  THYAAEGFVMRRDELKERVKDMLKNE----EMREVEKMEMIDELKRLGCSYHFEEEIMEA  1672
               Y  E +  + ++LKE+V  ML+ +    ++  + ++E+ID L RLG SYHFE+EI   
Sbjct  77    K-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLHQLELIDNLHRLGVSYHFEDEIKRT  135

Query  1671  LMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCGFNAS  1495
             L  I+ K             ++LYATAL+FR+LRQ G+N   ++ F  FMD K    ++S
Sbjct  136   LDRIHNK----------NTNENLYATALKFRILRQYGYNTPVKETFSRFMDEKGSFKSSS  185

Query  1494  LSEDTKGLLNLYESSFLSMEGETNL-ELARDFSAKHLK---------------------H  1381
               +D KG+L LYE+++L +E E+++   A+ F+  +LK                     H
Sbjct  186   HGDDCKGMLALYEAAYLLVEEESSIFRDAKSFTTAYLKEWVIKHDNNKHDDEHLCTLVNH  245

Query  1380  ELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWW  1201
              L++PLHWRMPRLEAR FI+ Y+ G     N ILLELAK+DFNIVQAVH E+LK  SRWW
Sbjct  246   ALELPLHWRMPRLEARWFIDVYENGPDM--NPILLELAKVDFNIVQAVHQENLKYASRWW  303

Query  1200  KKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLD  1021
             KK+ + E L F RDR+VENF+WT+G    P++   R M   + + I AVDD+YD+YGTLD
Sbjct  304   KKTGLGENLNFVRDRIVENFMWTVGEKFEPQFGYFRRMSTMVNALITAVDDVYDVYGTLD  363

Query  1020  ELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHLRKMW  844
             EL++FTD +ERW D T VE LP YM+ C+ AL N +NE+ +D L++ GV  ++ +L K W
Sbjct  364   ELEIFTDAVERW-DATVVEKLPHYMKLCFHALRNSINEMTFDALRDQGVDIVISYLTKAW  422

Query  843   ADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHV-FFYVNNLAEDAAVLDCL  667
             AD+CKAYL EAKWY SGY P  +EY+ENAWI+I   +IL H   F  N + ++   L+ +
Sbjct  423   ADICKAYLVEAKWYNSGYIPPLQEYMENAWISIGATVILVHANTFTANPITKEG--LEFV  480

Query  666   TDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNE  487
              DYP IIR SS+ILR A+D GTS  E+KRGDV K+IQCYM EA VS  EAR+ I+  + +
Sbjct  481   KDYPNIIRWSSVILRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQ  540

Query  486   LWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE-TQTRIQTLLFE  313
              W K+N+         S  F+ +AMN+ARM+QCMYQ GDGHG    E T+ R+ +L F+
Sbjct  541   TWMKINRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEITKARVLSLFFD  599



>ref|XP_008461029.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=599

 Score =   476 bits (1225),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 254/556 (46%), Positives = 365/556 (66%), Gaps = 29/556 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEM---REVEK  1741
             +  RRSANY PP W + ++QSL +       F  RR+ L  RVK ML NEE      ++ 
Sbjct  48    SVVRRSANYQPPIWKHEFVQSLQSEFMDDRCF-NRREVLIRRVKMMLNNEESLVDDSLKG  106

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E++DEL+RLG SYHF+ EI + L  I  +        +    + LYAT+L FR+LRQ+G
Sbjct  107   LEVVDELQRLGISYHFQMEINQILEIINGRFNNGEEGLEWNNNRSLYATSLHFRILRQHG  166

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--  1387
             ++I +D+F  F +      +       KG+L+LYE+SFL+MEGE+ L+ AR F+ +HL  
Sbjct  167   YHIPEDMFKEFKNDIE-NLDNICEVKAKGMLSLYEASFLAMEGESFLDEARQFAVQHLSK  225

Query  1386  ---------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                            +H L++P HWRMPRLEAR FI++  + K  SN  +LL LAKLDFN
Sbjct  226   YLKSNNNDQIICTMIRHALQLPFHWRMPRLEARWFIDNVYQTKPNSN-PVLLNLAKLDFN  284

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             IVQ++H +DLK VSRWWK + + E+L FARDR++ NF W++G+   P     R M  K+ 
Sbjct  285   IVQSIHQDDLKDVSRWWKSTGLGEKLEFARDRLMANFFWSVGMGCEPHLQYLRTMSTKIA  344

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDM  892
             S I  +DD+YD+YGTLDEL+LFT  +ERW D+  ++ LP+YM+ C++AL+N +N++A+D 
Sbjct  345   SLITIIDDVYDVYGTLDELELFTHAVERW-DIGAIDSLPNYMQICFIALHNTINDMAFDA  403

Query  891   LKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF-  715
             +K+HGV ++ +LRKMW DLCK +L EAKWY + Y PTFEEY+ENAWI++S  L+L H + 
Sbjct  404   IKDHGVNVIPYLRKMWTDLCKTFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYV  463

Query  714   FYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAK  535
             F  N+L  +A  L+CL  +P IIR SSII RLAND  +S  E +RG+V K+IQCYM++  
Sbjct  464   FTTNSLTIEA--LECLQLHPNIIRYSSIIFRLANDLASSSEEAERGEVAKSIQCYMNDTG  521

Query  534   VSANEARDFIDLEMNELWKKMN-KVGIEGGSP-FSGTFIEVAMNIARMAQCMYQHGDGHG  361
              S  EAR ++   + E WKK+N +V     SP  S +FIE+A+N+AR++  +YQ+ DGH 
Sbjct  522   ASEQEARRYLKDLIVESWKKLNEEVQTLNNSPLLSKSFIEIALNLARISHTVYQYRDGHT  581

Query  360   INNFETQTRIQTLLFE  313
             + + ET+ R+ +L  +
Sbjct  582   VEDHETKDRVLSLFIK  597



>ref|XP_011088141.1| PREDICTED: (-)-alpha-terpineol synthase-like [Sesamum indicum]
Length=551

 Score =   473 bits (1217),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 262/548 (48%), Positives = 360/548 (66%), Gaps = 33/548 (6%)
 Frame = -3

Query  1881  PPT---WDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK-----MEMID  1726
             PPT    D++Y QSL ++ Y  E ++ R  ELK  VK ML  E  +EV       +E+ID
Sbjct  9     PPTSSTCDFNYFQSL-SSEYTDERYLRRASELKVEVKKMLVQE--KEVASSVEELLELID  65

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             EL+RLG SYHFE+EI + L  +Y +K     N    +E+DLY+TAL FR+LRQ+GF +SQ
Sbjct  66    ELQRLGISYHFEDEINQILGCLYKQKYAGGKNNSEGKERDLYSTALAFRLLRQHGFTVSQ  125

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VFD F + K   F+ SL+ DTKGLL LYE+SFLS  GE  L+L R+F+   L       
Sbjct  126   EVFDCFKNDK-GEFDLSLAHDTKGLLQLYEASFLSTPGEKTLDLGREFATNFLQKNPNQK  184

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                      +H L+ P HWR  R  AR FI++Y++   +  N+++LELAKLDFNIVQA H
Sbjct  185   IDENLSLLVRHALEFPTHWRAQRPNARWFIDAYER--RSDVNSVVLELAKLDFNIVQATH  242

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              E+LK +SRWWK++ IAE+L FARDR+VE + W+ G  P P+    R+M  KL +    +
Sbjct  243   QEELKHLSRWWKQTCIAEKLPFARDRLVEAYTWSSGYLPRPEQAYARMMSTKLNALTTVL  302

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DDIYDIYGTL+ELQLFTD ++RW D   +E LP+YM+  YLA  N VNE++YD+L +HG+
Sbjct  303   DDIYDIYGTLEELQLFTDAVQRW-DTEAIERLPEYMQIFYLAAYNLVNEMSYDVLTKHGI  361

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
               + H++K WAD+C  +LQEA +Y+ GYTPT EEYI NA I+I+ PL+L H +F   N  
Sbjct  362   LAIQHMKKQWADVCALFLQEANYYSKGYTPTLEEYINNACISITIPLMLCHAYFLDTNQI  421

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
             +  AV   L+ Y +I+R S  I RL++D  TS  EM+RGD PK+++CYM+E+  S  EAR
Sbjct  422   DMEAV-QALSTYHDIVRYSGTIARLSDDLATSADEMERGDTPKSVECYMNESGASREEAR  480

Query  513   DFIDLEMNELWKKMN-KVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             ++I   ++E WKKMN +V     SPFS  F+ +A ++ R+ Q MYQHGDGHG+     + 
Sbjct  481   EYIKFVIDETWKKMNAQVVAVDNSPFSKDFVSMAADLGRIGQYMYQHGDGHGVQGSHIKD  540

Query  336   RIQTLLFE  313
             R  +LLF+
Sbjct  541   RTSSLLFQ  548



>dbj|BAD27259.1| gamma-terpinene synthase [Citrus unshiu]
Length=600

 Score =   474 bits (1221),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 268/599 (45%), Positives = 377/599 (63%), Gaps = 49/599 (8%)
 Frame = -3

Query  2013  AIMAKMFSTFTTCKLPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLN  1843
              I++   S+     +P I R     A+S+  +     T  RRSA+YGP  W + YIQSL+
Sbjct  16    TILSLPLSSKVNGFVPPITRVQYPMAASTTSIKPVDQTIIRRSADYGPTIWSFDYIQSLD  75

Query  1842  TTHYAAEGFVMRRDELKERVKDMLKNE----EMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             +  Y  E +  + ++LKE+V  ML+ +    ++  + ++E+ID L RLG SYHFE+EI  
Sbjct  76    SK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLHQLELIDNLHRLGVSYHFEDEIKR  134

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCGFNA  1498
              L  I+               ++LYATAL+FR+LRQ G+N   ++ F  FMD K    ++
Sbjct  135   TLDRIHN----------KNTNENLYATALKFRILRQYGYNTPVKETFSHFMDEKGSFKSS  184

Query  1497  SLSEDTKGLLNLYESSFLSMEGETNL---------ELARDFSAKH-------------LK  1384
             S S+D KG+L LYE+++L +E E+++            +++  KH             +K
Sbjct  185   SHSDDCKGMLALYEAAYLLVEEESSIFRDAIRFTTAYLKEWVVKHDIDKNDDEYLCTLVK  244

Query  1383  HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRW  1204
             H L++PLHWRM RLEAR FI+ Y+ G     N ILLELAKLD+NIVQA+H EDLK VSRW
Sbjct  245   HALELPLHWRMRRLEARWFIDVYESGPDM--NPILLELAKLDYNIVQAIHQEDLKYVSRW  302

Query  1203  WKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTL  1024
             W K+ + E+L FARDRVVENF WT+G    P++  CR M A +   + ++DD+YD+YGTL
Sbjct  303   WMKTGLGEKLNFARDRVVENFFWTVGDIFEPQFGYCRRMSAMVNCLLTSIDDVYDVYGTL  362

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHLRKM  847
             DEL+LFTD +ERW D T  E LP YM+ C+ AL N VNE+ +  L++  V  I+ +L+K 
Sbjct  363   DELELFTDAVERW-DATATEQLPYYMKLCFHALYNSVNEMGFIALRDQEVGMIIPYLKKA  421

Query  846   WADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF-FYVNNLAEDAAVLDC  670
             WAD CK+YL EAKWY SGY PT +EY+ENAWI+++ P++L H + F  N + ++A  L+ 
Sbjct  422   WADQCKSYLVEAKWYNSGYIPTLQEYMENAWISVTAPVMLLHAYAFTANPITKEA--LEF  479

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
             L D P+IIR+SS+I+RL +D GTS  E+KRGDVPK+IQCYM E  VS +EAR+ I   + 
Sbjct  480   LQDSPDIIRISSMIVRLEDDLGTSSDELKRGDVPKSIQCYMHETGVSEDEAREHIRDLIA  539

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             E W KMN             FI +AMN+ RM+QCMY +GDGHG+    T+ R+ +L  +
Sbjct  540   ETWMKMNSARFGNPPYLPDVFIGIAMNLVRMSQCMYLYGDGHGVQE-NTKDRVLSLFID  597



>gb|KHG08606.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=576

 Score =   474 bits (1219),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 255/537 (47%), Positives = 358/537 (67%), Gaps = 28/537 (5%)
 Frame = -3

Query  1878  PTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSY  1699
             P WDY Y+QSL       E +  R  +L+E V+ ML N  +  +EK+E+ID L++LG SY
Sbjct  43    PIWDYDYVQSLRDDFVQDESYNERASKLQEEVRMMLGNM-VDYLEKLELIDTLQKLGLSY  101

Query  1698  HFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDG  1519
             HF+ EI   L +I   +  +     A ++ +LYATALEFR+LRQ+G+ + QDVF  FMD 
Sbjct  102   HFQSEINNTLKNISTDRTGTV----AWKKDNLYATALEFRLLRQHGYKVDQDVFTCFMDD  157

Query  1518  KRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---------------  1384
                   +SL++D KGLLNLYE+S+L +EGET LE AR+ +AK LK               
Sbjct  158   V-GNIKSSLNQDFKGLLNLYEASYLLLEGETMLENARELAAKLLKQYLKENNGDQYLRML  216

Query  1383  --HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVS  1210
               H  ++PLHWRM RLEAR FI+ Y+K K    N I+LELA LD+NIVQ++HLED K  S
Sbjct  217   VDHAFELPLHWRMARLEARWFIDVYEKNK--DKNPIILELAILDYNIVQSMHLEDFKYAS  274

Query  1209  RWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYG  1030
              WWK+  + ERL+FARDR++ NFLW +G+   P+    R    KL S +  +DD+YD+YG
Sbjct  275   TWWKELGLGERLSFARDRLMSNFLWGVGMIILPQDRKRRRNQTKLNSLLTCIDDVYDVYG  334

Query  1029  TLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRK  850
             TLDEL+LFTD +ERW D+  ++ LP+YM+  YLAL+NFVNE+A+D+LKE G+ ++  L+K
Sbjct  335   TLDELELFTDVLERW-DINAIQRLPNYMKIYYLALDNFVNEMAFDILKEQGINVIPFLKK  393

Query  849   MWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDC  670
             +W DLCKAYL EAKWY SGYTPT +EY++N WI+++ P +L H +   +++ E+  + + 
Sbjct  394   LWTDLCKAYLLEAKWYYSGYTPTLQEYMDNGWISVTGPAMLGHSYLATDHITEE-GLHNI  452

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
                YP+II  ++II+RL ND  TS +E+KRGDVPK+I CYM+E+  S  EAR+ +   ++
Sbjct  453   QEYYPDIIYQANIIVRLVNDLATSSYELKRGDVPKSILCYMNESGASEEEAREHMWKLID  512

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
               WKKMN+  +   SP    FIE+AMN AR+A  +YQ  DG GI + E + ++ +L 
Sbjct  513   AAWKKMNEDQMT-ISPLPRKFIEMAMNHARVALMIYQKDDGFGIEDNEIKDKVLSLF  568



>emb|CCM43929.1| linalool/myrcene synthase [Coffea arabica]
Length=596

 Score =   474 bits (1220),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 276/554 (50%), Positives = 368/554 (66%), Gaps = 34/554 (6%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  R+S N+   + D++++QSL    YA E +  R + LKE+VK ML ++EM  V ++E+
Sbjct  50    SPLRQSGNHQLLSSDFNHLQSLKND-YAEEKYKSRCEVLKEQVKMML-DQEMDVVNQLEL  107

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID+L+RLG SYHF +EI   L  IY +K  +        +  LYAT LEFR+LRQ+GF++
Sbjct  108   IDDLQRLGLSYHFGDEITSVLSGIYNRKSMNKMR----NQWGLYATCLEFRLLRQHGFDV  163

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE-LARDFSAKHLK---  1384
             SQ++FD F D K   F  SL ED+KG+L LYE+S+L  E E +   +AR F+AK LK   
Sbjct  164   SQEIFDCFKDEKG-DFRPSLCEDSKGMLYLYEASYLESENEESNLEMARRFAAKTLKKNL  222

Query  1383  --------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                           H L++PLHWRM RLEAR FI+ Y++   ++ N ILLELAKLDFNIV
Sbjct  223   DEKRVDQDLVALVQHALELPLHWRMMRLEARWFIDIYEE--RSNRNPILLELAKLDFNIV  280

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             QA H  DL    RWW+ + +AE+LTFARD +VENF WT+G+  +P+  N R +  K+ + 
Sbjct  281   QAAHQNDLTYTLRWWRSTCLAEKLTFARDMMVENFFWTVGIISDPQRGNGRRILTKVVAL  340

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I A+DDIYD YGTLDEL++FT  +ERW DV  ++ LPD M+ C+LAL NFVNE+AYD LK
Sbjct  341   ITAIDDIYDCYGTLDELEVFTTAVERW-DVNSIDQLPDCMKICFLALYNFVNEMAYDALK  399

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
             E GV I+ +LRK WADLCKAYLQEAKW+ SG  PT ++Y+ NAWI+IS P  L H +F V
Sbjct  400   EQGVNIIPYLRKSWADLCKAYLQEAKWFFSGEVPTLQQYLNNAWISISAPAFLVHAYFCV  459

Query  705   N-NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFE--MKRGDVPKAIQCYMDEAK  535
             +  + +D   L  L +Y +IIR S++ILRL ND GTSP    +  GDVPK+I+CYM E  
Sbjct  460   DYPINKDH--LQYLDNYHKIIRCSAMILRLTNDLGTSPESEVLNVGDVPKSIRCYMKETG  517

Query  534   VSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGIN  355
                 +AR+ +   + E WK+M +      SPFS TF  +A+N+ARM  CMYQHGDGHG  
Sbjct  518   ACEEKAREHLRFLITEAWKQMEEAQTL-DSPFSSTFNGIAVNLARMGLCMYQHGDGHGHQ  576

Query  354   NFETQTRIQTLLFE  313
             N E + RI +LLFE
Sbjct  577   NSEPRDRILSLLFE  590



>gb|ADX01381.1| pinene synthase [Citrus hystrix]
Length=602

 Score =   473 bits (1218),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 270/602 (45%), Positives = 371/602 (62%), Gaps = 49/602 (8%)
 Frame = -3

Query  2022  C*MAIMAKMFSTFTTCKLPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQ  1852
             C    ++   S+     +P I R     A+S+  +     T  RRSA+YGP  W + YIQ
Sbjct  13    CNFTRLSLPLSSKVNVFVPPITRVQYHVAASTTPIKPVDQTIIRRSADYGPTIWSFDYIQ  72

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDMLKNEE----MREVEKMEMIDELKRLGCSYHFEEE  1684
             SL++  Y  E +  + ++LKE+V  ML+ ++    +  + ++E+ID L RLG SYHFE+E
Sbjct  73    SLDSK-YKGESYARQLEKLKEQVSAMLQQDDKVVDLDPLHQLELIDNLHRLGVSYHFEDE  131

Query  1683  IMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCG  1507
             +   L  I+               K LYATAL+FR+LRQ G+N   ++ F  FMD K   
Sbjct  132   VKRTLDRIHN----------KNTNKSLYATALKFRILRQYGYNTPVEETFSRFMDEKGSF  181

Query  1506  FNASLSEDTKGLLNLYESSFLSMEGETNL---------ELARDFSAKH------------  1390
              ++S  +D KG+L LYE+++L +E E+++            +++  KH            
Sbjct  182   KSSSHGDDCKGMLALYEAAYLLVEEESSIFRDAIRFTTAYLKEWVIKHDNNKHDDEHLCT  241

Query  1389  -LKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSV  1213
              +KH L++PLHWRM RLEAR FI+ Y  G     N ILLE AKLD+NIVQA+H EDLK V
Sbjct  242   LVKHALELPLHWRMRRLEARWFIDVYQSGPDM--NPILLEFAKLDYNIVQAIHQEDLKYV  299

Query  1212  SRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIY  1033
             SRWWKK+ + E L F RDR+VENF+WT+G    P++   R M   + + I AVDD+YD+Y
Sbjct  300   SRWWKKTGLGENLNFVRDRIVENFMWTVGEKFEPQFGYFRRMSTMVIALITAVDDVYDVY  359

Query  1032  GTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHL  856
             GTLDEL++FTD +ERW D T VE LP YM+ C+ AL N +NE+ +D L++ GV  ++ +L
Sbjct  360   GTLDELEIFTDAVERW-DATAVEQLPHYMKLCFHALRNSINEMTFDALRDQGVDIVISYL  418

Query  855   RKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHV-FFYVNNLAEDAAV  679
              K WAD+CKAYL EAKWY SGY P  +EY+ENAWI+I   +IL H   F  N + ++   
Sbjct  419   TKAWADICKAYLVEAKWYNSGYIPPLQEYMENAWISIGATVILVHANTFTANPITKEG--  476

Query  678   LDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDL  499
             L+ + DYP IIR SS+ILR A+D GTS  E+KRGDV K+IQCYM EA VS  EAR+ I+ 
Sbjct  477   LEFVKDYPNIIRWSSVILRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHIND  536

Query  498   EMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE-TQTRIQTL  322
              + + W KMN+         S  F+ +AMN+ARM+QCMYQ GDGHG    E T+ R+  L
Sbjct  537   LIAQTWMKMNRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEITKDRVLPL  596

Query  321   LF  316
              F
Sbjct  597   FF  598



>ref|XP_010247894.1| PREDICTED: terpene synthase 10-like [Nelumbo nucifera]
Length=611

 Score =   474 bits (1219),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 260/548 (47%), Positives = 344/548 (63%), Gaps = 35/548 (6%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P +W+   +QSL +  +  E +V R  +L   VK    N+    V+ +E+ID 
Sbjct  72    RRSGNYKPSSWENDDLQSLKSD-FPEEAYVERATKLVVDVKRKF-NQAAGAVDLLELIDN  129

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             ++RLG  YHF+ EI  AL  I               +++LYATAL FR+LRQ+GF ISQD
Sbjct  130   VQRLGVGYHFQTEIKRALESIKDTS--------VNADEELYATALRFRLLRQHGFQISQD  181

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             VF  FMD K   FN SL +DTKGLL+LYE+S+   EGE  L+ A+ F+ +HL        
Sbjct  182   VFKSFMDKKGGSFNESLRKDTKGLLDLYEASYHGFEGEDILDGAQQFTKRHLIKQLKEKT  241

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L+MPLHWRM R EAR FI++Y   +    + ++LE AKLDFN+VQA
Sbjct  242   SPNYKNMARLVSHALEMPLHWRMNRWEARWFIDTYSMKQDM--DPLILEFAKLDFNMVQA  299

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
             ++ ++LK  SRWW    +AE L F+RDR+VEN+LWT G+   P++  CR    K    I 
Sbjct  300   IYQQELKDASRWWTDLGLAEALRFSRDRIVENYLWTTGIIFEPQFGYCRRQLTKANCLIT  359

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDEL+LFTD +ERW D+  +  LPDYM+ C++AL N +NE+AYD LK+ 
Sbjct  360   TIDDVYDVYGTLDELKLFTDAVERW-DINTLRDLPDYMKICFMALYNNINEMAYDFLKKR  418

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G  IL +L+K W DLCK YL EA+WY +GY PT EEY+ NAWI+IS P IL H +F V N
Sbjct  419   GWDILKYLKKGWLDLCKTYLVEAQWYYNGYKPTLEEYLNNAWISISAPTILVHNYFCVEN  478

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               ++ A L+ L +YP I+R S  +LR ++D GTS  E+KRGDVPK+IQCYM E       
Sbjct  479   KIKEEA-LEQLDNYPSIVRSSGALLRYSDDLGTSTDELKRGDVPKSIQCYMHETGAPEEI  537

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG-INNFET  343
             AR+ I     + WKKMNK  +   SPF   F + A  + RMAQ MYQHGDGHG + +  T
Sbjct  538   AREHIRGLRAKEWKKMNKC-MTAPSPFPQAFKDSAAGLGRMAQFMYQHGDGHGLLADSLT  596

Query  342   QTRIQTLL  319
             + RI  LL
Sbjct  597   KNRIMPLL  604



>gb|ABH07678.1| sabinene synthase [Salvia pomifera]
Length=581

 Score =   472 bits (1215),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 256/576 (44%), Positives = 363/576 (63%), Gaps = 35/576 (6%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             T+C  P+   +   +SF +        RRS +Y P  WD++YIQSLNT  Y  + +V R+
Sbjct  19    TSCTAPA---ARLQASFSLQQEEPRQIRRSGDYQPSLWDFNYIQSLNTP-YKEQRYVNRQ  74

Query  1803  DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyK  1624
              EL  +V+ +LK  +M  ++++E+ID+L+ LG SY F +EI + L  I+ + +       
Sbjct  75    AELIMQVRMLLK-VKMEAIQQLELIDDLQYLGLSYFFPDEIKQILSSIHNEHRYF-----  128

Query  1623  ATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFL  1444
                  DLY TAL FR+LRQ+GFN+S+DVFD F   K   FNA+L++DTKG+L LYE+SFL
Sbjct  129   --HNNDLYLTALGFRILRQHGFNVSEDVFDCFKTEKCSDFNANLAQDTKGMLQLYEASFL  186

Query  1443  SMEGETNLELARDFSAKHLK-------------------HELKMPLHWRMPRLEARSFIE  1321
               EGE  LELAR FS + L+                   H L +PLHWR+  LEAR F++
Sbjct  187   LREGEDTLELARRFSTRSLREKLDEDGDEIDEDLSSWIRHSLDLPLHWRIQGLEARWFLD  246

Query  1320  SYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENF  1141
             +Y   +    N ++ +LAKL+FNIVQA + E+LK VSRWW  S +AE+L F RDR+VE F
Sbjct  247   AY--ARRPDMNPLIFKLAKLNFNIVQATYQEELKDVSRWWNSSCLAEKLPFVRDRIVECF  304

Query  1140  LWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEH  961
              W IG     +Y   R M A + +F+  +DD+YD+YGTL+EL+LFTD I RWD+++ +  
Sbjct  305   FWAIGAFEPHQYSYQRKMAAIIITFVTIIDDVYDVYGTLEELELFTDMIRRWDNIS-ISQ  363

Query  960   LPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPT  781
             LP YM+ CYLAL NFV+E AYD+LK+     + +L++ W  L + YL+EA WY +GY P+
Sbjct  364   LPYYMQVCYLALYNFVSERAYDILKDQHFNSIPYLQRSWVSLVEGYLKEAYWYYNGYKPS  423

Query  780   FEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGT  601
              EEY+ NA I+IS P I++ ++F + N + D  V++ L +Y  I+ LS  ILRLA+D GT
Sbjct  424   LEEYLNNAKISISAPTIISQLYFTLAN-STDETVIESLYEYHNILYLSGTILRLADDLGT  482

Query  600   SPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIE  421
             S  E++RGDVPKAIQCYM +   S  EA + +   + E WK+MN V      PF+   + 
Sbjct  483   SQHELERGDVPKAIQCYMKDTNASEREAVEHVKFLIRETWKEMNTVTTASDCPFTDDLVA  542

Query  420   VAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             VA N+AR AQ +Y  GDGHG+ + E   ++  LLF+
Sbjct  543   VATNLARAAQFIYLDGDGHGVQHSEIHQQMGGLLFQ  578



>ref|XP_004231363.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic [Solanum 
lycopersicum]
 sp|G1JUH1.1|TPS3_SOLLC RecName: Full=(-)-camphene/tricyclene synthase, chloroplastic; 
Short=SlTPS3; AltName: Full=(4S)-limonene synthase.; AltName: 
Full=Myrcene synthase; Flags: Precursor [Solanum lycopersicum]
 gb|AEM05853.1| camphene/tricyclene synthase [Solanum lycopersicum]
Length=607

 Score =   473 bits (1217),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 265/556 (48%), Positives = 359/556 (65%), Gaps = 38/556 (7%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD---MLKNEEMREVEKMEM  1732
             RRS NY P  W+Y YIQS +  H+  E ++ R +ELK  +K    M+ +EE +E+EK+E+
Sbjct  57    RRSGNYEPTMWNYEYIQSTHN-HHVGEKYMKRFNELKAEMKKHLMMMLHEESQELEKLEL  115

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG SYHF++EI++ L  I+ +         AT    LY TAL+FR+LRQ+GF I
Sbjct  116   IDNLQRLGVSYHFKDEIIQILRSIHDQSSSE-----ATSANSLYYTALKFRILRQHGFYI  170

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETN--LELARDFSAKHLK--  1384
             SQD+ + F D ++  F  SL +DTKGLL LYE+SFLS + ET+  LE A  F+  HLK  
Sbjct  171   SQDILNDFKD-EQGHFKQSLCKDTKGLLQLYEASFLSTKSETSTLLESANTFAMSHLKNY  229

Query  1383  ----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFN  1252
                             H L++PLH  M R+E R +I+ Y+     + N +L+ELAKLDFN
Sbjct  230   LNGGDEENNWMVKLVRHALEVPLHCMMLRVETRWYIDIYEN--IPNANPLLIELAKLDFN  287

Query  1251  IVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN-CRIMGAKL  1075
              VQA+H ++L+++SRWWKKS +AE+L FARDR+VE F W  G+    +    CRIM  K+
Sbjct  288   FVQAMHQQELRNLSRWWKKSMLAEKLPFARDRIVEAFQWITGMIFESQENEFCRIMLTKV  347

Query  1074  YSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYD  895
              +    +DDIYD+YGTLDEL++FT  I+R + +  ++ LP YM+ CYLAL N  +EIAY 
Sbjct  348   TAMATVIDDIYDVYGTLDELEIFTHAIQRME-IKAMDELPHYMKLCYLALFNTSSEIAYQ  406

Query  894   MLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF  715
             +LKE G+ I+ +L K WADL K+YLQEA+WY SGYTP+ +EY+ENAWI++   +++ + F
Sbjct  407   VLKEQGINIMPYLTKSWADLSKSYLQEARWYYSGYTPSLDEYMENAWISVGSLVMVVNAF  466

Query  714   FYVNNLAEDAAVLDCL--TDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
             F V N      VL+ L    YP+IIR  + I+RL +D  TS  EMKRGDVPK+IQCYM E
Sbjct  467   FLVTN-PITKEVLEYLFSNKYPDIIRWPATIIRLTDDLATSSNEMKRGDVPKSIQCYMKE  525

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
                S  EAR  I+L + E WK +N       S F   F+  A+NIAR  Q +YQHGDGHG
Sbjct  526   NGASEEEARKHINLMIKETWKMINTAQ-HDNSLFCEKFMGCAVNIARTGQTIYQHGDGHG  584

Query  360   INNFETQTRIQTLLFE  313
             I N++ Q RI  L FE
Sbjct  585   IQNYKIQNRISKLFFE  600



>gb|ACN42013.2| linalool synthase [Perilla frutescens var. hirtella]
Length=604

 Score =   473 bits (1217),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 264/551 (48%), Positives = 360/551 (65%), Gaps = 28/551 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRS NY P  WD++Y+Q LNTTHY  E  + R  EL E+VK ML  EEM  V+++E++
Sbjct  60    TARRSGNYQPSLWDFNYLQPLNTTHYKEERHLKREAELIEQVK-MLLEEEMEAVQQLELV  118

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D+LK LG SY FE++I + L  IY + K   +N +A EE+DLY TAL FR+LRQ+GF +S
Sbjct  119   DDLKNLGLSYFFEDQIKQILTFIYNEHKCFRSNVEA-EERDLYFTALGFRLLRQHGFQVS  177

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL------  1387
             Q+VFD F + +   F ASL +DTKGL+ LYE+SFL  EGE  LELAR ++ K L      
Sbjct  178   QEVFDCFKNEEGSDFKASLGDDTKGLVQLYEASFLLREGEDTLELARQYATKFLQKKVDH  237

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          +H L++PLHWR+ RLEAR F+++Y        N I+LELAKLDFNI+
Sbjct  238   ELIDDDNNLLSWIRHSLEIPLHWRIQRLEARWFLDAY--ATRHDVNPIILELAKLDFNII  295

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             QA   E+LK +SRWW  + +AE+L F RDR+VE++ W I L    +Y   R + AK+ + 
Sbjct  296   QATQQEELKDLSRWWNSTCLAEKLPFVRDRLVESYFWAIALFEPHQYGYHRKIAAKIITL  355

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I ++DD+YDIYGTLDELQLFTD I+RW D   +  LP YM+  Y+ L NFV+E+AYD LK
Sbjct  356   ITSLDDVYDIYGTLDELQLFTDAIQRW-DTESISRLPYYMQLFYMVLYNFVSELAYDGLK  414

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
             E G   + +L++ WADL +AYL+EAKW+ +GYTP+ EEY+ NA+I+I    +++ VFF +
Sbjct  415   EKGFITIPYLQRSWADLVEAYLKEAKWFYNGYTPSMEEYLNNAYISIGATPVISQVFFTL  474

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
                + D  V++ L +Y  I+RLS +++RL +D GTSPFEMKRGDVPKAI  YM E   + 
Sbjct  475   AT-SIDKPVIESLYEYHRILRLSGMLVRLPDDLGTSPFEMKRGDVPKAILLYMKERNATE  533

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              EA++ +   + E WK+MN        P +   +  A N+ R AQ MY  GDG   N+ +
Sbjct  534   IEAQEHVRFLIREAWKEMNTATAAADCPLTDDLVAAAANLGRAAQFMYLDGDG---NHSQ  590

Query  345   TQTRIQTLLFE  313
                RI +LLFE
Sbjct  591   LHQRIASLLFE  601



>ref|XP_006369784.1| hypothetical protein POPTR_0001s31570g [Populus trichocarpa]
 gb|ERP66353.1| hypothetical protein POPTR_0001s31570g [Populus trichocarpa]
Length=593

 Score =   472 bits (1214),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 254/589 (43%), Positives = 369/589 (63%), Gaps = 41/589 (7%)
 Frame = -3

Query  1998  MFSTFTTCKLPSIHRSHASSSFRMCYHTT------------TTTRRSANYGPPTWDYSYI  1855
             +F   T  KL    R+    S   C+ +             +  RRS NY  P WD+ ++
Sbjct  8     LFPISTVTKLTFSSRTSLGLSRNGCFPSQVRCMVATETCDQSIARRSGNYPTPFWDHKFL  67

Query  1854  QSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             QSL T+ Y  E +  + ++LKE V+DML+ + +  V ++E+ID L+RLG +YHFE EI  
Sbjct  68    QSL-TSEYVGEPYTGQANKLKETVRDMLE-KPLDAVYQLELIDNLQRLGVAYHFELEIK-  124

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNAS  1495
                 I   +  +        ++DLYAT++EFR+LRQ+G+N+ QDVF+ F D ++  F   
Sbjct  125   ---SILESRWNNYKEDNREMKEDLYATSVEFRLLRQHGYNVPQDVFNSFKD-EQGNFKNC  180

Query  1494  LSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMP  1366
             L +D KG+LNLYE+S+  + GE+ LE ARDFS KHLK                 H L++P
Sbjct  181   LRDDVKGMLNLYEASYYLVNGESILEEARDFSEKHLKEYSKEQNEDHYLSLLVNHSLELP  240

Query  1365  LHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYI  1186
             LHWRM R+EAR FI++Y  G+    N ILLE A LDFN+VQA + ED++  SRWW    +
Sbjct  241   LHWRMQRMEARWFIDAY--GRKRDLNPILLEFAGLDFNMVQAKYQEDIRHASRWWTSMDL  298

Query  1185  AERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLF  1006
               +L + RDR++EN LW +G    P++   R M  ++ + I A+DD YD+YGTL+EL++F
Sbjct  299   GNKLFYTRDRLMENTLWAVGEVFEPQFGYYRKMATRITALITALDDAYDVYGTLEELEVF  358

Query  1005  TDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKA  826
             TD IE WD +  ++ LP YM+  + AL   +NEI Y++LKE G+ ++  L+K+W DLC+A
Sbjct  359   TDVIESWD-INALDELPYYMKISFFALFQSINEIGYNILKEQGINVVPSLKKLWGDLCRA  417

Query  825   YLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEii  646
             +L+EAKWY +GYTPT +EY++NAW+++S  +I+ H FF V N   D AV  C  +YP++I
Sbjct  418   FLKEAKWYYAGYTPTLQEYLDNAWLSVSGQVIIGHAFFLVTNQLTDEAV-RCCMEYPDLI  476

Query  645   rlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNK  466
             R SS I+RLA+D GTS  E+ RGD PK+IQCYM E   +  EAR+ +   ++E WKK+N 
Sbjct  477   RHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKKLN-  535

Query  465   VGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
               I    PFS  F+ + M++AR AQC Y+ GD +GI + ET  R+ +L+
Sbjct  536   AEILKPYPFSKKFMGIPMDLARTAQCFYEDGDAYGIQDQETHGRLASLI  584



>ref|XP_006369780.1| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
 gb|ERP66349.1| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
Length=558

 Score =   469 bits (1208),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 248/548 (45%), Positives = 356/548 (65%), Gaps = 29/548 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  RRS NY  P WD+ ++QSL T+ Y  E +  + ++LKE V+DML+ + +  V ++E+
Sbjct  14    SIARRSGNYPTPFWDHKFLQSL-TSEYVGEPYTGQANKLKETVRDMLE-KPLDAVYQLEL  71

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHFE EI      I   +           ++DLY T++EFR+LRQ+G+N+
Sbjct  72    IDNLQRLGVAYHFELEIK----SILESRWNDYKKDNREMKEDLYGTSVEFRLLRQHGYNV  127

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              QDVF+ F D ++  F   L +D KG+LNLYE+S+  + GE+ LE ARDFS KHLK    
Sbjct  128   PQDVFNSFKD-EQGNFKNCLRDDVKGMLNLYEASYYLVNGESILEEARDFSEKHLKEYSK  186

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++PLHWRM R+EAR FI++Y  G+    N ILLE A LDFN+VQ
Sbjct  187   EQNEDHYLSLLVNHSLELPLHWRMQRMEARWFIDAY--GRKRDLNPILLEFAGLDFNMVQ  244

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A + ED++  SRWW    +  +L + RDR++EN LW +G    P++   R M  ++ + I
Sbjct  245   AKYQEDIRHASRWWTSMDLGNKLFYTRDRLMENTLWAVGEVFEPQFGYYRKMATRITALI  304

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
              A+DD YD+YGTL+EL++FTD IE WD V  ++ LP YM+  + AL   +NEI Y++LKE
Sbjct  305   TALDDAYDVYGTLEELEVFTDVIESWD-VNALDQLPYYMKISFFALFQSINEIGYNILKE  363

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              G+ ++  L+K+W DLC+A+L+EAKWY +GYTPT +EY++NAW+++S  +IL H FF V 
Sbjct  364   QGINVVPSLKKLWGDLCRAFLKEAKWYYAGYTPTLQEYLDNAWLSVSGQVILGHAFFLVT  423

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
             N   + AV  C  +YP++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM E   +  
Sbjct  424   NQLTEEAV-RCCMEYPDLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQ  482

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             EAR+ +   + E WKK+N V I    PFS  F+ + M++AR AQC Y+ GD +GI + ET
Sbjct  483   EAREHVRYLIYETWKKLN-VEILKPYPFSKKFMGIPMDLARTAQCFYEDGDAYGIQDQET  541

Query  342   QTRIQTLL  319
               R+ +L+
Sbjct  542   HGRLASLI  549



>gb|AAX16075.1| linalool synthase [Perilla citriodora]
Length=603

 Score =   471 bits (1212),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 264/551 (48%), Positives = 363/551 (66%), Gaps = 29/551 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRS NY P  WD++Y+QSLNTTHY  E  + R  EL E+VK ML +EEM  V+K++++
Sbjct  60    TARRSGNYQPSLWDFNYLQSLNTTHYKEERHLKREAELIEQVK-MLLDEEMEAVQKLDLV  118

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D+LK LG SY FE++I + L  IY + +   +N +A +E+DLY TAL FR+LRQ+GF +S
Sbjct  119   DDLKNLGLSYFFEDQIKQILTFIYNEHECFRSNVEA-KERDLYFTALGFRLLRQHGFQVS  177

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL------  1387
             Q+VFD F + +   F ASL +DTKGLL LYE+SFL  EGE  LELAR ++ K L      
Sbjct  178   QEVFDCFKNEEGSDFKASLGDDTKGLLQLYEASFLLREGEDTLELARQYATKFLQKKVDH  237

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          +H L++PLHWR+ RLEAR F+++Y        N I+LELAKLDFNI+
Sbjct  238   ELIDDDSNLLSWIRHSLEIPLHWRIQRLEARWFLDAY--ATRHDVNPIILELAKLDFNII  295

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             +A   E+LK +SRWW  + +AE+L F RDR+VE++ W I L    +Y   R + AK+ + 
Sbjct  296   RATQQEELKDLSRWWNSTCLAEKLPFVRDRLVESYFWAIALFEPHQYGYHRKIAAKIITL  355

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I ++DD+YDIYGTLDELQLFTD I+RW D   +  LP YM+  Y+ L NFV+E+AYD LK
Sbjct  356   ITSLDDVYDIYGTLDELQLFTDAIQRW-DTESISRLPYYMQLFYMVLYNFVSELAYDGLK  414

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
             E G FI+ +L++ WADL  AYL+EAKW+ +GYTP+ EEY+ NA+I+I    +++ VFF +
Sbjct  415   EKG-FIIPYLQRSWADLVVAYLKEAKWFYNGYTPSMEEYLNNAYISIGATPVISQVFFTL  473

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
                + D  V++ L +Y  I+RLS +++RL +D GTS FEMKRGDVPK I+ YM E   + 
Sbjct  474   AT-SIDKPVIESLYEYHRILRLSGMLVRLPDDLGTSSFEMKRGDVPKTIELYMKERNATE  532

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              EA++ +   + E WK+MN        PF+   +  A N+ R AQ MY  GDG   N+ +
Sbjct  533   IEAQEHVRFLIREAWKEMNTATAAADCPFTDDLVAAAANLGRAAQFMYLDGDG---NHSQ  589

Query  345   TQTRIQTLLFE  313
                RI +LLFE
Sbjct  590   LHQRIASLLFE  600



>emb|CDP10953.1| unnamed protein product [Coffea canephora]
Length=598

 Score =   470 bits (1209),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 275/556 (49%), Positives = 368/556 (66%), Gaps = 36/556 (6%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  R+S N+   + D++++QSL    YA E ++ R + LKE+ K ML ++EM  V ++E+
Sbjct  50    SPLRQSGNHQLLSSDFNHLQSLKND-YAEEKYISRCEVLKEQAKMML-DQEMEVVNQLEL  107

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID+L+RLG SYHF +EI   L  IY +K  +        +  LYAT LEFR+LRQ+GF++
Sbjct  108   IDDLQRLGLSYHFGDEITSVLSGIYNRKSMNKMR----NQWGLYATCLEFRLLRQHGFDV  163

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE-LARDFSAKHLK---  1384
             SQ++FD F D K   F  SL ED+KG+L LYE+S+L  E E +   +AR F+AK LK   
Sbjct  164   SQEIFDCFKDEKG-DFRPSLCEDSKGMLYLYEASYLESENEESNLEMARRFAAKTLKKNL  222

Query  1383  --------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                           H L++PLHWRM RLEAR FI+ Y++   ++ N ILLELAKLDFNIV
Sbjct  223   DEKRVDQDLVALVQHALELPLHWRMMRLEARWFIDIYEE--RSNRNPILLELAKLDFNIV  280

Query  1245  QAVHLEDLKSVSR--WWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLY  1072
             QA H  DL    R  WW+ + +AE+LTFARD +VENF WT+G+  +P+  N R +  K+ 
Sbjct  281   QAAHQNDLTYTLRQEWWRSTCLAEKLTFARDMMVENFFWTVGIISDPQRGNGRRILTKVV  340

Query  1071  SFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDM  892
             + I A+DDIYD YGTLDEL++FT  +ERWD V  ++ LPD M+ C+LAL NFVNE+AYD 
Sbjct  341   ALITAIDDIYDCYGTLDELEVFTTAVERWD-VNSIDQLPDCMKICFLALYNFVNEMAYDA  399

Query  891   LKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFF  712
             LKE GV I+ +LRK WADLCKAYLQEAKW+ SG  PT ++Y+ NAWI+IS P  L H +F
Sbjct  400   LKEQGVNIIPYLRKSWADLCKAYLQEAKWFFSGEVPTLQQYLNNAWISISAPAFLVHAYF  459

Query  711   YVN-NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFE--MKRGDVPKAIQCYMDE  541
              V+  + +D   L  L +Y +IIR S++ILRL ND GTSP    +  GDVPK+I+CYM E
Sbjct  460   CVDYPINKDH--LQYLDNYHKIIRCSAMILRLTNDLGTSPESEVLNVGDVPKSIRCYMKE  517

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
                   +AR+ +   + E WK+M +      SPFS TF  +A+N+ARM  CMYQHGDGHG
Sbjct  518   TGACEEKAREHLRFLITEAWKQMEEAQTL-DSPFSSTFNGIAVNLARMGLCMYQHGDGHG  576

Query  360   INNFETQTRIQTLLFE  313
               N E + RI +LLFE
Sbjct  577   HQNSEPRDRILSLLFE  592



>ref|XP_004161823.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=601

 Score =   470 bits (1209),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 254/578 (44%), Positives = 370/578 (64%), Gaps = 40/578 (7%)
 Frame = -3

Query  1974  KLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDEL  1795
             +LP++ +++  S            RRSANY PP W + ++QSL +  +  +  + RR+ L
Sbjct  38    QLPTVRKAYDDS----------IVRRSANYQPPIWKHEFVQSLQS-EFMDDRCLNRREVL  86

Query  1794  KERVKDMLKNEEM---REVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyK  1624
               RVK ML NEE+     ++ +E +DEL+RLG SYHFE EI + L  I  +        +
Sbjct  87    IRRVKMML-NEELLVDDSLKGLEFVDELQRLGISYHFEMEINQLLEMINERFNNGEEGLE  145

Query  1623  ATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFL  1444
                 K LYA +L FR+LRQ+G++I QDVF  F +      +    E  KG+L+LYE+SFL
Sbjct  146   RNNNKSLYAISLHFRILRQHGYHIPQDVFKEFKNDIE-NLDNICEETAKGMLSLYEASFL  204

Query  1443  SMEGETN-LELARDFSAKHLK------------------HELKMPLHWRMPRLEARSFIE  1321
             +MEG+ + ++  R  + +HL                   H L++P HWRMPRLEAR FI+
Sbjct  205   AMEGDQSFMDETRQVAVQHLSKYLKSNNNNDQIICTMTSHALQLPFHWRMPRLEARWFID  264

Query  1320  SYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENF  1141
             +  + K  SN  +LL+LAKLDFN+VQ++H +DLK +SRWWK + + ++L FARDR++ NF
Sbjct  265   NVYQTKPDSN-PVLLDLAKLDFNVVQSIHQDDLKDISRWWKSTGLGKKLEFARDRLMANF  323

Query  1140  LWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEH  961
              W++G+   P     R M  K+ S I  VDD+YD+YGTLDEL+LFT+ +ERW D++ ++ 
Sbjct  324   FWSVGMGCEPHLQYLRTMSTKIASLITIVDDVYDVYGTLDELELFTNVVERW-DISAIDS  382

Query  960   LPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPT  781
             LP+YM+ C++AL+N +N++A++ +K+HGV ++ +LRKMW DLCK +L EAKWY S Y PT
Sbjct  383   LPNYMQICFMALHNTINDMAFEAIKDHGVNVIPYLRKMWTDLCKTFLTEAKWYYSNYKPT  442

Query  780   FEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGT  601
             FEEY+ENAWI++S  L+L H + + +      A L+CL  YP IIR SSII RLAND  +
Sbjct  443   FEEYLENAWISVSGSLLLVHAYVFTSKSLTIEA-LECLQHYPNIIRYSSIIFRLANDLAS  501

Query  600   SPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP-FSGTF  427
             S  E KRG+V K+IQCYM++   S  EAR +I   + + WKK+N +V     SP     F
Sbjct  502   SSEEAKRGEVAKSIQCYMNDTGASEQEARRYIKDLIMKSWKKLNEEVQTLNNSPLLCKGF  561

Query  426   IEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             IE+A+N+AR++  +YQH DGH I + ET+ R+ +L  +
Sbjct  562   IEIALNLARISHTVYQHRDGHTIEDHETKDRVLSLFIK  599



>ref|XP_006467490.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO78140.1| hypothetical protein CISIN_1g006994mg [Citrus sinensis]
Length=616

 Score =   470 bits (1209),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 269/571 (47%), Positives = 371/571 (65%), Gaps = 37/571 (6%)
 Frame = -3

Query  1947  ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLK  1768
             A+++  +C     + RRSANY P  W Y Y+QSL +  Y  E +  R ++LK  V+ ML+
Sbjct  46    AANATSVC-EKAISNRRSANYQPSMWGYDYLQSL-SNEYVVESYAQRIEKLKGEVRLMLE  103

Query  1767  NEEMREVE---KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn-nyKATEEKDLY  1600
             N+E+  V+   ++E++D L+RLG SYHFE+EI   L  IY ++   S+ + K  +E  LY
Sbjct  104   NKEVDYVDALHQLEIVDNLQRLGVSYHFEDEIKRFLSRIYNERNSRSSYHAKEKQESSLY  163

Query  1599  ATALEFRVLRQNGFNI-SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETN  1423
             A ALEFR+LRQ+GF++ +Q     FMD K     + L +D KG+L LYE+++L +E E+N
Sbjct  164   AVALEFRLLRQHGFDMHAQGTLSLFMDEK-GKLKSCLGDDIKGILALYEAAYLLVEEESN  222

Query  1422  L-ELARDFSAKHLK-------------------HELKMPLHWRMPRLEARSFIESYDKGK  1303
             +   A +F+  HLK                   H L++PLHWRM RLEAR FI+ Y +G 
Sbjct  223   IFNEAINFTTTHLKEYVKHNNNDDDGYLSTLVEHALELPLHWRMVRLEARWFIDMYQRGP  282

Query  1302  TTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGL  1123
                 N +L+ELAKLDFN VQA H E+LK VSRWW+K+ + E L FARDR++ENF W +G 
Sbjct  283   DV--NQVLVELAKLDFNAVQAEHQEELKYVSRWWRKTGLGE-LHFARDRIMENFFWALGE  339

Query  1122  TPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMR  943
                P++  CR M  K  + I  +DD+YD+YGTLDEL+LFT+ +ERWD V  ++ LP YM+
Sbjct  340   VWEPQFGYCRRMSTKANALITTIDDVYDVYGTLDELELFTNAVERWD-VNAMDQLPYYMK  398

Query  942   FCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIE  763
              C+L L+N  NE+A+D+LK+ GV I+ +L+K WAD+CK++L EAKWY+SGY PT EEY++
Sbjct  399   LCFLVLHNSTNEMAFDVLKKQGVHIIPYLKKAWADMCKSFLLEAKWYSSGYIPTLEEYMD  458

Query  762   NAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMK  583
             NAWI++S P+IL H +  + N     A L  L +YP IIR  S+I RLAND  TS  E+K
Sbjct  459   NAWISVSGPVILLHAYTLIANPPTKEA-LQFLEEYPNIIRWPSMIFRLANDLATSSDEVK  517

Query  582   RGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP--FSGTFIEVAM  412
             RGDVPKAIQCYM E   S ++AR+ I   +   W KMN K G E       S  FI  A+
Sbjct  518   RGDVPKAIQCYMHETGASESDAREHIRDLITATWMKMNSKDGDENPDHLLLSNNFIRFAI  577

Query  411   NIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
             N+ARMAQC YQ+GDGH I + +++ R+  LL
Sbjct  578   NLARMAQCTYQNGDGHTIQH-KSKNRVLPLL  607



>sp|Q8L5K4.1|GTPS_CITLI RecName: Full=Gamma-terpinene synthase, chloroplastic; Short=ClgammaTS; 
Flags: Precursor [Citrus limon]
 gb|AAM53943.1|AF514286_1 gamma-terpinene synthase [Citrus limon]
Length=600

 Score =   469 bits (1206),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 261/562 (46%), Positives = 361/562 (64%), Gaps = 46/562 (8%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNE----EMREVE  1744
             T  RRSA+YGP  W + YIQSL++  Y  E +  + ++LKE+V  ML+ +    ++  + 
Sbjct  53    TIIRRSADYGPTIWSFDYIQSLDS-KYKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLH  111

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L RLG SYHFE+EI   L  I+               K LYA AL+FR+LRQ 
Sbjct  112   QLELIDNLHRLGVSYHFEDEIKRTLDRIHN----------KNTNKSLYARALKFRILRQY  161

Query  1563  GFNIS-QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNL---------EL  1414
             G+    ++ F  FMD K     +S S++ KG+L LYE+++L +E E+++           
Sbjct  162   GYKTPVKETFSRFMDEKGSFKLSSHSDECKGMLALYEAAYLLVEEESSIFRDAIRFTTAY  221

Query  1413  ARDFSAKH-------------LKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLE  1273
              +++ AKH             +KH L++PLHWRM RLEAR FI+ Y+ G     N ILLE
Sbjct  222   LKEWVAKHDIDKNDNEYLCTLVKHALELPLHWRMRRLEARWFIDVYESGPDM--NPILLE  279

Query  1272  LAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCR  1093
             LAK+D+NIVQAVH EDLK VSRWWKK+ + E+L FARDRVVENF WT+G    P++  CR
Sbjct  280   LAKVDYNIVQAVHQEDLKYVSRWWKKTGLGEKLNFARDRVVENFFWTVGDIFEPQFGYCR  339

Query  1092  IMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFV  913
              M A +   + ++DD+YD+YGTLDEL+LFTD +ERW D T  E LP YM+ C+ AL N V
Sbjct  340   RMSAMVNCLLTSIDDVYDVYGTLDELELFTDAVERW-DATTTEQLPYYMKLCFHALYNSV  398

Query  912   NEIAYDMLKEHGV-FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCP  736
             NE+ +  L++  V  I+ +L+K WAD CK+YL EAKWY SGY PT +EY+ENAWI+++ P
Sbjct  399   NEMGFIALRDQEVGMIIPYLKKAWADQCKSYLVEAKWYNSGYIPTLQEYMENAWISVTAP  458

Query  735   LILAHVF-FYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
             ++L H + F  N + ++A  L+ L D P+IIR+SS+I+RL +D GTS  E+KRGDVPK+I
Sbjct  459   VMLLHAYAFTANPITKEA--LEFLQDSPDIIRISSMIVRLEDDLGTSSDELKRGDVPKSI  516

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             QCYM E  VS +EAR+ I   + E W KMN             FI +AMN+ RM+QCMY 
Sbjct  517   QCYMHETGVSEDEAREHIRDLIAETWMKMNSARFGNPPYLPDVFIGIAMNLVRMSQCMYL  576

Query  378   HGDGHGINNFETQTRIQTLLFE  313
             +GDGHG+    T+ R+ +L  +
Sbjct  577   YGDGHGVQE-NTKDRVLSLFID  597



>gb|ABP01684.1| pinene synthase [Rosmarinus officinalis]
Length=599

 Score =   469 bits (1206),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 258/550 (47%), Positives = 355/550 (65%), Gaps = 27/550 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P +WD++YIQSLNT  Y  E  + R  EL  +VK +LK E+   V+++E+ID+
Sbjct  54    RRSGNYQPSSWDFNYIQSLNTP-YKEERQLNREAELIVQVKMLLK-EKREYVKQLELIDD  111

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             LK LG SY F++EI E L  IY + K   N+    +E+DLY  AL FR+LRQ+GFN+SQ+
Sbjct  112   LKYLGLSYFFQDEIKEILGFIYNEHKWLDNSE--ADERDLYLKALGFRILRQHGFNVSQE  169

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             VFD F + K   F ASL++DTKG+L LYE++FL  EGE  LELAR F+ K L        
Sbjct  170   VFDCFKNEKGSDFKASLAQDTKGILQLYEAAFLLREGEDTLELARAFATKCLQKKLDEGG  229

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   +    N ++ ELAKLDFNI+QA
Sbjct  230   DGIDENLLSWIRHSLDLPLHWRIQRLEARWFLDAY--ARRPDMNPLIFELAKLDFNIIQA  287

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              + ++LK VSRWW +  +AE+L F RDR+VE++ W +G+    +Y   R M   +     
Sbjct  288   TYQQELKDVSRWWNRLGLAEKLPFVRDRIVESYFWGVGMFEPNQYGYQRKMSGIIIMLAT  347

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWD-DVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
              +DD+YD+YGTLDELQLFTDTI  +  D   +  LP YM+ CYLAL NFV+E+AYD LKE
Sbjct  348   VIDDVYDVYGTLDELQLFTDTIRSFSWDTESISQLPYYMQLCYLALYNFVSELAYDNLKE  407

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
                  + +L K W DL +AYL+EAKWY SGYTP+ EEY+ NA I+I+ P I++ + F + 
Sbjct  408   QHFISIPYLHKSWVDLAEAYLKEAKWYYSGYTPSLEEYLSNAKISIASPNIISQLHFTLA  467

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
             N + D   ++ L  Y  I+ LS ++LRLA+D GT+PFE+KRGDV KAIQC+M +   S  
Sbjct  468   NSSTDKWSIESLYQYHNILNLSGMLLRLADDVGTAPFELKRGDVQKAIQCHMKDRNASEK  527

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             EA++ +   + E WK+MN   +  G PF+   +  A N+ R+AQ MY  GDGHG+ +   
Sbjct  528   EAQEHVMFLLREAWKEMN-TAMADGYPFADELVAAAANLGRVAQFMYLEGDGHGVQHSGI  586

Query  342   QTRIQTLLFE  313
               ++  LLFE
Sbjct  587   HQQMAGLLFE  596



>gb|ACN42011.1| linalool synthase [Perilla frutescens var. hirtella]
Length=604

 Score =   469 bits (1206),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 260/551 (47%), Positives = 361/551 (66%), Gaps = 28/551 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRS NY P  WD++Y+QSLNTTHY  E  + R  EL E+VK ML +EEM  V+K++++
Sbjct  60    TARRSGNYQPSLWDFNYLQSLNTTHYKEERHLKREAELIEQVK-MLLDEEMGAVQKLDLV  118

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D+LK LG SY FE++I + L  IY + +   +N +A +E+DLY TAL FR+LRQ+GF +S
Sbjct  119   DDLKNLGLSYFFEDQIKQILTFIYNEHECFRSNVEA-KERDLYFTALGFRLLRQHGFQVS  177

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL------  1387
             Q+VFD F + +   F ASL +DTKGL+ LYE+SFL  EGE  LELAR ++ K L      
Sbjct  178   QEVFDCFKNEEGSDFKASLGDDTKGLVQLYEASFLLREGEDTLELARQYATKFLQKKVDH  237

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          +H L++PLHWR+ RLEAR F+++Y        N I+LELAKLDFNI+
Sbjct  238   ELIDDDSNLLSWIRHSLEIPLHWRIQRLEARWFLDAY--ATRHDVNPIILELAKLDFNII  295

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             QA   E+LK +SRWW  + + E+L F RDR+VE++ W I L    +Y   R + AK+ + 
Sbjct  296   QATQQEELKDLSRWWNSTCLVEKLPFVRDRLVESYFWAIALFEPHQYGYHRKIAAKIITL  355

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I ++DD+YDIYGTLDELQLFTD I+RW D   +  L  YM+  Y+ L NFV+E+AYD LK
Sbjct  356   ITSLDDVYDIYGTLDELQLFTDAIQRW-DTESISRLAYYMQLFYMVLYNFVSELAYDGLK  414

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
             E G   + +L++ WADL +AYL+EAKW+ +GYTP+ EEY+ NA+I+I    +++ VFF +
Sbjct  415   EKGFITIPYLQRSWADLVEAYLKEAKWFYNGYTPSMEEYLNNAYISIGATPVISQVFFTL  474

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
                + D  V++ L +Y  I+RLS +++RL +D GTSPFEMKRGDVPK I+ YM E   + 
Sbjct  475   AT-SIDKPVIESLYEYHRILRLSGMLVRLPDDLGTSPFEMKRGDVPKTIELYMKERNATE  533

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              EA++ +   + E W++MN        PF+   +  A N+ R AQ MY  GDG   N+ +
Sbjct  534   IEAQEHVRFLIREAWREMNTATAAADCPFTDDLVAAAANLGRAAQFMYLDGDG---NHSQ  590

Query  345   TQTRIQTLLFE  313
                RI +LLFE
Sbjct  591   LHQRIASLLFE  601



>ref|XP_006351728.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=596

 Score =   468 bits (1204),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 257/555 (46%), Positives = 347/555 (63%), Gaps = 46/555 (8%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD---MLKNEEMREVE-K  1741
             T RRS NY P TWD+ YIQS++  +Y  + ++ R DE+K+ +K    M+ +  ++E++ K
Sbjct  53    TIRRSGNYKPTTWDFQYIQSIDN-NYVGDMYMERLDEVKKEMKKNLMMMVDGSIQELDVK  111

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID L+RLG SYHF++EIM+ L  I+ +               LY+TAL+FR+ RQ G
Sbjct  112   LELIDNLERLGVSYHFKDEIMQILKSIHDQN--------VATGHSLYSTALKFRLFRQYG  163

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             F+ISQD+ + FMD +      S+  DTKGLL LYE+SFLS E ET+L      +  HL  
Sbjct  164   FHISQDILNNFMD-ENDNLKQSICNDTKGLLKLYEASFLSTENETSLRNTTKSTLTHLMR  222

Query  1383  ------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLD  1258
                               H L++P HW MPRLE R +I  Y++      N +LLELAKLD
Sbjct  223   YVDQNRCGEENIMVELVVHALELPRHWMMPRLETRWYISIYERMPNA--NPLLLELAKLD  280

Query  1257  FNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAK  1078
             FNIVQA H +DL+ +SRWWK + +AE+L F+RD +VEN  W +G    P++   R +  K
Sbjct  281   FNIVQATHQQDLRILSRWWKNTGLAEKLPFSRDILVENMFWAVGALFEPQHSYFRRLITK  340

Query  1077  LYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAY  898
             +  FI  +DDIYD+YGTLDEL+LFT  I+RWD    +E LPDYM+ CYLAL N +NE+AY
Sbjct  341   VIVFISIIDDIYDVYGTLDELELFTLAIQRWD-TKAMEQLPDYMKVCYLALINIINEVAY  399

Query  897   DMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHV  718
             ++LK H + +L +L K WADLCK+YLQEAKWY +GY P FEEY++NA I+I+ P++L H 
Sbjct  400   EVLKNHDINVLPYLTKSWADLCKSYLQEAKWYHNGYKPNFEEYMDNARISIAVPMVLVHS  459

Query  717   FFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEA  538
              F V N     A LD L +YP+IIR S+ I R  +D GTS  E+KRGDV K+IQCYM+E 
Sbjct  460   LFLVTNQITKEA-LDSLNNYPDIIRWSATIFRFTDDLGTSSDELKRGDVSKSIQCYMNEK  518

Query  537   KVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI  358
               S  EAR+ I   + E W+ MN       SPFS TFI +  NI R +  MY H D    
Sbjct  519   GASEEEAREHITFLIKETWEAMNTAQ-RKNSPFSDTFIGIVKNITRTSHFMYLHND----  573

Query  357   NNFETQTRIQTLLFE  313
                  ++ I  +LFE
Sbjct  574   ----VKSSISKILFE  584



>gb|AHY21666.1| multiproduct monoterpene synthase [Populus nigra]
Length=593

 Score =   468 bits (1203),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 364/588 (62%), Gaps = 41/588 (7%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFRMCYHT------------TTTTRRSANYGPPTWDYSYIQ  1852
             F   T  K     R+   SS   C+ +             +  RRS NY  P WD+ ++Q
Sbjct  9     FPISTVTKRTFSRRTSLGSSRNGCFPSEVRCMVATETCDQSIARRSGNYPTPFWDHKFLQ  68

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEA  1672
             SL T+ Y  E +  + ++LKE V+DML+ + +  V ++E+ID L+RLG +YHFE EI   
Sbjct  69    SL-TSEYVGEPYTGQANKLKETVRDMLE-KPLDAVYQLELIDNLQRLGVAYHFELEIK--  124

Query  1671  LMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASL  1492
                I   +           ++DLYAT++EFR+LRQ+G+N+ QDVF+ F D ++  F   L
Sbjct  125   --SILESRWTDYKKDNREMKEDLYATSVEFRLLRQHGYNVPQDVFNSFKD-EQGNFKNCL  181

Query  1491  SEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPL  1363
              +D KG+LNLYE+S+    GE+ LE ARDFS KHLK                 H L++PL
Sbjct  182   RDDVKGMLNLYEASYYLGNGESILEEARDFSEKHLKEYSKEQNEDHYLSLLVNHSLELPL  241

Query  1362  HWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIA  1183
             HWRM R+EAR FI++Y  G+    N ILLE A LDFN+VQA + ED++  SRWW    + 
Sbjct  242   HWRMQRMEARWFIDAY--GRKRDLNPILLEFAGLDFNMVQAKYQEDIRHASRWWTSMDLG  299

Query  1182  ERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFT  1003
              +L + RDR++EN LW +G    P++   R M  ++ + I  +DD YD+YGTL+EL++FT
Sbjct  300   NKLFYTRDRLMENTLWAVGEVFEPQFGYYRKMATRVNALITTLDDAYDVYGTLEELEVFT  359

Query  1002  DTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAY  823
             D IERWD +  ++ LP YM+  + AL   +NEI Y++LKE G+ ++  L+K+W DLC+A+
Sbjct  360   DVIERWD-INALDQLPYYMKISFFALFQSINEIGYNILKEQGINVVPSLKKLWGDLCRAF  418

Query  822   LQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiir  643
             L+EAKWY + YTPT +EY++NAW++IS  +IL H FF V N   + AV  C  +YP++IR
Sbjct  419   LKEAKWYYAAYTPTLQEYLDNAWLSISGQVILGHAFFLVTNQLTEEAV-RCCMEYPDLIR  477

Query  642   lssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKV  463
              SS ILRLA+D GTS  E+ RGD PK+IQCYM E   +  EAR+ +   ++E WKK+N  
Sbjct  478   YSSTILRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKKLN-A  536

Query  462   GIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
              I    PFS  F+ + M++AR AQC Y+ GD +GI + ET  R+ +L 
Sbjct  537   EILKPYPFSKKFMGIPMDLARTAQCFYEAGDAYGIQDQETHGRLASLF  584



>ref|XP_011015877.1| PREDICTED: terpene synthase 10-like [Populus euphratica]
Length=603

 Score =   468 bits (1204),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/548 (45%), Positives = 355/548 (65%), Gaps = 29/548 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  RRS NY  P WD+ ++QSL T+ Y  E +  + ++LKE V+DMLK + +  V ++E+
Sbjct  49    SIARRSGNYPTPFWDHKFLQSL-TSEYVGEPYTGQANKLKETVRDMLK-KPLDAVYQLEL  106

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHFE EI      I   +           ++DLYAT++EFR+LRQ+G+N+
Sbjct  107   IDNLQRLGVAYHFELEIK----SILESRWNHYKEDNREMKEDLYATSVEFRLLRQHGYNV  162

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              QDVF+ F D +   F   L +D KG+LNLYE+S+  + GET LE ARDFS KHLK    
Sbjct  163   PQDVFNSFKD-EHGNFKNCLRDDVKGMLNLYEASYYLVNGETILEEARDFSEKHLKEYCK  221

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++PLHWRM R+EAR FI++Y  G+    N +LLE A LDFN+VQ
Sbjct  222   EQNEDHYLSLLVNHSLELPLHWRMQRMEARWFIDAY--GRKRDLNPVLLEFAGLDFNMVQ  279

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A +LED++  SRWW    +  +L + RDR++EN LW +G    P++   R M  ++ + I
Sbjct  280   AKYLEDIRHESRWWTSMDLGNKLFYTRDRLMENTLWAVGEVFEPRFGYYRKMATRVNALI  339

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
               +DD YD+YGTL+EL++FTD IE WD +  ++ LP YM+  + AL   +NEI Y++LK+
Sbjct  340   TTLDDAYDVYGTLEELEVFTDVIESWD-INALDQLPYYMKISFFALFQSINEIGYNILKD  398

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              G+ ++  L+K+W DLC+A+L+EAKWY +GYTPT +EY++NAW++IS  +IL H  F V 
Sbjct  399   QGINVVPSLKKLWGDLCRAFLKEAKWYYAGYTPTLQEYLDNAWLSISGQVILGHALFLVT  458

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
             N   + AV  C  +YP++IRLSS I+RLA+D GTS  E+ RGD PK+IQCYM E   +  
Sbjct  459   NQLTEEAV-RCCMEYPDLIRLSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQ  517

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             EAR+ +   ++E WKK+N   I    PFS  F+ + M++AR AQC Y+ GD +GI + ET
Sbjct  518   EAREHVRYLIHETWKKLN-AEILKPYPFSKKFMGIPMDLARTAQCFYESGDAYGIQDQET  576

Query  342   QTRIQTLL  319
               R+ +L 
Sbjct  577   HGRLASLF  584



>ref|XP_006467489.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|KDO78141.1| hypothetical protein CISIN_1g006994mg [Citrus sinensis]
Length=622

 Score =   468 bits (1204),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 271/577 (47%), Positives = 373/577 (65%), Gaps = 43/577 (7%)
 Frame = -3

Query  1947  ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLK  1768
             A+++  +C     + RRSANY P  W Y Y+QSL +  Y  E +  R ++LK  V+ ML+
Sbjct  46    AANATSVC-EKAISNRRSANYQPSMWGYDYLQSL-SNEYVVESYAQRIEKLKGEVRLMLE  103

Query  1767  NEEMREVE---KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn-nyKATEEKDLY  1600
             N+E+  V+   ++E++D L+RLG SYHFE+EI   L  IY ++   S+ + K  +E  LY
Sbjct  104   NKEVDYVDALHQLEIVDNLQRLGVSYHFEDEIKRFLSRIYNERNSRSSYHAKEKQESSLY  163

Query  1599  ATALEFRVLRQNGFNI-SQDV------FDGFMDGKRCGFNASLSEDTKGLLNLYESSFLS  1441
             A ALEFR+LRQ+GF++ +QDV         FMD K     + L +D KG+L LYE+++L 
Sbjct  164   AVALEFRLLRQHGFDMHAQDVRVAVGTLSLFMDEK-GKLKSCLGDDIKGILALYEAAYLL  222

Query  1440  MEGETNL-ELARDFSAKHLK-------------------HELKMPLHWRMPRLEARSFIE  1321
             +E E+N+   A +F+  HLK                   H L++PLHWRM RLEAR FI+
Sbjct  223   VEEESNIFNEAINFTTTHLKEYVKHNNNDDDGYLSTLVEHALELPLHWRMVRLEARWFID  282

Query  1320  SYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENF  1141
              Y +G     N +L+ELAKLDFN VQA H E+LK VSRWW+K+ + E L FARDR++ENF
Sbjct  283   MYQRGPDV--NQVLVELAKLDFNAVQAEHQEELKYVSRWWRKTGLGE-LHFARDRIMENF  339

Query  1140  LWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEH  961
              W +G    P++  CR M  K  + I  +DD+YD+YGTLDEL+LFT+ +ERWD V  ++ 
Sbjct  340   FWALGEVWEPQFGYCRRMSTKANALITTIDDVYDVYGTLDELELFTNAVERWD-VNAMDQ  398

Query  960   LPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPT  781
             LP YM+ C+L L+N  NE+A+D+LK+ GV I+ +L+K WAD+CK++L EAKWY+SGY PT
Sbjct  399   LPYYMKLCFLVLHNSTNEMAFDVLKKQGVHIIPYLKKAWADMCKSFLLEAKWYSSGYIPT  458

Query  780   FEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGT  601
              EEY++NAWI++S P+IL H +  + N     A L  L +YP IIR  S+I RLAND  T
Sbjct  459   LEEYMDNAWISVSGPVILLHAYTLIANPPTKEA-LQFLEEYPNIIRWPSMIFRLANDLAT  517

Query  600   SPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP--FSGT  430
             S  E+KRGDVPKAIQCYM E   S ++AR+ I   +   W KMN K G E       S  
Sbjct  518   SSDEVKRGDVPKAIQCYMHETGASESDAREHIRDLITATWMKMNSKDGDENPDHLLLSNN  577

Query  429   FIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
             FI  A+N+ARMAQC YQ+GDGH I + +++ R+  LL
Sbjct  578   FIRFAINLARMAQCTYQNGDGHTIQH-KSKNRVLPLL  613



>sp|O81192.1|BPPS_SALOF RecName: Full=(+)-bornyl diphosphate synthase, chloroplastic; 
Short=BPPS; AltName: Full=(+)-alpha-pinene synthase; AltName: 
Full=(+)-camphene synthase; AltName: Full=SBS; Flags: Precursor 
[Salvia officinalis]
 gb|AAC26017.1| (+)-bornyl diphosphate synthase [Salvia officinalis]
Length=598

 Score =   466 bits (1200),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 265/579 (46%), Positives = 359/579 (62%), Gaps = 30/579 (5%)
 Frame = -3

Query  1992  STFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFV  1813
             +    C  P+  R  AS S ++        RRS NY P  WD +YIQSLNT  Y  E  +
Sbjct  28    ALLVPCTAPTA-RLRASCSSKL--QEAHQIRRSGNYQPALWDSNYIQSLNTP-YTEERHL  83

Query  1812  MRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn  1633
              R+ EL  +V+ +LK E+M  V+++E+I +LK LG S  F++EI E L  IY + K   N
Sbjct  84    DRKAELIVQVRILLK-EKMEPVQQLELIHDLKYLGLSDFFQDEIKEILGVIYNEHKCFHN  142

Query  1632  nyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYES  1453
             N    E+ DLY TAL FR+LRQ+GFNISQDVF+ F + K   F ASL++DTKG+L LYE+
Sbjct  143   NE--VEKMDLYFTALGFRLLRQHGFNISQDVFNCFKNEKGIDFKASLAQDTKGMLQLYEA  200

Query  1452  SFLSMEGETNLELARDFSAKHL-------------------KHELKMPLHWRMPRLEARS  1330
             SFL  +GE  LELAR+F+ K L                   +H L +PLHWR+  +EAR 
Sbjct  201   SFLLRKGEDTLELAREFATKCLQKKLDEGGNEIDENLLLWIRHSLDLPLHWRIQSVEARW  260

Query  1329  FIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVV  1150
             FI++Y   +    N ++ ELAKL+FNI+QA H ++LK +SRWW +    E+L F RDR+V
Sbjct  261   FIDAY--ARRPDMNPLIFELAKLNFNIIQATHQQELKDLSRWWSRLCFPEKLPFVRDRLV  318

Query  1149  ENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTK  970
             E+F W +G+    ++   R M A +      +DDIYD+YGTLDEL+LFTDT +RWD    
Sbjct  319   ESFFWAVGMFEPHQHGYQRKMAATIIVLATVIDDIYDVYGTLDELELFTDTFKRWD-TES  377

Query  969   VEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGY  790
             +  LP YM+ CY  ++N++++ AYD+LKEHG F L +LRK   DL +AY  EAKWY SGY
Sbjct  378   ITRLPYYMQLCYWGVHNYISDAAYDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHSGY  437

Query  789   TPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAND  610
             TP+ +EY+  A I+++ P I++  +F   N + D AV+D L  Y +I+ L+ IILRL +D
Sbjct  438   TPSLDEYLNIAKISVASPAIISPTYFTFANASHDTAVIDSLYQYHDILCLAGIILRLPDD  497

Query  609   KGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGT  430
              GTS FE+ RGDVPK IQCYM E   S  EA + +   + E WK MN   I  G PF   
Sbjct  498   LGTSYFELARGDVPKTIQCYMKETNASEEEAVEHVKFLIREAWKDMN-TAIAAGYPFPDG  556

Query  429   FIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              +  A NI R+AQ +Y HGDG G+ + +T   I  LLFE
Sbjct  557   MVAGAANIGRVAQFIYLHGDGFGVQHSKTYEHIAGLLFE  595



>ref|XP_009602962.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=514

 Score =   463 bits (1191),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 249/538 (46%), Positives = 340/538 (63%), Gaps = 70/538 (13%)
 Frame = -3

Query  1872  WDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHF  1693
             WD+ YIQS++   YA E ++ R ++LKE +K ++  E  +E+EK+E+ID L+RLG SYHF
Sbjct  2     WDFEYIQSIHND-YAGEKYMKRFNKLKEEMKKLIMAEGSQELEKLELIDNLQRLGVSYHF  60

Query  1692  EEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKR  1513
             + EIM+ L +I         N  A     LYATAL+FR+LR++GF+ISQ           
Sbjct  61    KHEIMQILSNI---------NLNAATGDSLYATALKFRLLREHGFHISQ-----------  100

Query  1512  CGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------  1384
                                      E ET L+ A  F+A HLK                 
Sbjct  101   -------------------------ETETTLKYATRFTAAHLKNYLGNHCDHKDNRMVAL  135

Query  1383  --HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVS  1210
               H L++P HW MPRLE + +I  Y+    ++ N +LLELAKLDFNIVQAVH +DL+ +S
Sbjct  136   AQHALELPRHWMMPRLETQWYISIYE--IMSNANPLLLELAKLDFNIVQAVHQQDLRILS  193

Query  1209  RWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYG  1030
             RWWK + +AE+L+F+RDR+VEN  W +G+   P++   R M  K+ +F+  +DDIYD+YG
Sbjct  194   RWWKSTCLAEKLSFSRDRLVENLFWAVGIEFEPQHSYFRRMLTKVIAFVGIIDDIYDVYG  253

Query  1029  TLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRK  850
             TLDEL++FTD IERW ++  +E LP YM+ CYLAL N  NE+AY++LKE G+ +L +L K
Sbjct  254   TLDELEVFTDAIERW-EIKAIEQLPHYMKVCYLALFNITNEMAYEILKEQGIDVLPYLTK  312

Query  849   MWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDC  670
              WADLCK++++EA+WY SGY PT EEY++NAWI+I+ P++L H FF V N     A L+ 
Sbjct  313   SWADLCKSFIREARWYYSGYVPTLEEYMDNAWISIAVPMVLVHAFFLVTNPVPKEA-LES  371

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
             L+ YP++IR S+ I RLA+D  TS  E+KRGDVPK+IQCYM+E   S  EAR+ I   + 
Sbjct  372   LSKYPDLIRCSATIFRLADDLATSSDELKRGDVPKSIQCYMNEKGTSEEEAREHIRFCIK  431

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             E W++MN    E  S FS TF+E+  NIAR A CMY HGDGHGI N E +  I  +L 
Sbjct  432   ETWERMNTTQRE-NSLFSDTFVEITKNIARTAHCMYLHGDGHGIQNGEVKNSISKILL  488



>gb|AHY39266.1| linalool synthase [Perilla citriodora]
Length=602

 Score =   466 bits (1199),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 258/551 (47%), Positives = 361/551 (66%), Gaps = 28/551 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRS NY P  WD++Y++SLNTTHY  E  + R  EL E+VK ML +EEM  V+++E++
Sbjct  58    TARRSGNYQPSLWDFNYLRSLNTTHYKEERHLKREAELIEQVK-MLLDEEMEAVQQLELV  116

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D+LK LG SY FE++I + L  IY + +   +N +A EE+DLY TAL FR+LRQ+   +S
Sbjct  117   DDLKNLGLSYFFEDQIKQILTFIYNEHECFRSNVEA-EERDLYFTALGFRLLRQHSLQVS  175

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL------  1387
             Q+VFD F + +   F ASL +DTKGL+ LYE+SFL  EGE  LELAR ++ K L      
Sbjct  176   QEVFDCFKNEEGSDFKASLGDDTKGLVQLYEASFLLREGEDTLELARQYATKFLQKKVDH  235

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          +H L++PLHWR+ RLEAR F+++Y        N I+LELAKLDFNI+
Sbjct  236   ELIDDDNNLLSWIRHSLEIPLHWRIQRLEARWFLDAY--AMRHDVNPIILELAKLDFNII  293

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             QA   E+LK +SRWW  + +AE+L F RDR+VE++ W I L    ++   R + AK+ + 
Sbjct  294   QATQQEELKDLSRWWNSTCLAEKLPFVRDRLVESYFWAIALFEPHQFGYHRKIAAKIITL  353

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I ++DD+YDIYGTLDELQLFTD I+RW D   +  LP YM+  Y+ L NF++E+AYD LK
Sbjct  354   ITSLDDVYDIYGTLDELQLFTDAIQRW-DTESISRLPYYMQLFYMVLYNFISELAYDGLK  412

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
             E G   + +L++ WADL +AYL+EAKW+ +GYTP+ EEY+ NA+I+I    +++ VFF +
Sbjct  413   EKGFITIPYLQRSWADLVEAYLKEAKWFYNGYTPSMEEYLNNAYISIGATPVISQVFFTL  472

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
                + D  V++ L +Y  I+RLS +++RL +D GTS FEM+RGDVPKAI+ YM E   + 
Sbjct  473   AT-SIDKPVIESLYEYHRILRLSGMLVRLPDDLGTSSFEMRRGDVPKAIELYMKERNATE  531

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              EA++ +   + E WK+MN        PF+   +  A N+ R AQ MY  GDG   N+ +
Sbjct  532   IEAQEHVRFLIREAWKEMNTATTVADCPFTDDLVAAAANLGRAAQFMYLDGDG---NHSQ  588

Query  345   TQTRIQTLLFE  313
                RI +LLFE
Sbjct  589   LHQRIASLLFE  599



>ref|XP_006388836.1| hypothetical protein POPTR_0092s00200g [Populus trichocarpa]
 gb|ERP47750.1| hypothetical protein POPTR_0092s00200g [Populus trichocarpa]
Length=593

 Score =   466 bits (1198),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 246/548 (45%), Positives = 355/548 (65%), Gaps = 29/548 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  RRS NY  P WD+ ++QSL T+ Y  E +  + ++LKE V+DML+ + +  V ++E+
Sbjct  49    SIARRSGNYPTPFWDHKFLQSL-TSEYVGEPYTGQANKLKETVRDMLE-KPLDAVYQLEL  106

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHFE EI      I   +           ++DLYAT++EFR+LRQ+G+N+
Sbjct  107   IDNLQRLGVAYHFELEIK----SILESRWNDYKKDNREMKQDLYATSVEFRLLRQHGYNV  162

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
              QDVF+ F D ++  F   L +D KG+LNLYE+S+  + GE+ LE ARDFS KHLK    
Sbjct  163   PQDVFNSFKD-EQGNFKNCLRDDVKGMLNLYEASYYLVNGESILEEARDFSEKHLKEYSK  221

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L++PLHWRM R+EAR FI++Y  G+    N ILLE A LDFN+VQ
Sbjct  222   EQNEDHYLSLLVNHSLELPLHWRMQRMEARWFIDAY--GRKRDLNPILLEFAGLDFNMVQ  279

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A + ED++  SRWW    +  +L + RDR++EN LWT+G    P++   R M  ++ + I
Sbjct  280   AKYQEDIRHASRWWTSMDLGNKLFYTRDRLMENTLWTVGEEFEPQFGYYRKMATRVNALI  339

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
               +DD YD+YGTL+EL++FTD IE WD +  ++ LP YM+  + AL   +NEI Y++LKE
Sbjct  340   TTLDDAYDVYGTLEELEVFTDVIESWD-INALDQLPYYMKISFFALFQSINEIGYNILKE  398

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
              G+ ++  ++K+W DLC+A+L+EAKWY +GYTPT +EY++NAW++IS  +IL H FF V 
Sbjct  399   QGINVVPSMKKLWGDLCRAFLKEAKWYYAGYTPTLQEYLDNAWLSISGQVILGHAFFLVT  458

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
             N   + AV  C  +YP++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM E   +  
Sbjct  459   NQLTEEAV-RCCMEYPDLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQ  517

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             EAR+ +   ++E WKK+N   I    PFS  F+ + M++AR AQ  Y+ GD +GI + ET
Sbjct  518   EAREHVRYLIHETWKKLN-AEILKPYPFSKKFMGIPMDLARTAQSFYEAGDAYGIQDQET  576

Query  342   QTRIQTLL  319
               R+ +L 
Sbjct  577   HGRLASLF  584



>ref|XP_006365870.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Solanum 
tuberosum]
Length=501

 Score =   462 bits (1190),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 337/506 (67%), Gaps = 28/506 (6%)
 Frame = -3

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML+      +E++E+ID L+RLG  YHFEEEI   L    +    +  +    E   +YA
Sbjct  1     MLEKIITNSLEQLELIDILQRLGIYYHFEEEIHTVLKQTCVSYNYNKRDLNNEE---VYA  57

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
              ALEFR+LRQ G+++ Q++F  FM+ K   F  +L EDTKGLL+LYE+S+L ME E  +E
Sbjct  58    VALEFRLLRQQGYHVPQEIFCSFMN-KEGKFKTALVEDTKGLLSLYEASYLCMEDENIME  116

Query  1416  LARDFSAKHL-----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNN  1288
              ARDF+  +L                  H L+MP+HWRM RLEAR FIE Y K  T + N
Sbjct  117   NARDFATHYLMESLKKKKMDENVGEQVSHALEMPVHWRMERLEARWFIEIYHK--TENMN  174

Query  1287  AILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPK  1108
              +LLELAKLD+N+VQA +LE+LK +SRW K   + ++++F RDR+VE F W +G TPNP+
Sbjct  175   PLLLELAKLDYNMVQATYLEELKQMSRWDKNIKLVKKMSFVRDRLVEGFFWAVGFTPNPQ  234

Query  1107  YVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLA  928
             +  CR +  KL   I  +DDIYD+YGTLDEL+LFTD ++RW D+   E LP+YM+  +LA
Sbjct  235   FGFCRKLSTKLAVLITTIDDIYDVYGTLDELELFTDIVDRW-DINATEQLPEYMKISFLA  293

Query  927   LNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWIT  748
             L N +NE+AYD+LKE G  I+  +RK WA+LCKAYL E KWY  GYTPT  E++ NAWI+
Sbjct  294   LFNSMNELAYDILKEQGFSIISQIRKQWANLCKAYLLEVKWYQRGYTPTLNEFLRNAWIS  353

Query  747   ISCPLILAHVFFYVNN-LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDV  571
              + P+++ H +F + N + ED   L+CL  YP II   S+ILRLAND GTSP E+K+GD 
Sbjct  354   NTGPVLIMHAYFCITNPIKEDE--LECLNHYPPIIYSPSLILRLANDLGTSPDEIKKGDH  411

Query  570   PKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQ  391
              K+IQCYM ++K S   AR++I   +++ W KMN+  +   S FS  F   +MN+AR++Q
Sbjct  412   LKSIQCYMHDSKCSEENARNYIQKLIDQTWMKMNRDILRDQS-FSKDFRRTSMNLARISQ  470

Query  390   CMYQHGDGHGINNFETQTRIQTLLFE  313
             C+YQHGDG GI + ET+ RI +L FE
Sbjct  471   CIYQHGDGFGIPDRETKDRILSLFFE  496



>pdb|1N1B|A Chain A, Crystal Structure Of (+)-bornyl Diphosphate Synthase 
From Sage
 pdb|1N1B|B Chain B, Crystal Structure Of (+)-bornyl Diphosphate Synthase 
From Sage
 pdb|1N1Z|A Chain A, (+)-Bornyl Diphosphate Synthase: Complex With Mg And 
Pyrophosphate
 pdb|1N1Z|B Chain B, (+)-Bornyl Diphosphate Synthase: Complex With Mg And 
Pyrophosphate
 pdb|1N20|A Chain A, (+)-bornyl Diphosphate Synthase: Complex With Mg And 
3-aza- 2,3-dihydrogeranyl Diphosphate
 pdb|1N20|B Chain B, (+)-bornyl Diphosphate Synthase: Complex With Mg And 
3-aza- 2,3-dihydrogeranyl Diphosphate
 pdb|1N21|A Chain A, (+)-Bornyl Diphosphate Synthase: Cocrystal With Mg And 
3- Aza-2,3-Dihydrogeranyl Diphosphate
 pdb|1N22|A Chain A, (+)-Bornyl Diphosphate Synthase: Complex With Mg, Pyrophosphate, 
And (4r)-7-Aza-7,8-Dihydrolimonene
 pdb|1N22|B Chain B, (+)-Bornyl Diphosphate Synthase: Complex With Mg, Pyrophosphate, 
And (4r)-7-Aza-7,8-Dihydrolimonene
 pdb|1N23|A Chain A, (+)-Bornyl Diphosphate Synthase: Complex With Mg, Pyrophosphate, 
And (1r,4s)-2-Azabornane
 pdb|1N23|B Chain B, (+)-Bornyl Diphosphate Synthase: Complex With Mg, Pyrophosphate, 
And (1r,4s)-2-Azabornane
 pdb|1N24|A Chain A, (+)-Bornyl Diphosphate Synthase: Complex With Mg And 
Product
 pdb|1N24|B Chain B, (+)-Bornyl Diphosphate Synthase: Complex With Mg And 
Product
Length=549

 Score =   464 bits (1193),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 259/549 (47%), Positives = 349/549 (64%), Gaps = 27/549 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD +YIQSLNT  Y  E  + R+ EL  +V+ +LK E+M  V+++E+I +
Sbjct  6     RRSGNYQPALWDSNYIQSLNTP-YTEERHLDRKAELIVQVRILLK-EKMEPVQQLELIHD  63

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             LK LG S  F++EI E L  IY + K   NN    E+ DLY TAL FR+LRQ+GFNISQD
Sbjct  64    LKYLGLSDFFQDEIKEILGVIYNEHKCFHNNE--VEKMDLYFTALGFRLLRQHGFNISQD  121

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             VF+ F + K   F ASL++DTKG+L LYE+SFL  +GE  LELAR+F+ K L        
Sbjct  122   VFNCFKNEKGIDFKASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLDEGG  181

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+  +EAR FI++Y   +    N ++ ELAKL+FNI+QA
Sbjct  182   NEIDENLLLWIRHSLDLPLHWRIQSVEARWFIDAY--ARRPDMNPLIFELAKLNFNIIQA  239

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              H ++LK +SRWW +    E+L F RDR+VE+F W +G+    ++   R M A +     
Sbjct  240   THQQELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGMFEPHQHGYQRKMAATIIVLAT  299

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DDIYD+YGTLDEL+LFTDT +RWD    +  LP YM+ CY  ++N++++ AYD+LKEH
Sbjct  300   VIDDIYDVYGTLDELELFTDTFKRWD-TESITRLPYYMQLCYWGVHNYISDAAYDILKEH  358

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G F L +LRK   DL +AY  EAKWY SGYTP+ +EY+  A I+++ P I++  +F   N
Sbjct  359   GFFCLQYLRKSVVDLVEAYFHEAKWYHSGYTPSLDEYLNIAKISVASPAIISPTYFTFAN  418

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
              + D AV+D L  Y +I+ L+ IILRL +D GTS FE+ RGDVPK IQCYM E   S  E
Sbjct  419   ASHDTAVIDSLYQYHDILCLAGIILRLPDDLGTSYFELARGDVPKTIQCYMKETNASEEE  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A + +   + E WK MN   I  G PF    +  A NI R+AQ +Y HGDG G+ + +T 
Sbjct  479   AVEHVKFLIREAWKDMN-TAIAAGYPFPDGMVAGAANIGRVAQFIYLHGDGFGVQHSKTY  537

Query  339   TRIQTLLFE  313
               I  LLFE
Sbjct  538   EHIAGLLFE  546



>ref|XP_009593950.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=608

 Score =   466 bits (1199),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 269/576 (47%), Positives = 368/576 (64%), Gaps = 41/576 (7%)
 Frame = -3

Query  1968  PSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKE  1789
             P ++ S  S++ +  +      RRS NY P TWD  YIQS++   Y  E ++ R ++LK+
Sbjct  43    PPLNHSTISTN-QSSFSDLNPIRRSGNYEPTTWDSEYIQSIHN-DYVGEKYIKRFNKLKK  100

Query  1788  RVKDMLK---NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKAT  1618
              +K+ +    NE   E++K+E+ID L+RLG SYHF +EIM+ L  I++          A+
Sbjct  101   EMKEKMMIMINEGSEELDKLELIDNLQRLGVSYHFNDEIMQILSSIHLN---------AS  151

Query  1617  EEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSM  1438
                 LYATAL+FR+LRQ+GF++SQD+ + F D +      SL  DT+ LL LYE+SFLS 
Sbjct  152   TGDSLYATALKFRLLRQHGFHVSQDILNDFKD-EHGHLKESLCVDTERLLQLYEASFLST  210

Query  1437  EGE-TNLELARDFSAKHL-------------------KHELKMPLHWRMPRLEARSFIES  1318
             E E T LE A  F+   L                   +H L++PLHW M R+E + +I  
Sbjct  211   ETESTFLECANIFAMSQLQNFLNNQLYEEDNVTVALVRHALELPLHWMMLRVETKWYINI  270

Query  1317  YDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFL  1138
             Y++   ++ NA+LLELAKLDFNIVQA H EDL+++SRWWK S +AE+L F RDR+VE FL
Sbjct  271   YER--MSNANALLLELAKLDFNIVQATHQEDLRNLSRWWKNSCLAEKLPFTRDRIVEAFL  328

Query  1137  WTIGLTPNP-KYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEH  961
             W  G+   P K   CR +  ++ +    +DDIYD+YGTLDEL+LFT  +ER + +  ++H
Sbjct  329   WIAGMMFEPQKNQLCRTLLTRVTAMATVIDDIYDVYGTLDELELFTCAVERME-LKAIDH  387

Query  960   LPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPT  781
             LPDYM+ CYLAL N V EIAY++LKE G+ I+ +L+K W DLCKAYLQEA+WY  GY PT
Sbjct  388   LPDYMKVCYLALFNTVTEIAYEVLKEQGINIIPYLQKPWGDLCKAYLQEARWYYEGYIPT  447

Query  780   FEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGT  601
              EEY++NAWIT+   +I+ + FF+V N     A L  L+ YP+IIR S+ I+RLA+D  T
Sbjct  448   LEEYMDNAWITVGSLVIVFNAFFFVTNPITKEA-LKYLSKYPDIIRWSATIIRLADDLAT  506

Query  600   SPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIE  421
             +  EMKRGDV K+IQCYM+E  VS  +A+  I   + E WK +N    E  S FS  FI 
Sbjct  507   TSDEMKRGDVAKSIQCYMNEKGVSEEDAKKHISSLIKETWKLINTAQRE-NSIFSEAFIR  565

Query  420   VAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              A+NIAR  Q +YQ+GDGHGI N+  + R   L FE
Sbjct  566   CAVNIARTGQSIYQYGDGHGIQNYMIKNRNSELFFE  601



>gb|ADK73617.1| terpene synthase 5 [Origanum vulgare]
Length=553

 Score =   464 bits (1193),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 252/548 (46%), Positives = 350/548 (64%), Gaps = 28/548 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E   +R++EL   VK +L  + M  V+++E+ID
Sbjct  14    SRRSGNYQPSLWDFNFIQSQPTHHYKEER--IRKEELIVNVKTLLGTK-MEAVKQLELID  70

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F++EI   L  I+ + K   NN       DLY TAL FR+LRQ+GFN+SQ
Sbjct  71    DLRNLGLSYFFQDEIKNILSFIHKENKSFQNNQVG----DLYFTALGFRLLRQHGFNVSQ  126

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  127   EVFNRFENDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLHKKVDEG  186

Query  1386  ----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                       +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA 
Sbjct  187   IDDDSVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQAT  244

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
              LE+LK VSRWW  S +AE+L F RDR+VE  LW + L    ++   R M A + +F+  
Sbjct  245   MLEELKEVSRWWTNSCLAEKLPFVRDRIVECHLWALALFEPHQFGYQRKMAAIIITFVTV  304

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ G
Sbjct  305   IDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDKG  363

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
                + +L + W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +   
Sbjct  364   FNSIPYLHRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLATS  423

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
              E   V++ +  Y  I+ LS +ILRLA+D GT+ FE+KRGDV KA+QCYM +  V+  EA
Sbjct  424   TE-KTVIESVYGYHNILYLSGMILRLADDLGTTQFELKRGDVQKAVQCYMKDKNVTEKEA  482

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             ++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E   
Sbjct  483   QEHVRYLIREAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIHK  542

Query  336   RIQTLLFE  313
             ++  LLFE
Sbjct  543   QMGGLLFE  550



>dbj|BAD27258.1| gamma-terpinene synthase [Citrus unshiu]
Length=600

 Score =   465 bits (1196),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 266/599 (44%), Positives = 373/599 (62%), Gaps = 49/599 (8%)
 Frame = -3

Query  2013  AIMAKMFSTFTTCKLPSIHRSH---ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLN  1843
              I++   S+     +P I R     A+S+  +     T  RRSA+YGP  W + YIQSL+
Sbjct  16    TILSLPLSSKVNGFVPPITRVQYPMAASTTSIKPVDQTIIRRSADYGPTIWSFDYIQSLD  75

Query  1842  TTHYAAEGFVMRRDELKERVKDMLKNE----EMREVEKMEMIDELKRLGCSYHFEEEIME  1675
             +  Y  E +  + ++LKE+V  ML+ +    ++  + ++E+ID L RLG SYHFE+EI  
Sbjct  76    SK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLHQLELIDNLHRLGVSYHFEDEIKR  134

Query  1674  ALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS-QDVFDGFMDGKRCGFNA  1498
              L  I+ K             K     AL+FR+LRQ G+N   ++ F  FMD K    ++
Sbjct  135   TLDRIHNKNLM----------KIYMPQALKFRILRQYGYNTPVKETFSHFMDEKGSFKSS  184

Query  1497  SLSEDTKGLLNLYESSFLSMEGETNL---------ELARDFSAKH-------------LK  1384
             S S+D KG+L LYE+++L +E E+++            +++  KH             +K
Sbjct  185   SHSDDCKGMLALYEAAYLLVEEESSIFRDAIRFTTAYLKEWVVKHDIDKNDDEYLCTLVK  244

Query  1383  HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRW  1204
             H L++PLHWRM RLEAR FI+ Y+ G     N ILLELAKLD+NIVQA+H EDLK VSRW
Sbjct  245   HALELPLHWRMRRLEARWFIDVYESGPDM--NPILLELAKLDYNIVQAIHQEDLKYVSRW  302

Query  1203  WKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTL  1024
             W K+ + E+L FARDRVVENF WT+G    P++  CR M A +   + ++DD+YD+YGTL
Sbjct  303   WMKTGLGEKLNFARDRVVENFFWTVGDIFEPQFGYCRRMSAMVNCLLTSIDDVYDVYGTL  362

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV-FILHHLRKM  847
             DEL+LFTD +ERW D T  E LP YM+ C+ AL N VNE+ +  L++  V  I+ +L+K 
Sbjct  363   DELELFTDAVERW-DATATEQLPYYMKLCFHALYNSVNEMGFIALRDQEVGMIIPYLKKA  421

Query  846   WADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF-FYVNNLAEDAAVLDC  670
             WAD CK+YL EAKWY SGY PT +EY+ENAWI+++ P++L H + F  N + ++A  L+ 
Sbjct  422   WADQCKSYLVEAKWYNSGYIPTLQEYMENAWISVTAPVMLLHAYAFTANPITKEA--LEF  479

Query  669   LTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMN  490
             L D P+IIR+SS+I+RL +D GTS  E+KRGDVPK+IQCYM E  VS +EAR+ I   + 
Sbjct  480   LQDSPDIIRISSMIVRLEDDLGTSSDELKRGDVPKSIQCYMHETGVSEDEAREHIRDLIA  539

Query  489   ELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             E W KMN             FI +AMN+ RM+QCMY +GDGHG+    T+ R+ +L  +
Sbjct  540   ETWMKMNSARFGNPPYLPDVFIGIAMNLVRMSQCMYLYGDGHGVQE-NTKDRVLSLFID  597



>gb|AID51203.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=551

 Score =   462 bits (1189),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 249/549 (45%), Positives = 349/549 (64%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  11    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  67

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  68    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  123

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  124   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  183

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  184   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLVLELGKIDFNIIQA  241

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  242   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  301

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  302   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  360

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  361   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  420

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  421   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  479

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++++   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  480   AQEYVRYLIQEAWKEMNTAMAEPDCPFSEELVMAAANLGRASQFIYLEGDGHGVQHSEIH  539

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  540   KQMGGLLFE  548



>ref|XP_002298717.2| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
 gb|EEE83522.2| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
Length=559

 Score =   462 bits (1189),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 247/549 (45%), Positives = 355/549 (65%), Gaps = 30/549 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  RRS NY  P WD+ ++QSL T+ Y  E +  + ++LKE V+DML+ + +  V ++E+
Sbjct  14    SIARRSGNYPTPFWDHKFLQSL-TSEYVGEPYTGQANKLKETVRDMLE-KPLDAVYQLEL  71

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG +YHFE EI      I   +           ++DLY T++EFR+LRQ+G+N+
Sbjct  72    IDNLQRLGVAYHFELEIK----SILESRWNDYKKDNREMKEDLYGTSVEFRLLRQHGYNV  127

Query  1551  SQD-VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK---  1384
              Q  VF+ F D ++  F   L +D KG+LNLYE+S+  + GE+ LE ARDFS KHLK   
Sbjct  128   PQGYVFNSFKD-EQGNFKNCLRDDVKGMLNLYEASYYLVNGESILEEARDFSEKHLKEYS  186

Query  1383  --------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                           H L++PLHWRM R+EAR FI++Y  G+    N ILLE A LDFN+V
Sbjct  187   KEQNEDHYLSLLVNHSLELPLHWRMQRMEARWFIDAY--GRKRDLNPILLEFAGLDFNMV  244

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             QA + ED++  SRWW    +  +L + RDR++EN LW +G    P++   R M  ++ + 
Sbjct  245   QAKYQEDIRHASRWWTSMDLGNKLFYTRDRLMENTLWAVGEVFEPQFGYYRKMATRITAL  304

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I A+DD YD+YGTL+EL++FTD IE WD V  ++ LP YM+  + AL   +NEI Y++LK
Sbjct  305   ITALDDAYDVYGTLEELEVFTDVIESWD-VNALDQLPYYMKISFFALFQSINEIGYNILK  363

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
             E G+ ++  L+K+W DLC+A+L+EAKWY +GYTPT +EY++NAW+++S  +IL H FF V
Sbjct  364   EQGINVVPSLKKLWGDLCRAFLKEAKWYYAGYTPTLQEYLDNAWLSVSGQVILGHAFFLV  423

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
              N   + AV  C  +YP++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM E   + 
Sbjct  424   TNQLTEEAV-RCCMEYPDLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATE  482

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              EAR+ +   + E WKK+N V I    PFS  F+ + M++AR AQC Y+ GD +GI + E
Sbjct  483   QEAREHVRYLIYETWKKLN-VEILKPYPFSKKFMGIPMDLARTAQCFYEDGDAYGIQDQE  541

Query  345   TQTRIQTLL  319
             T  R+ +L+
Sbjct  542   THGRLASLI  550



>gb|AID51195.1| gamma-terpinene synthase, partial [Thymus caespititius]
 gb|AID51196.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=554

 Score =   461 bits (1187),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 249/549 (45%), Positives = 348/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  14    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  70

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  71    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  126

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  127   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  186

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  187   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  244

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  245   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  304

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  305   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  363

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  364   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  423

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  424   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  482

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  483   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIH  542

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  543   KQMGGLLFE  551



>gb|AID51200.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=550

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 249/549 (45%), Positives = 348/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  10    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  66

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  67    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  122

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  123   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  182

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  183   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  240

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  241   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  300

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  301   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  359

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  360   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  419

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  420   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  479   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIH  538

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  539   KQMGGLLFE  547



>gb|AID51197.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=554

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 244/549 (44%), Positives = 347/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L   +M  +E+++ ID
Sbjct  14    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLL-GTKMEAIEQLDFID  70

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI     DI       +  ++  +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  71    DLRNLGLSYFFLDEIK----DILSFIYSENKCFQNNQAGDLYFTSLGFRLLRQHGFNVSQ  126

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  127   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  186

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  187   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  244

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  245   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  304

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +++E+AYD+LK+ 
Sbjct  305   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYISELAYDILKDK  363

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  364   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  423

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  424   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  482

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + +  
Sbjct  483   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSKIH  542

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  543   KQMGGLLFE  551



>gb|AID51204.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=551

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 244/549 (44%), Positives = 347/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  11    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  67

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI     DI       +  ++  +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  68    DLRNLGLSYFFLDEIK----DILSFIYSENKCFQNNQAGDLYFTSLGFRLLRQHGFNVSQ  123

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  124   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  183

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  184   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  241

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  242   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  301

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +++E+AYD+LK+ 
Sbjct  302   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYISELAYDILKDK  360

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  361   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  420

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  421   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  479

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + +  
Sbjct  480   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSKIH  539

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  540   KQMGGLLFE  548



>gb|AID51199.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=550

 Score =   460 bits (1184),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 347/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  10    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  66

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  67    DLRNLGLSYFFPDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  122

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F D     F ASL ED KG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  123   EVFNRFKDDDGSDFKASLGEDAKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  182

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  183   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  240

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  241   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  300

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  301   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  359

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  360   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  419

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE++RGDVPKA+QCYM +  V+  E
Sbjct  420   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELRRGDVPKAVQCYMKDKNVTEKE  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  479   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIH  538

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  539   KQMGGLLFE  547



>gb|AID51201.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=551

 Score =   460 bits (1183),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 249/549 (45%), Positives = 348/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  11    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  67

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  68    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  123

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  124   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARRFSTKYLQKKVDEK  183

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  184   GIDDENVSSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  241

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  242   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  301

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  302   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  360

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  361   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  420

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  421   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEEE  479

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  480   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIH  539

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  540   KQMGGLLFE  548



>gb|AEJ91556.1| alpha-thujene synthase/sabinene synthase [Litsea cubeba]
Length=580

 Score =   460 bits (1184),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 256/585 (44%), Positives = 362/585 (62%), Gaps = 44/585 (8%)
 Frame = -3

Query  1989  TFTTCKLPSIHRSHASSSFRMCYHTTTTT-----------RRSANYGPPTWDYSYIQSLN  1843
             +F+    PS HR    ++ R  +HT   T           RRSANY P  WD +++++L 
Sbjct  9     SFSFQHSPSPHRL---TTLRYTHHTIRCTASAPSYSDLVGRRSANYKPSKWDSNFVETLE  65

Query  1842  TTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMD  1663
             +  Y  E   M  ++L   VK ++K + +  +EKME++D ++RLG  Y F +EI E L  
Sbjct  66    SD-YKKENHEMYIEKLMGDVKHLMK-KVVNPIEKMELVDTIQRLGLGYLFNKEIKEVLNT  123

Query  1662  IymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSED  1483
             I   K           +KDL+A AL+FR+LRQ+G+ +S D F  F D K  GF  SL  D
Sbjct  124   IATSKATFKT------KKDLHAVALQFRLLRQHGYEVSPDAFHKFKDEK-GGFKESLCMD  176

Query  1482  TKGLLNLYESSFLSMEGETNLELARDFSAKHLK---------------HELKMPLHWRMP  1348
              KG+L+LYE+S LS +GE  L+ AR+F++ HLK               H L+MPLHWRM 
Sbjct  177   IKGMLSLYEASHLSFQGEVVLDEAREFTSTHLKAIEGNIDPVLLKKVRHSLEMPLHWRML  236

Query  1347  RLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTF  1168
             RLEAR +IE+YD+      N  L ELAK DFN VQ ++   LK +SRWW+   + ERL F
Sbjct  237   RLEARWYIETYDE--EDRKNPSLAELAKHDFNSVQTIYQRSLKRMSRWWRDLGLGERLEF  294

Query  1167  ARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIER  988
             +RDR+VE F WT G+  +P++  CR +  K+   +  +DD+YD+YG+L+EL+LFTD ++R
Sbjct  295   SRDRLVECFFWTTGVIFDPQFERCRGVLTKVNQLVSTIDDVYDVYGSLEELELFTDAVDR  354

Query  987   WDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAK  808
             WD +  +E LP+YM+ CYLAL N  N+IAY+ LKE G+ ++ +L+K+W DLCK+Y+ EA+
Sbjct  355   WD-IRAMEQLPEYMKICYLALYNTTNDIAYEALKEEGLDVIPYLKKVWTDLCKSYIVEAR  413

Query  807   WYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssii  628
             WY++GY PT EEY+ENAW +I+ P+ L H +F         A+    ++   +I+ SS+I
Sbjct  414   WYSNGYKPTLEEYLENAWTSIAGPVALGHAYFSFGQKMPFEAL--NYSNTSSLIKWSSMI  471

Query  627   lrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG  448
              RL +D  TS  E+ RGDVPK+IQCYM EA VS + ARD I   ++E WKKMN+  +   
Sbjct  472   FRLCDDLATSSDEVARGDVPKSIQCYMYEAGVSESVARDHIKYLIDEAWKKMNECLVP-S  530

Query  447   SPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             +PF    I    N+ARMA CMY+HGDGHG +N   + R+  LL E
Sbjct  531   TPFLQPLINAGFNLARMAHCMYEHGDGHGFSNELDKKRVLLLLAE  575



>gb|AID51198.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=550

 Score =   459 bits (1181),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 347/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  10    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  66

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  67    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  122

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  123   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVGEK  182

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  183   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  240

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  241   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  300

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  301   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  359

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTP  EEY+ NA ++IS P I++ V+F +  
Sbjct  360   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPALEEYLNNAKVSISSPTIISQVYFTLAT  419

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  420   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  479   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIH  538

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  539   KQMGGLLFE  547



>gb|AID51202.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=550

 Score =   459 bits (1180),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 348/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  10    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  66

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  67    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  122

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  123   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  182

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  183   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  240

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  241   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  300

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ RW D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  301   VIDDVYDVYGTLDELQLFTDTVRRW-DTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  359

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA +++S P I++ V+F +  
Sbjct  360   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSMSSPTIISQVYFTLAT  419

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V++ +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  420   STE-KVVIESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  478

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  479   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVMAAANLGRASQFIYLEGDGHGVQHSEIH  538

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  539   KQMGGLLFE  547



>ref|XP_011090122.1| PREDICTED: (+)-epi-alpha-bisabolol synthase-like [Sesamum indicum]
Length=543

 Score =   457 bits (1176),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 249/548 (45%), Positives = 360/548 (66%), Gaps = 29/548 (5%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RRSANY P  W   YIQSL++  Y    F+ R ++LK  V  ML+N +    +++E++
Sbjct  4     TVRRSANYKPSIWSDEYIQSLHSV-YGERRFLERSEKLKGEVTVMLENTD-DPFDQIELV  61

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D L++LG  YHF + + E L + Y+       N      ++L+A AL FR+LRQ+G++IS
Sbjct  62    DVLQKLGICYHFTDYVDEILKNTYVLVDGDPWNV-----ENLHAAALRFRLLRQHGYDIS  116

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----  1384
              +VF  F+D +   F  +L +D KGLL+LYE+S+LSMEGE+ L+ A+ F+  HLK     
Sbjct  117   PEVFRSFVD-QTGNFRTTLCDDVKGLLSLYEASYLSMEGESILDTAKVFATHHLKQKLKQ  175

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++P H RM RLE R FI++Y++ + T  N +LLELAKLDFNIVQ +
Sbjct  176   NTNQNLAEEISHALEVPYHCRMLRLETRWFIDAYERRRDT--NPLLLELAKLDFNIVQKM  233

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             + ++LK +SRW   + +AE+L FARDR+VE F WT+G T  P +  CRIM  K    I  
Sbjct  234   YQDELKELSRWHTNTRLAEKLKFARDRLVECFFWTVGFTFEPCHRYCRIMSVKFAVLITI  293

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DDIYD+YGTLDEL+LFTD ++RW DV+ ++ LPDYM+ C+LAL N VNE+AYD+L++ G
Sbjct  294   IDDIYDVYGTLDELELFTDAVDRW-DVSALKLLPDYMKICFLALYNTVNEMAYDVLRDQG  352

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
               I+ H    WA+LCK Y+ EA+WY SGY P+ +E++ N W++ + PL+L H +F + N 
Sbjct  353   FNIIPHSTNRWAELCKKYMLEAQWYYSGYKPSLKEFLGNGWVSSTGPLLLVHAYFSMTNP  412

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
              +D  + D L  +PEII+ +S++ RLA+D GTS  E+KRGD  K+IQCYM +      ++
Sbjct  413   LKDEPLED-LQKHPEIIKWTSLVSRLADDLGTSSDELKRGDNAKSIQCYMHDTGCCEEDS  471

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQT  337
             R FI   +   WKK+NK  I     +S  FI+ ++N AR++QCMYQ+GDGHGI + E++ 
Sbjct  472   RSFIKNLIESTWKKINK-DILMNHDYSKDFIKTSINFARISQCMYQYGDGHGIPDRESKA  530

Query  336   RIQTLLFE  313
             RI +L+ E
Sbjct  531   RILSLVIE  538



>gb|KHG19407.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=553

 Score =   457 bits (1176),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 251/497 (51%), Positives = 343/497 (69%), Gaps = 28/497 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRSA Y PP W+Y +IQSL +  Y  E F  +   L   V+ ML+N  M  +EK+E+ID
Sbjct  51    VRRSAKYHPPIWEYDFIQSLKSD-YLGESFNEQAIRLVGEVRMMLENV-MDPLEKLELID  108

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RLG SYHF+ E    L DI+++  +S   +   +E +LYATALEFR+LRQ+G+N+++
Sbjct  109   SLQRLGLSYHFKNETKRILEDIHLRADQSKALW---KEGNLYATALEFRLLRQHGYNVTR  165

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK------  1384
             ++F GFMD +   F +SL +D KGLLNLYE+S LSMEGE  L++ARDF+AK L+      
Sbjct  166   EIFSGFMD-EMGNFKSSLCKDCKGLLNLYEASHLSMEGEGILDIARDFAAKQLQQYLKQK  224

Query  1383  -----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                        H L++PLHWR+ RLEAR FI+ Y+K +    N +LLELAKLDFNIVQAV
Sbjct  225   KLDEYVRMLMEHALELPLHWRVSRLEARWFIDVYEKRE--ERNPMLLELAKLDFNIVQAV  282

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             H +DL+ VS+WW+   + E+L FARDR++ENFLWT+G+  +P + N R    K+ + I +
Sbjct  283   HQDDLRYVSKWWRDIGLGEKLPFARDRLMENFLWTMGVAFDPHFGNLRRTLTKIAALITS  342

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTLDEL+LFT  +ERW D+  +E LP+YM+ C+ AL N +NEIA+  LKEHG
Sbjct  343   IDDVYDVYGTLDELELFTQAVERW-DINAMELLPEYMKICFFALYNSINEIAFGDLKEHG  401

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
                +  L+K WA+LCK+YL EAKWY SGY PTF+EYI+NA I+I+ P+IL+HVFF  N  
Sbjct  402   FPTIPFLKKAWAELCKSYLVEAKWYHSGYIPTFKEYIDNARISIAAPVILSHVFFSSNVT  461

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
              ++   L+   D   +I  SS+ILRL +D GTS  E+KRGDVPK+I+CYM E   S  EA
Sbjct  462   TKEC--LEYWKDDSNLIYCSSMILRLVDDLGTSMDELKRGDVPKSIKCYMHETGCSEVEA  519

Query  516   RDFIDLEMNELWKKMNK  466
             R+ I   ++  WK+MN+
Sbjct  520   REQIKTFIDATWKRMNE  536



>ref|NP_001233805.1| monoterpene synthase 1 [Solanum lycopersicum]
 gb|AAX69063.1| monoterpene synthase 1 [Solanum lycopersicum]
 gb|AEM05855.1| linalool synthase [Solanum lycopersicum]
Length=609

 Score =   459 bits (1181),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 266/617 (43%), Positives = 364/617 (59%), Gaps = 70/617 (11%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSI-----HRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQ  1852
             ++I++ +     T K PS+      RS  +       H  +TTRRS NY P  WD+ +IQ
Sbjct  2     VSILSNIGMMVVTFKRPSLFTSLRRRSANNIIITKHSHPISTTRRSGNYKPTMWDFQFIQ  61

Query  1851  SLNTTHYAAEGFVMRRDELKERVKDMLKNEEM---REVEKMEMIDELKRLGCSYHFEEEI  1681
             SL+   Y  + ++ R ++LK+ VK M+   E     E+EK+E+ID L+RLG SYHF++EI
Sbjct  62    SLHNP-YEGDKYMKRLNKLKKEVKKMMMTVEGSHDEELEKLELIDNLERLGVSYHFKDEI  120

Query  1680  MEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMD-------  1522
             M+ +  I +                LY TAL+FR+LRQ+GF+ISQD+ + F D       
Sbjct  121   MQIMRSINININ-------IAPPDSLYTTALKFRLLRQHGFHISQDILNDFKDENGNLKQ  173

Query  1521  ----GKRCGFNASLSE----------DTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
                   +   N+S  E          +TKGLL LYE+SFLS+E E+ L      +  HL 
Sbjct  174   SICKDTKDILNSSKDEHDNLKQSTCNNTKGLLKLYEASFLSIENESFLRNTTKSTLAHLM  233

Query  1383  --------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
                                 H L++P HW +PRLE R +I  Y++   ++ N +LLELAK
Sbjct  234   RYVDQNRCGEEDNMIVELVVHALELPRHWMVPRLETRWYISIYER--MSNANPLLLELAK  291

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             LDFNIVQA H +DL+ +SRWWK + +AE+L F+RD +VEN  W +G    P++   R + 
Sbjct  292   LDFNIVQATHQQDLRILSRWWKNTGLAEKLPFSRDILVENMFWAVGALFEPQHSYFRRLI  351

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
              K+  FI  +DDIYD+YGTLDEL+LFT  I+RW D   +E LPDYM+ CYLAL N +NE+
Sbjct  352   TKVIVFISIIDDIYDVYGTLDELELFTLAIQRW-DTKAMEQLPDYMKVCYLALINIINEV  410

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
             AY++LK H + +L +L K WADLCK+YLQEAKWY +GY P  EEY++NA I+I  P++L 
Sbjct  411   AYEVLKNHDINVLPYLTKSWADLCKSYLQEAKWYHNGYKPNLEEYMDNARISIGVPMVLV  470

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMD  544
             H  F V N     A LD LT+YP+IIR S+ I RL +D GTS  E+KRGDV K+IQCYM+
Sbjct  471   HSLFLVTNQITKEA-LDSLTNYPDIIRWSATIFRLNDDLGTSSDELKRGDVSKSIQCYMN  529

Query  543   EAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGH  364
             E   S  EA + I+  + E W+ MN       SP S TFIEVA NI + +  MY H D  
Sbjct  530   EKGASEEEAIEHIEFLIQETWEAMNTAQ-SKNSPLSETFIEVAKNITKASHFMYLHSD--  586

Query  363   GINNFETQTRIQTLLFE  313
                    ++ I  +LFE
Sbjct  587   ------VKSSISKILFE  597



>ref|XP_011090121.1| PREDICTED: (+)-epi-alpha-bisabolol synthase-like [Sesamum indicum]
Length=543

 Score =   456 bits (1174),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 247/549 (45%), Positives = 357/549 (65%), Gaps = 29/549 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
              T RRSANY P  W   YIQSL++  Y    F+ R ++LK  V  ML+N +   + ++E+
Sbjct  3     ATVRRSANYKPSIWSDEYIQSLHSV-YGERRFLERAEKLKGEVTVMLENTD-DPLNQIEL  60

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             +D L+RLG  YHF + + E L +I +       N       +L+A AL FR+LRQ+G++I
Sbjct  61    VDVLQRLGICYHFTDHVDEILKNICVLVGGDQWNI-----DNLHAAALRFRLLRQHGYDI  115

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
             S +VF  FMD +   F  +L +D KGLL+LYE+S+LS+EGE+ L+ A+ F+  HLK    
Sbjct  116   SPEVFRSFMD-QTGNFRTTLCDDVKGLLSLYEASYLSVEGESILDTAKVFATHHLKQKLK  174

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++P H RM RLE R FI++Y++ +    + +LLELAKLDFNIVQ 
Sbjct  175   QNTNQNLVEEISHALEVPYHCRMLRLETRWFIDAYERRRDM--DPLLLELAKLDFNIVQK  232

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
             ++ ++LK +SRW   + +AE+L FAR+R+VE FLW +G+T  P +  CRIM  K    + 
Sbjct  233   MYQDELKELSRWHTNTRLAEKLKFARNRLVECFLWAVGITFEPCHRYCRIMLVKFGVLVT  292

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DDIYD+YGTLDEL+LFTD ++RW DV+ ++ LPDYM+ C+LAL N VNE AYD+L + 
Sbjct  293   IIDDIYDVYGTLDELKLFTDAVDRW-DVSALKLLPDYMKICFLALYNTVNETAYDVLGDQ  351

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G  I+ H    WA+LCK Y+ EA+WY SGY P+ +E++ N W++++ PL L H +F + N
Sbjct  352   GFNIIPHSTNRWAELCKKYMVEAQWYHSGYKPSLKEFLGNGWVSVAGPLFLVHAYFSMTN  411

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               +D  + D L  +PEI++ +S++ RLA+D GTS  E+KRGD PK+IQCYM +      +
Sbjct  412   PLKDEPLED-LQKHPEIVKWTSLVCRLADDLGTSSDELKRGDSPKSIQCYMHDTGCCEED  470

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             +R FI   +   WKK+NK  I     +S  FI+ ++N AR++QCMYQ+GDGHGI + E++
Sbjct  471   SRSFIKNLIESTWKKINK-DILMNHDYSKDFIKASINFARISQCMYQYGDGHGIPDRESK  529

Query  339   TRIQTLLFE  313
              RI  LL E
Sbjct  530   ARILALLIE  538



>sp|Q5SBP0.1|TPSD_OCIBA RecName: Full=Terpinolene synthase, chloroplastic; Flags: Precursor 
[Ocimum basilicum]
 gb|AAV63792.1| terpinolene synthase [Ocimum basilicum]
Length=601

 Score =   458 bits (1179),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 251/566 (44%), Positives = 351/566 (62%), Gaps = 25/566 (4%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S S ++      TTRRS NY P  WD++Y+QSLN  H+  E ++ R+ +L E+VK 
Sbjct  38    RLRPSCSLQL--QPPPTTRRSGNYEPSAWDFNYLQSLNNYHHKEERYLRRQADLIEKVKM  95

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKAT-EEKDLY  1600
             +LK E+M  ++++E+ID+L+ LG SY F+++I   L  IY +      +  AT EE +LY
Sbjct  96    ILKEEKMEALQQLELIDDLRNLGLSYCFDDQINHILTTIYNQHSCFHYHEAATSEEANLY  155

Query  1599  ATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNL  1420
              TAL FR+LR++GF +SQ+VFD F + K   F   L +DT+GLL LYE+SFL  EGE  L
Sbjct  156   FTALGFRLLREHGFKVSQEVFDRFKNEKGTDFRPDLVDDTQGLLQLYEASFLLREGEDTL  215

Query  1419  ELARDFSAKHLK------------------HELKMPLHWRMPRLEARSFIESYDKGKTTS  1294
             E AR F+ K L+                  H L++PLHWR+ RLEA+ F+++Y       
Sbjct  216   EFARQFATKFLQKKVEEKMIEEENLLSWTLHSLELPLHWRIQRLEAKWFLDAY--ASRPD  273

Query  1293  NNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPN  1114
              N I+ ELAKL+FNI QA+  E+LK +SRWW  + IAE+L FARDR+VE+  W IG    
Sbjct  274   MNPIIFELAKLEFNIAQALQQEELKDLSRWWNDTGIAEKLPFARDRIVESHYWAIGTLEP  333

Query  1113  PKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCY  934
              +Y   R + AK+ +    VDD+YD+YGTLDELQLFTD I RW D+  +  LP YM+ CY
Sbjct  334   YQYRYQRSLIAKIIALTTVVDDVYDVYGTLDELQLFTDAIRRW-DIESINQLPSYMQLCY  392

Query  933   LALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAW  754
             LA+ NFV+E+AYD+ ++ G   L +L K W DL +AY QEAKWY SGYTP+ E+Y+  A 
Sbjct  393   LAIYNFVSELAYDIFRDKGFNSLPYLHKSWLDLVEAYFQEAKWYHSGYTPSLEQYLNIAQ  452

Query  753   ITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGD  574
             I+++ P IL+ ++F +   + D  V++ +  Y  I+ LS I+LRL +D GT+  E+ RGD
Sbjct  453   ISVASPAILSQIYFTMAG-SIDKPVIESMYKYRHILNLSGILLRLPDDLGTASDELGRGD  511

Query  573   VPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMA  394
             + KA+QCYM E  VS  EARD +     E+ K+MN        PF+  F+  A N+ R+A
Sbjct  512   LAKAMQCYMKERNVSEEEARDHVRFLNREVSKQMNPARAADDCPFTDDFVVAAANLGRVA  571

Query  393   QCMYQHGDGHGINNFETQTRIQTLLF  316
               MY  GDG G+        +  LLF
Sbjct  572   DFMYVEGDGLGLQYPAIHQHMAELLF  597



>gb|KEH38236.1| monoterpene synthase [Medicago truncatula]
Length=591

 Score =   458 bits (1178),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 267/586 (46%), Positives = 377/586 (64%), Gaps = 45/586 (8%)
 Frame = -3

Query  2007  MAKMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYA  1828
             + K +S+  TC   +     + +  +  Y  +++TRRSAN+ P  W Y YIQSL++ +  
Sbjct  21    LGKKYSSLATCNFNTFS---SKTQCKGSYIPSSSTRRSANFQPSIWTYDYIQSLSSEYKE  77

Query  1827  AEGFVMRRDE---LKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIy  1657
                 VM R +   LKE+V+ ML   E  E+ ++E+ID L+RLG SYHF  EI + L +IY
Sbjct  78    ----VMYRKQCSILKEKVRMMLNKTE-NELTQLELIDVLQRLGVSYHFNNEIRDILDNIY  132

Query  1656  mkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTK  1477
              K+           +K+L+ATA EFR+LRQ+G+++S DV   F D + C F      D +
Sbjct  133   NKQTFKL-------KKNLHATAREFRLLRQHGYDLSTDVIVCFED-EICNFKNGHFVDVE  184

Query  1476  GLLNLYESSFLSMEGETNLELARDFSAKHLK----------------HELKMPLHWRMPR  1345
             G+L+LYE+SF   E E  L+ ARD ++K LK                H L++PLHW +PR
Sbjct  185   GMLSLYEASFHLFEDEPILDEARDVTSKFLKEFLDKNGDKNISLQISHALELPLHWGIPR  244

Query  1344  LEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFA  1165
              EAR FI+ Y++ +  + N +LLE A+LDFNI+Q+++ EDLK  SRWWK++ + + L+FA
Sbjct  245   WEARWFIDIYERQQ--NKNHVLLEFAQLDFNILQSLYQEDLKYTSRWWKRTTLGDNLSFA  302

Query  1164  RDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERW  985
             RDR+VENF+WT+G    P++   R +  K+ S I  +DD+YD+YGTL+EL+LFT  I+RW
Sbjct  303   RDRLVENFVWTVGTNFKPEFDYFRKVLTKVNSLITIIDDVYDVYGTLEELELFTKAIDRW  362

Query  984   DDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKW  805
              D+  ++ LP+YM+ C+ AL + VNE+A++ LK+ G  I  +L+K WADLCK+YL EAKW
Sbjct  363   -DLNAMDSLPNYMKMCFHALYDLVNELAFETLKKCGYHITPYLKKAWADLCKSYLIEAKW  421

Query  804   YASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL--AEDAAVLDCLTDYPEiirlssi  631
             Y SGYTP+  EY+ENAWI+IS P IL H +F + +    ED   L CL +  +IIRLS+I
Sbjct  422   YHSGYTPSLGEYLENAWISISAPAILTHAYFVIPHSFKIED---LVCLEENSDIIRLSAI  478

Query  630   ilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEG  451
             ILRLAND GT   E + GD+PK+IQCYM+E   S  EA +++   M   WKKMNK     
Sbjct  479   ILRLANDLGTYKRENETGDIPKSIQCYMNETGASEVEACEYVKSMMFIEWKKMNKEA--H  536

Query  450   GSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             GS FS  FI+ A+N+ARMA  MY HGDGH I   E + RI +L+F+
Sbjct  537   GSSFSQCFIDTAVNLARMALFMYHHGDGHTIQAPEIKNRITSLVFQ  582



>gb|EYU19469.1| hypothetical protein MIMGU_mgv1a021922mg, partial [Erythranthe 
guttata]
Length=526

 Score =   455 bits (1171),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 258/562 (46%), Positives = 339/562 (60%), Gaps = 77/562 (14%)
 Frame = -3

Query  1914  TTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEM---REVE  1744
             ++T RR+ NY P  W + Y+QSL T  Y  E +++R  EL E+VK +L  EE      + 
Sbjct  10    SSTVRRTGNYNPSLWGFDYLQSL-TGEYQEEKYLIRASELVEQVKILLLMEEQILELPIP  68

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
              +E+ID L RLG S H                                            
Sbjct  69    NLELIDNLHRLGISQH--------------------------------------------  84

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSED-TKGLLNLYESSFLSMEGETNLELARDFSAKHL  1387
             GF +SQDVFD F +     F  SL ++ TKGLL LYE+SFL   GE  LELAR+F+   L
Sbjct  85    GFRVSQDVFDCFKNETGDYFEESLGDNNTKGLLQLYEASFLMTRGENTLELAREFATNLL  144

Query  1386  K-------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
             +                   H L++P+HWR+ R  AR FIE     K+   N I+LELAK
Sbjct  145   RKKLDRINGDDDVLLLTAVRHALELPIHWRVQRPNARWFIEEA-YAKSRDMNPIVLELAK  203

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             LDFNIVQA H ++LK VS WW+K+ IA+ L FARDRVVEN+LWT G+  +P+Y   RIM 
Sbjct  204   LDFNIVQAKHQQELKHVSSWWEKTSIAKVLPFARDRVVENYLWTTGIF-DPQYGYSRIMA  262

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
              K+ + +  +DD++D+YGTL+ELQ+F   I+RWD +  ++ LP YM+ C+LALNNFV+E+
Sbjct  263   TKVNALVTVIDDVFDVYGTLEELQIFNHVIQRWD-IEAMDKLPHYMQICFLALNNFVDEL  321

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
             AYD+LK+ G+ I+ HLRK W DLCKAY+QEA+WY + +TPT EEYIENAWI+IS P I++
Sbjct  322   AYDVLKQQGILIIPHLRKSWGDLCKAYMQEAEWYYAKHTPTKEEYIENAWISISAPAIVS  381

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMD  544
               +F V N  +  AV   L  Y  I+R SS++LRLAND GTS  EM RGDVPK IQCYM 
Sbjct  382   QAYFLVTNPIDKEAV-RSLYQYHNIVRCSSMVLRLANDLGTSSDEMSRGDVPKLIQCYMR  440

Query  543   EAKVSANEARDFIDLEMNELWKKMN----KVGIEGGSP-FSGTFIEVAMNIARMAQCMYQ  379
             E   +  EAR+++   M E WKK N    +V I   S       I++A ++ RMAQ MYQ
Sbjct  441   ETSANIEEAREYVMSIMRETWKKTNEELLRVDINADSQLLPQNVIKIAADLGRMAQYMYQ  500

Query  378   HGDGHGINNFETQTRIQTLLFE  313
             HGDGHGI N E + RI +LLF+
Sbjct  501   HGDGHGIQNLEMKDRISSLLFD  522



>gb|AID51194.1| gamma-terpinene synthase [Thymus caespititius]
Length=554

 Score =   456 bits (1172),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 346/549 (63%), Gaps = 29/549 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+++IQS  T HY  E    R+++L   VK +L  + M  +E+++ ID
Sbjct  14    SRRSGNYQPSLWDFNFIQSQPTHHYEEER--NRKEDLIVHVKTLLGTK-MEAIEQLDFID  70

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L+ LG SY F +EI   L  IY + K   N     +  DLY T+L FR+LRQ+GFN+SQ
Sbjct  71    DLRNLGLSYFFLDEIKNILSFIYSENKCFQN----NQAGDLYFTSLGFRLLRQHGFNVSQ  126

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF+ F +     F ASL EDTKG+L LYE+SFL  EGE  LELAR FS K+L       
Sbjct  127   EVFNRFKNDDGSDFKASLGEDTKGILQLYEASFLLREGEDTLELARQFSTKYLQKKVDEK  186

Query  1386  -----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                        +H L +PLHWR+ RLEAR F+++Y   K    N ++LEL K+DFNI+QA
Sbjct  187   GIDDENVLSWIRHSLDLPLHWRIQRLEARWFLDAYAARKDM--NPLILELGKIDFNIIQA  244

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
               L++LK VSRWW  S +AE+L F RDR+VE + W + L    ++   R M A + +F+ 
Sbjct  245   TMLDELKEVSRWWNNSCLAEKLPFVRDRIVECYFWALALFEPHQFGYQRKMAAIIITFVT  304

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDELQLFTDT+ R  D   +  LP YM+ CYL+L  +V+E+AYD+LK+ 
Sbjct  305   VIDDVYDVYGTLDELQLFTDTVRR-XDTESISQLPYYMQVCYLSLYTYVSELAYDILKDK  363

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   + +LR+ W  L + + +EA+WY SGYTPT EEY+ NA ++IS P I++ V+F +  
Sbjct  364   GFNSIPYLRRSWLSLIEGFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYFTLAT  423

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               E   V + +  Y  I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +  V+  E
Sbjct  424   STE-KVVXESVYGYHNILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKE  482

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             A++ +   + E WK+MN    E   PFS   +  A N+ R +Q +Y  GDGHG+ + E  
Sbjct  483   AQEHVRYLIQEAWKEMNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSEIH  542

Query  339   TRIQTLLFE  313
              ++  LLFE
Sbjct  543   KQMGGLLFE  551



>gb|AGN72805.1| alpha pinene [Lavandula viridis]
Length=600

 Score =   455 bits (1171),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 255/568 (45%), Positives = 355/568 (63%), Gaps = 29/568 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S S ++       TRRSANY P  WD+++IQSL+   Y  + +V R  EL  +VK 
Sbjct  39    RLRLSCSLQLDGKPLDETRRSANYQPSAWDFNFIQSLHN-QYKEDKYVTRHTELTAQVK-  96

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML  EE   V+++++I++LK LG +Y F+++I + L  IY + +   NN    E  DLY 
Sbjct  97    MLLEEETDAVQQLDLIEDLKNLGINYLFKDKIQQILNHIYNQHRCFQNNQ--VEGNDLYF  154

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ+GF +SQ+VFD F + +   FN SL +DTKGLL LYE+SFL  EGE  LE
Sbjct  155   TALGFRLLRQHGFEVSQEVFDRFTNEEGTDFNPSLIDDTKGLLQLYEASFLLREGEDTLE  214

Query  1416  LARDFSAKHL--------------------KHELKMPLHWRMPRLEARSFIESYDKGKTT  1297
             LAR FS K L                    +H L++PLHWR+ R+EAR F+++Y      
Sbjct  215   LARQFSTKLLQKKVDEDGDREVGDNLLVWIRHSLELPLHWRIHRIEARWFLDAY--ATRH  272

Query  1296  SNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTP  1117
               N I+ ELAKLDFNI QA   E+L+ +SRWW  + + E+L+FARDRVVE++ W IG   
Sbjct  273   DMNPIIFELAKLDFNITQATQQEELRDLSRWWNSAGLVEKLSFARDRVVESYFWAIGTLE  332

Query  1116  NPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFC  937
               +Y   R + AK+ + I  VDD+YDIYGTLDEL+LFTD + RW D    + LP YM+ C
Sbjct  333   PRQYGYQRKLVAKIIALISVVDDVYDIYGTLDELKLFTDVMRRW-DAESFDQLPYYMKIC  391

Query  936   YLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENA  757
             YL +NNF+ E+AYD+LK+ G   L +L++ W D+ + Y  EAKWY SGYTP  EEY++NA
Sbjct  392   YLIINNFIFELAYDILKDKGFNSLSYLQRSWLDVVEGYFTEAKWYYSGYTPNLEEYLKNA  451

Query  756   WITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRG  577
              IT++CP+IL+ ++F + +  E    L+ +  Y +I+ LS ++LRL +D GT+  E+KRG
Sbjct  452   KITVTCPMILSQIYFTIASSIEKPE-LESMYKYHDILYLSGLLLRLPDDLGTALHELKRG  510

Query  576   DVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARM  397
             DVPKA+QCYM E  V   EAR+ +   + E  K+MN V      PF   F+  A N+ R+
Sbjct  511   DVPKAMQCYMKEKNVPEKEAREHVRFLIREASKQMNTVS-AADCPFPDDFVAAAANLGRV  569

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             A  +Y  GDG G  + +   +I  L+FE
Sbjct  570   ANFVYVDGDGFGDQHSKMLQQIAALMFE  597



>gb|AGN72802.1| alpha pinene [Lavandula stoechas]
Length=600

 Score =   455 bits (1171),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 255/568 (45%), Positives = 355/568 (63%), Gaps = 29/568 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S S ++       TRRSANY P  WD+++IQSL+   Y  + +V R  EL  +VK 
Sbjct  39    RLRLSCSLQLDGKPLDETRRSANYQPSAWDFNFIQSLHN-QYKEDKYVTRHTELTAQVK-  96

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML  EE   V+++++I++LK LG +Y F+++I + L  IY + +   NN    E  DLY 
Sbjct  97    MLLEEETDAVQQLDLIEDLKNLGINYLFKDKIQQILNHIYNQHRCFQNNQ--VEGNDLYF  154

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ+GF +SQ+VFD F + +   FN SL +DTKGLL LYE+SFL  EGE  LE
Sbjct  155   TALGFRLLRQHGFEVSQEVFDRFTNEEGTDFNPSLIDDTKGLLQLYEASFLLREGEDTLE  214

Query  1416  LARDFSAKHL--------------------KHELKMPLHWRMPRLEARSFIESYDKGKTT  1297
             LAR FS K L                    +H L++PLHWR+ R+EAR F+++Y      
Sbjct  215   LARQFSTKLLQKKVDEDGDREVGDNLLVWIRHSLELPLHWRIHRIEARWFLDAY--ATRH  272

Query  1296  SNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTP  1117
               N I+ ELAKLDFNI QA   E+L+ +SRWW  + + E+L+FARDRVVE++ W IG   
Sbjct  273   DMNPIIFELAKLDFNITQATQQEELRDLSRWWNSAGLVEKLSFARDRVVESYFWAIGTLE  332

Query  1116  NPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFC  937
               +Y   R + AK+ + I  VDD+YDIYGTLDEL+LFTD + RW D    + LP YM+ C
Sbjct  333   PRQYGYQRKLVAKIIALISVVDDVYDIYGTLDELKLFTDVMRRW-DAESFDQLPYYMKIC  391

Query  936   YLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENA  757
             YL +NNF+ E+AYD+LK+ G   L +L++ W D+ + Y  EAKWY SGYTP  EEY++NA
Sbjct  392   YLIINNFIFELAYDILKDKGFNSLSYLQRSWLDVVEGYFTEAKWYYSGYTPNLEEYLKNA  451

Query  756   WITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRG  577
              IT++CP+IL+ ++F + +  E    L+ +  Y +I+ LS ++LRL +D GT+  E+KRG
Sbjct  452   KITVTCPMILSQIYFTIASSIEKPE-LESMYKYHDILYLSGLLLRLPDDLGTALHELKRG  510

Query  576   DVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARM  397
             DVPKA+QCYM E  V   EAR+ +   + E  K+MN V      PF   F+  A N+ R+
Sbjct  511   DVPKAMQCYMKEKNVPEKEAREHVRFLIREASKQMNTVS-AADCPFPDDFVAAAANLGRV  569

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             A  +Y  GDG G  + +   +I  L+FE
Sbjct  570   ANFVYVDGDGFGDQHSKMLQQIAALMFE  597



>ref|XP_004488753.1| PREDICTED: myrcene synthase, chloroplastic-like isoform X1 [Cicer 
arietinum]
Length=594

 Score =   455 bits (1170),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 257/573 (45%), Positives = 365/573 (64%), Gaps = 41/573 (7%)
 Frame = -3

Query  1980  TCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRD  1801
             T   P   R  AS      Y   T  RRS+ + P  W   YIQSL ++ Y  E +  +  
Sbjct  30    TSNFPRPTRCKAS------YKVETIPRRSSKFQPSIWTNDYIQSL-SSEYKEEMYREQCK  82

Query  1800  ELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKA  1621
              L E V+ ML   +  E++++E ID L+RLG +YHF  EI   L +IY  +        +
Sbjct  83    VLSEEVRMMLCKVK-NEIDQLEFIDVLQRLGVAYHFNNEIRNILDNIYNTQT-------S  134

Query  1620  TEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLS  1441
               + +LYAT+L+FR+LRQ+ +NIS DVF  F D + C F      D + +L++YE+SF S
Sbjct  135   NLKNNLYATSLKFRLLRQHRYNISTDVFIDFQD-EMCNFKKEQPIDVEAMLSMYEASFHS  193

Query  1440  MEGETNLELARDFSAKHLK---------------HELKMPLHWRMPRLEARSFIESYDKG  1306
                ET L+  RD ++K LK               H L++PLHWR+PR EA  FI   ++ 
Sbjct  194   FANETILDELRDVTSKFLKEYLKNGGNHISLLISHALELPLHWRIPRWEAWWFINICERQ  253

Query  1305  KTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIG  1126
             +  + N +LL+ AKLDFNIVQ+++ E+LK  SRWWK++ + E+L+F+RDR+VENF+WT+G
Sbjct  254   Q--NQNHVLLQFAKLDFNIVQSIYQEELKYTSRWWKRTELGEKLSFSRDRLVENFVWTMG  311

Query  1125  LTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYM  946
                 P++   R +  K+ SFI  +DD+YD+YGTL+EL+LFT TIERW D++ +  LP YM
Sbjct  312   TNFKPEFEYFRKVITKVNSFITTIDDVYDVYGTLEELELFTHTIERW-DLSAMNSLPYYM  370

Query  945   RFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYI  766
             + C+LAL NFVNE+A+++LK+ G +I+ +L+K+WADLCK+YL EAKWY S YTPT  EY+
Sbjct  371   KICFLALYNFVNELAFEILKKSGYYIIPYLKKVWADLCKSYLIEAKWYHSKYTPTLGEYL  430

Query  765   ENAWITISCPLILAHVFFYVNNL--AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPF  592
             ENAWI+IS P+IL H +  + +    ED A L+   +  +II  S++ILR AND G+   
Sbjct  431   ENAWISISAPVILTHAYIAIPHSFKIEDLASLE---EDSKIIYFSTMILRFANDIGSYKR  487

Query  591   EMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAM  412
             E++ GD+PK+IQCYM+E+ VS  EA D+I   +  +WKKMNK      S FS +FI+  +
Sbjct  488   EIETGDIPKSIQCYMNESGVSEVEACDYIKSMICTMWKKMNKEA--HTSSFSQSFIDTCI  545

Query  411   NIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             N ARMA  MY+HGDGH I + E Q RI +L  +
Sbjct  546   NHARMAMFMYEHGDGHSIQDLEIQNRITSLALQ  578



>ref|XP_010514206.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=593

 Score =   455 bits (1170),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 256/578 (44%), Positives = 364/578 (63%), Gaps = 33/578 (6%)
 Frame = -3

Query  1977  CKLPSIHRSHASSSFRMCYHTTTTT---RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMR  1807
             C+ P  H      S        T+    RRS NY P +WD+ Y+ S+    YA+E  V+ 
Sbjct  21    CRRPHRHPRFVCKSMTKKTPEATSADLPRRSGNYQPSSWDHFYLLSIEN-RYASEKVVIT  79

Query  1806  RDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnny  1627
             RD LK +VK ML   + R +E++E+ID+L++LG SYHFE EI   L D ++K  ++    
Sbjct  80    RDLLKRKVKRMLHVTKSR-LEQLELIDDLQKLGVSYHFELEINNILTDFHLKNGRNIWK-  137

Query  1626  KATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSF  1447
                +E+DL+ATALEFR+LRQ+GF++S+++FD  +D  R   N   S++   +++LYE+S+
Sbjct  138   -CDKEEDLHATALEFRLLRQHGFDVSENIFDVIVD--RIKSNRFKSDNIPSIISLYEASY  194

Query  1446  LSMEGETNL-ELARDFSAKHLK-----------------HELKMPLHWRMPRLEARSFIE  1321
             LS + +T L ++ R F+ + ++                 H L+MP HWRM RLE R +I+
Sbjct  195   LSTKADTKLHKVIRPFATEEIRKYVDGETYNMEIREKAIHALEMPHHWRMRRLETRWYID  254

Query  1320  SYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENF  1141
             +Y+K     NN +L+ELAK+DFNIVQ  H EDLK VS WWK + +A  L F RDR+VEN+
Sbjct  255   AYEKKH--DNNLVLVELAKVDFNIVQTTHQEDLKYVSSWWKDTCLANELPFVRDRIVENY  312

Query  1140  LWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEH  961
              WT+GL   P++   + +   + + +  +DDIYDIYGTL+EL+LFT T+E W DV +++ 
Sbjct  313   FWTVGLIYEPQFGYIQRIMTIVNALVTTIDDIYDIYGTLEELELFTSTVENW-DVNRLDG  371

Query  960   LPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPT  781
             LP+YMR C+L L N +N I YD+LK   + +   L+K WADLCK YL EAKWY  GY P+
Sbjct  372   LPEYMRLCFLILYNEINGIGYDILKYKNIDVTPFLKKSWADLCKTYLVEAKWYNRGYKPS  431

Query  780   FEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirl-ssiilrLANDKG  604
              EEY+ENAWI+IS P IL H F+ V +       L+ L+ + + I   S+ +LRLAND G
Sbjct  432   VEEYMENAWISISAPTILIH-FYCVFSDQISIQNLETLSQHRQQIVRCSATVLRLANDLG  490

Query  603   TSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFI  424
             TS  E+ RGDV K++QCYM E   S  EAR+ +   +++ W  MN       S FS  F+
Sbjct  491   TSLDELARGDVLKSVQCYMHEMGASEEEAREHVQQMISDTWDDMNDETNAARSSFSRGFV  550

Query  423   EVAMNIARMAQCMYQHGDGHGI-NNFETQTRIQTLLFE  313
             E AMN+ARM+QCMYQ+GDGHG  N  +T  R+Q+LL +
Sbjct  551   EAAMNLARMSQCMYQYGDGHGCPNKAKTVDRVQSLLVD  588



>gb|AEJ91554.1| trans-ocimene synthase [Litsea cubeba]
Length=582

 Score =   454 bits (1168),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 241/552 (44%), Positives = 351/552 (64%), Gaps = 32/552 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             ++     RRSANY P  WD  YI+SL +  Y  E F  R ++LK   K +L+   +  + 
Sbjct  41    HNALQIARRSANYHPSIWDPQYIESLKSP-YGDECFGTRLEKLKFEAKRLLE-ATIEPLS  98

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
              +E++D ++RLG +YHFE+EI E L  +Y           A    DLY  AL+FR+LRQ+
Sbjct  99    WLELVDSIQRLGVAYHFEDEIKEGLDGVYGVG--------AHAGDDLYTAALQFRLLRQH  150

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-  1387
             G+ ++ D+F+ F++ +R  F A  S D KGLL+LYE+S   + GE  LE A++FS KHL 
Sbjct  151   GYGVTPDIFNKFLEKERT-FKACTSLDAKGLLSLYEASHTMIHGEEVLEDAKEFSVKHLN  209

Query  1386  --------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNI  1249
                           +H L+MPLHWRMPRLEA+ +I+    G++   N +LLELA+LDFN 
Sbjct  210   YLMGNLQNNLREQVQHALEMPLHWRMPRLEAKHYIDV--NGRSDERNMVLLELARLDFNF  267

Query  1248  VQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYS  1069
             VQ+ H E+LK VSRWW+   +A++L F+RDR+VEN+LW +G+ P PK+ NCR    KL S
Sbjct  268   VQSKHQEELKEVSRWWRDLGLAKKLGFSRDRLVENYLWAVGIAPEPKFSNCRKGLTKLIS  327

Query  1068  FICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDML  889
              +  +DDIYD+YG+LDEL+LFT+ ++RW D+  +E LP+YM+ CYLAL NFV+E++YD L
Sbjct  328   ILTVIDDIYDVYGSLDELELFTEAVKRW-DIEALETLPEYMKICYLALFNFVHEVSYDTL  386

Query  888   KEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFY  709
             K++G  IL  +R+ W  LC +YL EA+W+ +G  P  +EY+ N WI++  P+ + H +F 
Sbjct  387   KDYGWNILPFIREEWERLCMSYLVEAEWFGNGNKPALDEYLRNGWISVGGPVAMVHAYFL  446

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
                     ++ + L    E+I  SS+  RL +D GTS  EMKRGDVPKA++CYM +   S
Sbjct  447   QGRPIRKDSI-NFLDHGSELIYWSSVATRLNDDLGTSKAEMKRGDVPKAVECYMIQTGES  505

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
               +AR+ I   + + WKKMN+  ++   P S  ++E  +N+ R AQC+YQHGDG G +  
Sbjct  506   YEDAREHIQGLVRDCWKKMNEECLKCCLPKS--YVETVLNMVRTAQCIYQHGDGIGTSTG  563

Query  348   ETQTRIQTLLFE  313
              TQ R+ +L+ E
Sbjct  564   VTQDRVISLICE  575



>ref|XP_008460931.1| PREDICTED: terpene synthase 10-like isoform X2 [Cucumis melo]
Length=602

 Score =   454 bits (1169),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 257/551 (47%), Positives = 357/551 (65%), Gaps = 33/551 (6%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMRE-VEKME  1735
              T RRSANY P  W   +IQSL ++ +    +  R + L   VK MLK     + +E++E
Sbjct  61    ATVRRSANYHPSIWKDEFIQSL-SSQFKGVTYGKRLNHLIGEVKAMLKKAPSEDSLEQLE  119

Query  1734  MIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             +ID L+RLG SY+FE EI   L  +Y K+           +KDLY T+LEFR+ RQ+GF 
Sbjct  120   LIDTLQRLGISYYFESEIKHVLKTLYNKRDLD------DNKKDLYVTSLEFRLFRQHGFE  173

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----  1387
             ISQ+VF  F D      N S   +   +L+LYE+SF S E E  LE A+ F+  +L    
Sbjct  174   ISQEVFSDFKDEIEISDNISFLGNINRILSLYEASFSSFENEDFLEKAKCFAINYLEKYM  233

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          KH L++PLHWR  R+EAR FI+ Y++ K    N ILLE+AKLDFNI+
Sbjct  234   RRTRVDEVDMAMIKHALELPLHWRTSRMEARWFIDIYERKKDM--NPILLEMAKLDFNIL  291

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             Q+++LEDLKS S WW  S + E L+F+RDR++ NFLWTIG    P++  CR M  K+ SF
Sbjct  292   QSIYLEDLKSASSWWTSSRLGENLSFSRDRLMANFLWTIGTGFEPEFSYCRRMITKINSF  351

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I  +DDIYD+YGTLDEL+LFT  IERW DV  ++ +P YM+  +LAL++ +NE+A+ + K
Sbjct  352   ITILDDIYDVYGTLDELELFTKAIERW-DVNAIDEIPYYMKVYFLALHDSINEMAFQVFK  410

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF-FY  709
             +  V ++ +L  MW  LCK+YLQEAKWY S Y PT EEY++NAW++IS P+IL H + F 
Sbjct  411   DQEVDVIQYLHNMWIGLCKSYLQEAKWYHSNYKPTLEEYMDNAWVSISGPVILVHSYVFA  470

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
              +++A++   L+ L    +IIR SS ILRLA+D  TS  E+KRGDVPK+IQCYM++  VS
Sbjct  471   TSHIAKEE--LESLDKTNDIIRWSSTILRLADDLATSSDELKRGDVPKSIQCYMNDTGVS  528

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
              N+AR++I   +NE WKK+N+   E  +  S   I+++ N+ARMAQCMY +GDG+GI   
Sbjct  529   ENDARNYIKHLINETWKKLNESEAENIA-LSQVIIQMSKNLARMAQCMYLNGDGYGIEQ-  586

Query  348   ETQTRIQTLLF  316
             ET+  + +L+ 
Sbjct  587   ETKDHVLSLII  597



>gb|AEJ91555.1| alpha-thujene synthase [Litsea cubeba]
Length=580

 Score =   453 bits (1166),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 251/572 (44%), Positives = 354/572 (62%), Gaps = 41/572 (7%)
 Frame = -3

Query  1950  HASSSFRMCYHTTTTT-----------RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             H  ++ R  +H    T           RRSANY P  WD +++++L +  Y  E   M  
Sbjct  19    HKLTTLRYTHHRIRCTASAPSYSDLVRRRSANYKPSKWDSNFVETLESD-YKKENHEMYI  77

Query  1803  DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyK  1624
             ++L   VK ++K E +  +EKME++D ++RLG  Y F +EI E L  I   K        
Sbjct  78    EKLMGDVKHLMK-EVVNPIEKMELVDTIQRLGLGYLFNKEIKEVLNTITTSKATLKT---  133

Query  1623  ATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFL  1444
                +KDL+A AL+FR+LRQ+G+ +S D F  F D K  GF  SL  D KG+L LYE+S L
Sbjct  134   ---KKDLHAVALQFRLLRQHGYEVSPDAFHEFKDEK-GGFKESLCMDIKGMLCLYEASHL  189

Query  1443  SMEGETNLELARDFSAKHLK---------------HELKMPLHWRMPRLEARSFIESYDK  1309
             S +GE  L+ AR+F++ HLK               H L+MPLHWRM RLEAR +IE+YD+
Sbjct  190   SFQGEVVLDEAREFTSTHLKAIGGNIDPVLLKKVRHSLEMPLHWRMLRLEARWYIETYDE  249

Query  1308  GKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTI  1129
                   N  L ELAK DFN VQ ++   LK +SRWW+   + ERL F+RDR+VE F WT 
Sbjct  250   --EDRKNPSLAELAKHDFNSVQTIYQRSLKRMSRWWRDLGLGERLEFSRDRLVECFFWTT  307

Query  1128  GLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDY  949
             G+  +P++  CR +  K+   +  +DD+YD+YG+L+EL+LFTD ++RWD +  +E LP+Y
Sbjct  308   GVIFDPQFERCRGVLTKVNQLVSTIDDVYDVYGSLEELELFTDAVDRWD-IRAMEQLPEY  366

Query  948   MRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEY  769
             M+ CYLAL N  N+IAY+ LKE G+ ++ +L+K+W DLCK+Y+ EA+WY++GY PT EEY
Sbjct  367   MKICYLALYNTTNDIAYEALKEEGLDVIPYLKKVWTDLCKSYIVEARWYSNGYKPTLEEY  426

Query  768   IENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFE  589
             +ENAW +I+ P+ L H +F         A+    ++   +I+ SS+I RL +D  TS  E
Sbjct  427   LENAWTSIAGPVALVHAYFSFGQKMPFEAL--NYSNTSSLIKWSSMIFRLCDDLATSSDE  484

Query  588   MKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMN  409
             + RGDVPK+IQCYM EA VS + ARD I   ++E WKKMN+  +   +PF    I   +N
Sbjct  485   VARGDVPKSIQCYMYEAGVSESVARDHIKYLIDEAWKKMNECLVY-NTPFLQPLINAGLN  543

Query  408   IARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             +ARMA CMY+ GDGHG +N   + R+  LL E
Sbjct  544   LARMAHCMYERGDGHGFSNELDKKRVLLLLAE  575



>gb|ABD77417.1| linalool synthase [Lavandula latifolia]
Length=602

 Score =   453 bits (1166),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 253/568 (45%), Positives = 357/568 (63%), Gaps = 29/568 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S + ++   +   TRRS NY P  WD++YIQSL+   Y  E +  R  EL  +VK 
Sbjct  41    RLRVSCATQLEIKSVDETRRSGNYNPTAWDFNYIQSLDN-QYKKERYSTRHAELTVQVKK  99

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             +L+ EEM  V+K+E+I++LK LG SY F++ I + L  IY + K   N+    EEKDLY 
Sbjct  100   LLE-EEMEAVQKLELIEDLKNLGISYPFKDNIQQILNQIYNEHKCCHNSE--VEEKDLYF  156

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ GF +SQ+VFD F + K   F  +L++DTKGLL LYE+SFL  E E  LE
Sbjct  157   TALRFRLLRQQGFEVSQEVFDHFKNEKGTDFKPNLADDTKGLLQLYEASFLLREAEDTLE  216

Query  1416  LARDFSAKHL--------------------KHELKMPLHWRMPRLEARSFIESYDKGKTT  1297
              AR FS K L                    +  L++PLHWR+ RLEAR F+++Y   +  
Sbjct  217   SARQFSTKLLQKKVDENGDDKIEDNLLLWIRRSLELPLHWRVQRLEARGFLDAY--VRRP  274

Query  1296  SNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTP  1117
               N I+ ELAKLDFNI QA   E+LK +SRWW  + +AE+L FARDRVVE++ W +G   
Sbjct  275   DMNPIVFELAKLDFNITQATQQEELKDLSRWWNSTGLAEKLPFARDRVVESYFWAMGTFE  334

Query  1116  NPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFC  937
               +Y   R + AK+ +    VDD+YD+YGTL+EL+LFTD I RWD  + ++ LP YM+ C
Sbjct  335   PHQYGYQRELVAKIIALATVVDDVYDVYGTLEELELFTDAIRRWDRES-IDQLPYYMQLC  393

Query  936   YLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENA  757
             +L +NNFV E+A+D+LK+     L HL++ W DL +AYL EAKWY S YTP+ EEY+  A
Sbjct  394   FLTVNNFVFELAHDVLKDKSFNCLPHLQRSWLDLAEAYLVEAKWYHSRYTPSLEEYLNIA  453

Query  756   WITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRG  577
              ++++CP I++ ++F +  +     V++ +  Y +I+ LS ++LRL +D GT+ FE+KRG
Sbjct  454   RVSVTCPTIVSQMYFAL-PIPIGKPVIEIMYKYHDILYLSGMLLRLTDDLGTASFELKRG  512

Query  576   DVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARM  397
             DVPKA+QCYM E  V  NEAR+ +   + E  K+MN   +    PF+  F   A N+ R+
Sbjct  513   DVPKAVQCYMKERNVPENEAREHVKFLIREASKQMN-TAMATDCPFTEDFAVAAANLGRV  571

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             A  +Y  GDG G+ + +   +I TL+FE
Sbjct  572   ANFVYVDGDGFGVQHSKIYEQIGTLMFE  599



>sp|Q5SBP1.1|MYRS_OCIBA RecName: Full=Beta-myrcene synthase, chloroplastic; Flags: Precursor 
[Ocimum basilicum]
 gb|AAV63791.1| beta-myrcene synthase [Ocimum basilicum]
Length=599

 Score =   453 bits (1165),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 256/580 (44%), Positives = 350/580 (60%), Gaps = 36/580 (6%)
 Frame = -3

Query  1962  IHRSHASSSFRMCYHTT-----------TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGF  1816
             +H S+  +S   C  +T              RRS NY P  WD++YIQSLN  H   E  
Sbjct  21    LHNSNNKASNPRCVSSTRRRPSCPLQLDVEPRRSGNYQPSAWDFNYIQSLNNNHSKEERH  80

Query  1815  VMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkss  1636
             + R+ +L E VK ML  +EM  V+++E+I++LK LG SY F++EI   L  IY   K   
Sbjct  81    LERKAKLIEEVK-MLLEQEMAAVQQLELIEDLKNLGLSYLFQDEIKIILNSIYNHHKCFH  139

Query  1635  nnyKAT--EEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
             NN++       DLY  AL FR+ RQ+GF +SQ+VFD F + +   F+A+L++DTKGLL L
Sbjct  140   NNHEQCIHVNSDLYFVALGFRLFRQHGFKVSQEVFDCFKNEEGSDFSANLADDTKGLLQL  199

Query  1461  YESSFLSMEGETNLELARDFSAKHLK------------------HELKMPLHWRMPRLEA  1336
             YE+S+L  E E  LE+AR FS K L+                  H L++PLHWR+ RLEA
Sbjct  200   YEASYLVTEDEDTLEMARQFSTKILQKKVEEKMIEKENLLSWTLHSLELPLHWRIQRLEA  259

Query  1335  RSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDR  1156
             + F+++Y        N I+ ELAKL+FNI QA+  E+LK +SRWW  + IAE+L FARDR
Sbjct  260   KWFLDAY--ASRPDMNPIIFELAKLEFNIAQALQQEELKDLSRWWNDTGIAEKLPFARDR  317

Query  1155  VVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDV  976
             +VE+  W IG     +Y   R + AK+ +    VDD+YD+YGTLDELQLFTD I RW D+
Sbjct  318   IVESHYWAIGTLEPYQYRYQRSLIAKIIALTTVVDDVYDVYGTLDELQLFTDAIRRW-DI  376

Query  975   TKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYAS  796
               +  LP YM+ CYLA+ NFV+E+AYD+ ++ G   L +L K W DL +AY  EAKW+  
Sbjct  377   ESINQLPSYMQLCYLAIYNFVSELAYDIFRDKGFNSLPYLHKSWLDLVEAYFVEAKWFHD  436

Query  795   GYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLA  616
             GYTPT EEY+ N+ ITI CP I++ ++F   N + D   ++ +  Y +I+ LS ++ RL 
Sbjct  437   GYTPTLEEYLNNSKITIICPAIVSEIYFAFAN-SIDKTEVESIYKYHDILYLSGMLARLP  495

Query  615   NDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFS  436
             +D GTS FEMKRGDV KAIQCYM E   S  EAR+ I   M E WK MN        PF 
Sbjct  496   DDLGTSSFEMKRGDVAKAIQCYMKEHNASEEEAREHIRFLMREAWKHMNTAAAADDCPFE  555

Query  435   GTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
                +  A ++ R+A  +Y  GDG G+ + +   ++  LLF
Sbjct  556   SDLVVGAASLGRVANFVYVEGDGFGVQHSKIHQQMAELLF  595



>gb|AGN72799.1| alpha pinene [Lavandula pedunculata subsp. lusitanica]
Length=600

 Score =   453 bits (1165),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 253/564 (45%), Positives = 353/564 (63%), Gaps = 29/564 (5%)
 Frame = -3

Query  1944  SSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKN  1765
             S S ++       TRRSANY P  WD+++IQSL+   Y  + +V R  EL  +VK ML  
Sbjct  43    SCSLQLDGKPLDETRRSANYQPSAWDFNFIQSLHN-QYKEDKYVTRHTELTAQVK-MLLE  100

Query  1764  EEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALE  1585
             EE   V+++++I++LK LG +Y F+++I + L  IY + +   NN    E  DLY TAL 
Sbjct  101   EETDAVQQLDLIEDLKNLGINYLFKDKIQQILNHIYNQHRCFQNNQ--VEGNDLYFTALG  158

Query  1584  FRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARD  1405
             FR+LRQ+GF +SQ+VFD F + +   FN SL +DTKGLL LYE+SFL  EGE  LELAR 
Sbjct  159   FRLLRQHGFEVSQEVFDRFTNEEGTDFNPSLIDDTKGLLQLYEASFLLREGEDTLELARQ  218

Query  1404  FSAKHL--------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNA  1285
             FS K L                    +H L++PLHWR+ R+EAR F+++Y        N 
Sbjct  219   FSTKLLQKKVDEDGDREVGDNLLVWIRHSLELPLHWRIHRIEARWFLDAY--ATRHDMNP  276

Query  1284  ILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKY  1105
             I+ ELAKLDFNI QA   E+L+ +SRWW  + + E+L+FARDRVVE++ W IG     +Y
Sbjct  277   IIFELAKLDFNITQATQQEELRDLSRWWNSAGLVEKLSFARDRVVESYFWAIGTLEPRQY  336

Query  1104  VNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLAL  925
                R + AK+ + I  VDD+YDIYGTLDEL+LFTD + RW D    + LP YM+ CYL +
Sbjct  337   GYQRKLVAKIIALISVVDDVYDIYGTLDELKLFTDVMRRW-DAESFDQLPYYMKICYLII  395

Query  924   NNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITI  745
             NNF+ E+AYD+LK+ G   L +L++ W D+ + Y  EAKWY SGYTP  EEY++NA IT+
Sbjct  396   NNFIFELAYDILKDKGFNSLSYLQRSWLDVVEGYFTEAKWYYSGYTPNLEEYLKNAKITV  455

Query  744   SCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPK  565
             +CP+IL+ ++F + +  E    L+ +  Y +I+ LS ++LRL +D GT+  E+KRGD PK
Sbjct  456   TCPMILSQIYFTIASSIEKPE-LESMYKYHDILYLSGLLLRLPDDLGTALHELKRGDAPK  514

Query  564   AIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCM  385
             A+QCYM E  V   EAR+ +   + E  K+MN V      PF   F+  A N+ R+A  +
Sbjct  515   AMQCYMKEKNVPEKEAREHVRFLIREASKQMNTVS-AADCPFPDDFVAAAANLGRVANFV  573

Query  384   YQHGDGHGINNFETQTRIQTLLFE  313
             Y  GDG G  + +   +I  L+FE
Sbjct  574   YVDGDGFGDQHSKMLQQIAALMFE  597



>gb|AGN72804.1| alpha fenchol [Lavandula viridis]
Length=594

 Score =   452 bits (1164),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 253/565 (45%), Positives = 355/565 (63%), Gaps = 26/565 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S S ++ Y     TRRS NY P  WD+ YIQSL    Y  E ++ R  +L  +VK 
Sbjct  36    RLQTSCSLQLDYKPVDETRRSGNYQPSAWDFEYIQSLKNK-YKEEKYLTRHTKLTVQVK-  93

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML +E+M  V++++ I++L  LG SY F+++I + L  IY + +   NN    EE DLY 
Sbjct  94    MLLDEDMEAVQQLDFIEDLNNLGISYLFKDKITQILNHIYNEHRCFHNNE--AEESDLYF  151

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ+GF +SQ+VFD F + K   F ASL+ DTKGLL LYE+SFL  EGE  LE
Sbjct  152   TALGFRLLRQHGFKVSQEVFDCFKNEKYTNFKASLAGDTKGLLQLYEASFLLREGEDTLE  211

Query  1416  LARDFSAKHL-----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNN  1288
             LAR FS K L                 +H L++PLHWR+ RLEAR F+++Y        N
Sbjct  212   LARKFSTKLLQQKIDEGEPDNNLLSCIRHSLELPLHWRLQRLEARWFLDAY--ATRHDMN  269

Query  1287  AILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPK  1108
              I+ ELAKL+FNI QA   E+LK +SRWW  + +AE+L FARDR+VE++ W +G     +
Sbjct  270   PIIFELAKLEFNITQATQQEELKDLSRWWNSTGLAEKLPFARDRIVESYFWAMGTFEPHQ  329

Query  1107  YVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLA  928
             Y   R + +K+ +    VDDIYD+YGTL+EL+LFTD I RW +   ++ LP Y++ CYLA
Sbjct  330   YGYQRELVSKIIALTTVVDDIYDVYGTLEELELFTDVIRRW-ETESIDELPYYIQLCYLA  388

Query  927   LNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWIT  748
             +N FV ++A+D+LK+ G   L +L++ W DL + YL EAKWY + YTP+ EEY+ NA +T
Sbjct  389   VNKFVFDLAHDVLKDKGFNSLPYLKRSWKDLIERYLIEAKWYHNRYTPSLEEYLNNARVT  448

Query  747   ISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVP  568
             I+CP IL+ ++F + +  E   V++ +  Y +I+ LS ++LRL +D GT+PFE+KRGDVP
Sbjct  449   ITCPTILSQIYFALASPIE-KPVIEVMYKYHDILYLSGMLLRLPDDLGTAPFELKRGDVP  507

Query  567   KAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQC  388
             KA+QCYM E  V   EAR+ +   + E  K+MN   +    PF+  F   A N+ R+A  
Sbjct  508   KAVQCYMKERNVPEKEAREHVRFLIREASKQMN-TAMAIDCPFTEDFAVAAANLGRVANL  566

Query  387   MYQHGDGHGINNFETQTRIQTLLFE  313
              Y  GDG GI +      I +L+F+
Sbjct  567   AYVEGDGFGIQHSNIYEHIGSLMFK  591



>gb|AGN72801.1| alpha fenchol [Lavandula stoechas]
Length=594

 Score =   452 bits (1163),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 252/565 (45%), Positives = 355/565 (63%), Gaps = 26/565 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S S ++ Y     TRRS NY P  WD+ YIQSL    Y  E ++ R  +L  +VK 
Sbjct  36    RLQTSCSLQLDYKPVDETRRSGNYQPSAWDFEYIQSLKNK-YKEEKYLTRHTKLTVQVK-  93

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML +E+M  V++++ I++L  LG SY F+++I + L  IY + +   NN    EE DLY 
Sbjct  94    MLLDEDMEAVQQLDFIEDLNNLGISYLFKDKITQILNHIYNEHRCFHNNE--AEESDLYF  151

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ+GF +SQ+VFD F + K   F ASL+ DTKGLL LYE+SFL  EGE  LE
Sbjct  152   TALGFRLLRQHGFKVSQEVFDCFKNEKYTNFKASLAGDTKGLLQLYEASFLLREGEDTLE  211

Query  1416  LARDFSAKHL-----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNN  1288
             LAR FS K L                 +H L++PLHWR+ RLEAR F+++Y        N
Sbjct  212   LARKFSTKLLQQKIDEGEPDNNLLSCIRHSLELPLHWRLQRLEARWFLDAY--ATRHDMN  269

Query  1287  AILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPK  1108
              I+ ELAKL+FNI QA   E+LK +SRWW  + +AE+L FARDR+VE++ W +G     +
Sbjct  270   PIIFELAKLEFNITQATQQEELKDLSRWWNSTGLAEKLPFARDRIVESYFWAMGTFEPHQ  329

Query  1107  YVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLA  928
             Y   R + +K+ +    VDDIYD+YGTL+EL+LFTD I RW +   ++ LP Y++ CYLA
Sbjct  330   YGYQRELVSKIIALTTVVDDIYDVYGTLEELELFTDVIRRW-ETESIDELPYYIQLCYLA  388

Query  927   LNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWIT  748
             +N FV ++A+D+LK+ G   L +L++ W DL + YL EAKWY + YTP+ EEY+ NA +T
Sbjct  389   VNKFVFDLAHDVLKDKGFNSLPYLKRSWKDLIERYLIEAKWYHNRYTPSLEEYLNNARVT  448

Query  747   ISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVP  568
             I+CP IL+ ++F + +  E   V++ +  Y +I+ LS ++LRL +D GT+PFE+KRGDVP
Sbjct  449   ITCPTILSQIYFALASPIE-KPVIEVMYKYHDILYLSGMLLRLPDDLGTAPFELKRGDVP  507

Query  567   KAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQC  388
             KA+QCYM E  V   EAR+ +   + E  K+MN   +    PF+  F   A N+ R+A  
Sbjct  508   KAVQCYMKERNVPEKEAREHVRFLIREASKQMN-TAMAIDCPFTEDFAVAAANLGRVANL  566

Query  387   MYQHGDGHGINNFETQTRIQTLLFE  313
              Y  GDG G+ +      I +L+F+
Sbjct  567   AYVEGDGFGVQHSNIYEHIGSLMFK  591



>gb|AGN72798.1| alpha fenchol [Lavandula pedunculata subsp. lusitanica]
Length=594

 Score =   452 bits (1163),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 252/565 (45%), Positives = 355/565 (63%), Gaps = 26/565 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S S ++ Y     TRRS NY P  WD+ YIQSL    Y  E ++ R  +L  +VK 
Sbjct  36    RLQTSCSLQLDYKPVDETRRSGNYQPSAWDFEYIQSLKNK-YKEEKYLTRHTKLTVQVK-  93

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML +E+M  V++++ I++L  LG SY F+++I + L  IY + +   NN    EE DLY 
Sbjct  94    MLLDEDMEAVQQLDFIEDLNNLGISYLFKDKITQILNHIYNEHRCFHNNE--AEESDLYF  151

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ+GF +SQ+VFD F + K   F ASL+ DTKGLL LYE+SFL  EGE  LE
Sbjct  152   TALGFRLLRQHGFKVSQEVFDCFKNEKYTNFKASLAGDTKGLLQLYEASFLLREGEDTLE  211

Query  1416  LARDFSAKHL-----------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNN  1288
             LAR FS K L                 +H L++PLHWR+ RLEAR F+++Y        N
Sbjct  212   LARKFSTKLLQQKIDEGEPDNNLLSCIRHSLELPLHWRLQRLEARWFLDAY--ATRHDMN  269

Query  1287  AILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPK  1108
              I+ ELAKL+FNI QA   E+LK +SRWW  + +AE+L FARDR+VE++ W +G     +
Sbjct  270   PIIFELAKLEFNITQATQQEELKDLSRWWNSTGLAEKLPFARDRIVESYFWAMGTFEPHQ  329

Query  1107  YVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLA  928
             Y   R + +K+ +    VDDIYD+YGTL+EL+LFTD I RW +   ++ LP Y++ CYLA
Sbjct  330   YGYQRELVSKIIALTTVVDDIYDVYGTLEELELFTDVIRRW-ETESIDELPYYIQLCYLA  388

Query  927   LNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWIT  748
             +N FV ++A+D+LK+ G   L +L++ W DL + YL EAKWY + YTP+ EEY+ NA +T
Sbjct  389   VNKFVFDLAHDVLKDKGFNSLPYLKRSWKDLIERYLIEAKWYHNRYTPSLEEYLNNARVT  448

Query  747   ISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVP  568
             I+CP IL+ ++F + +  E   V++ +  Y +I+ LS ++LRL +D GT+PFE+KRGDVP
Sbjct  449   ITCPTILSQIYFALASPIE-KPVIEVMYKYHDILYLSGMLLRLPDDLGTAPFELKRGDVP  507

Query  567   KAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQC  388
             KA+QCYM E  V   EAR+ +   + E  K+MN   +    PF+  F   A N+ R+A  
Sbjct  508   KAVQCYMKERNVPEKEAREHVRFLIREASKQMN-TAMAIDCPFTEDFAVAAANLGRVANL  566

Query  387   MYQHGDGHGINNFETQTRIQTLLFE  313
              Y  GDG G+ +      I +L+F+
Sbjct  567   AYVEGDGFGVQHSNIYEHIGSLMFK  591



>gb|AGN90903.1| limonene synthase [Mentha x gracilis]
 gb|AGN90904.1| limonene synthase [Mentha x gracilis]
 gb|AGN90913.1| limonene synthase [Mentha spicata]
 gb|AGN90914.1| limonene synthase [Mentha spicata]
Length=600

 Score =   452 bits (1163),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 254/580 (44%), Positives = 357/580 (62%), Gaps = 31/580 (5%)
 Frame = -3

Query  2001  KMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAE  1822
             K+FS+   C   S  R + SSS        TT RRS NY P  WD  +IQSL++  Y  +
Sbjct  32    KLFSSTNKCSGRSRLRVYCSSS------QLTTERRSGNYNPSRWDVEFIQSLHSD-YKKD  84

Query  1821  GFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkk  1642
                +R  EL   VK M   +E  ++ ++E+ID+L+R+G S HF+ E  E L  IY+    
Sbjct  85    KHAIRASELVTLVK-MELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILSSIYLDHHY  143

Query  1641  ssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
               N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F + +   F  SLS+DT+GLL L
Sbjct  144   YKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFKN-EEGEFKESLSDDTRGLLQL  201

Query  1461  YESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPRLEAR  1333
             YE+SFL  EGET LE AR+F+ K L+                 + L +PLHWR+ R  A 
Sbjct  202   YEASFLLTEGETTLESAREFATKFLEERVNEGGGDGDLLTRIAYSLDIPLHWRIKRPNAP  261

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              +IE Y K      N  +LELA LD NIVQA   E+LK   RWW+ +   E+L FARDR+
Sbjct  262   VWIEWYRK--RPDMNPAVLELAILDLNIVQAQFQEELKESFRWWRNTGFVEKLPFARDRL  319

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             VE + W  G+    ++ + RIM  K+ + I  +DDIYD+YGTL+EL+ FTD I RWD + 
Sbjct  320   VECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEQFTDLIRRWD-IN  378

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +LR+ W DL   Y+ EA+W+  G
Sbjct  379   SIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGG  438

Query  792   YTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAN  613
             + P+ EEY+EN+W +IS P +L H+FF V +      V D L  Y +++R SS +LRLA+
Sbjct  439   HKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-DSLYKYHDLVRWSSFVLRLAD  497

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSG  433
             D GTS  E+ RGDVPK++QCYM +   S  EAR  +   + E+WKKMN   +   SPF  
Sbjct  498   DLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGK  557

Query  432   TFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              FI  A+++ RMAQ MY +GDGHG  +     ++   LFE
Sbjct  558   DFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFE  597



>ref|XP_008460928.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Cucumis 
melo]
Length=536

 Score =   450 bits (1157),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 244/523 (47%), Positives = 345/523 (66%), Gaps = 27/523 (5%)
 Frame = -3

Query  1815  VMRRDELKERVKDMLKNEEM--REVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkk  1642
             ++RRD L +RVK ML  E +    ++ +E+IDEL+RLG SYHF+ EI + L  I  +   
Sbjct  17    LIRRDMLIKRVKMMLNKEPLVGDSLKGLEVIDELQRLGISYHFQMEINQMLEIINERFNN  76

Query  1641  ssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
                  +    + LYAT+L FR+LRQ+G++I QDVF  F +      +    E  KG+L  
Sbjct  77    GEEGLEWNNNRSLYATSLHFRILRQHGYHIPQDVFKEFKNEIE-NLDCICEEKAKGMLTF  135

Query  1461  YESSFLSMEGETNLELARDFS----AKHLK-------------HELKMPLHWRMPRLEAR  1333
             YE+SFL+M+GE+ ++ AR F+    +K+LK             H L++P HWRMPRLEAR
Sbjct  136   YEASFLAMKGESFVDEARQFAIQRLSKYLKSNNNDQIICTMISHALQLPFHWRMPRLEAR  195

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              FI++  + K  SN  +LL+LAKLDFNIVQ++H  DLK VSRWWK + + E+L FARDR+
Sbjct  196   WFIDNVYRTKPNSN-PVLLDLAKLDFNIVQSIHQNDLKDVSRWWKSTGLGEKLEFARDRL  254

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             + NF W++G+   P     R M  K  S I  +DD+YD+YGTLDEL+LFTD +ERW ++ 
Sbjct  255   MANFFWSVGMGCEPHLQYLRTMSTKTASLITIIDDVYDVYGTLDELELFTDAVERW-NIG  313

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              ++ LP+YM+ C++AL+N +N++A+D +K HGV ++ +LRK W DLCK +L EAKWY + 
Sbjct  314   AIDSLPNYMQICFIALHNTINDMAFDAIKNHGVNVIPYLRKTWTDLCKTFLIEAKWYYTN  373

Query  792   YTPTFEEYIENAWITISCPLILAHVF-FYVNNLAEDAAVLDCLTDYPEiirlssiilrLA  616
             Y PTFEEY+ENAWI++S  L+L H + F  N+L  +A  L+CL  YP IIR SSII RLA
Sbjct  374   YKPTFEEYLENAWISVSGSLLLVHAYVFTTNSLTIEA--LECLQLYPNIIRYSSIIFRLA  431

Query  615   NDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP-  442
             ND  +S  E KRG+V K+IQCYM++   S  EAR +I   + E WKK+N +V     SP 
Sbjct  432   NDLASSSEEAKRGEVAKSIQCYMNDTGASEQEARRYIKDLIMESWKKLNEEVQTLNNSPL  491

Query  441   FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
                 FIE+A+N+AR++  +YQH DGH + + ET+ R+ +L  +
Sbjct  492   LLKDFIEIALNLARISHTVYQHRDGHTVEDHETKDRVLSLFMK  534



>sp|Q2XSC6.1|LALIM_LAVAN RecName: Full=(R)-limonene synthase; Short=LaLIMS [Lavandula 
angustifolia]
 gb|ABB73044.1| limonene synthase [Lavandula angustifolia]
Length=602

 Score =   452 bits (1162),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 252/568 (44%), Positives = 358/568 (63%), Gaps = 29/568 (5%)
 Frame = -3

Query  1956  RSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             R   S + ++   +   TRRS NY P  WD++YIQSL+   Y  E +  R  EL  +VK 
Sbjct  41    RLRVSCATQLEIKSVDETRRSGNYNPTAWDFNYIQSLDN-QYKKERYSTRHAELTVQVKK  99

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             +L+ EEM  V+K+E+I++LK LG SY F++ I + L  IY + K   N+    EEKDLY 
Sbjct  100   LLE-EEMEAVQKLELIEDLKNLGISYPFKDNIQQILNQIYNEHKCCHNSE--VEEKDLYF  156

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+LRQ GF +SQ+VFD F + K   F  +L++DTKGLL LYE+SFL  E E  LE
Sbjct  157   TALRFRLLRQQGFEVSQEVFDHFKNEKGTDFKPNLADDTKGLLQLYEASFLLREAEDTLE  216

Query  1416  LARDFSAKHL--------------------KHELKMPLHWRMPRLEARSFIESYDKGKTT  1297
             LAR FS K L                    +  L++PLHWR+ RLEAR F+++Y   +  
Sbjct  217   LARQFSTKLLQKKVDENGDDKIEDNLLLWIRRSLELPLHWRVQRLEARGFLDAY--VRRP  274

Query  1296  SNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTP  1117
               N I+ ELAKLDFNI QA   E+LK +SRWW  + +AE+L FARDRVVE++ W +G   
Sbjct  275   DMNPIVFELAKLDFNITQATQQEELKDLSRWWNSTGLAEKLPFARDRVVESYFWAMGTFE  334

Query  1116  NPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFC  937
               +Y   R + AK+ +    VDD+YD+YGTL+EL+LFTD I RWD  + ++ LP YM+ C
Sbjct  335   PHQYGYQRELVAKIIALATVVDDVYDVYGTLEELELFTDAIRRWDRES-IDQLPYYMQLC  393

Query  936   YLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENA  757
             +L +NNFV E+A+D+LK+     L HL++ W DL +AYL EAKWY S YTP+ EEY+  A
Sbjct  394   FLTVNNFVFELAHDVLKDKSFNCLPHLQRSWLDLAEAYLVEAKWYHSRYTPSLEEYLNIA  453

Query  756   WITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRG  577
              ++++CP I++ ++F +  +  +  V++ +  Y +I+ LS ++LRL +D GT+ FE+KRG
Sbjct  454   RVSVTCPTIVSQMYFAL-PIPIEKPVIEIMYKYHDILYLSGMLLRLPDDLGTASFELKRG  512

Query  576   DVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARM  397
             DV KA+QCYM E  V  NEAR+ +   + E  K++N   +    PF+  F   A N+ R+
Sbjct  513   DVQKAVQCYMKERNVPENEAREHVKFLIREASKQIN-TAMATDCPFTEDFAVAAANLGRV  571

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             A  +Y  GDG G+ + +   +I TL+FE
Sbjct  572   ANFVYVDGDGFGVQHSKIYEQIGTLMFE  599



>ref|XP_010425235.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=595

 Score =   451 bits (1160),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 255/579 (44%), Positives = 365/579 (63%), Gaps = 35/579 (6%)
 Frame = -3

Query  1974  KLPSIHRSHASSSFRMCYHTTTTT-----RRSANYGPPTWDYSYIQSLNTTHYAAEGFVM  1810
             +LP  H SH      M   T   T     RRS NY P  WD+ Y+ S+   +YA+E  V+
Sbjct  22    RLPHPHGSHRFVCKSMTKTTPDATSVDLRRRSGNYQPSPWDHCYLLSIKN-NYASEKEVI  80

Query  1809  RRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnn  1630
              RD LKE+VK ML +     +E++E ID+L++LG SYHFE EI   L   + +  K++  
Sbjct  81    ARDMLKEKVKRML-DVTKSHLEQLEFIDDLQKLGVSYHFELEINNILTSFHDENGKNTWK  139

Query  1629  yKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESS  1450
                  E+DL+ATALEFR+LRQ+GF++S+++FD  ++  +   N+  S+    +++LYE+S
Sbjct  140   --GDNEEDLHATALEFRLLRQHGFDVSENIFDAIIE--KIESNSFKSDSIPSIISLYEAS  195

Query  1449  FLSMEGETNL-ELARDFSAKHLK-----------------HELKMPLHWRMPRLEARSFI  1324
             +LS + +T L ++ R F+ + ++                 H L+MP HWRM RLE R +I
Sbjct  196   YLSTKADTKLHKVIRPFATEEIRKYVDDETNNMEIREKAIHALEMPYHWRMRRLETRWYI  255

Query  1323  ESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVEN  1144
             ++Y+K      N +L+ELAK+DFNIVQ  H EDLK V+ WWK + +A  L F RDR+VEN
Sbjct  256   DAYEKKHDM--NLVLIELAKVDFNIVQTTHQEDLKYVASWWKDTCLANELPFVRDRIVEN  313

Query  1143  FLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVE  964
             + WT+GL   P++   R +   + + +  +DDIYDIYGTL+EL+LFT  ++ W DV +++
Sbjct  314   YFWTVGLIYEPQFGYLRRIMTIVNALVTTIDDIYDIYGTLEELELFTSMVDNW-DVNRLD  372

Query  963   HLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTP  784
              LP+YMR C+L L N +N I YD+LK   + +   L+K WADLCK YL EAKWY  GY P
Sbjct  373   ELPEYMRLCFLLLCNEINGIGYDILKYKNIDVTPFLKKSWADLCKTYLVEAKWYNRGYKP  432

Query  783   TFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPE-iirlssiilrLANDK  607
             + EEY+ENAWI+IS P IL H F+ V +       L+ L+ + + I+R S+ +LRLAND 
Sbjct  433   SVEEYMENAWISISAPTILIH-FYCVFSDQISLQNLETLSQHRQHIVRRSATVLRLANDL  491

Query  606   GTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTF  427
             GTSP E+ RGDV K++QCYM EA  S  EAR+ +   +++ W  MN       S FS  F
Sbjct  492   GTSPDELARGDVLKSVQCYMHEAGASEEEAREHVQQMISDTWDDMNNETKPARSSFSRGF  551

Query  426   IEVAMNIARMAQCMYQHGDGHGI-NNFETQTRIQTLLFE  313
             +E AMN+ARM+QCMYQ+GDGHG  N  +T  R+++LL +
Sbjct  552   VEAAMNLARMSQCMYQYGDGHGCPNKAKTVDRVRSLLVD  590



>gb|ACN42010.1| geraniol synthase [Perilla setoyensis]
Length=603

 Score =   451 bits (1160),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 354/562 (63%), Gaps = 23/562 (4%)
 Frame = -3

Query  1947  ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLK  1768
             ASSS ++        RRS NY P  WD++Y+QSLNT  Y  E ++ R  EL  +VK +L+
Sbjct  45    ASSSLQLDVKPVEEGRRSGNYQPSIWDFNYVQSLNTP-YKEERYLTRHAELIVQVKPLLE  103

Query  1767  NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkk-kssnnyKATEEKDLYATA  1591
              ++M   +++E+ID+L  LG SY F++ I + L  IY + +   SN     E++DLY TA
Sbjct  104   -KKMEATQQLELIDDLNNLGLSYFFQDRIKQILSFIYDENQCFHSNINDQAEKRDLYFTA  162

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             L FR+LRQ+GFN+SQ+VFD F + K   F ASLS +TKGLL LYE+SFL  EGE  LELA
Sbjct  163   LGFRLLRQHGFNVSQEVFDCFKNDKGSDFKASLSGNTKGLLQLYEASFLVREGEDTLELA  222

Query  1410  RDFSAKHLK----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAIL  1279
             R F+ K L+                H L++PLHWR+ RLEAR F+++Y        N I+
Sbjct  223   RQFATKFLRRKLDEIDDNHLLSRIHHSLEIPLHWRIQRLEARWFLDAY--ATRHDMNPII  280

Query  1278  LELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN  1099
             LELAKLDFNI+QA H E+LK VSRWW+ + +AE+L F RDR+VE++ W I L    +Y  
Sbjct  281   LELAKLDFNIIQATHQEELKDVSRWWQNTRLAEKLPFVRDRLVESYFWAIALFEPHQYGY  340

Query  1098  CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNN  919
              R + AK+ +   ++DD+YDIYGTLDELQLFTD   RW D   +  LP  M+  Y+ ++N
Sbjct  341   QRRVAAKIITLATSIDDVYDIYGTLDELQLFTDNFRRW-DTESLGGLPYSMQLFYMVIHN  399

Query  918   FVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISC  739
             FV+E+AY++LKE G   + +L++ W DL +++L+EA WY SGYTP+ EEYI+N  I+I  
Sbjct  400   FVSELAYEILKEKGFIAIPYLQRSWVDLAESFLKEANWYYSGYTPSLEEYIDNGSISIGA  459

Query  738   PLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
               +L+ V+F + N  E   + + +  Y  I+RLS +++RL +D GTS FE KRGDVPKA+
Sbjct  460   VAVLSQVYFTLANSIEKPKI-ESMYKYHHILRLSGLLVRLHDDLGTSLFEKKRGDVPKAV  518

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             +  M E   +  EA + +   + E WK+MN      G PF       A N+ R AQ +Y 
Sbjct  519   EICMKERNDTEEEAEEHVKYLIREAWKEMNTATAAAGCPFMDELNVAAANLGRAAQFVYL  578

Query  378   HGDGHGINNFETQTRIQTLLFE  313
              GDGHG+ + +   ++  L+F+
Sbjct  579   DGDGHGVQHSKIHQQMGGLMFK  600



>gb|ABB30218.1| geraniol synthase [Perilla frutescens]
 gb|ABI54448.1| geraniol synthase [Perilla frutescens var. crispa]
Length=603

 Score =   451 bits (1160),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 247/562 (44%), Positives = 354/562 (63%), Gaps = 23/562 (4%)
 Frame = -3

Query  1947  ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLK  1768
             AS S ++        RRS NY P  WD++Y+QSLNT  Y  E ++ R  EL  +VK +L+
Sbjct  45    ASCSLQLDVKPVQEGRRSGNYQPSIWDFNYVQSLNTP-YKEERYLTRHAELIVQVKPLLE  103

Query  1767  NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkk-kssnnyKATEEKDLYATA  1591
              ++M   +++E+ID+L  LG SY F++ I + L  IY + +   SN     E++DLY TA
Sbjct  104   -KKMEAAQQLELIDDLNNLGLSYFFQDRIKQILSFIYDENQCFHSNINDQAEKRDLYFTA  162

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             L FR+LRQ+GF++SQ+VFD F +     F ASLS++TKGLL LYE+SFL  EGE  LE A
Sbjct  163   LGFRILRQHGFDVSQEVFDCFKNDSGSDFKASLSDNTKGLLQLYEASFLVREGEDTLEQA  222

Query  1410  RDFSAKHLK----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAIL  1279
             R F+ K L+                H L++PLHWR+ RLEAR F+++Y        N ++
Sbjct  223   RQFATKFLRRKLDEIDDNHLLSCIHHSLEIPLHWRIQRLEARWFLDAY--ATRHDMNPVI  280

Query  1278  LELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN  1099
             LELAKLDFNI+QA H E+LK VSRWW+ + +AE+L F RDR+VE++ W I L    +Y  
Sbjct  281   LELAKLDFNIIQATHQEELKDVSRWWQNTRLAEKLPFVRDRLVESYFWAIALFEPHQYGY  340

Query  1098  CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNN  919
              R + AK+ +   ++DD+YDIYGTLDELQLFTD   RW D   +  LP  M+  Y+ ++N
Sbjct  341   QRRVAAKIITLATSIDDVYDIYGTLDELQLFTDNFRRW-DTESLGRLPYSMQLFYMVIHN  399

Query  918   FVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISC  739
             FV+E+AY++LKE G  ++ +L++ W DL +++L+EA WY SGYTP+ EEYI+N  I+I  
Sbjct  400   FVSELAYEILKEKGFIVIPYLQRSWVDLAESFLKEANWYYSGYTPSLEEYIDNGSISIGA  459

Query  738   PLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
               +L+ V+F + N  E   + + +  Y  I+RLS +++RL +D GTS FE KRGDVPKA+
Sbjct  460   VAVLSQVYFTLANSIEKPKI-ESMYKYHHILRLSGLLVRLHDDLGTSLFEKKRGDVPKAV  518

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             +  M E  V+  EA + +   + E WK+MN      G PF       A N+ R AQ +Y 
Sbjct  519   EICMKERNVTEEEAEEHVKYLIREAWKEMNTATTAAGCPFMDELNVAAANLGRAAQFVYL  578

Query  378   HGDGHGINNFETQTRIQTLLFE  313
              GDGHG+ + +   ++  L+FE
Sbjct  579   DGDGHGVQHSKIHQQMGGLMFE  600



>dbj|BAA08367.1| limonene cyclase [Perilla frutescens var. acuta]
 dbj|BAA21629.1| 1-limonene synthase [Perilla frutescens]
Length=603

 Score =   451 bits (1160),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 260/580 (45%), Positives = 355/580 (61%), Gaps = 37/580 (6%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             +T    +I R      FR C    +  RRS NY P  W+  YI SLN+ HY  +  + R 
Sbjct  35    STSTRAAIARLPLCLRFR-CSLQASDQRRSGNYSPSFWNADYILSLNS-HYKDKSHMKRA  92

Query  1803  DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyK  1624
              EL  +VK M+  +E   V ++E+ID+L++L  S+H E+EI E L  I     K      
Sbjct  93    GELIVQVK-MVMGKETDPVVQLELIDDLQKLALSHHVEKEIKEILFKISTYDHKIMV---  148

Query  1623  ATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFL  1444
                E+DLY+TAL FR+LRQ GF + Q+VFD F +     F  SLS DTKGLL LYE+SFL
Sbjct  149   ---ERDLYSTALAFRLLRQYGFKVPQEVFDCFKNDN-GEFKRSLSSDTKGLLQLYEASFL  204

Query  1443  SMEGETNLELARDFSAKHL-----------------------KHELKMPLHWRMPRLEAR  1333
               EGE  LELAR+F+ K L                       +H L +P+HWR+ R  A 
Sbjct  205   LTEGEMTLELAREFATKSLQEKLNEKTIDDDDDADTNLISCVRHSLDIPIHWRIQRPNAS  264

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              +I++Y +   +  N ++LELAKLD NI QA   ++LK    WWK + +AE+L F RDR+
Sbjct  265   WWIDAYKR--RSHMNPLVLELAKLDLNIFQAQFQQELKQDLGWWKNTCLAEKLPFVRDRL  322

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             VE + W  G+    ++ N R+  AK+ + I  +DDIYD+YGTL+EL+LFT+ I RWD V+
Sbjct  323   VECYFWCTGIIQPLQHENARVTLAKVNALITTLDDIYDVYGTLEELELFTEAIRRWD-VS  381

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              ++HLP+YM+ C+LALNNFV++ AYD++KE  + I+ +LRK W DL + YL EAKW+ SG
Sbjct  382   SIDHLPNYMQLCFLALNNFVDDTAYDVMKEKDINIIPYLRKSWLDLAETYLVEAKWFYSG  441

Query  792   YTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAN  613
             + P  EEY+ NAWI+IS P++L HVFF V +      V + L  Y ++IR SS ILRLA+
Sbjct  442   HKPNLEEYLNNAWISISGPVMLWHVFFRVTDSITRETV-ESLFKYHDLIRYSSTILRLAD  500

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSG  433
             D GTS  E+ RGDVPK+IQCYM++   S  EAR  I   + E WKK+N+      SPF  
Sbjct  501   DLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHIRWLIAETWKKINEEVWSVDSPFCK  560

Query  432   TFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              FI  A ++ RMAQ MY +GDGHGI N +   ++  +LFE
Sbjct  561   DFIACAADMGRMAQFMYHNGDGHGIQNPQIHQQMTDILFE  600



>gb|AAG31435.1| limonene synthase [Perilla citriodora]
Length=604

 Score =   451 bits (1159),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 262/581 (45%), Positives = 357/581 (61%), Gaps = 38/581 (7%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             +T    +I R      FR C    +  RRS NY P  W+  YI SLN  HY  E   M+R
Sbjct  35    STSTRAAIARLPLCLRFR-CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKR  92

Query  1803  -DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnny  1627
               EL  +VK M+  +E   V ++E+ID+L +L  S+HFE+EI E L +I +   K     
Sbjct  93    AGELIVQVK-MVMGKETDPVVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMV--  149

Query  1626  KATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSF  1447
                 E+DLY+TAL FR+LRQ GF + Q+VFD F +     F  SLS DTKGLL LYE+SF
Sbjct  150   ----ERDLYSTALAFRLLRQYGFKVPQEVFDCFKNDNG-EFKRSLSSDTKGLLQLYEASF  204

Query  1446  LSMEGETNLELARDFSAKHL-----------------------KHELKMPLHWRMPRLEA  1336
             L  EGE  LELAR+F+   L                       +H L +P+HWR+ R  A
Sbjct  205   LLTEGEMTLELAREFATIFLQEKLNDKTIDDDDDADTNLISCVRHSLDIPIHWRIQRPNA  264

Query  1335  RSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDR  1156
               +I++Y +   +  N ++LELAKLD NI QA   ++LK    WWK + +AE+L FARDR
Sbjct  265   SWWIDAYKR--RSHMNPLVLELAKLDLNIFQAQFQQELKQDLGWWKNTCLAEKLPFARDR  322

Query  1155  VVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDV  976
             +VE + W  G+    ++ N R+  AK+ + I  +DDIYD+YGTL+EL+LFT+ I RWD V
Sbjct  323   LVECYFWCTGIIQPLQHENARVTLAKVNALITTLDDIYDVYGTLEELELFTEAIRRWD-V  381

Query  975   TKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYAS  796
             + ++HLP+YM+ C+LALNNFV++ AYD++KE  + I+ +LRK W DL + YL EAKW+ S
Sbjct  382   SSIDHLPNYMQLCFLALNNFVDDTAYDVMKEKDINIIPYLRKSWLDLAETYLVEAKWFYS  441

Query  795   GYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLA  616
             G+ P  EEY+ NAWI+IS P++L HVFF V +      V + L  Y ++IR SS ILRLA
Sbjct  442   GHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRETV-ESLFKYHDLIRYSSTILRLA  500

Query  615   NDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFS  436
             +D GTS  E+ RGDVPK+IQCYM++   S  EAR  +   + E WKK+N+      SPF 
Sbjct  501   DDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHVRWLIAETWKKINEEVWSADSPFC  560

Query  435   GTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
               FI  A ++ RMAQ MY +GDGHGI N +   ++  +LFE
Sbjct  561   KDFIACAADMGRMAQFMYHNGDGHGIQNPQIHQQMTDILFE  601



>gb|AGN90911.1| limonene synthase [Mentha spicata]
Length=600

 Score =   450 bits (1158),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 253/580 (44%), Positives = 355/580 (61%), Gaps = 31/580 (5%)
 Frame = -3

Query  2001  KMFSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAE  1822
             K+FS+   C   S  R + SSS        TT RRS NY P  WD  +IQSL++  Y  +
Sbjct  32    KLFSSTNKCSGRSRLRVYCSSS------QLTTERRSGNYNPSRWDVEFIQSLHSD-YKKD  84

Query  1821  GFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkk  1642
                +R  EL   VK M   +E  ++ ++E+ID+L+R+G S HF+ E  E L  IY+    
Sbjct  85    KHAIRASELVTLVK-MELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILSSIYLDHHY  143

Query  1641  ssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
               N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F + +   F  SLS+DT+GLL L
Sbjct  144   YKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFKN-EEGEFKESLSDDTRGLLQL  201

Query  1461  YESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPRLEAR  1333
             YE+SFL  EGET LE AR+F+ K L+                 + L +PLHWR+ R  A 
Sbjct  202   YEASFLLTEGETTLESAREFATKFLEERVNEGGGDGDLLTRIAYSLDIPLHWRIKRPNAP  261

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              +IE Y K      N  +LELA LD NIVQA   E+LK   RWW+ +   E+L FARDR+
Sbjct  262   VWIEWYRK--RPDMNPAVLELAILDLNIVQAQFQEELKESFRWWRNTGFVEKLPFARDRL  319

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             VE + W  G+    ++ + RIM  K+ + I  +DDIYD+YGTL+EL+ FTD I RWD + 
Sbjct  320   VECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEQFTDLIRRWD-IN  378

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +LR+ W DL   Y+ EA+W+  G
Sbjct  379   SIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGG  438

Query  792   YTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAN  613
             + P+ EEY+EN+W +IS P +L H+FF V +      V D L  Y +++R S  +LRLA+
Sbjct  439   HKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-DSLYKYHDLVRWSPFVLRLAD  497

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSG  433
             D GTS  E+ RGDVPK++QCYM     S  EAR  +   + E+WKKMN   +   SPF  
Sbjct  498   DLGTSVEEVSRGDVPKSLQCYMSVYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGK  557

Query  432   TFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              FI  A+++ RMAQ MY +GDGHG  +     ++   LFE
Sbjct  558   DFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFE  597



>ref|XP_008775412.1| PREDICTED: terpene synthase 10-like [Phoenix dactylifera]
Length=582

 Score =   449 bits (1156),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 254/579 (44%), Positives = 364/579 (63%), Gaps = 35/579 (6%)
 Frame = -3

Query  1980  TCKLPSIHRSHAS-SSFRMCY-----HTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEG  1819
             T  L   HR  AS ++ R C+        TT RRSAN+ P  WDY +IQSL  +      
Sbjct  11    TINLAHPHRRLASFTTPRSCHVAHKIPCATTERRSANFQPSLWDYKFIQSLRGSQKDDAK  70

Query  1818  FVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkks  1639
                R ++LK+ V++++  E +  V ++E+ID L++LG  YHF++EI     DI      S
Sbjct  71    NAQRIEKLKKEVRNLIDEEAL--VRQLELIDALQQLGIEYHFDKEIK----DILATTFAS  124

Query  1638  snnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLY  1459
               N      ++LYA AL FRVLR++GF++SQ +F  F D K   F A L ++TK +L+LY
Sbjct  125   LENISMMLSENLYAIALLFRVLREHGFHVSQGIFRSFNDEKG-RFKAYLCKETKDILSLY  183

Query  1458  ESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPRLEARS  1330
             ++S+ ++EGET L+ ARDF+ KHLK                 H L++PL+ RM RL  R 
Sbjct  184   QASYYALEGETTLDEARDFTTKHLKNLNANLLDEPYLQEDVAHALELPLNRRMRRLHTRW  243

Query  1329  FIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVV  1150
             FI++Y +    S + +LLELA LDFN VQA +  +LK  S+WW    +A +L+FARDR++
Sbjct  244   FIDAYKE--EDSMHPVLLELAMLDFNAVQATYQSELKEGSKWWNDLGLAIKLSFARDRLM  301

Query  1149  ENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTK  970
             E + W+IG    P++   R    ++  FI AVDDIYD+YGTLDEL+LFT+ +ERWD V+ 
Sbjct  302   ECYYWSIGWAFEPRFGFYRRTATRVNCFISAVDDIYDVYGTLDELELFTNAVERWD-VSA  360

Query  969   VEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGY  790
             +E LPDYM+ C+LA  N  NE AY +LKE G+ ++  LRK WADLCK++L EAKWY SGY
Sbjct  361   MEQLPDYMKPCFLAFINTTNETAYYVLKEKGIDVIPCLRKAWADLCKSFLVEAKWYHSGY  420

Query  789   TPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAND  610
             TPTF+EY++NAWI+ S P+ L H +  V+        L+C+  YP+I++ ++ I RL +D
Sbjct  421   TPTFKEYLDNAWISSSAPVTLTHAYVCVSQEITQEG-LECIMSYPDIVQCTAKIFRLCDD  479

Query  609   KGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGT  430
                S  E++RGDV  AIQCYM +  VS + AR+ I   ++  WK++N       SPF  +
Sbjct  480   LAGSKEELERGDVSSAIQCYMHDEGVSESVAREHIRGMIDAFWKELNGDRF-TNSPFEES  538

Query  429   FIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             FI  AMN+ARM +C+YQ+GDG+ + + ET+ RI+ LL +
Sbjct  539   FIVTAMNVARMVECIYQYGDGYSMPDRETKDRIKLLLID  577



>gb|AAF76186.1| mercene synthase [Perilla frutescens]
Length=608

 Score =   450 bits (1158),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 245/578 (42%), Positives = 354/578 (61%), Gaps = 35/578 (6%)
 Frame = -3

Query  1977  CKLPSIHRSHASSSFRM---CYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMR  1807
             C + S     A++  R+   C    +  RRS NY P  W+  YI SLN  +         
Sbjct  30    CGVSSTSTRAATARLRLRLRCSMQLSDQRRSGNYSPSFWNTDYILSLNCDYEDERRMRGA  89

Query  1806  RDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnny  1627
               EL E+VK ML  +E   + ++E+ID L++L  S+HFE+E    L +I           
Sbjct  90    AGELVEQVK-MLMEKETDPIVQLELIDVLQKLALSHHFEKEFEGILFNISTIYDD-----  143

Query  1626  KATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSF  1447
                 E+DLY+T L FR+LRQ+G+ + Q++F+ F + K   F  SLS DTKGLL LYE+SF
Sbjct  144   -KNRERDLYSTTLAFRLLRQHGYQVPQELFECFKNDK-GEFKESLSNDTKGLLQLYEASF  201

Query  1446  LSMEGETNLELARDFSAKHL--------------------KHELKMPLHWRMPRLEARSF  1327
             L  EGET LELAR+F+ K L                    +H L MP++WR+ R  AR +
Sbjct  202   LLTEGETTLELAREFATKFLQEKEKLNIDDDDDTNLISCVRHSLDMPIYWRIQRPNARWW  261

Query  1326  IESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVE  1147
             I +Y++   T  N ++LEL+KLDFNI+QA + ++LK   RWW+ + IAE+L FARDR+VE
Sbjct  262   IHAYNR--RTHINPLVLELSKLDFNIIQAQYQQELKQDLRWWRNTCIAEKLPFARDRLVE  319

Query  1146  NFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKV  967
             ++ W+ G+    ++ N RIM AK  + I  +DD+YD+YGTL+EL+LF + I RW +++ +
Sbjct  320   SYFWSTGIIQPRQHENARIMMAKALALITTLDDVYDVYGTLEELELFIEAIRRW-EISSI  378

Query  966   EHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYT  787
             + LP+YM+ C+L +NNFV++ AYD++KE  + I+ +LRK W DL +AYL EAKW+  GY 
Sbjct  379   DQLPNYMQLCFLTINNFVDDTAYDVMKEKDINIIPYLRKSWVDLAEAYLVEAKWFYGGYK  438

Query  786   PTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDK  607
             P  EEY+ N WI++S P IL HVFF V + +     ++ L  Y ++IR SS ++RLA+D 
Sbjct  439   PNLEEYLNNGWISVSGPAILCHVFFGVTD-SITMETVESLFKYHDLIRCSSTLVRLADDL  497

Query  606   GTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTF  427
              TS  E+ RGDVPK+IQCYM++   S  EAR  +   + E WK+MN   +   SPF   F
Sbjct  498   ATSLDEVSRGDVPKSIQCYMNDNNASEEEARLHVRWLIAETWKEMNVEMVSADSPFCKDF  557

Query  426   IEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             I  A ++ RMAQ MY +GDGHG+ N +   ++   LF+
Sbjct  558   IACAADMGRMAQYMYHNGDGHGMQNSQIHQQMTDFLFQ  595



>gb|AAF65545.1| limonene synthase [Perilla citriodora]
Length=604

 Score =   450 bits (1158),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 257/562 (46%), Positives = 350/562 (62%), Gaps = 37/562 (7%)
 Frame = -3

Query  1926  CYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR-DELKERVKDMLKNEEMRE  1750
             C    +  RRS NY P  W+  YI SLN  HY  E   M+R  EL  +VK M+  +E   
Sbjct  53    CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKRAGELIVQVK-MVMGKETDP  110

Query  1749  VEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLR  1570
             V ++E+ID+L +L  S+HFE+EI E L +I +   K         E+DLY+TAL FR+LR
Sbjct  111   VVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMV------ERDLYSTALAFRLLR  164

Query  1569  QNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKH  1390
             Q GF + Q+VFD F +     F  SLS DTKGLL LYE+SFL  EGE  LELAR+F+   
Sbjct  165   QYGFKVPQEVFDCFKNDN-GEFKRSLSSDTKGLLQLYEASFLLTEGEMTLELAREFATIF  223

Query  1389  L-----------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAIL  1279
             L                       +H L +P+HWR+ R  A  +I++Y +   +  N ++
Sbjct  224   LQEKLNDKTIDDDDDADTNLISCVRHSLDIPIHWRIQRPNASWWIDAYKR--RSHMNPLV  281

Query  1278  LELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN  1099
             LELAKLD NI QA   ++LK    WWK + +AE+L FARDR+VE + W  G+    ++ N
Sbjct  282   LELAKLDLNIFQAQFQQELKQDLGWWKNTCLAEKLPFARDRLVECYFWCTGIIQPLQHEN  341

Query  1098  CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNN  919
              R+  AK+ + I  +DDIYD+YGTL+EL+LFT+ I RWD V+ ++HLP+YM+ C+LALNN
Sbjct  342   ARVTLAKVNALITTLDDIYDVYGTLEELELFTEAIRRWD-VSSIDHLPNYMQLCFLALNN  400

Query  918   FVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISC  739
             FV++ AYD++KE  + I+ +LRK W DL + YL EAKW+ SG+ P  EEY+ NAWI+IS 
Sbjct  401   FVDDTAYDVMKEKDINIIPYLRKSWLDLAETYLVEAKWFYSGHKPNMEEYLNNAWISISG  460

Query  738   PLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
             P++L HVFF V +      V + L  Y ++IR SS ILRLA+D GTS  E+ RGDVPK+I
Sbjct  461   PVMLCHVFFRVTDSITRETV-ESLFKYHDLIRYSSTILRLADDLGTSLEEVSRGDVPKSI  519

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             QCYM++   S  EAR  +   + E WKK+N+      SPF   FI  A ++ RMAQ MY 
Sbjct  520   QCYMNDNNASEEEARRHVRWLIAETWKKINEEVWSADSPFCKDFIACAADMGRMAQFMYH  579

Query  378   HGDGHGINNFETQTRIQTLLFE  313
             +GDGHGI N +   ++  +LFE
Sbjct  580   NGDGHGIQNPQIHQQMTDILFE  601



>gb|AAY88965.1| geraniol synthase [Perilla citriodora]
 gb|ABB30216.1| geraniol synthase [Perilla citriodora]
 gb|ABB30217.1| geraniol synthase [Perilla citriodora]
Length=603

 Score =   450 bits (1157),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 247/562 (44%), Positives = 354/562 (63%), Gaps = 23/562 (4%)
 Frame = -3

Query  1947  ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLK  1768
             AS S ++        RRS NY P  WD++Y+QSLNT  Y  E ++ R  EL  +VK +L+
Sbjct  45    ASCSLQLDVKPVQEGRRSGNYQPSIWDFNYVQSLNTP-YKEERYLTRHAELIVQVKPLLE  103

Query  1767  NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkk-kssnnyKATEEKDLYATA  1591
              ++M   +++E+ID+L  LG SY F++ I + L  IY + +   SN     E++DLY TA
Sbjct  104   -KKMEPAQQLELIDDLNNLGLSYFFQDRIKQILSFIYDENQCFHSNINDQAEKRDLYFTA  162

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             L FR+LRQ+GF++SQ+VFD F +     F ASLS++TKGLL LYE+SFL  EGE  LE A
Sbjct  163   LGFRLLRQHGFDVSQEVFDCFKNDNGSDFKASLSDNTKGLLQLYEASFLVREGEDTLEQA  222

Query  1410  RDFSAKHLK----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAIL  1279
             R F+ K L+                H L++PLHWR+ RLEAR F+++Y        N ++
Sbjct  223   RQFATKFLRRKLDEIDDNHLLSCIHHSLEIPLHWRIQRLEARWFLDAY--ATRHDMNPVI  280

Query  1278  LELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN  1099
             LELAKLDFNI+QA H E+LK VSRWW+ + +AE+L F RDR+VE++ W I L    +Y  
Sbjct  281   LELAKLDFNIIQATHQEELKDVSRWWQNTRLAEKLPFVRDRLVESYFWAIALFEPHQYGY  340

Query  1098  CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNN  919
              R + AK+ +   ++DD+YDIYGTLDELQLFTD   RW D   +  LP  M+  Y+ ++N
Sbjct  341   QRRVAAKIITLATSIDDVYDIYGTLDELQLFTDNFRRW-DTESLGRLPYSMQLFYMVIHN  399

Query  918   FVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISC  739
             FV+E+AY++LKE G  ++ +L++ W DL +++L+EA WY SGYTP+ EEYI+N  I+I  
Sbjct  400   FVSELAYEILKEKGFIVIPYLQRSWVDLAESFLKEANWYYSGYTPSLEEYIDNGSISIGA  459

Query  738   PLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAI  559
               +L+ V+F + N  E   + + +  Y  I+RLS +++RL +D GTS FE KRGDVPKA+
Sbjct  460   VAVLSQVYFTLANSIEKPKI-ESMYKYHHILRLSGLLVRLHDDLGTSLFEKKRGDVPKAV  518

Query  558   QCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQ  379
             +  M E  V+  EA + +   + E WK+MN      G PF       A N+ R AQ +Y 
Sbjct  519   EICMKERNVTEEEAEEHVKYLIREAWKEMNTATTAAGCPFMDELNVAAANLGRAAQFVYL  578

Query  378   HGDGHGINNFETQTRIQTLLFE  313
              GDGHG+ + +   ++  L+FE
Sbjct  579   DGDGHGVQHSKIHQQMGGLMFE  600



>gb|AAG31437.1| limonene synthase [Perilla frutescens]
Length=604

 Score =   450 bits (1157),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 261/581 (45%), Positives = 357/581 (61%), Gaps = 38/581 (7%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             +T    +I R      FR C    +  RRS NY P  W+  YI SLN  HY  E   M+R
Sbjct  35    STSTRAAIARLPLCLRFR-CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKR  92

Query  1803  -DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnny  1627
               EL  +VK M+  +E   V ++E+ID+L +L  S+HFE+EI E L +I +   K     
Sbjct  93    AGELIVQVK-MVMGKETDPVVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMV--  149

Query  1626  KATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSF  1447
                 E+DLY+TAL FR+LRQ+G+ + Q+VFD F +     F  SLS DTKGLL LYE+SF
Sbjct  150   ----ERDLYSTALAFRLLRQHGYQVHQEVFDCFKNDNG-EFKRSLSSDTKGLLQLYEASF  204

Query  1446  LSMEGETNLELARDFSAKHL-----------------------KHELKMPLHWRMPRLEA  1336
             L  EGE  LELAR+F+   L                       +H L +P+HWR+ R  A
Sbjct  205   LLTEGEMTLELAREFATIFLQEKLNDKTIDDDDDADTNLISCVRHSLDIPIHWRIQRPNA  264

Query  1335  RSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDR  1156
               +I++Y +   +  N ++LELAKLD NI QA   ++LK    WWK + +AE+L FARDR
Sbjct  265   SWWIDAYKR--RSHMNPLVLELAKLDLNIFQAQFQQELKQDLGWWKNTCLAEKLPFARDR  322

Query  1155  VVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDV  976
             +VE + W  G+    ++ N R+  AK+ + I  +DDIYD+YGTL+EL+LFT+ I RWD V
Sbjct  323   LVECYFWCTGIIQPLQHENARVTLAKVNALITTLDDIYDVYGTLEELELFTEAIRRWD-V  381

Query  975   TKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYAS  796
               ++HLP+YM+ C+LALNNFV++ AYD++KE  + I+ +LRK W DL + YL EAKW+ S
Sbjct  382   ISIDHLPNYMQLCFLALNNFVDDTAYDVMKEKDINIIPYLRKSWLDLAETYLVEAKWFYS  441

Query  795   GYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLA  616
             G+ P  EEY+ NAWI+IS P++L HVFF V +      V + L  Y ++IR SS ILRLA
Sbjct  442   GHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRETV-ESLFKYHDLIRYSSTILRLA  500

Query  615   NDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFS  436
             +D GTS  E+ RGDVPK+IQCYM++   S  EAR  +   + E WKK+N+      SPF 
Sbjct  501   DDLGTSLEEVSRGDVPKSIQCYMNDDNASEEEARRHVRWLIAETWKKINEEVWSADSPFC  560

Query  435   GTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
               FI  A ++ RMAQ MY +GDGHGI N +   ++  +LFE
Sbjct  561   KDFIACAADMGRMAQFMYHNGDGHGIQNPQIHQQMTDILFE  601



>gb|ABW86881.1| limonene synthase [Mentha x piperita]
Length=599

 Score =   449 bits (1156),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 253/601 (42%), Positives = 364/601 (61%), Gaps = 46/601 (8%)
 Frame = -3

Query  2001  KMFSTFTTCKLPS-----IHRSHASSSFRMCYHTT----------------TTTRRSANY  1885
             K+FS      +PS     +  SH +SS ++  +T                 TT RRS NY
Sbjct  4     KVFSGAMQMPIPSKLTTYLQPSHLNSSPKLLSNTKGTSRSRLRVSCSSSQLTTERRSGNY  63

Query  1884  GPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGC  1705
              P  WD  +IQ+L++  Y  E    R  EL   VK M   +E  ++ ++E+ID+L+R+G 
Sbjct  64    NPSRWDVDFIQTLHSD-YKDEKHARRASELVTLVK-MELEKETDQIRQLELIDDLQRMGL  121

Query  1704  SYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFM  1525
             S HF+ E  E L  +Y+      N     EE+DLY+T+L FR+LR++GF ++Q+VFD F 
Sbjct  122   SDHFQNEFKEILSSVYLDHGYYKNPD-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFK  180

Query  1524  DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------------  1384
             + +   F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+             
Sbjct  181   N-EEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDENLL  239

Query  1383  ----HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKS  1216
                 + L++PLHWR+ R  A  +I+SY K      N ++L+LA LD NIVQA   ++LK 
Sbjct  240   TRIAYSLEIPLHWRIKRPNAPVWIDSYRKRPNM--NPVVLDLAILDLNIVQAHFQQELKE  297

Query  1215  VSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDI  1036
               RWW+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+
Sbjct  298   SFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDV  357

Query  1035  YGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHL  856
             YGTL+EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV+E +YD++KE GV ++ +L
Sbjct  358   YGTLEELEHFTDLIRRWD-IDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYL  416

Query  855   RKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVL  676
             R+ W DL   Y+ EA+W+  G+ P+ EEY+EN+W++IS P +L H+FF V +      V 
Sbjct  417   RQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWMSISGPCMLTHIFFRVTDSFTKETV-  475

Query  675   DCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLE  496
             D L  Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   
Sbjct  476   DSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWL  535

Query  495   MNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             + E+WKKMN   +   SPF   FI  A+++ RMAQ MY +GDGHG  +     ++   LF
Sbjct  536   IAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTATLF  595

Query  315   E  313
             E
Sbjct  596   E  596



>gb|AAC37366.1| 4S-limonene synthase [Mentha spicata]
Length=599

 Score =   449 bits (1155),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 255/597 (43%), Positives = 360/597 (60%), Gaps = 37/597 (6%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIHRSHASSSFRM-----------CYHTTTTT-RRSANYGPPT  1873
             +A    + S  TTC  PS  +S                   C  +  TT RRS NY P  
Sbjct  8     VATQMAIPSNLTTCLQPSHFKSSPKLLSSTNSSSRSRLRVYCSSSQLTTERRSGNYNPSR  67

Query  1872  WDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHF  1693
             WD ++IQSL  + Y  +  V+R  EL   VK M   +E  ++ ++E+ID+L+R+G S HF
Sbjct  68    WDVNFIQSL-LSDYKEDKHVIRASELVTLVK-MELEKETDQIRQLELIDDLQRMGLSDHF  125

Query  1692  EEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKR  1513
             + E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F + + 
Sbjct  126   QNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFKN-EE  183

Query  1512  CGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------  1384
               F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+                 
Sbjct  184   GEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEEKVNEGGVDGDLLTRIA  243

Query  1383  HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRW  1204
             + L +PLHWR+ R  A  +IE Y   K    N ++LELA LD NIVQA   E+LK   RW
Sbjct  244   YSLDIPLHWRIKRPNAPVWIEWY--RKRPDMNPVVLELAILDLNIVQAQFQEELKESFRW  301

Query  1203  WKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTL  1024
             W+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+YGTL
Sbjct  302   WRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTL  361

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMW  844
             +EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +LR+ W
Sbjct  362   EELEQFTDLIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYLRQSW  420

Query  843   ADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLT  664
              DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +      V D L 
Sbjct  421   VDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-DSLY  479

Query  663   DYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNEL  484
              Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   + E+
Sbjct  480   KYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEV  539

Query  483   WKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             WKKMN   +   SPF   FI  A+++ RMAQ MY +GDGHG  +     ++   LFE
Sbjct  540   WKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFE  596



>ref|XP_008460932.1| PREDICTED: terpene synthase 10-like isoform X3 [Cucumis melo]
Length=601

 Score =   449 bits (1155),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 257/551 (47%), Positives = 356/551 (65%), Gaps = 34/551 (6%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMRE-VEKME  1735
              T RRSANY P  W   +IQSL ++ +    +  R + L   VK MLK     + +E++E
Sbjct  61    ATVRRSANYHPSIWKDEFIQSL-SSQFKGVTYGKRLNHLIGEVKAMLKKAPSEDSLEQLE  119

Query  1734  MIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             +ID L+RLG SY+FE EI   L  +Y K+           +KDLY T+LEFR+ RQ+GF 
Sbjct  120   LIDTLQRLGISYYFESEIKHVLKTLYNKRDLD------DNKKDLYVTSLEFRLFRQHGFE  173

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----  1387
             ISQ VF  F D      N S   +   +L+LYE+SF S E E  LE A+ F+  +L    
Sbjct  174   ISQ-VFSDFKDEIEISDNISFLGNINRILSLYEASFSSFENEDFLEKAKCFAINYLEKYM  232

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          KH L++PLHWR  R+EAR FI+ Y++ K    N ILLE+AKLDFNI+
Sbjct  233   RRTRVDEVDMAMIKHALELPLHWRTSRMEARWFIDIYERKKDM--NPILLEMAKLDFNIL  290

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             Q+++LEDLKS S WW  S + E L+F+RDR++ NFLWTIG    P++  CR M  K+ SF
Sbjct  291   QSIYLEDLKSASSWWTSSRLGENLSFSRDRLMANFLWTIGTGFEPEFSYCRRMITKINSF  350

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I  +DDIYD+YGTLDEL+LFT  IERW DV  ++ +P YM+  +LAL++ +NE+A+ + K
Sbjct  351   ITILDDIYDVYGTLDELELFTKAIERW-DVNAIDEIPYYMKVYFLALHDSINEMAFQVFK  409

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVF-FY  709
             +  V ++ +L  MW  LCK+YLQEAKWY S Y PT EEY++NAW++IS P+IL H + F 
Sbjct  410   DQEVDVIQYLHNMWIGLCKSYLQEAKWYHSNYKPTLEEYMDNAWVSISGPVILVHSYVFA  469

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
              +++A++   L+ L    +IIR SS ILRLA+D  TS  E+KRGDVPK+IQCYM++  VS
Sbjct  470   TSHIAKEE--LESLDKTNDIIRWSSTILRLADDLATSSDELKRGDVPKSIQCYMNDTGVS  527

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
              N+AR++I   +NE WKK+N+   E  +  S   I+++ N+ARMAQCMY +GDG+GI   
Sbjct  528   ENDARNYIKHLINETWKKLNESEAENIA-LSQVIIQMSKNLARMAQCMYLNGDGYGIEQ-  585

Query  348   ETQTRIQTLLF  316
             ET+  + +L+ 
Sbjct  586   ETKDHVLSLII  596



>gb|AGN90902.1| limonene synthase [Mentha arvensis]
 gb|AGN90909.1| limonene synthase [Mentha suaveolens]
Length=599

 Score =   449 bits (1155),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 256/601 (43%), Positives = 361/601 (60%), Gaps = 46/601 (8%)
 Frame = -3

Query  2001  KMFSTFTTCKLPS-----IHRSHASSSFRMCYHTT----------------TTTRRSANY  1885
             K+FS  T   +PS     +  SH  SS ++   T                 TT RRS NY
Sbjct  4     KVFSVATQMAIPSKLTTCLQPSHLKSSPKLFSSTNSSGRSRLRVYCSSSQLTTERRSGNY  63

Query  1884  GPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGC  1705
              P  WD  +IQSL++  Y  +   +R  EL   VK M   +E  ++ ++E+ID+L+R+G 
Sbjct  64    NPSRWDVEFIQSLHSD-YKKDKHAIRASELVTLVK-MELEKETDQIRQLELIDDLQRMGL  121

Query  1704  SYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFM  1525
             S HF+ E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F 
Sbjct  122   SDHFQNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFK  180

Query  1524  DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------------  1384
             + +   F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+             
Sbjct  181   N-EEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDGDLL  239

Query  1383  ----HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKS  1216
                 + L +PLHWR+ R  A  +IE Y   K    N  +LELA LD NIVQA   E+LK 
Sbjct  240   TRIAYSLDIPLHWRIKRPNAPVWIEWY--RKRPDMNPAVLELAILDLNIVQAQFQEELKE  297

Query  1215  VSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDI  1036
               RWW+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+
Sbjct  298   SFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDV  357

Query  1035  YGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHL  856
             YGTL+EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +L
Sbjct  358   YGTLEELEQFTDLIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYL  416

Query  855   RKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVL  676
             R+ W DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +      V 
Sbjct  417   RQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-  475

Query  675   DCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLE  496
             D L  Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   
Sbjct  476   DSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWL  535

Query  495   MNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             + E+WKKMN   +   SPF   FI  A+++ RMAQ MY +GDGHG  +     ++   LF
Sbjct  536   IAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLF  595

Query  315   E  313
             E
Sbjct  596   E  596



>gb|AAK06663.1| limonene synthase [Perilla frutescens var. frutescens]
Length=604

 Score =   449 bits (1155),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 261/581 (45%), Positives = 356/581 (61%), Gaps = 38/581 (7%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             +T    +I R      FR C    +  RRS NY P  W+  YI SLN  HY  E   M+R
Sbjct  35    STSTRAAIARLPLCLRFR-CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKR  92

Query  1803  -DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnny  1627
               EL  +VK M+  +E   V ++E+ID+L +L  S+HFE+EI E L +I +   K     
Sbjct  93    AGELIVQVK-MVMGKETDPVVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMV--  149

Query  1626  KATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSF  1447
                 E+DLY+TAL FR+LRQ GF + Q+VFD F +     F  SLS DTKGLL LYE+SF
Sbjct  150   ----ERDLYSTALAFRLLRQYGFKVPQEVFDCFKNDNG-EFKRSLSSDTKGLLQLYEASF  204

Query  1446  LSMEGETNLELARDFSAKHL-----------------------KHELKMPLHWRMPRLEA  1336
             L  EGE  LELAR+F+   L                       +H L +P+HWR+ R  A
Sbjct  205   LLTEGEMTLELAREFATIFLQEKLNDKTIDDDDDADTNLISCVRHSLDIPIHWRIQRPNA  264

Query  1335  RSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDR  1156
               +I++Y +   +  N ++LELAKLD NI QA   ++LK    WWK + +AE+L F RDR
Sbjct  265   SWWIDAYKR--RSHMNPLVLELAKLDLNIFQAQFQQELKQDLGWWKNTCLAEKLPFTRDR  322

Query  1155  VVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDV  976
             +VE + W  G+    ++ N R+  AK+ + I  +DDIYD+YGTL+EL+LFT+ I RWD V
Sbjct  323   LVECYFWCTGIIQPLQHENARVTLAKVNALITTLDDIYDVYGTLEELELFTEAIRRWD-V  381

Query  975   TKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYAS  796
             + ++HLP+YM+ C+LALNNFV++ AYD++KE  + I+ +LRK W DL + YL EAKW+ S
Sbjct  382   SSIDHLPNYMQLCFLALNNFVDDTAYDVMKEKDINIIPYLRKSWLDLAETYLVEAKWFYS  441

Query  795   GYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLA  616
             G+ P  EEY+ NAWI+IS P++L HVFF V +      V + L  Y ++IR SS ILRLA
Sbjct  442   GHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRETV-ESLFKYHDLIRYSSTILRLA  500

Query  615   NDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFS  436
             +D GTS  E+ RGDVPK+IQCYM++   S  EAR  +   + E WKK+N+      SPF 
Sbjct  501   DDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHVRWLIAETWKKINEEVWSADSPFC  560

Query  435   GTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
               FI  A ++ RMAQ MY +GDGHGI N +   ++  +LFE
Sbjct  561   KDFIACAADMGRMAQFMYHNGDGHGIQNPQIHQQMTDILFE  601



>gb|AGN90905.1| limonene synthase [Mentha canadensis]
 gb|AGN90906.1| limonene synthase [Mentha canadensis]
 gb|AGN90907.1| limonene synthase [Mentha canadensis]
 gb|AGN90910.1| limonene synthase [Mentha suaveolens]
 gb|AGN90912.1| limonene synthase [Mentha spicata]
Length=599

 Score =   449 bits (1154),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 257/597 (43%), Positives = 365/597 (61%), Gaps = 41/597 (7%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIHRS--------HASSSFRMCYHTT----TTTRRSANYGPPT  1873
             MAI +K+    TTC  PS  +S        ++S   R+  + +    TT RRS NY P  
Sbjct  12    MAIPSKL----TTCLQPSHLKSSPKLFPSTNSSGRSRLRVYCSSSQLTTERRSGNYNPSR  67

Query  1872  WDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHF  1693
             WD  +IQSL++  Y  +   +R  EL   VK M   +E  ++ ++E+ID+L+R+G S HF
Sbjct  68    WDVEFIQSLHSD-YKKDKHAIRASELVTLVK-MELEKETDQIRQLELIDDLQRMGLSDHF  125

Query  1692  EEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKR  1513
             + E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F + + 
Sbjct  126   QNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFKN-EE  183

Query  1512  CGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------  1384
               F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+                 
Sbjct  184   GEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDGDLLTRIA  243

Query  1383  HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRW  1204
             + L +PLHWR+ R  A  +IE Y K      N  +LELA LD NIVQA   E+LK   RW
Sbjct  244   YSLDIPLHWRIKRPNAPVWIEWYRKRPDM--NPAVLELAILDLNIVQAQFQEELKESFRW  301

Query  1203  WKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTL  1024
             W+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+YGTL
Sbjct  302   WRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTL  361

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMW  844
             +EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +LR+ W
Sbjct  362   EELEQFTDLIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYLRQSW  420

Query  843   ADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLT  664
              DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +      V D L 
Sbjct  421   VDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-DSLY  479

Query  663   DYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNEL  484
              Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   + E+
Sbjct  480   KYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEV  539

Query  483   WKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             WKKMN   +   SPF   FI  A+++ RMAQ MY +GDGHG  +     ++   LFE
Sbjct  540   WKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFE  596



>gb|AAG31438.1| limonene synthase [Perilla frutescens]
Length=603

 Score =   449 bits (1154),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 259/580 (45%), Positives = 354/580 (61%), Gaps = 37/580 (6%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             +T    +I R      FR C    +  RRS NY P  W+  YI  LN+ HY  +  + R 
Sbjct  35    STSTRAAIARLPLCLRFR-CSLQASDQRRSGNYSPSFWNADYILLLNS-HYKDKSHMKRA  92

Query  1803  DELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyK  1624
              EL  +VK M+  +E   V ++E+ID+L++L  S+H E+EI E L  I     K      
Sbjct  93    GELIVQVK-MVMGKETDPVVQLELIDDLQKLALSHHVEKEIKEILFKISTYDHKIMV---  148

Query  1623  ATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFL  1444
                E+DLY+TAL FR+LRQ GF + Q+VFD F +     F  SLS DTKGLL LYE+SFL
Sbjct  149   ---ERDLYSTALAFRLLRQYGFKVPQEVFDCFKNDNG-EFKRSLSSDTKGLLQLYEASFL  204

Query  1443  SMEGETNLELARDFSAKHL-----------------------KHELKMPLHWRMPRLEAR  1333
               EGE  LELAR+F+ K L                       +H L +P+HWR+ R  A 
Sbjct  205   LTEGEMTLELAREFATKSLQEKLNEKTIDDDDDADTNLISCVRHSLDIPIHWRIQRPNAS  264

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              +I++Y +   +  N ++LELAKLD NI QA   ++LK    WWK + +AE+L F RDR+
Sbjct  265   WWIDAYKR--RSHMNPLVLELAKLDLNIFQAQFQQELKQDLGWWKNTCLAEKLPFVRDRL  322

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             VE + W  G+    ++ N R+  AK+ + I  +DDIYD+YGTL+EL+LFT+ I RWD V+
Sbjct  323   VECYFWCTGIIQPLQHENARVTLAKVNALITTLDDIYDVYGTLEELELFTEAIRRWD-VS  381

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              ++HLP+YM+ C+LALNNFV++ AYD++KE  + I+ +LRK W DL + YL EAKW+ SG
Sbjct  382   SIDHLPNYMQLCFLALNNFVDDTAYDVMKEKDINIIPYLRKSWLDLAETYLVEAKWFYSG  441

Query  792   YTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAN  613
             + P  EEY+ NAWI+IS P++L HVFF V +      V + L  Y ++IR SS ILRLA+
Sbjct  442   HKPNLEEYLNNAWISISGPVMLCHVFFRVTDSITRETV-ESLFKYHDLIRYSSTILRLAD  500

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSG  433
             D GTS  E+ RGDVPK+IQCYM++   S  EAR  I   + E WKK+N+      SPF  
Sbjct  501   DLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHIRWLIAETWKKINEEVWSVDSPFCK  560

Query  432   TFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              FI  A ++ RMAQ MY +GDGHGI N +   ++  +LFE
Sbjct  561   DFIACAADMGRMAQFMYHNGDGHGIQNPQIHQQMTDILFE  600



>gb|AFZ41794.1| putative cineole synthase, partial [Rosmarinus officinalis]
Length=593

 Score =   448 bits (1153),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 253/570 (44%), Positives = 355/570 (62%), Gaps = 34/570 (6%)
 Frame = -3

Query  1965  SIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKER  1786
             + HR   +       +   T RR+  Y P  WD++ IQS N+  Y  E  + R   L E+
Sbjct  36    TTHRGLRARCSLQAANEIQTGRRTGGYQPTLWDFNSIQSFNS-EYKEEMHLERAAALIEQ  94

Query  1785  VKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKD  1606
             VK ML  E++ +V  +E+ID+L+R+G S HF+ EI +              N   T E+D
Sbjct  95    VK-MLLLEQVDDVRCLELIDDLRRMGISSHFDHEIAQIF-------NSKYFNNNETGERD  146

Query  1605  LYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGET  1426
             LY+TAL FR+LR++GF++SQ+VFD F +     FN S + DTKGLL LYE+SFLS +GE 
Sbjct  147   LYSTALRFRLLREHGFSVSQEVFDYFKNDNGTDFNPSFAHDTKGLLQLYEASFLSAQGEE  206

Query  1425  NLELARDFSAKHLK-----HE-------------LKMPLHWRMPRLEARSFIESYDKGKT  1300
              LE+AR+F+ K L+     HE             L+ P HWR+    ARSFI++Y +   
Sbjct  207   TLEIAREFARKFLEKRVVDHEIDDINLLSSVERALEFPAHWRVQMPNARSFIDAYKRRPD  266

Query  1299  TSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLT  1120
                N ++LELAKLD NIVQA   ++LK  SRWW  + + ++L F RDR+VE + WT G+ 
Sbjct  267   M--NPVVLELAKLDINIVQAQFQQELKEASRWWNSTCLVQQLPFVRDRIVECYYWTTGVL  324

Query  1119  PNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRF  940
                ++ N RIM  K+ + +  +DD++DIYGT++ELQLFT  I+RW D+  +  LP YM+ 
Sbjct  325   ERRQHGNERIMLTKINALVTTIDDVFDIYGTVEELQLFTAAIQRW-DIESMNQLPPYMQI  383

Query  939   CYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIEN  760
             CYLA+ NFVNE AYD LKE G   +  LRK W DL ++YL EA WY +G+ P+ EEYIEN
Sbjct  384   CYLAVFNFVNETAYDTLKEKGFNSVPFLRKAWVDLVESYLIEADWYYNGHKPSLEEYIEN  443

Query  759   AWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKR  580
             AWI+I    IL+H+FF + +  E+ AV + +  Y +I+R S  ILRLA+D GTS  E++R
Sbjct  444   AWISIGGIPILSHLFFQLTDSIEEEAV-ESMHKYHDIVRASCTILRLADDMGTSLDEVER  502

Query  579   GDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIAR  400
             GDVPK++QCYM+E   S  EAR+ +   + + WK MNK  +   SPFS  F+E A N+ R
Sbjct  503   GDVPKSVQCYMNEKNASEEEAREHVRSLIEQTWKTMNKEMM--MSPFSKYFVEAAANLGR  560

Query  399   MAQCMYQH-GDGHGINNFETQTRIQTLLFE  313
             MAQC+YQH  DG G+ +      +++LLF+
Sbjct  561   MAQCIYQHERDGFGMQHSLVNKMLRSLLFD  590



>ref|XP_009602963.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=492

 Score =   444 bits (1143),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 226/449 (50%), Positives = 306/449 (68%), Gaps = 25/449 (6%)
 Frame = -3

Query  1605  LYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGET  1426
             LYA AL+FR+ R++ F+ISQD+F+ F D        ++ +DTKGLL LYE+SFL+ E ET
Sbjct  24    LYAIALKFRLFREHDFHISQDIFNDFKDEND-NLKENICKDTKGLLQLYEASFLATETET  82

Query  1425  NLELARDFSAKHLK-------------------HELKMPLHWRMPRLEARSFIESYDKGK  1303
              L+ A  F+A HLK                   H L++P HW MPRLE + +I  Y+   
Sbjct  83    TLKYATRFTAAHLKNYLGNHCDHKDNRMVALAQHALELPRHWMMPRLETQWYISIYEI--  140

Query  1302  TTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGL  1123
              ++ N +LLELAKLDFNIVQAVH +DL+ +SRWWK + +AE+L+F+RDR+VEN  W +G+
Sbjct  141   MSNANPLLLELAKLDFNIVQAVHQQDLRILSRWWKSTCLAEKLSFSRDRLVENLFWAVGI  200

Query  1122  TPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMR  943
                P++   R M  K+ +F+  +DDIYD+YGTLDEL++FTD IERW ++  +E LP YM+
Sbjct  201   EFEPQHSYFRRMLTKVIAFVGIIDDIYDVYGTLDELEVFTDAIERW-EIKAIEQLPHYMK  259

Query  942   FCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIE  763
              CYLAL N  NE+AY++LKE G+ +L +L K WADLCK++++EA+WY SGY PT EEY++
Sbjct  260   VCYLALFNITNEMAYEILKEQGIDVLPYLTKSWADLCKSFIREARWYYSGYVPTLEEYMD  319

Query  762   NAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMK  583
             NAWI+I+ P++L H FF V N     A L+ L+ YP++IR S+ I RLA+D  TS  E+K
Sbjct  320   NAWISIAVPMVLVHAFFLVTNPVPKEA-LESLSKYPDLIRCSATIFRLADDLATSSDELK  378

Query  582   RGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIA  403
             RGDVPK+IQCYM+E   S  EAR+ I   + E W++MN    E  S FS TF+E+  NIA
Sbjct  379   RGDVPKSIQCYMNEKGTSEEEAREHIRFCIKETWERMNTTQRE-NSLFSDTFVEITKNIA  437

Query  402   RMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             R A CMY HGDGHGI N E +  I  +L 
Sbjct  438   RTAHCMYLHGDGHGIQNGEVKNSISKILL  466



>gb|KDP25062.1| hypothetical protein JCGZ_22597 [Jatropha curcas]
Length=1168

 Score =   464 bits (1195),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 258/574 (45%), Positives = 364/574 (63%), Gaps = 43/574 (7%)
 Frame = -3

Query  1947  ASSSFRMCYH-TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDML  1771
              +   R C    T   RRSANY P  WD+S+++SL T+ +  E + MR +++KE VK M+
Sbjct  605   VNGGVRFCISGKTVAARRSANYPPSKWDHSFVESL-TSEFVGEPYSMRIEKMKEEVKMMI  663

Query  1770  KNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATA  1591
               EE+     +E+ID ++RLG ++HFE+EI +AL  IY    K +      +  DL ATA
Sbjct  664   --EEV--ANPLEIIDTVQRLGVAHHFEDEIQKALKCIYSNNNKCTIM---KQSDDLCATA  716

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             LEFR+LRQ G+N  Q+VF  F D +   F ASL +D KGL+ LYE+S+LS+ GET LE A
Sbjct  717   LEFRLLRQQGYNAPQEVFSSFKD-EEGNFRASLCDDLKGLVYLYEASYLSVPGETILEEA  775

Query  1410  RDFSAKHL----------------------------KHELKMPLHWRMPRLEARSFIESY  1315
             RDF++K++                            +H +++PL WRM R E R FI+ Y
Sbjct  776   RDFASKNILKYLNNIRDSYEQEQIISGEEHVQVMLARHAMELPLRWRMQRAECRWFIDVY  835

Query  1314  DKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLW  1135
             +   + S N  LL  AKLDFN+VQA+H +DLK    WWKK+ + E+L F RDR +E FL 
Sbjct  836   ES--SPSMNPTLLHFAKLDFNMVQAIHQQDLKHAFSWWKKTGLGEKLGFVRDRPMEVFLR  893

Query  1134  TIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLP  955
              +G    P+Y   R +  ++ + +  VDDIYD+YGT DELQLF+D +ERW D+  ++ LP
Sbjct  894   AVGGLYEPQYAYFRRILTRVGALVTVVDDIYDVYGTFDELQLFSDAVERW-DMDAMDQLP  952

Query  954   DYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFE  775
              YM+ C+LAL N +NEI  ++L  +G+++L +L++ W +LCK+YL EAKWY  GYTPT E
Sbjct  953   RYMKICFLALYNSINEIVQELLVNYGLYVLPYLKREWTNLCKSYLLEAKWYHDGYTPTLE  1012

Query  774   EYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSP  595
             EY++N +I+IS PL+L H +F V     +  V   L +YP+IIR SS+I RLA+D GTS 
Sbjct  1013  EYLQNGFISISAPLLLVHAYFTVTGQITE-EVSKYLEEYPDIIRYSSLITRLADDLGTSS  1071

Query  594   FEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVA  415
             +E KRGD  K+IQCYM E + S  EAR +I   + E WKK+N+  I   +  S T +++ 
Sbjct  1072  YEQKRGDNSKSIQCYMHETESSEEEARKYIHYLIGETWKKINEEQIR-NTHLSQTLMKMG  1130

Query  414   MNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             +N+ARM+QCMYQHGDG G+ N ET+  I +LL +
Sbjct  1131  INLARMSQCMYQHGDGFGVQNVETKNYILSLLVQ  1164


 Score =   400 bits (1028),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 235/568 (41%), Positives = 336/568 (59%), Gaps = 65/568 (11%)
 Frame = -3

Query  1947  ASSSFRMCYHTTT-TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDML  1771
              ++  R C    T   RRSANY P  WD+S+++SL T+ +  E + MR +++KE+VK M+
Sbjct  34    VNAGVRCCISGKTGAARRSANYPPSKWDHSFVESL-TSEFVGEPYSMRIEKMKEQVKMMI  92

Query  1770  KNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATA  1591
               EE+     +E+ID ++RLG ++HFE+EI +AL  IY    K +      +  DL ATA
Sbjct  93    --EEV--ANPLEIIDTVQRLGLAHHFEDEIQKALKCIYSNNNKCTIM---KQSDDLCATA  145

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             LEFR+LRQ G++  Q+VF  F D +   F ASL +D KGL+ LYE+S+LS+ GET LE A
Sbjct  146   LEFRLLRQQGYDAPQEVFSSFKD-EEGNFRASLCDDLKGLVYLYEASYLSVPGETILEEA  204

Query  1410  RDFSAKHL----------------------------KHELKMPLHWRMPRLEARSFIESY  1315
             RDF++K++                            +H +++PL WRM R + R FI+ Y
Sbjct  205   RDFASKNILKYLNNIRDSYEQEQIISGEEHVQVMLARHAMELPLRWRMQRADCRWFIDVY  264

Query  1314  DKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLW  1135
             +   + S N  LL  AKLDFN+VQA+H +DLK    WWKK+ + E+L F R R +E FLW
Sbjct  265   ES--SPSMNPTLLHFAKLDFNMVQAIHQQDLKHAFSWWKKTGLGEKLGFVRGRPMEVFLW  322

Query  1134  TIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLP  955
              +G    P+Y   R +  ++ + +  VDDIYD+YGT DELQLF+D +ERW D+  ++ LP
Sbjct  323   AVGGLYEPQYAYFRRILTRVGALVTVVDDIYDVYGTFDELQLFSDAVERW-DIDAMDQLP  381

Query  954   DYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFE  775
              YM+ C+L L N +NEI  ++L  +G+ +L +L++ W +LCK+YL EAKWY         
Sbjct  382   QYMKICFLTLYNSINEIVQELLVNYGLSVLPYLKREWTNLCKSYLLEAKWYHE-------  434

Query  774   EYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSP  595
                            L H +F V     +  V   L +YP+IIR S++I RL +D GTS 
Sbjct  435   ---------------LVHAYFTVTGQITE-EVSKYLEEYPDIIRYSALISRLVDDLGTSS  478

Query  594   FEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVA  415
              E KRGD  K+IQCYM E   S  EAR +I   + E WKK+N+  I     FS T I++ 
Sbjct  479   HEQKRGDNSKSIQCYMHETGSSEKEARKYIHYLIGETWKKINEEQIRNNH-FSQTLIKLG  537

Query  414   MNIARMAQCMYQHGDGHGINNFETQTRI  331
             +N+AR++Q +YQ+GDG G  N ET+  I
Sbjct  538   INLARISQFVYQYGDGFGAQNVETKNNI  565



>gb|AGS42396.1| terpene synthase 3 [Thymus vulgaris]
Length=595

 Score =   447 bits (1150),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 263/554 (47%), Positives = 339/554 (61%), Gaps = 34/554 (6%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNT-THYAAEGFVMRRDELKERVKDMLKNEEMREVEK  1741
             T    RRS NY P  WD+SYIQSLNT  HY  E   +RR EL   VK +L  EE+  V++
Sbjct  52    TVKDRRRSGNYRPALWDFSYIQSLNTHDHYNKE---VRRGELIVEVKKLL-GEEIGAVKQ  107

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNG  1561
             +E+ID+LK LG SY F+EEI   L  IY + K   NN      KDLY TAL FR+LR+ G
Sbjct  108   LELIDDLKNLGLSYFFQEEIRNVLGSIYAEHKFFRNNQVEGS-KDLYFTALGFRLLREAG  166

Query  1560  FNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
             FNISQ+VFD F + +  GF   L EDTKG+L LYE+SFL  EGE  LELAR  S + LK 
Sbjct  167   FNISQEVFDRFKNEEGSGFEERLGEDTKGMLQLYEASFLLREGEDTLELARQISTEFLKE  226

Query  1383  -----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDF  1255
                              H L++PLHWR+ RLEAR F+++Y   K    N ++ ELAKLDF
Sbjct  227   KLDGTEISDGNLSSSIRHSLEIPLHWRIQRLEARWFLDAYAARKDM--NPLIFELAKLDF  284

Query  1254  NIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKL  1075
             N +QA   ++LK +SRWWK   +  +L F RDR+VE++ W +GL    K+   R + AK+
Sbjct  285   NNIQATQQQELKDLSRWWKNLSLPVKLPFVRDRLVESYFWAVGLFEPHKFGYQRKIAAKI  344

Query  1074  YSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYD  895
              + I ++DD+YDIYGTLDELQLFTD I RW D      LP Y++  Y AL  FV+E+AYD
Sbjct  345   ITLITSLDDVYDIYGTLDELQLFTDAIRRW-DTKSANQLPYYLQLFYFALYTFVSEVAYD  403

Query  894   MLK-EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHV  718
             +LK E G F + HL++ W DL + YLQEAKWY + YTP+ EEY+  A +TI  P +++ V
Sbjct  404   ILKEEEGFFTIPHLQRAWVDLVEGYLQEAKWYHANYTPSMEEYLNTATVTIGAPAVISQV  463

Query  717   FFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEA  538
              F +    E A   + L +Y EIIRLS  ++RL +D GT PFEMKRGDV K+IQ YM E 
Sbjct  464   HFVLAKSNEKA---ESLHEYEEIIRLSGKLVRLPDDLGTLPFEMKRGDVAKSIQIYMKEH  520

Query  537   KVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI  358
               S  EA + +  E+ E WK+MN +     +        V  N+ R AQ MY  GDG   
Sbjct  521   GASREEAEEHVRYEIREAWKEMNTLMAAKSALRDDDLAMVVANLGRDAQFMYLDGDG---  577

Query  357   NNFETQTRIQTLLF  316
             N+   Q +IQ LLF
Sbjct  578   NHSHLQHQIQNLLF  591



>ref|NP_189212.1| 1,8-cineole synthase [Arabidopsis thaliana]
 ref|NP_189210.2| 1,8-cineole synthase [Arabidopsis thaliana]
 sp|P0DI76.1|CIN1_ARATH RecName: Full=1,8-cineole synthase 1, chloroplastic; Short=AtTPS-CIN1; 
AltName: Full=Limonene cyclase; AltName: Full=Terpenoid 
synthase 27; Short=AtTPS27; Flags: Precursor [Arabidopsis 
thaliana]
 sp|P0DI77.1|CIN2_ARATH RecName: Full=1,8-cineole synthase 2, chloroplastic; Short=AtTPS-CIN2; 
AltName: Full=Limonene cyclase; AltName: Full=Terpenoid 
synthase 23; Short=AtTPS23; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01180.1| limonene cyclase [Arabidopsis thaliana]
 dbj|BAB01181.1| limonene cyclase [Arabidopsis thaliana]
 gb|AAU01970.1| 1,8-cineole synthase [Arabidopsis thaliana]
 gb|AEE77073.1| 1,8-cineole synthase [Arabidopsis thaliana]
 gb|AEE77075.1| 1,8-cineole synthase [Arabidopsis thaliana]
Length=600

 Score =   447 bits (1151),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 243/555 (44%), Positives = 359/555 (65%), Gaps = 34/555 (6%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  W++ Y+ S+    YA+E  V+ RD LK++VK ML +E+   +E++E+ID
Sbjct  46    SRRSGNYQPSPWNHCYLLSIENK-YASETEVITRDVLKKKVKSMLDDEKKSRLEQLELID  104

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             +L++LG SYHFE EI + L D+++K  ++       +E+DL+AT+LEFR+LRQ+GF++S+
Sbjct  105   DLQKLGVSYHFEIEINDTLTDLHLKMGRNCWK--CDKEEDLHATSLEFRLLRQHGFDVSE  162

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNL-ELARDFSAKHLK-----  1384
             ++FD  +D  +   N   + +  G+++LYE+S+LS + +T L ++ R F+ + ++     
Sbjct  163   NIFDVIID--QIESNTFKTNNINGIISLYEASYLSTKSDTKLHKVIRPFATEQIRKFVDD  220

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                          H L+MP HWRM RL+ R +I++Y+K      N +L+E AK+DFNIVQ
Sbjct  221   EDTKNIEVREKAYHALEMPYHWRMRRLDTRWYIDAYEKKHDM--NLVLIEFAKIDFNIVQ  278

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A H EDLK VSRWWK + +  +L F RDR+VEN+ WT+GL   P++   R +   + + +
Sbjct  279   AAHQEDLKYVSRWWKDTCLTNQLPFVRDRIVENYFWTVGLIYEPQFGYIRRIMTIVNALV  338

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
               +DDIYDIYGTL+EL+LFT  +E W DV ++  LP+YMR C+L L N +N I  D+LK 
Sbjct  339   TTIDDIYDIYGTLEELELFTSMVENW-DVNRLGELPEYMRLCFLILYNEINGIGCDILKY  397

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
               + ++ +L+K WADLC+ YL EAKWY  GY P+ EEY++NAWI+IS P IL H F+ V 
Sbjct  398   KKIDVIPYLKKSWADLCRTYLVEAKWYKRGYKPSLEEYMQNAWISISAPTILIH-FYCVF  456

Query  702   NLAEDAAVLDCLTDYPEiirl-ssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
             +       L+ L+ + + I   S+ +LRLAND GTSP E+ RGDV K++QCYM E   S 
Sbjct  457   SDQISVQNLETLSQHRQHIVRCSATVLRLANDLGTSPTELARGDVLKSVQCYMHETGASE  516

Query  525   NEARDFIDLEMNELWKKMN---KVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGI-  358
               ARD +   ++++W  MN   K      S   G F E AMN+ARM+QCMYQ+GDGHG  
Sbjct  517   ERARDHVHQMISDMWDDMNSETKTACNSSSRSRG-FKEAAMNLARMSQCMYQYGDGHGCP  575

Query  357   NNFETQTRIQTLLFE  313
                +T  R+Q+LL +
Sbjct  576   EKAKTIDRVQSLLVD  590



>gb|AGN90908.1| limonene synthase [Mentha canadensis]
Length=599

 Score =   447 bits (1150),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 255/597 (43%), Positives = 365/597 (61%), Gaps = 41/597 (7%)
 Frame = -3

Query  2016  MAIMAKMFSTFTTCKLPSIHRS--------HASSSFRMCYHTT----TTTRRSANYGPPT  1873
             MAI +K+    TTC  PS  +S        ++S   R+  + +    TT RRS NY P  
Sbjct  12    MAIPSKL----TTCLQPSHLKSSPKLFPSTNSSGRSRLRVYCSSSQLTTERRSGNYNPSR  67

Query  1872  WDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHF  1693
             WD  +IQSL++  Y  +   +R  EL   VK M   +E  ++ ++E+ID+L+R+G S HF
Sbjct  68    WDVEFIQSLHSD-YKKDKHAIRASELVTLVK-MELEKETDQIRQLELIDDLQRMGLSDHF  125

Query  1692  EEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKR  1513
             + E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F + + 
Sbjct  126   QNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFKN-EE  183

Query  1512  CGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------  1384
               F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+                 
Sbjct  184   GEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDGDLLTRIA  243

Query  1383  HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRW  1204
             + L +PLHWR+ R  A  +IE Y K      N  +LELA LD NIVQA   E+LK   RW
Sbjct  244   YSLDIPLHWRIKRPNAPVWIEWYRK--RPDMNPAVLELAILDLNIVQAQFQEELKESFRW  301

Query  1203  WKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTL  1024
             W+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+YGTL
Sbjct  302   WRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTL  361

Query  1023  DELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMW  844
             +EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +LR+ W
Sbjct  362   EELEQFTDLIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYLRQSW  420

Query  843   ADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLT  664
              DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +      V D L 
Sbjct  421   VDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-DSLY  479

Query  663   DYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNEL  484
              Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   + E+
Sbjct  480   KYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEV  539

Query  483   WKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             WK+MN   +   SPF   F+  A+++ RMAQ MY +GDGHG  +     ++   LFE
Sbjct  540   WKRMNAERVSKDSPFGKDFVGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLFE  596



>gb|AAD50304.1|AF175323_1 limonene synthase [Mentha longifolia]
Length=599

 Score =   447 bits (1150),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 256/601 (43%), Positives = 362/601 (60%), Gaps = 46/601 (8%)
 Frame = -3

Query  2001  KMFSTFTTCKLPS-----IHRSHASSSFRM---------------CYHTT-TTTRRSANY  1885
             K+FS  T   +PS     +  SH  SS ++               C  +  TT RRS NY
Sbjct  4     KVFSVATQMAIPSKLTRCLQPSHLKSSPKLLSSTNSSSRSRLRVYCSSSQLTTERRSGNY  63

Query  1884  GPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGC  1705
              P  WD  +IQSL++  Y  +   +R  EL   VK M   +E   + ++E+ID+L+R+G 
Sbjct  64    NPSRWDVEFIQSLHSD-YEEDKHAIRASELVTLVK-MELEKETDHIRQLELIDDLQRMGL  121

Query  1704  SYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFM  1525
             S HF+ E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F 
Sbjct  122   SDHFQNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFK  180

Query  1524  DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------------  1384
             + +   F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+             
Sbjct  181   N-EEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGVDGDLL  239

Query  1383  ----HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKS  1216
                 + L +PLHWR+ R  A ++IE Y   K    N ++LELA LD NIVQA   E+LK 
Sbjct  240   TRIAYSLDIPLHWRIKRPNAPAWIEWY--RKRPDMNPVVLELAILDLNIVQAQFQEELKE  297

Query  1215  VSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDI  1036
               RWW+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+
Sbjct  298   SFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDV  357

Query  1035  YGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHL  856
             YGTL+EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +L
Sbjct  358   YGTLEELEQFTDLIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYL  416

Query  855   RKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVL  676
             R+ W DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +      V 
Sbjct  417   RQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-  475

Query  675   DCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLE  496
             D L  Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   
Sbjct  476   DSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWL  535

Query  495   MNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             + E+WKKMN   +   SPF   FI  A ++ RMAQ MY +GDGHG  +     ++   LF
Sbjct  536   IAEVWKKMNAERVSKDSPFGKDFIGCAADLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLF  595

Query  315   E  313
             E
Sbjct  596   E  596



>ref|XP_006487820.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=625

 Score =   448 bits (1152),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 256/566 (45%), Positives = 355/566 (63%), Gaps = 44/566 (8%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKN-----EEMREVEK  1741
              RRSANY P  W Y Y+QSL+   YA E    R ++LK  V+ ML N     + +  +  
Sbjct  63    NRRSANYQPSIWSYDYLQSLSNG-YAGESCAQRIEKLKGEVRLMLDNYKELDDYVDALYY  121

Query  1740  MEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKD---LYATALEFRVLR  1570
             +E++D L+RLG SYHFE EI   L  IY K+    ++    +E     LYA +LEFR+LR
Sbjct  122   LEIVDNLQRLGVSYHFEGEIKRFLNRIYNKRNSRRSSTYHAKENQESLLYAASLEFRLLR  181

Query  1569  QNGFNI-SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNL-ELARDFSA  1396
             Q+G++I +      FMD ++  F + L +D KG+L LYE+++L  E E+ +   A +F+ 
Sbjct  182   QHGYDIHAHGTLSSFMD-EKGKFKSCLGDDIKGILALYEAAYLLGEEESTIFHEAINFTT  240

Query  1395  KHL----------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAI  1282
              HL                      KH L++PLHWRM RLEAR FI+ Y++G  T  N +
Sbjct  241   THLEEYVKKHNDDDDDDGGYFSALVKHALELPLHWRMVRLEARWFIDVYERG--TDMNPV  298

Query  1281  LLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYV  1102
             L+ELAKLDFN VQA H ++LK VS WW+K+ + E L FARDR+VENF W +G    P++ 
Sbjct  299   LVELAKLDFNSVQAAHQDELKYVSWWWRKTGLGE-LHFARDRIVENFFWALGEIWEPQFG  357

Query  1101  NCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALN  922
              CR M  K+ + I  VDD+YD+YGTLDEL+ FT+ +ERWD V  ++ LP YM+ C+  L+
Sbjct  358   YCRRMSTKVNALITTVDDVYDVYGTLDELEQFTNAVERWD-VNAMDQLPYYMKMCFHVLH  416

Query  921   NFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITIS  742
             +  NE+A+D LK+ GV ++ +L+K WAD+CK++L EAKWY+SGY PT +EYIENAW+++S
Sbjct  417   SSTNEMAFDALKDQGVHVVPYLKKAWADMCKSFLLEAKWYSSGYIPTLDEYIENAWVSVS  476

Query  741   CPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKA  562
              P+IL H +  + N A++ A L  L +YP IIR  S+I RLAND  TS  E+KRGDVPKA
Sbjct  477   GPVILLHAYSLIANPAKEEA-LQFLQEYPHIIRWPSMIFRLANDLATSSDEVKRGDVPKA  535

Query  561   IQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSP----FSGTFIEVAMNIARMA  394
             IQCYM E   S ++AR  I   +   W KMN       +P        F++ AMN+ARMA
Sbjct  536   IQCYMHETGASESDARQHIRDLITAAWMKMNNKREGDENPDHLLLPNNFVQFAMNLARMA  595

Query  393   QCMYQHGDGHGINNFETQTRIQTLLF  316
             QC YQ+GDGH + +  ++ R+  LL 
Sbjct  596   QCTYQNGDGHTVQD-NSKNRVLPLLI  620



>ref|NP_001268188.1| uncharacterized protein LOC100243167 [Vitis vinifera]
 ref|XP_010657361.1| PREDICTED: uncharacterized protein LOC100243167 isoform X1 [Vitis 
vinifera]
 gb|ADR74204.1| (E)-beta-ocimene synthase [Vitis vinifera]
Length=601

 Score =   447 bits (1149),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 245/568 (43%), Positives = 359/568 (63%), Gaps = 36/568 (6%)
 Frame = -3

Query  1941  SSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVM--------RRDELKER  1786
             S+    +   T +RRSA+Y P  W Y +++SL       +G V         R  +L++ 
Sbjct  37    SANEQSFSLMTESRRSAHYQPAFWSYDFVESLKKREEICDGSVKELEKMYEDRARKLEDE  96

Query  1785  VKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKD  1606
             VK M+  +    +  +E ID+++RLG  + FE +I  +L  I + +  +     A + + 
Sbjct  97    VKWMIHEKSAEPLTLLEFIDDIQRLGLGHRFENDIKRSLDKILLLEGSN-----AGKGES  151

Query  1605  LYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGET  1426
             L+ TAL FR+L+Q+G+ +SQ+VF+GF D +   F A L +D KG+L+LYE+S+L+ EGET
Sbjct  152   LHHTALRFRILKQHGYKVSQEVFEGFTD-QNGHFKACLCKDVKGMLSLYEASYLASEGET  210

Query  1425  NLELARDFSAKHLK---------------HELKMPLHWRMPRLEARSFIESYDKGKTTSN  1291
              L  A  F   HLK               H +++PLH RMPRLEAR FIE+Y + +   +
Sbjct  211   LLHEAMAFLKMHLKDLEGTLDKSLEELVNHAMELPLHRRMPRLEARWFIEAYKRREGADD  270

Query  1290  NAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNP  1111
               +LLELA LDFN+VQ    +DL+ +SRWWK   +A +L FARDR++E F WT+G+   P
Sbjct  271   --VLLELAILDFNMVQWTLQDDLQDMSRWWKDMGLASKLHFARDRLMECFFWTVGMAFEP  328

Query  1110  KYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYL  931
             ++ NCR    K+ SFI  +DD+YD+YG++DEL+LFTD + RW D+  V +LP YM+ C+L
Sbjct  329   EFSNCRKGLTKVTSFITTIDDVYDVYGSVDELELFTDAVARW-DINMVNNLPGYMKLCFL  387

Query  930   ALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWI  751
             AL N VNE+AYD LKE G  IL +L K WADLCK +L EAKW    YTPTFEEY+EN W 
Sbjct  388   ALYNTVNEMAYDTLKEQGHNILPYLTKAWADLCKVFLVEAKWCHKEYTPTFEEYLENGWR  447

Query  750   TISCPLILAHVFFYVN-NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGD  574
             ++S   IL H +F ++ N+ ++A  L+CL +  E++R  S I RL ND  TS  E++RG+
Sbjct  448   SVSGAAILIHAYFLMSKNITKEA--LECLENDHELLRWPSTIFRLCNDLATSKAELERGE  505

Query  573   VPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVG-IEGGSPFSGTFIEVAMNIARM  397
                +I CYM +  VS  +AR+ + + ++E WKKMNKV  ++  SPF+  F+E A+N+AR+
Sbjct  506   SANSISCYMHQTGVSEEDAREHMKILIDESWKKMNKVREMDSDSPFAKPFVETAINLARI  565

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             AQC YQ+GD HG  +  ++ R+ +L+ E
Sbjct  566   AQCTYQYGDSHGAPDARSKKRVLSLIVE  593



>emb|CAN65805.1| hypothetical protein VITISV_042691 [Vitis vinifera]
Length=601

 Score =   447 bits (1149),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 245/568 (43%), Positives = 359/568 (63%), Gaps = 36/568 (6%)
 Frame = -3

Query  1941  SSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVM--------RRDELKER  1786
             S+    +   T +RRSA+Y P  W Y +++SL       +G V         R  +L++ 
Sbjct  37    SANEQSFSLMTESRRSAHYQPAFWSYDFVESLKKREEICDGSVKELEKMYEDRARKLEDE  96

Query  1785  VKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKD  1606
             VK M+  +    +  +E ID+++RLG  + FE +I  +L  I + +  +     A + + 
Sbjct  97    VKWMIHEKSAEPLTLLEFIDDIQRLGLGHRFENDIKRSLDKILLLEGSN-----AGKGES  151

Query  1605  LYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGET  1426
             L+ TAL FR+L+Q+G+ +SQ+VF+GF D +   F A L +D KG+L+LYE+S+L+ EGET
Sbjct  152   LHHTALRFRILKQHGYKVSQEVFEGFTD-QNGHFKACLCKDVKGMLSLYEASYLASEGET  210

Query  1425  NLELARDFSAKHLK---------------HELKMPLHWRMPRLEARSFIESYDKGKTTSN  1291
              L  A  F   HLK               H +++PLH RMPRLEAR FIE+Y + +   +
Sbjct  211   LLHEAMAFLKMHLKDLEGTLDKSLEELVNHAMELPLHRRMPRLEARWFIEAYKRREGADD  270

Query  1290  NAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNP  1111
               +LLELA LDFN+VQ    +DL+ +SRWWK   +A +L FARDR++E F WT+G+   P
Sbjct  271   --VLLELAILDFNMVQWTLQDDLQDMSRWWKDMGLASKLHFARDRLMECFFWTVGMAFEP  328

Query  1110  KYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYL  931
             ++ NCR    K+ SFI  +DD+YD+YG++DEL+LFTD + RW D+  V +LP YM+ C+L
Sbjct  329   EFSNCRKGLTKVTSFITTIDDVYDVYGSVDELELFTDAVARW-DINMVNNLPGYMKLCFL  387

Query  930   ALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWI  751
             AL N VNE+AYD LKE G  IL +L K WADLCK +L EAKW    YTPTFEEY+EN W 
Sbjct  388   ALYNTVNEMAYDTLKEQGHNILPYLTKAWADLCKVFLVEAKWCHKEYTPTFEEYLENGWR  447

Query  750   TISCPLILAHVFFYVN-NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGD  574
             ++S   IL H +F ++ N+ ++A  L+CL +  E++R  S I RL ND  TS  E++RG+
Sbjct  448   SVSGAAILIHAYFLMSKNITKEA--LECLENDHELLRWPSTIFRLCNDLATSKAELERGE  505

Query  573   VPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVG-IEGGSPFSGTFIEVAMNIARM  397
                +I CYM +  VS  +AR+ + + ++E WKKMNKV  ++  SPF+  F+E A+N+AR+
Sbjct  506   SANSISCYMHQTGVSEEDAREHMKILIDESWKKMNKVREMDSDSPFAKPFVETAINLARI  565

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             AQC YQ+GD HG  +  ++ R+ +L+ E
Sbjct  566   AQCTYQYGDSHGAPDARSKKRVLSLIVE  593



>pdb|2ONG|A Chain A, Crystal Structure Of Of Limonene Synthase With 2- Fluorogeranyl 
Diphosphate (Fgpp).
 pdb|2ONG|B Chain B, Crystal Structure Of Of Limonene Synthase With 2- Fluorogeranyl 
Diphosphate (Fgpp).
 pdb|2ONH|A Chain A, Crystal Structure Of Of Limonene Synthase With 2- Fluorolinalyl 
Diphosphate(flpp)
 pdb|2ONH|B Chain B, Crystal Structure Of Of Limonene Synthase With 2- Fluorolinalyl 
Diphosphate(flpp)
Length=543

 Score =   444 bits (1143),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 345/547 (63%), Gaps = 25/547 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD ++IQSL  + Y  +  V+R  EL   VK M   +E  ++ ++E+ID+
Sbjct  2     RRSGNYNPSRWDVNFIQSL-LSDYKEDKHVIRASELVTLVK-MELEKETDQIRQLELIDD  59

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+R+G S HF+ E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+
Sbjct  60    LQRMGLSDHFQNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQE  118

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------  1384
             VFD F + +   F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+       
Sbjct  119   VFDSFKN-EEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEEKVNEGG  177

Query  1383  ----------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                       + L +PLHWR+ R  A  +IE Y   K    N ++LELA LD NIVQA  
Sbjct  178   VDGDLLTRIAYSLDIPLHWRIKRPNAPVWIEWY--RKRPDMNPVVLELAILDLNIVQAQF  235

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              E+LK   RWW+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +
Sbjct  236   QEELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVI  295

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DDIYD+YGTL+EL+ FTD I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV
Sbjct  296   DDIYDVYGTLEELEQFTDLIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGV  354

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              ++ +LR+ W DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +  
Sbjct  355   NVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSF  414

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
                 V D L  Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR
Sbjct  415   TKETV-DSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEAR  473

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               +   + E+WKKMN   +   SPF   FI  A+++ RMAQ MY +GDGHG  +     +
Sbjct  474   KHVKWLIAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQ  533

Query  333   IQTLLFE  313
             +   LFE
Sbjct  534   MTRTLFE  540



>sp|A7IZZ2.1|TPS2_CANSA RecName: Full=(+)-alpha-pinene synthase, chloroplastic; Flags: 
Precursor [Cannabis sativa]
 gb|ABI21838.1| (+)-alpha-pinene synthase [Cannabis sativa]
Length=615

 Score =   446 bits (1148),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 247/556 (44%), Positives = 348/556 (63%), Gaps = 35/556 (6%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             T+T  RRSANY PP W + +IQSL    Y  E +  R ++LKE VK ML   E   V+ +
Sbjct  66    TSTIVRRSANYDPPIWSFDFIQSL-PCKYKGEPYTSRSNKLKEEVKKMLVGMENSLVQ-L  123

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E+ID L+RLG SYHFE EI+  L +       ++ +     + DLYATALEFR+LR+ G+
Sbjct  124   ELIDTLQRLGISYHFENEIISILKE-----YFTNISTNKNPKYDLYATALEFRLLREYGY  178

Query  1557  NISQDVFDGFMDGKRCGFNASL-SEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-  1384
              I Q++F+ F D +   F AS+ ++D KG+L LYE+SF    GE  LE AR F+ ++LK 
Sbjct  179   AIPQEIFNDFKD-ETGKFKASIKNDDIKGVLALYEASFYVKNGENILEEARVFTTEYLKR  237

Query  1383  --------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
                                 H L+MPLHWR  R EA+ FIE Y+K  T   N  LLE AK
Sbjct  238   YVMMIDQNIILNDNMAILVRHALEMPLHWRTIRAEAKWFIEEYEK--TQDKNGTLLEFAK  295

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAE-RLTFARDRVVENFLWTIGLTPNPKYVNCRIM  1087
             LDFN++Q++  EDLK VSRWW+ S + + ++ +ARDR+VE FLW +G+   P++ + R +
Sbjct  296   LDFNMLQSIFQEDLKHVSRWWEHSELGKNKMVYARDRLVEAFLWQVGVRFEPQFSHFRRI  355

Query  1086  GAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNE  907
              A++Y+ I  +DDIYD+YGTL+EL+LFT  +ERWD  T +  LPDYM+  +  L N VNE
Sbjct  356   SARIYALITIIDDIYDVYGTLEELELFTKAVERWDAKT-IHELPDYMKLPFFTLFNTVNE  414

Query  906   IAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLIL  727
             +AYD+L+EH    + +L+  WA+LC+ YL+EAKW+ SGY PT ++YIENA ++I   +I 
Sbjct  415   MAYDVLEEHNFVTVEYLKNSWAELCRCYLEEAKWFYSGYKPTLKKYIENASLSIGGQIIF  474

Query  726   AHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYM  547
              + FF +     + A+      +    R  S++LRLA+D GT   EMKRGDVPK+IQCYM
Sbjct  475   VYAFFSLTKSITNEALESLQEGHHAACRQGSLMLRLADDLGTLSDEMKRGDVPKSIQCYM  534

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDG  367
              +   S +EAR+ I   ++E+WK+MN    E  S FS  F++   N+ RM+  MYQHGDG
Sbjct  535   HDTGASEDEAREHIKFLISEIWKEMNDED-EYNSIFSKEFVQACKNLGRMSLFMYQHGDG  593

Query  366   HGINNFETQTRIQTLL  319
             H   +  ++ RI  L+
Sbjct  594   HASQDSHSRKRISDLI  609



>gb|AGN90915.1| limonene synthase [Mentha canadensis]
Length=599

 Score =   446 bits (1146),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 255/601 (42%), Positives = 362/601 (60%), Gaps = 46/601 (8%)
 Frame = -3

Query  2001  KMFSTFTTCKLPS-----IHRSHASSSFRM---------------CYHTT-TTTRRSANY  1885
             K+FS  T   +PS     +  SH  SS ++               C  +  TT RRS NY
Sbjct  4     KVFSVATQMAIPSKLTRCLQPSHLKSSPKLLSSTNSSSRSRLRVYCSSSQLTTERRSGNY  63

Query  1884  GPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGC  1705
              P  WD  +IQSL++  Y  +   +R  EL   VK M   +E   + ++E+ID+L+R+G 
Sbjct  64    NPSRWDVEFIQSLHSD-YEEDKHAIRASELVTLVK-MELEKETDHIRQLELIDDLQRMGL  121

Query  1704  SYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFM  1525
             S HF+ E  E L  IY+      N +   EE+DLY+T+L FR+LR++GF ++Q+VFD F 
Sbjct  122   SDHFQNEFKEILSSIYLDHHYYKNPF-PKEERDLYSTSLAFRLLREHGFQVAQEVFDSFK  180

Query  1524  DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK-------------  1384
             + +   F  SLS+DT+GLL LYE+SFL  EGET LE AR+F+ K L+             
Sbjct  181   N-EEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGVDGDLL  239

Query  1383  ----HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKS  1216
                 + L +PLHWR+ R  A ++IE Y   K    N ++LELA LD NIVQA   E+LK 
Sbjct  240   TRIAYSLDIPLHWRIKRPNAPTWIEWY--RKRPDMNPVVLELAILDLNIVQAQFQEELKE  297

Query  1215  VSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDI  1036
               RWW+ +   E+L FARDR+VE + W  G+    ++ + RIM  K+ + I  +DDIYD+
Sbjct  298   SFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDV  357

Query  1035  YGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHL  856
             YGTL+EL+ FT+ I RWD +  ++ LPDYM+ C+LALNNFV++ +YD++KE GV ++ +L
Sbjct  358   YGTLEELEQFTELIRRWD-INSIDQLPDYMQLCFLALNNFVDDTSYDVMKEKGVNVIPYL  416

Query  855   RKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVL  676
             R+ W DL   Y+ EA+W+  G+ P+ EEY+EN+W +IS P +L H+FF V +      V 
Sbjct  417   RQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETV-  475

Query  675   DCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLE  496
             D L  Y +++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +   S  EAR  +   
Sbjct  476   DSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWL  535

Query  495   MNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
             + E+WKKMN   +   SPF   FI  A ++ RMAQ MY +GDGHG  +     ++   LF
Sbjct  536   IAEVWKKMNAERVSKDSPFGKDFIGCAADLGRMAQLMYHNGDGHGTQHPIIHQQMTRTLF  595

Query  315   E  313
             E
Sbjct  596   E  596



>ref|XP_006471091.1| PREDICTED: (R)-limonene synthase 1-like isoform X1 [Citrus sinensis]
 ref|XP_006471092.1| PREDICTED: (R)-limonene synthase 1-like isoform X2 [Citrus sinensis]
Length=607

 Score =   446 bits (1147),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 246/557 (44%), Positives = 354/557 (64%), Gaps = 34/557 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y   T  RRSANY P  WD+ ++QSLN+ +Y  + +  R +ELK +VK  +K +    ++
Sbjct  46    YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDQTYRRRAEELKGKVKTAIK-DVTEPLD  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG +YHFE EI   L +I+   K  +       +++LYAT+LEFR+LRQ+
Sbjct  104   QLELIDNLQRLGLAYHFEPEIRNILRNIHNHNKDYNW-----RKENLYATSLEFRLLRQH  158

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             G+ +SQ+VF GF D K  GF   + +D KG+L+L+E+S+ S+EGE+ +E A  F++KHLK
Sbjct  159   GYPVSQEVFSGFKDDK-GGF---ICDDFKGILSLHEASYYSLEGESIMEEAWQFTSKHLK  214

Query  1383  --------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
                                   L++PLHW++P LEAR FI  Y+K +    N +LLELAK
Sbjct  215   ETMIISNSKEEYVFVAEQAKRALELPLHWKVPMLEARWFIHVYEKRE--DKNHLLLELAK  272

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             L+FN +QA++ E+LK +S WWK + + E+L+FAR+R+V +FLW++G+   P++  CR + 
Sbjct  273   LEFNTLQAIYQEELKDISGWWKDTALGEKLSFARNRLVASFLWSMGIAFEPQFAYCRRVL  332

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
                 + I  +DDIYD+YGTLDEL++FTD + RWD    ++HLP YM+ C+LAL NFVNE 
Sbjct  333   TISIALITVIDDIYDVYGTLDELEIFTDAVARWDINYALKHLPGYMKMCFLALYNFVNEF  392

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
             AY +LK+    +L  ++  W  L +AYL EAKWY S YTP  EEY+EN  ++I+ PLI+A
Sbjct  393   AYYVLKQQDFDMLLSIKNAWLGLIQAYLVEAKWYHSKYTPKLEEYLENGLVSITGPLIIA  452

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMD  544
               +    N       L+ L   P+I+  SS I RL +D GTS  E++RGDVPK+IQCYM 
Sbjct  453   ISYLSGTNPIIKKE-LEFLESNPDIVHWSSKIFRLQDDLGTSSDEIQRGDVPKSIQCYMH  511

Query  543   EAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGH  364
             E   S   AR+ I   M ++WKK+N    +  SP + T  E  +N+ RM+  MY HGDGH
Sbjct  512   ETGASEEVAREHIKDMMRQMWKKVNAYTADKDSPLTRTTTEFLLNLVRMSHFMYLHGDGH  571

Query  363   GINNFETQTRIQTLLFE  313
             G+ N ET     TLLF+
Sbjct  572   GVQNQETIDVGFTLLFQ  588



>sp|Q5SBP2.1|FES_OCIBA RecName: Full=(-)-endo-fenchol synthase, chloroplastic; Flags: 
Precursor [Ocimum basilicum]
 gb|AAV63790.1| fenchol synthase [Ocimum basilicum]
Length=598

 Score =   446 bits (1146),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 250/579 (43%), Positives = 349/579 (60%), Gaps = 35/579 (6%)
 Frame = -3

Query  1962  IHRSHASSSFRMCYHTT-----------TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGF  1816
             +H S+  +S   C  +T              RRS NY P  WD++YIQSLN  H   E  
Sbjct  21    LHNSNNKASNPRCVSSTRRRPSCPLQLDVEPRRSGNYQPSAWDFNYIQSLNNNHSKEERH  80

Query  1815  VMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkk--k  1642
             +  + +L E VK ML  +EM  V+++E I++LK LG SY F++EI   L  IY   K   
Sbjct  81    LQGKAKLIEEVK-MLLEQEMAAVQQLEFIEDLKNLGLSYLFQDEIKIILNSIYNHHKCFH  139

Query  1641  ssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNL  1462
             +++  +  E  DLY  AL FR+ RQ+GF +SQ+VFD F + +   F  +L+EDTKGLL L
Sbjct  140   NNHQQRTDENADLYFVALGFRLFRQHGFKVSQEVFDCFKNEEGSDFIPNLAEDTKGLLQL  199

Query  1461  YESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMPRLEAR  1333
             YE+S+L  + E  LE+AR FS K L+                 H L++PLHWR+ R+EA+
Sbjct  200   YEASYLVRQDEDTLEMARQFSTKILQKKVEEKMIEENLLSWTCHSLELPLHWRVQRIEAK  259

Query  1332  SFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRV  1153
              F+++Y        N I+ ELAKL+FNI QA+   +LK +SRWW  + IAE+L FARDR+
Sbjct  260   WFLDAY--ASKPDMNPIIFELAKLEFNIAQALQQGELKDLSRWWNDTGIAEKLPFARDRI  317

Query  1152  VENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVT  973
             VE   W IG     +Y   R + AK+ +    VDD+YD+YGTLDE QLFTD I RW D+ 
Sbjct  318   VEAHYWAIGTLEPYQYRYQRSLIAKIIALTTVVDDVYDVYGTLDEPQLFTDAIRRW-DIE  376

Query  972   KVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASG  793
              +  LP Y++ CYLA+ NFV+E+AYD+ ++ G   L +L K W DL +AY  EAKW+ SG
Sbjct  377   SINQLPHYLQLCYLAIYNFVSELAYDIFRDKGFNSLPYLHKSWLDLVEAYFLEAKWFHSG  436

Query  792   YTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAN  613
             YTPT EEY+ N+ +TI+CP I++ ++F   N + D   ++ +  Y +I+ LS ++LRL +
Sbjct  437   YTPTLEEYLNNSKMTITCPAIVSEIYFAFAN-SIDKTEVESVYKYHDILYLSGMLLRLPD  495

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSG  433
             D GT+ FEMKRGDV KAIQCYM E   S  EAR+ I   M E WK+MN        PF  
Sbjct  496   DLGTTTFEMKRGDVAKAIQCYMKEHNASEEEAREHIRFLMREAWKQMNTAAAANNCPFVN  555

Query  432   TFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
              F+  A ++ R+A  +Y  GDG G+ + +   ++  LLF
Sbjct  556   DFVVGAASLGRVANFVYVEGDGFGVQHSKIHQQMAELLF  594



>gb|AAL17636.1| d-limonene synthase [Agastache rugosa]
Length=613

 Score =   446 bits (1147),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 246/551 (45%), Positives = 351/551 (64%), Gaps = 25/551 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             T  RRS NY P  WD  +IQSLN+  Y  E    R  EL  +VK +++ E    + ++E+
Sbjct  67    TIERRSGNYSPSRWDVDFIQSLNS-DYQEERHTRRASELITQVKMLMEKETTDPIRQLEL  125

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID+L+RLG S HF+ E  E L  IY+  K  + N    E +DLY+TAL FR+LR++GF +
Sbjct  126   IDDLQRLGLSDHFQNEFKEILNTIYLDNKYYNINIMREESRDLYSTALAFRLLREHGFQV  185

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHELK  1372
             +Q+VF+ F + +   F ASL +DT+GLL LYE+SFL  EGE  LE+AR+F+ K L+ +LK
Sbjct  186   AQEVFECFKN-EEGDFKASLIDDTRGLLQLYEASFLFKEGENTLEIAREFTTKILQEKLK  244

Query  1371  -----------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                              +P +W + R     +I+ Y   K +  N ++LELA LD NIVQ
Sbjct  245   GDEIDDNLLSSIRYSLEIPNYWSVVRPNVSVWIDEY--RKRSDMNPVVLELAILDANIVQ  302

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             A    +LK   RWW+ +   E+L FARDR++E++ W+ G+    ++ N RI+ AK+ + I
Sbjct  303   AQLQLELKESLRWWRNTCFVEKLPFARDRLIESYFWSTGMVEPRQHANARIIMAKVIALI  362

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
               +DDIYD+YGTL+EL+ FT+   RWD V+ ++ LP YM+ C+LA+NNFV++ AY++LKE
Sbjct  363   TVMDDIYDVYGTLEELEQFTEAFRRWD-VSSIDQLPTYMQLCFLAINNFVDDTAYNVLKE  421

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV-  706
              GV ++ +LRK W D  + YL E+KWY SG+ P+ EEY+EN+WI++S P +L H FF V 
Sbjct  422   SGVNVMTYLRKSWVDQAENYLMESKWYYSGHKPSLEEYLENSWISVSGPCVLTHEFFGVT  481

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
             ++LA+D   LD L +Y +I+R SS +LRLA+D GTS  E+ RGDVPK+IQCYM +   S 
Sbjct  482   DSLAKDT--LDSLYEYHDIVRWSSYLLRLADDLGTSVEEVSRGDVPKSIQCYMHDNDASE  539

Query  525   NEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFE  346
              EAR  I   + E+WKKMN   +   SPF   FI    ++ RMAQ MY +GDGHG  + +
Sbjct  540   EEARQHIKGLIREMWKKMNVERVSEDSPFCRDFIRCCEDLGRMAQFMYHYGDGHGTQHPK  599

Query  345   TQTRIQTLLFE  313
                +I   LF+
Sbjct  600   IHQQIAACLFQ  610



>gb|AGS42397.1| terpene synthase 4 [Thymus vulgaris]
Length=579

 Score =   444 bits (1142),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 258/568 (45%), Positives = 346/568 (61%), Gaps = 33/568 (6%)
 Frame = -3

Query  1953  SHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTT-HYAAEGFVMRRDELKERVKD  1777
             S  S S ++   T    RRS  Y P  WD+++IQSLNT  HY  E  V R++EL   VK 
Sbjct  21    SPLSISSKLDTKTEKDRRRSGKYRPALWDFNFIQSLNTNDHYHKE--VHRQEELIVEVKK  78

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             +L  EE+  V+++E+ID+LK LG SY  +EEI   L  IY++ K   NN     + DLY 
Sbjct  79    LL-GEEIEAVKQLELIDDLKNLGLSYFCQEEIRNVLGSIYVEHKFFINNQVEGSKLDLYF  137

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE  1417
             TAL FR+ R+ GF++SQ+VFD F + +  GF   L EDTKG+L LYE+SFL  EGE  LE
Sbjct  138   TALGFRLFREAGFSVSQEVFDRFKNEESSGFEECLGEDTKGMLQLYEASFLLREGEDTLE  197

Query  1416  LARDFSAKHL-------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTS  1294
             LAR  S K L                   +H L++PLHWR+ RLEAR F+++Y   K   
Sbjct  198   LARQISTKFLQEKLDGTQISDDNNLSSSIRHSLEIPLHWRIQRLEARWFLDAYAARKDM-  256

Query  1293  NNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPN  1114
              N  + ELAKLDFNI+QA   ++LK +SRWWK   + E+L F RDR+VE++ W +GL   
Sbjct  257   -NPFIFELAKLDFNIIQAAQQQELKDLSRWWKNLSLPEKLPFVRDRLVESYFWAVGLFEP  315

Query  1113  PKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCY  934
               + N R + AK+ + I ++DD+YDIYGTLDELQLFTD I RW D      LP Y++  Y
Sbjct  316   HTFGNQRKIAAKIITLITSLDDVYDIYGTLDELQLFTDAIRRW-DTESANQLPYYLQLFY  374

Query  933   LALNNFVNEIAYDMLKEHGVFI-LHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENA  757
               L+ FV+++AYD+LKE   FI + HL++ W DL + YLQEAKWY + YTP+ EEY+  A
Sbjct  375   FVLHTFVSDVAYDILKEEEGFITIPHLQRAWVDLVEGYLQEAKWYHANYTPSMEEYLNTA  434

Query  756   WITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRG  577
              +TI  P +++ V F +    E A   + L +Y +IIRLS  ++RL +D GT PFEMKRG
Sbjct  435   TVTIGAPAVISQVHFVLAKSKEKA---ESLHEYEDIIRLSGKLVRLPDDIGTLPFEMKRG  491

Query  576   DVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARM  397
             DV K+IQ YM E   S  EA + +  E+ E WK+MN +     +      + VA N+ R 
Sbjct  492   DVAKSIQIYMKEHGASREEAEERVRYEIREAWKEMNTIMAANSALRGDDLVMVAANLGRD  551

Query  396   AQCMYQHGDGHGINNFETQTRIQTLLFE  313
             AQ MY  GDG   N+   Q  IQ LLF+
Sbjct  552   AQFMYLDGDG---NHSHLQHHIQNLLFQ  576



>ref|XP_006471085.1| PREDICTED: (R)-limonene synthase 1-like [Citrus sinensis]
Length=607

 Score =   445 bits (1144),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 247/557 (44%), Positives = 352/557 (63%), Gaps = 34/557 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y   T  RRSANY P  WD+ ++QSLN+ +Y  + +  R +ELK +VK  +K +    ++
Sbjct  46    YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDQTYRRRAEELKGKVKTAIK-DVTEPLD  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG +YHFE EI   L +IY   K          + +LYAT+LEFR+LRQ+
Sbjct  104   QLELIDNLQRLGLAYHFETEIRNILHNIYNNNKDYIW-----RKANLYATSLEFRLLRQH  158

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             G+ +SQ+VF GF D K  GF   + +D KG+L+L+E+S+ S+EGE+ +E A  F++KHLK
Sbjct  159   GYPVSQEVFSGFKDDK-GGF---ICDDFKGILSLHEASYYSLEGESIMEEAWQFTSKHLK  214

Query  1383  --------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
                                   L++PLHW++P LEAR FI  Y+K +    N +LLELAK
Sbjct  215   ETMIISNSKEEYVFVAEQAKRALELPLHWKVPTLEARWFIHVYEKRE--DKNHLLLELAK  272

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             L+FN +QA++ E+LK +S WWK + + E+L+FAR+R+V +FLW++G+   P++  CR + 
Sbjct  273   LEFNTLQAIYQEELKDISGWWKDTGLGEKLSFARNRLVASFLWSMGIAFEPQFAYCRRVL  332

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
                 + I  +DDIYD+YGTLDEL++FTD + RWD    ++HLP YM+ C+LAL NFVNE 
Sbjct  333   TISIALITVIDDIYDVYGTLDELEIFTDAVARWDINYALKHLPGYMKMCFLALYNFVNEF  392

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
             AY +LK+    +L  ++  W  L +AYL EAKWY S YTP  EEY+EN  ++I+ PLI+A
Sbjct  393   AYYVLKQQDFDMLLSIKNAWLGLIQAYLVEAKWYHSKYTPKLEEYLENGLVSITGPLIIA  452

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMD  544
               +    N       L+ L   P+I+  SS I RL +D GTS  E++RGDVPK+IQCYM 
Sbjct  453   ISYLSGTNPIIKKE-LEFLESNPDIVHWSSKIFRLQDDLGTSSDEIQRGDVPKSIQCYMH  511

Query  543   EAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGH  364
             E   S   AR+ I   M ++WKK+N    +  SP + T  E  +N+ RM+  MY HGDGH
Sbjct  512   ETGASEEVAREHIKDMMRQMWKKVNAYTADKDSPLTRTTTEFLLNLVRMSHFMYLHGDGH  571

Query  363   GINNFETQTRIQTLLFE  313
             G+ N ET     TLLF+
Sbjct  572   GVQNQETIDVGFTLLFQ  588



>ref|XP_010109567.1| Isoprene synthase [Morus notabilis]
 gb|EXC23171.1| Isoprene synthase [Morus notabilis]
Length=598

 Score =   444 bits (1143),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 245/551 (44%), Positives = 349/551 (63%), Gaps = 31/551 (6%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             T  R++ANY P +W Y ++QSL  T Y  E +  + ++L++ V+ M+  E    V  +E+
Sbjct  56    TADRQTANYQPSSWSYDFLQSLEAT-YHVETYEEKVEKLEKEVRLMINEENASFVASLEL  114

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN-  1555
             IDE++RLG  Y FEE+I +AL  I   +  +S       EK L+A+AL FR+LRQ+GFN 
Sbjct  115   IDEIQRLGLGYRFEEDIRKALDRISSLEGFNSGI-----EKSLHASALSFRLLRQHGFNN  169

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----  1387
             ++QD+F  F D     F  SL +D KG+L+LYE+S L+  GE  L+ AR F+ KHL    
Sbjct  170   VTQDIFKNFKD-HNGSFKESLFKDVKGVLSLYEASHLAFPGEDLLDEARKFTRKHLNDLI  228

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                           H L++PLH RM RLEAR +IE+YDK   +  N ILLE AK DFN+V
Sbjct  229   RSGNLSKDVAEEISHALEIPLHQRMQRLEARRYIEAYDK--RSDANRILLEFAKWDFNMV  286

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             Q+    DLK +SRWWK   +  +L+FARDR++E+F W +G+   P+Y N      K+ +F
Sbjct  287   QSTLKNDLKDLSRWWKDMGLTNKLSFARDRLMESFFWAVGMAFEPQYSNLHKELTKVVAF  346

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I  +DD+YD+YGT++EL+LFTD +ERW DV  V++LPDYMR C+LAL N VN++ YD LK
Sbjct  347   ITVIDDVYDVYGTVEELELFTDAVERW-DVKAVQNLPDYMRICFLALYNTVNDLVYDTLK  405

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFY-  709
             EHGV+IL +L K WAD+CKA+LQE KW  +  TP+FEEY+EN W++ S  L+L + +   
Sbjct  406   EHGVYILPYLTKAWADMCKAFLQEKKWTQNKETPSFEEYLENGWMSSSGGLLLVNAYLLM  465

Query  708   VNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVS  529
             + N+      L+ L +Y +++R  S+I RL ND  TS  E++RG+   +I   M +  +S
Sbjct  466   IQNITNQG--LESLENYHDLLRWPSVIFRLVNDLATSTAELERGETNNSISRIMSDRGLS  523

Query  528   ANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
                AR  I   + E W KMNK      SPF+  F+E A+N+AR+AQC YQHGDGHG  + 
Sbjct  524   EEYARQDIRNLIEETWTKMNKDATSDDSPFAKPFVETAINLARIAQCQYQHGDGHGNPDA  583

Query  348   ETQTRIQTLLF  316
              ++ R+ +L+ 
Sbjct  584   GSKNRVLSLII  594



>gb|ACI32638.1| MTS2 [Humulus lupulus]
Length=613

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 258/594 (43%), Positives = 359/594 (60%), Gaps = 50/594 (8%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGF  1816
             F    T K  +  RS      + C     T RRSANY P  W + YIQSL T+ Y  + +
Sbjct  25    FGRLFTPKTSTKSRSSTCHPIQ-CTVVNNTDRRSANYEPSIWSFDYIQSL-TSQYKGKSY  82

Query  1815  VMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkss  1636
               R +ELK+ VK M+++     + ++++ID L+RLG SYHFE+EI   L     K+K  +
Sbjct  83    SSRLNELKKEVK-MMEDGTKECLAQLDLIDTLQRLGISYHFEDEINTIL-----KRKYIN  136

Query  1635  nnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMD--GKRCGFNASLSEDTKGLLNL  1462
                      +LY+TAL+FR+LRQ+G+ ++Q+VF+ F D  GK   F   LS+D  G+L+L
Sbjct  137   IQNNINHNYNLYSTALQFRLLRQHGYLVTQEVFNAFKDETGK---FKTYLSDDIMGVLSL  193

Query  1461  YESSFLSMEGETNLELARDFSAKHLK---------------------------------H  1381
             YE+SF +M+ E  LE AR FS + LK                                 H
Sbjct  194   YEASFYAMKHENVLEEARVFSTECLKEYMMKMEQNKVLLDHDLDHNDNFNVNHHVLIINH  253

Query  1380  ELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWW  1201
              L++PLHWR+ R EAR FI+ Y+K +    ++ LLE AKLDFN+VQ+ H EDLK +SRWW
Sbjct  254   ALELPLHWRITRSEARWFIDVYEKKQDM--DSTLLEFAKLDFNMVQSTHQEDLKHLSRWW  311

Query  1200  KKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLD  1021
             + S + E+L FARDR++E FLW +GL   P++   + + A+L+  I  +DDIYD+YGTL+
Sbjct  312   RHSKLGEKLNFARDRLMEAFLWEVGLKFEPEFSYFKRISARLFVLITIIDDIYDVYGTLE  371

Query  1020  ELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWA  841
             EL+LFT  +ERWD V  +  LP+YM+  +L L+N +NE+A+D+L +     + +L+K   
Sbjct  372   ELELFTKAVERWD-VNAINELPEYMKMPFLVLHNTINEMAFDVLGDQNFLNIEYLKKSLV  430

Query  840   DLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTD  661
             DLCK YLQEAKWY SGY PT +EYIE AW++I  P+IL H +F   N     ++      
Sbjct  431   DLCKCYLQEAKWYYSGYQPTLQEYIEMAWLSIGGPVILVHAYFCFTNPITKESMKFFTEG  490

Query  660   YPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELW  481
             YP II+ S +I+RLA+D GT   E+ RGDVPK+IQCYM +   S +EAR+ I   + E W
Sbjct  491   YPNIIQQSCLIVRLADDFGTFSDELNRGDVPKSIQCYMYDTGASEDEAREHIKFLICETW  550

Query  480   KKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLL  319
             K MNK   E  S FS TF+EV  N+AR A  MYQ+GDGH   N  ++ RI  L+
Sbjct  551   KDMNK-NDEDNSCFSETFVEVCKNLARTALFMYQYGDGHASQNCLSKERIFALI  603



>sp|A7IZZ1.1|TPS1_CANSA RecName: Full=(-)-limonene synthase, chloroplastic; AltName: 
Full=(-)-(4S)-limonene synthase; AltName: Full=CsTPS1; Flags: 
Precursor [Cannabis sativa]
 gb|ABI21837.1| (-)-limonene synthase [Cannabis sativa]
Length=622

 Score =   445 bits (1144),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 246/556 (44%), Positives = 352/556 (63%), Gaps = 34/556 (6%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             T  + RRSANYGPP W + ++QSL    Y  E +  R ++L++ VK ML   E   + ++
Sbjct  72    TNNSDRRSANYGPPIWSFDFVQSL-PIQYKGESYTSRLNKLEKDVKRMLIGVE-NSLAQL  129

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E+ID ++RLG SY FE EI+  L +     K ++NN       DLYATAL+FR+LRQ GF
Sbjct  130   ELIDTIQRLGISYRFENEIISILKE-----KFTNNNDNPNPNYDLYATALQFRLLRQYGF  184

Query  1557  NISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK--  1384
              + Q++F+ F + K   F A++S D  G L LYE+SF   +GE+ LE AR F+ K LK  
Sbjct  185   EVPQEIFNNFKNHKTGEFKANISNDIMGALGLYEASFHGKKGESILEEARIFTTKCLKKY  244

Query  1383  -------------------HELKMPLHWRMPRLEARSFIES-YDKGKTTSNNAILLELAK  1264
                                H L+MPL WR+ R EA+ FIE  Y++ +    N  LLE AK
Sbjct  245   KLMSSSNNNNMTLISLLVNHALEMPLQWRITRSEAKWFIEEIYERKQDM--NPTLLEFAK  302

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             LDFN++Q+ + E+LK +SRWWK S + E+L F RDR+VE FLW +G+   P++   RIM 
Sbjct  303   LDFNMLQSTYQEELKVLSRWWKDSKLGEKLPFVRDRLVECFLWQVGVRFEPQFSYFRIMD  362

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
              KLY  +  +DD++DIYGTL+ELQLFT+ ++RWD + +++ LPDYM+  +    NF NE+
Sbjct  363   TKLYVLLTIIDDMHDIYGTLEELQLFTNALQRWD-LKELDKLPDYMKTAFYFTYNFTNEL  421

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
             A+D+L+EHG   + + +K+  +LCK +LQEAKW+ SGY PT +EY+EN W+++   +IL 
Sbjct  422   AFDVLQEHGFVHIEYFKKLMVELCKHHLQEAKWFYSGYKPTLQEYVENGWLSVGGQVILM  481

Query  723   HVFFYVNNLAEDAAVLDCLTD-YPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYM  547
             H +F   N     A L+CL D +P I+R +SIILRLA+D GT   E+KRGDVPK+IQCYM
Sbjct  482   HAYFAFTNPVTKEA-LECLKDGHPNIVRHASIILRLADDLGTLSDELKRGDVPKSIQCYM  540

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDG  367
              +   S +EAR+ I   ++E WK+MN       S FS  F++V  N+ R +Q +YQ+GDG
Sbjct  541   HDTGASEDEAREHIKYLISESWKEMNNEDGNINSFFSNEFVQVCQNLGRASQFIYQYGDG  600

Query  366   HGINNFETQTRIQTLL  319
             H   N  ++ R+  L+
Sbjct  601   HASQNNLSKERVLGLI  616



>ref|XP_002878732.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54991.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=592

 Score =   443 bits (1140),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 242/546 (44%), Positives = 338/546 (62%), Gaps = 38/546 (7%)
 Frame = -3

Query  1926  CYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREV  1747
             C  T    RRSANY P  WD+ ++ S+   +   +  V  RD LKE+V+ ML +++   V
Sbjct  39    CNKTPIVHRRSANYQPSLWDHHHLLSVENKYMKDKSSVRERDLLKEKVRKMLNDKKKTYV  98

Query  1746  EKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQ  1567
             +++E ID+L++LG SYHFE E     MDI +             E DL+ATALEFR+ RQ
Sbjct  99    DQLEFIDDLQKLGISYHFEAE-----MDIILTSSYQKERTNV-RESDLHATALEFRLFRQ  152

Query  1566  NGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE-LARDFSAKH  1390
             +G N+S+DVFD FM  K CG   S  +D  G L+LYE+S+LS + +T L+   R F+ + 
Sbjct  153   HGLNVSEDVFDVFM--KICGKFGS--DDIYGFLSLYEASYLSTKSDTKLQKCIRPFATQQ  208

Query  1389  LK---------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLE  1273
             L+                       L MP +WRM RL+ R +I+ Y  GK  + N +LLE
Sbjct  209   LRDFVDTHSNENCGSCDMVEMVVQTLDMPYYWRMRRLDTRRYIDVY--GKRHNKNLVLLE  266

Query  1272  LAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCR  1093
              AKLDFNIVQA+H E+LK VS WW+++ + ++L FARDR+VEN+ WTIG    P+Y   R
Sbjct  267   FAKLDFNIVQAIHQEELKHVSSWWRETGLGKQLYFARDRIVENYFWTIGQIQEPQYGYVR  326

Query  1092  IMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFV  913
              +  K+ + +  +DDIYDIYGTL+EL+LFT   E W DV +++ LP+YMR C+L + N V
Sbjct  327   QIMTKINALLTTIDDIYDIYGTLEELELFTSAFENW-DVNRLDELPEYMRLCFLVVYNEV  385

Query  912   NEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPL  733
             N I  D+L+   + ++  L+K W D+CKAYL EAKWY SG+ P  EEY++NAWI+IS P 
Sbjct  386   NSIGCDILRNKNINVIPFLKKSWTDVCKAYLVEAKWYKSGHKPNLEEYMQNAWISISAPT  445

Query  732   ILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiil-rLANDKGTSPFEMKRGDVPKAIQ  556
             I  H F+ V +      VL+ L+++ + I  SS  + RLAND  TSP E+ RGDV K+IQ
Sbjct  446   IFVH-FYCVFSAQLSIKVLETLSEHQQNIVRSSASVFRLANDLVTSPDELARGDVCKSIQ  504

Query  555   CYMDEAKVSANEARDFIDLEMNELWKKMNKVGI-EGGSPFSGTFIEVAMNIARMAQCMYQ  379
             CYM E   S ++AR  +   +N+LW +MN   +    S     F+E  +N+ARM+QCMYQ
Sbjct  505   CYMSENGASEDKARTHVRQMINDLWDEMNYEKMAHSSSLLHHDFMETVINLARMSQCMYQ  564

Query  378   HGDGHG  361
             +GDGHG
Sbjct  565   YGDGHG  570



>gb|ABI20515.1| cinenol synthase [Rosmarinus officinalis]
Length=593

 Score =   443 bits (1139),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 249/570 (44%), Positives = 353/570 (62%), Gaps = 34/570 (6%)
 Frame = -3

Query  1965  SIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKER  1786
             + HR   +       +   T RR+  Y P  WD++ IQS N+  Y  +  + R   L E+
Sbjct  36    TTHRGLRARCSLQAANEIQTGRRTGGYQPTLWDFNSIQSFNSK-YKEDVHLERAAALIEQ  94

Query  1785  VKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKD  1606
             VK ML  E++ +V  +E+ID+L+R+G S HF+ EI +              N   T E+D
Sbjct  95    VK-MLLQEQVDDVRCLELIDDLRRMGISSHFDHEIAQIF-------NSKYFNNNETGERD  146

Query  1605  LYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGET  1426
             LY+TAL FR+LR++GF++SQ+VFD F +     FN S + +TKGLL LYE+SFLS +GE 
Sbjct  147   LYSTALRFRLLREHGFSVSQEVFDYFKNDNVTDFNPSFAHETKGLLQLYEASFLSAQGEE  206

Query  1425  NLELARDFSAKHLK-----HE-------------LKMPLHWRMPRLEARSFIESYDKGKT  1300
              LE+AR+F+ K L+     HE             L+ P HWR+    ARSFI++Y +   
Sbjct  207   TLEIAREFARKFLEKRVVDHEIDDINLLTSVERALEFPTHWRVQMPNARSFIDAYKRRPD  266

Query  1299  TSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLT  1120
                N ++LELAKLD NIVQA   ++LK  SRWW  + + ++L F RDR+VE + WT G+ 
Sbjct  267   M--NPVVLELAKLDINIVQAQFQQELKEASRWWNSTCLVQQLPFVRDRIVECYYWTTGVL  324

Query  1119  PNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRF  940
                ++ N RIM  K+++ +  +DD++DIYGT++ELQ FT  I+RW D+  +  LP YM+ 
Sbjct  325   ERRQHGNERIMLTKIFALVTTIDDVFDIYGTVEELQQFTAAIQRW-DIESMNQLPPYMQI  383

Query  939   CYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIEN  760
             CYLA+ NFVNE AYD LKE G   +  LRK W DL ++YL EA WY +G+ P+ EEYIEN
Sbjct  384   CYLAVFNFVNETAYDTLKEKGFNSVPFLRKAWVDLVESYLIEADWYYNGHKPSLEEYIEN  443

Query  759   AWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKR  580
             AWI+I    IL+H+FF + +  E+ AV + +  Y +I+R S  ILRL +D GTS  E++R
Sbjct  444   AWISIGGIPILSHLFFQLTDSIEEEAV-ESMHKYHDIVRASCTILRLPDDLGTSLDEVER  502

Query  579   GDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIAR  400
             GDVPK++QCYM+E   S  EAR+ +   + + WK MNK  +   SPFS  F+E A N+ R
Sbjct  503   GDVPKSVQCYMNEKNASEEEAREHVRSLIEQTWKTMNKEMM--MSPFSKYFVEAAANLGR  560

Query  399   MAQCMYQH-GDGHGINNFETQTRIQTLLFE  313
             MAQC+YQH  DG G+ +      ++ LLF+
Sbjct  561   MAQCIYQHERDGFGMQHSLVNKMLRGLLFD  590



>ref|XP_002875284.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51543.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   443 bits (1139),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 248/571 (43%), Positives = 360/571 (63%), Gaps = 42/571 (7%)
 Frame = -3

Query  1929  MCYHTTTTT---------RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKD  1777
             +C   T TT         RRS NY P  WD+ Y+ S+    YA+E  V+ RD LK++V+ 
Sbjct  28    VCKSMTKTTPDSTSADLRRRSGNYQPSPWDHCYLLSIENK-YASEKEVITRDVLKKKVRM  86

Query  1776  MLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYA  1597
             ML  E+   +E++E+ID+L++LG SYHFE +I + L D ++K  ++       +E+DL+A
Sbjct  87    MLDVEKKSRLEQLELIDDLQKLGVSYHFELQINDTLTDFHLKNGRNVWK--CDKEEDLHA  144

Query  1596  TALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNL-  1420
             TALEFR+LRQ+GF++S+++FD  +D  +   N   S   KG+++LYE+SFLS + +T L 
Sbjct  145   TALEFRLLRQHGFDVSENIFDVIID--KIESNTFKSNGIKGIISLYEASFLSTKSDTKLH  202

Query  1419  ELARDFSAKHLK-----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSN  1291
             ++ R F+ + ++                 H L+MP HWRM RLE R  I+SY K +    
Sbjct  203   KVIRPFATEQIRKFVDDETNNIEEREKAIHALEMPYHWRMRRLEMRWCIDSYKKKQDM--  260

Query  1290  NAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNP  1111
             N +L+E AK+DFNIVQA H EDLK VS WWK + +A +L F RDR+VEN+ WT+GL   P
Sbjct  261   NLVLIEFAKIDFNIVQAAHQEDLKYVSSWWKDTSLANQLPFVRDRIVENYFWTVGLIYEP  320

Query  1110  KYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYL  931
             ++   R +   + + +  +DDIYDIYGT++EL+LFT  +E W DV ++  LP+YMR C+L
Sbjct  321   QFGYIRRIMTIVNALVTTIDDIYDIYGTIEELELFTSMVENW-DVNRLGELPEYMRLCFL  379

Query  930   ALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWI  751
              L N +N I   +LK   + ++  L+K WADLC+ YL EAKWY  GY P+ EEY++NAWI
Sbjct  380   ILYNEINGIGCHVLKCKKIDVIPFLKKSWADLCRTYLVEAKWYKRGYKPSLEEYMQNAWI  439

Query  750   TISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirl-ssiilrLANDKGTSPFEMKRGD  574
             +IS P +L H F+ V +       LD L+ + + I   S+ +LRLAND GTSP E+ RGD
Sbjct  440   SISAPTVLIH-FYCVFSDQISIQSLDTLSQHRQKIVRCSATVLRLANDLGTSPDELARGD  498

Query  573   VPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMN---KVGIEGGSPFSGTFIEVAMNIA  403
             V K++QCYM E   S  +AR+ +   +++ W  MN   K      S  S  F+E AMN+A
Sbjct  499   VVKSVQCYMHETGASEEKAREHVQQMISDTWDDMNFETKTAC-NSSLLSRGFVEAAMNLA  557

Query  402   RMAQCMYQHGDGHGI-NNFETQTRIQTLLFE  313
             RM+QCMYQ+GDGHG  +  +T  R+++LL +
Sbjct  558   RMSQCMYQYGDGHGFPDKAKTVGRVRSLLVD  588



>gb|ACM89961.1| 1,8 cineole synthase 2 [Salvia fruticosa]
Length=596

 Score =   443 bits (1139),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 253/560 (45%), Positives = 355/560 (63%), Gaps = 31/560 (6%)
 Frame = -3

Query  1938  SFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEE  1759
             S ++      T RRS NY P  WD  YIQSL++  Y  E  + R  EL  +VK ML+ EE
Sbjct  46    SVQLSAGQLQTERRSGNYSPSLWDVDYIQSLHSD-YKEERHMRRASELIMQVKMMLE-EE  103

Query  1758  MREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFR  1579
                V ++E+ID+L+RLG   HF+ E  E L  IY+  K   N+     E DLY+TAL FR
Sbjct  104   ADPVRQLELIDDLQRLGLGDHFQNEFKEILKSIYLDHKCFKNHG----EMDLYSTALAFR  159

Query  1578  VLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFS  1399
             +LRQ+ F ++QDVFD F + K     ASLS+DT+G+L LYE+SFL+MEGE  L+L R+F+
Sbjct  160   LLRQHCFQVAQDVFDCFKNEK-GELKASLSDDTRGVLQLYEASFLTMEGEKTLDLGREFA  218

Query  1398  AKHLKHELK------------------MPLHWRMPRLEARSFIESYDKGKTTSNNAILLE  1273
             AK L+ +LK                  +P+HWR+ R  A  +I++Y +   +  N I+LE
Sbjct  219   AKILEDKLKEESSDDLYLLLSIRYALDIPIHWRIGRGNASMWIDAYKR--RSDMNPIVLE  276

Query  1272  LAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCR  1093
             LA LD NIVQA + E+LK   +WW+ + I E+L FARDR+VE + WT G+    ++ N R
Sbjct  277   LAILDSNIVQAQYQEELKQDLQWWRNTCIVEKLPFARDRLVECYFWTTGIVQPRQHANAR  336

Query  1092  IMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFV  913
             I   K+ + I  +DD+YD+YGTL+EL+ FTD I RW D++ +E LP YM+ C+LAL+NFV
Sbjct  337   ITVGKVNALITTIDDVYDVYGTLEELEQFTDVIRRW-DMSSIEQLPGYMQLCFLALDNFV  395

Query  912   NEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPL  733
              + AY++LKE G   + +L+K W DL +AYL EAKWY SG+ P  EEY+  +WI+I   +
Sbjct  396   KDTAYEVLKEQGFNAIPYLQKSWRDLVEAYLVEAKWYHSGHKPNLEEYLNTSWISIGGTV  455

Query  732   ILAHVFFYVN-NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQ  556
             IL H FF V  +L ++A+  D L  Y +++R SS+ILRLA+D GTS  E+ RGDVPK+IQ
Sbjct  456   ILTHAFFRVTESLTKEAS--DALYGYHDLVRWSSVILRLADDLGTSVDEVSRGDVPKSIQ  513

Query  555   CYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQH  376
             CYM++   S  +ARD +   + E WKK+N+  +    PF   FI  A+++ R  Q MY +
Sbjct  514   CYMNDHNASEAQARDHVKWMIAETWKKINQERVAMDPPFCQDFIACAVDMGRKTQYMYHY  573

Query  375   GDGHGINNFETQTRIQTLLF  316
             GDGHGI +     ++ T LF
Sbjct  574   GDGHGIQHPIIHQQMTTCLF  593



>gb|ABH07677.1| cineole synthase [Salvia fruticosa]
Length=591

 Score =   442 bits (1138),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 245/548 (45%), Positives = 347/548 (63%), Gaps = 32/548 (6%)
 Frame = -3

Query  1908  TTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMI  1729
             T RR+  Y P  WD+S IQS ++  Y  E  +MR   + ++VK ML+ EE+  + ++E+I
Sbjct  55    TERRTGGYQPTLWDFSTIQSFDS-EYKEEKHLMRAAGMIDQVKMMLQ-EEVDSIRRLELI  112

Query  1728  DELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNIS  1549
             D+L+RLG S HFE EI+E L                 +E+DLY+TAL FR+LRQ  F++S
Sbjct  113   DDLRRLGISCHFEREIVEIL-------NSKYYTNNEIDERDLYSTALRFRLLRQYDFSVS  165

Query  1548  QDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHE---  1378
             Q+VFD F + K   F  SL +DT+GLL LYE+SFLS +GE  L LARDF+ K L+     
Sbjct  166   QEVFDCFKNAKGTDFKPSLVDDTRGLLQLYEASFLSAQGEETLRLARDFATKFLQKRVLV  225

Query  1377  -------------LKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                          L++P HWR+    ARSFI++Y +      N  +LELAKLDFN+VQA 
Sbjct  226   DKDINLLSSIERALELPTHWRVQMPNARSFIDAYKRRPDM--NPTVLELAKLDFNMVQAQ  283

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
               ++LK  SRWW  + +   L F RDR+VE + WT G+    ++   RIM  K+ + +  
Sbjct  284   FQQELKEASRWWNSTGLVHELPFVRDRIVECYYWTTGVVERRQHGYERIMLTKINALVTT  343

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD++DIYGTL+ELQLFT  I+RW D+  ++ LP YM+ CYLAL NFVNE+AYD L++ G
Sbjct  344   IDDVFDIYGTLEELQLFTTAIQRW-DIESMKQLPPYMQICYLALFNFVNEMAYDTLRDKG  402

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
                  +LRK+W  L ++YL EAKWY  G+ P+ EEY++N+WI+I    IL+H+FF + + 
Sbjct  403   FDSTPYLRKVWVGLIESYLIEAKWYYKGHKPSLEEYMKNSWISIGGIPILSHLFFRLTDS  462

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEA  517
              E+ A  + +  Y +I+R S  ILRLA+D GTS  E++RGDVPK++QCYM+E   S  EA
Sbjct  463   IEEEAA-ESMHKYHDIVRASCTILRLADDMGTSLDEVERGDVPKSVQCYMNEKNASEEEA  521

Query  516   RDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQH-GDGHGINNFETQ  340
             R+ +   +++ WK MNK  +   S FS  F+EV+ N+ARMAQ +YQH  DG G+ +    
Sbjct  522   REHVRSLIDQTWKMMNKEMM--TSSFSKYFVEVSANLARMAQWIYQHESDGFGMQHSLVN  579

Query  339   TRIQTLLF  316
               ++ LLF
Sbjct  580   KMLRDLLF  587



>ref|XP_004150683.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=561

 Score =   441 bits (1134),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 246/563 (44%), Positives = 356/563 (63%), Gaps = 44/563 (8%)
 Frame = -3

Query  1983  TTCKLPSIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRR  1804
             T  +LP++ +++  S            RRSANY PP W + ++QSL +  +  +  + RR
Sbjct  35    TVKQLPTVRKAYDDS----------IIRRSANYQPPIWKHEFVQSLQS-EFMDDRCLNRR  83

Query  1803  DELKERVKDMLKNEEM---REVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssn  1633
             + L  RVK ML NEE+     ++ +E +DEL+RLG SYHFE EI + L  I  +      
Sbjct  84    EVLIRRVKMML-NEELLVDDSLKGLEFVDELQRLGISYHFEMEINQLLEMINERFNNGEE  142

Query  1632  nyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYES  1453
               +    K LYA +L FR+LRQ+G++I QDVF  F +      +    E  KG+L+LYE+
Sbjct  143   GLERNNNKSLYAISLHFRILRQHGYHIPQDVFKEFKNDIE-NLDNICEETAKGMLSLYEA  201

Query  1452  SFLSMEGETN-LELARDFSAKHLKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILL  1276
             SFL+MEG+ + ++ AR                      +AR FI++  + K  SN  +LL
Sbjct  202   SFLAMEGDQSFMDEAR----------------------QARWFIDNVYQTKPDSN-PVLL  238

Query  1275  ELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNC  1096
             +LAKLDFNIVQ++H +DLK +SRWWK + + E+L FARDR++ NF W++G+   P     
Sbjct  239   DLAKLDFNIVQSIHQDDLKDISRWWKSTGLGEKLEFARDRLMANFFWSVGMGCEPHLQYL  298

Query  1095  RIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNF  916
             R M  K+ S I  VDD+YD+YGTLDEL+LFT+ +ERW D++ ++ LP+YM+ C++AL+N 
Sbjct  299   RTMSTKIASLITIVDDVYDVYGTLDELELFTNVVERW-DISAIDSLPNYMQICFIALHNT  357

Query  915   VNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCP  736
             +N++A+D +K+HGV ++ +LRKMW DLCK +L EAKWY S Y PTFEEY+ENAWI++S  
Sbjct  358   INDMAFDAIKDHGVNVIPYLRKMWTDLCKTFLTEAKWYYSNYKPTFEEYLENAWISVSGS  417

Query  735   LILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQ  556
             L+L H + + +      A L+CL  YP IIR SSII RLAND  +S  E KRG+V K+IQ
Sbjct  418   LLLVHAYVFTSKSLTIEA-LECLQHYPNIIRYSSIIFRLANDLASSSEEAKRGEVAKSIQ  476

Query  555   CYMDEAKVSANEARDFIDLEMNELWKKMN-KVGIEGGSP-FSGTFIEVAMNIARMAQCMY  382
             CYM++   S  EAR +I   + + WKK+N +V     SP     FIE+A+N+AR++  +Y
Sbjct  477   CYMNDTGASEQEARRYIKDLIMKSWKKLNEEVQTLNNSPLLCKGFIEIALNLARISHTVY  536

Query  381   QHGDGHGINNFETQTRIQTLLFE  313
             QH DGH I + ET+ R+ +L  +
Sbjct  537   QHRDGHTIEDHETKDRVLSLFIK  559



>dbj|BAD91046.1| (E)-beta-ocimene synthase [Citrus unshiu]
Length=617

 Score =   442 bits (1138),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 261/603 (43%), Positives = 369/603 (61%), Gaps = 54/603 (9%)
 Frame = -3

Query  1992  STFTTCKLPSIHRSHAS---SSFRMCYHTTTT-------TRRSANYGPPTWDYSYIQSLN  1843
             S  ++   PSI +S+++   +S   C   T          RRSANY P  W Y Y+QSL 
Sbjct  20    SFISSLGSPSISKSNSNGFCASPIQCMSATKVRDKAINDNRRSANYQPSMWSYDYLQSL-  78

Query  1842  TTHYAAEGFVMRRDELKERVKDMLKNEEMREVEK-------MEMIDELKRLGCSYHFEEE  1684
             +  Y  E    R ++LK  V+ ML N   +EV+        +E++D L+RLG SYHFE E
Sbjct  79    SNGYVGESCAQRIEKLKGEVRLMLDN--YKEVDDYVDALHCLEIVDNLQRLGVSYHFEGE  136

Query  1683  IMEALMDIymkkkkssnnyKATEEKD---LYATALEFRVLRQNGFNI-SQDVFDGFMDGK  1516
             I   L  IY K+    ++    +E     LYA +LEFR+LRQ+G++I +      FMD +
Sbjct  137   IKRFLNSIYNKRNSRRSSTYHAKENQESLLYAASLEFRLLRQHGYDIHAHGTLSSFMD-E  195

Query  1515  RCGFNASLSEDTKGLLNLYESSFLSMEGETNL-ELARDFSAKHLK---------------  1384
             +  F + L +D KG+L LYE+++L  E E+ +   A +F+  HL+               
Sbjct  196   KGKFKSCLGDDIKGILALYEAAYLLGEEESTIFHEAINFTTTHLEEYVKKHNDDDGYFSA  255

Query  1383  ---HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSV  1213
                H L++PLHWRM RLEAR FI+ Y++G  T  N +L+ELAKLDFN VQA H ++LK V
Sbjct  256   LVNHALELPLHWRMVRLEARWFIDVYERG--TDMNPVLVELAKLDFNSVQAAHQDELKYV  313

Query  1212  SRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIY  1033
             S WW+K+ + E L FARDR++ENF W +G    P++  CR M  K+ + I  +DD+YD+Y
Sbjct  314   SWWWRKTGLGE-LHFARDRILENFFWALGEIWEPQFGYCRRMSTKVNALITTIDDVYDVY  372

Query  1032  GTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLR  853
             GTLDEL+ FT+ +ERWD V  ++ LP YM+ C+  L++  NE+A+D LK+ GV ++ +L+
Sbjct  373   GTLDELEQFTNAVERWD-VNAMDQLPYYMKLCFHVLHSSTNEMAFDTLKDQGVHVVPYLK  431

Query  852   KMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLD  673
             K WAD+CK++L EAKWY+SGY PT +EYIENAW+++S P+IL H +  + N A++ A L 
Sbjct  432   KAWADMCKSFLLEAKWYSSGYIPTLDEYIENAWVSVSGPVILLHAYTLIANPAKEEA-LQ  490

Query  672   CLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEM  493
              L +YP IIR  S+I RLAND  TS  E+KRGDVPKAIQCYM E   S ++AR  I   +
Sbjct  491   FLQEYPHIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDARLHIRDLI  550

Query  492   NELWKKMNKVGIEGGSP----FSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQT  325
                W KMN       +P        F++ AMN+ARMAQC YQ+GD H + +  ++ R+  
Sbjct  551   TAAWMKMNNKREGDENPDHLLLPNNFVQFAMNLARMAQCTYQNGDRHTVQD-NSKNRVLP  609

Query  324   LLF  316
             LL 
Sbjct  610   LLI  612



>gb|AAM89254.1|AF527416_1 3-carene synthase [Salvia stenophylla]
Length=597

 Score =   442 bits (1136),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 248/548 (45%), Positives = 343/548 (63%), Gaps = 26/548 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY P  WD  YIQSL++  Y  E    R  EL   VK +L+ E      ++E+ID+
Sbjct  51    RRSGNYSPSKWDVDYIQSLHSD-YKEERHTRRASELIMEVKKLLEKEP-NPTRQLELIDD  108

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L++LG S HF  E  E L  +Y+  K   N      E+DLY+TAL FR+LRQ+GF ++QD
Sbjct  109   LQKLGLSDHFNNEFKEILNSVYLDNKYYRNGAMKEVERDLYSTALAFRLLRQHGFQVAQD  168

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL--------  1387
             V + F + K   F  SLS+DT+GLL LYE+SFL  EGE  LELARDF+ K L        
Sbjct  169   VLECFKNTK-GEFEPSLSDDTRGLLQLYEASFLLTEGENTLELARDFTTKILEEKLRNDE  227

Query  1386  ----------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                       +H L++P+HWR+ R+    +I+ Y +      N I+LELA LD NIVQA 
Sbjct  228   IDDINLVTWIRHSLEIPIHWRIDRVNTSVWIDVYKRRPDM--NPIVLELAVLDSNIVQAQ  285

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
             + E+LK   +WW+ + +AE+L FARDR+VE++ W +G+    ++   R+   +  + I  
Sbjct  286   YQEELKLDLQWWRNTCLAEKLPFARDRLVESYFWGVGVVQPRQHGIARMAVDRSIALITV  345

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YGTL+EL+ FT+ I RWD ++ ++ LP YM+ C+LAL+NF+N+IAYD+LKE G
Sbjct  346   IDDVYDVYGTLEELEQFTEAIRRWD-ISSIDQLPSYMQLCFLALDNFINDIAYDVLKEQG  404

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL  697
               I+ +LRK W D+ + +L EAKWY +G+ P  EEY+EN W +I   ++L H FF V + 
Sbjct  405   FNIIPYLRKSWTDMIEGFLLEAKWYHNGHKPKLEEYLENGWRSIGSTVVLTHAFFGVTHS  464

Query  696   AEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYM-DEAKVSANE  520
                  + D    Y EI+RLSS++LRLA+D GTS  E+ RGDVPKAIQCYM D    S  E
Sbjct  465   LTKENI-DQFFGYHEIVRLSSMLLRLADDLGTSTDEVSRGDVPKAIQCYMNDNIGASEAE  523

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR+ +   + E WKKMNKV +   +PFS  FI  AM + RM Q MY +GDGHGI +    
Sbjct  524   AREHVKWCIWETWKKMNKVRVARDTPFSQDFIVCAMGMGRMGQYMYHYGDGHGIQHSIIH  583

Query  339   TRIQTLLF  316
              ++ T LF
Sbjct  584   QQMSTCLF  591



>ref|XP_010514210.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=595

 Score =   441 bits (1135),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 249/583 (43%), Positives = 360/583 (62%), Gaps = 40/583 (7%)
 Frame = -3

Query  1965  SIHRSHASSSFR-MCYHTTTTT---------RRSANYGPPTWDYSYIQSLNTTHYAAEGF  1816
             S H  H     R +C   T TT         RRS NY P  WD+ Y+ S+   +  A+  
Sbjct  16    STHNFHFQRPHRFICKSITKTTADATSVDLRRRSVNYQPSPWDHRYLLSIENKYVNAKK-  74

Query  1815  VMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkss  1636
             V+ RD LK++VK M   E    +E +E IDEL++LG SYHFE+EI   L   Y   K  +
Sbjct  75    VISRDLLKKKVKKMFDVETKSRLELLEFIDELQKLGISYHFEQEINTILT--YFHLKHGN  132

Query  1635  nnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYE  1456
             N  +   E+DL+ATALEFR+ RQ+GF++S+++FD  ++  +   N  ++ED K +++LYE
Sbjct  133   NVSRDDNEEDLHATALEFRIFRQHGFDVSEEIFDVIIN--KIESNTFMNEDIKNIISLYE  190

Query  1455  SSFLSMEGETNL-ELARDFSAKHLK-----------------HELKMPLHWRMPRLEARS  1330
             +S+LS + +T L ++ R F+ K ++                 H L+MP HWRM RLE R 
Sbjct  191   ASYLSTKSDTKLHKVIRPFATKQIRKFVDDEIYNIEVREKAIHALEMPYHWRMKRLETRW  250

Query  1329  FIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVV  1150
             +I++Y+K K  + N +L+ELAK+DFNIVQ  + EDLK VS WWK + +A +L F RDR+V
Sbjct  251   YIDAYEK-KHDTKNLVLIELAKIDFNIVQTAYQEDLKYVSSWWKDTCLANKLPFIRDRIV  309

Query  1149  ENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTK  970
             EN+ W IG+   P++   R +   + + I  +DDIYD+YGTL+EL++FT  +E W D+ +
Sbjct  310   ENYFWNIGVIYEPQFGYVRRIMTIVNALITTIDDIYDVYGTLEELEIFTSIVESW-DINR  368

Query  969   VEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGY  790
             ++ LP+YMR C+L L N  N I  D+LK   + ++  L+K WADLCK YL EAKWY  GY
Sbjct  369   LDELPEYMRLCFLILYNETNGIGCDVLKYKNIDVIPFLKKSWADLCKTYLVEAKWYKRGY  428

Query  789   TPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirl-ssiilrLAN  613
              P+ EEY++NA I+IS P IL H F+   +      +L+ L+ + + +   S+++LRLAN
Sbjct  429   KPSLEEYMQNARISISAPTILIH-FYCTFSDQISTQILESLSQHRQHVIRCSAVVLRLAN  487

Query  612   DKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGG--SPF  439
             D  TSP EM RGDV K++QCYM E   S   AR  +   +++ W +MN   I  G  S  
Sbjct  488   DLATSPDEMTRGDVLKSVQCYMHENGASQEHARAHVQQMISDTWDEMNYETITAGRSSSL  547

Query  438   SGTFIEVAMNIARMAQCMYQHGDGHG-INNFETQTRIQTLLFE  313
             S  F+E AMN+ARM+QCMYQHGDGHG  +  +T  R+Q+L+ +
Sbjct  548   SIGFVEAAMNLARMSQCMYQHGDGHGSPDKAKTVDRVQSLIVD  590



>ref|XP_002275273.1| PREDICTED: probable terpene synthase 9 [Vitis vinifera]
Length=585

 Score =   441 bits (1133),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 236/550 (43%), Positives = 343/550 (62%), Gaps = 37/550 (7%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
              T RRSANY P  WD  +I+SL+T  Y ++ F  R ++LKE  K ++K+       ++E+
Sbjct  52    VTERRSANYHPSIWDPKFIESLSTP-YTSDDFSNRLEDLKEEAKRLIKDAR-DTSSRLEL  109

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID ++RLG +YH EEEI EA+            +   T   DL+ TAL FR+LRQ+G++I
Sbjct  110   IDSIQRLGVAYHLEEEIKEAI---------DLVHLDDTTTYDLFTTALRFRLLRQHGYSI  160

Query  1551  SQDVFDGFM--DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK--  1384
             S DVFD F   DG+   F   +S+D  GLL+LYE+S L +EGE +LE AR FS  HLK  
Sbjct  161   SSDVFDKFRSKDGR---FMDGISQDIAGLLSLYEASHLGVEGEDDLEEARRFSTMHLKGL  217

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                            L++PLHWRMPRLEAR+FI+ Y +  T   N+ LLELAKLD+N+VQ
Sbjct  218   VGNLEGDLADQVQQSLEVPLHWRMPRLEARNFIDIYQRRNT--KNSALLELAKLDYNLVQ  275

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             +V+ ++LK ++RWW      E L+F+RDR++EN+LW++G TP P +  CRI   K     
Sbjct  276   SVYQKELKELTRWWTDLGFKENLSFSRDRLMENYLWSMGFTPEPHFSKCRIGLTKFICIF  335

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
              AVDD+YDIYG+ DEL+ FTD + RW D+  +E LP+YM+ CYLA  NF NE+ YD LK+
Sbjct  336   SAVDDMYDIYGSPDELRRFTDAVNRW-DIEALEDLPEYMKICYLATYNFANEMVYDALKD  394

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
             HG+ IL ++R  W +LC AY  E +W+ SG+ P+ +EY+ NAW ++  P ++ HV+  ++
Sbjct  395   HGLNILPYIRNQWVNLCAAYSIEMQWFYSGHKPSIDEYLGNAWTSVGGPGMMTHVYLLMD  454

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
              + +   + DCL     +   SS I RL++D GTS  E+ RGDV K+I+C+M E  +S  
Sbjct  455   CVTK-GNLNDCLDQASNLFYWSSFITRLSDDLGTSSAEIARGDVAKSIECFMIEKHISEE  513

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             +ARD +   ++  WKK+N+   +   P S   I   +N+AR AQC++Q G G G +   T
Sbjct  514   QARDQVGQLISHSWKKLNEESAKSSLPKSA--INSTLNMARTAQCIFQVGGGIGTSTGVT  571

Query  342   QTRIQTLLFE  313
             + R+ + + +
Sbjct  572   EDRLTSFIIK  581



>gb|AII32470.1| terpene synthase [Populus trichocarpa]
Length=572

 Score =   440 bits (1132),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 244/549 (44%), Positives = 349/549 (64%), Gaps = 28/549 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
              + RR ANY P TW   ++QSL   + A + +  +  EL+E V+ M+ + +M  +  +EM
Sbjct  31    VSKRRLANYQPTTWSCDFLQSLKNDN-ADKIYKDKAMELEEEVRCMINSGDMEMLTMLEM  89

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID+++RLG  + FE++I   L  I   ++          EK L ATAL FR+LRQ+G+ I
Sbjct  90    IDDIQRLGLGHRFEKDIKRKLDRISSSEQSY-----VEAEKSLRATALCFRLLRQHGYEI  144

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELAR------------  1408
             SQD+F GF+D +   F ASL  D +G+L+LYE+S L+ EGE  L  A             
Sbjct  145   SQDIFHGFLDDQG-NFMASLHNDIEGMLSLYEASHLACEGEEILNKANKQTSIYLRNHLG  203

Query  1407  ---DFSAKHLKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                  +A+ + H L++PLH +M  LEAR  IESY  GK    N  LL+L+KLDFN++Q+V
Sbjct  204   NSDSMTAERVSHALEVPLHHKMIMLEARWHIESY--GKREDANPKLLQLSKLDFNMMQSV  261

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
                DL+ +SRWW    +  +L F+RDR++E F WT+G+   P++ +CR    K+ SFI  
Sbjct  262   LQRDLQDMSRWWHDLGLKNKLRFSRDRLMECFFWTVGMAFEPEFNSCRKGLTKVTSFITT  321

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YG LDEL+ FT+ +ERW DV+ V +LPDYM+ C+LAL N VNE+AYD LKE G
Sbjct  322   IDDVYDVYGVLDELEAFTEAVERW-DVSAVRNLPDYMKLCFLALFNTVNEMAYDHLKEQG  380

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN-N  700
                +  L K WADLCKA+LQEAKW  +  TP+FEEY+ENAW ++S  +IL H +F +  N
Sbjct  381   EDAIPCLTKAWADLCKAFLQEAKWSYNNITPSFEEYLENAWRSVSGTVILIHAYFLMGEN  440

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
             +++ A  LD L +Y E++R  SII RL+ND  TS  E+ RG+   +I CYM E   S  E
Sbjct  441   ISKQA--LDYLVNYDELLRWPSIIFRLSNDLATSSAEIARGETANSISCYMYETGASEAE  498

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR  I+  + + W+ MNK  I+  +PF+ +F+  A+N+AR+AQC YQHGDGHG  +  ++
Sbjct  499   ARKHIEKLIQKAWRNMNKCQIDNETPFARSFVGTAINLARIAQCTYQHGDGHGAPDSRSK  558

Query  339   TRIQTLLFE  313
              RI +L+ E
Sbjct  559   NRISSLIIE  567



>gb|ACN42012.1| geraniol synthase [Perilla frutescens var. hirtella]
Length=603

 Score =   441 bits (1133),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 245/563 (44%), Positives = 354/563 (63%), Gaps = 25/563 (4%)
 Frame = -3

Query  1947  ASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLK  1768
             AS S ++        RRS NY P  WD++Y+QSLNT  Y  E ++ R  EL  +VK +L+
Sbjct  45    ASCSLQLDVKPAQEGRRSGNYQPSIWDFNYVQSLNTP-YKEERYLTRHAELIVQVKPLLE  103

Query  1767  NEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkk-kssnnyKATEEKDLYATA  1591
              ++M   +++E+ID+L  LG SY F++ I + L  IY + +   SN     E++DLY TA
Sbjct  104   -KKMEAAQQLELIDDLNNLGLSYFFQDRIKQILSFIYDENQCFHSNINDQAEKRDLYFTA  162

Query  1590  LEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELA  1411
             L F++LRQ+GF++SQ+VFD F +     F ASLS++TKGLL LYE+SFL  EGE  LE A
Sbjct  163   LGFKLLRQHGFDVSQEVFDCFKNDNGSDFKASLSDNTKGLLQLYEASFLVREGEDTLEQA  222

Query  1410  RDFSAKHLK----------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAIL  1279
             R F+ K L+                H L++PLHWR+ RLEAR F+++Y        N  +
Sbjct  223   RQFATKFLRRKLDEIDDNHLLSCIHHSLEIPLHWRIQRLEARWFLDAY--ATRHDMNPAI  280

Query  1278  LELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVN  1099
             LELAKLDFNI+QA H E+LK VSRWW+ + +AE+L F RDR+VE++ W I L    +Y  
Sbjct  281   LELAKLDFNIIQATHQEELKDVSRWWQNTRLAEKLPFVRDRLVESYFWAIALFEPHQYGY  340

Query  1098  CRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDY-MRFCYLALN  922
              R + AK+ +   ++DD+YDIYGTLDELQLFTD   RWD  T+   +P Y M+  Y+ ++
Sbjct  341   QRRVAAKIITLATSIDDVYDIYGTLDELQLFTDNFRRWD--TESLGIPPYSMQLFYMVIH  398

Query  921   NFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITIS  742
             NFV+E+A ++LKE G  ++ +L++ W DL +++L+EA WY SGYTP+ EEYI+N  ++I 
Sbjct  399   NFVSELACEILKEKGFIVIPYLQRSWIDLAESFLKEANWYYSGYTPSLEEYIDNGSVSIG  458

Query  741   CPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKA  562
                +L+ V+F + N  E   + + +  Y  I+RLS +++RL +D GTS FE KRGDVPKA
Sbjct  459   AVAVLSQVYFTLANSIEKPKI-ESMYKYHHILRLSGLLVRLHDDLGTSLFEKKRGDVPKA  517

Query  561   IQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMY  382
             ++  M E  V+  EA + +   + E WK+MN      G PF       A N+ R AQ +Y
Sbjct  518   VEICMKERNVTEEEAEEHVKYLIREAWKEMNTATAAAGCPFMDELNVAAANLGRAAQFVY  577

Query  381   QHGDGHGINNFETQTRIQTLLFE  313
               GDGHG+ + +   ++  L+FE
Sbjct  578   LDGDGHGVQHSKIHQQMGGLMFE  600



>ref|XP_003596036.1| (R)-limonene synthase [Medicago truncatula]
 gb|AES66287.1| monoterpene synthase [Medicago truncatula]
Length=589

 Score =   440 bits (1132),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 267/586 (46%), Positives = 365/586 (62%), Gaps = 43/586 (7%)
 Frame = -3

Query  2007  MAKMFSTFTTCKLP--SIHRSHASSSFRMCYHTTTTTRRSANYGPPTWDYSYIQSL-NTT  1837
             + K +S+  TC     SI     +SS      + T TRRSAN  P  W Y YIQSL N  
Sbjct  21    LGKKYSSLATCNPNTFSIKTQCNASSKDAKDDSQTITRRSANSQPSIWTYDYIQSLTNLE  80

Query  1836  HYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIy  1657
                 + F+M    LKE+V+ M+ N+   E++++E ID L+RLG +Y F  EI + L +IY
Sbjct  81    VKHTKEFLM----LKEKVR-MMFNKMENEIDQLEFIDVLQRLGVAYQFNNEIGKILDNIY  135

Query  1656  mkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTK  1477
               +           + +LYAT+L+FR+LRQ+G+NIS D+   F+D K   F    S D +
Sbjct  136   NSQTSML-------KNNLYATSLKFRLLRQHGYNISTDILCCFLD-KHDSFKEYHSFDVE  187

Query  1476  GLLNLYESSFLSMEGETNLELARDFSAKHLK-----------------HELKMPLHWRMP  1348
             G+L+LYESSF S E ET L+ ARDF++K LK                 H L++PLHWR+P
Sbjct  188   GVLSLYESSFHSFEDETILDEARDFTSKCLKEYNMNQNSGTYTSLLINHALELPLHWRVP  247

Query  1347  RLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTF  1168
             R EA  FI  Y++ +  S   ILLE AK+DFNIVQ+   E+LK  SRWWK + + E+L+F
Sbjct  248   RWEAHWFINVYERKQNMS--PILLEFAKIDFNIVQSNFQEELKYASRWWKITELDEKLSF  305

Query  1167  ARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIER  988
             AR+R+VENF+W++G +  P     R    K+ + I ++DD+YD+YGTL+ELQLFT  I+R
Sbjct  306   ARNRLVENFVWSVGTSYEPDLEYYRKEMTKVNALITSIDDVYDVYGTLEELQLFTKAIDR  365

Query  987   WDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAK  808
             WD ++ +E LP YM+ C+ AL NFVNE+A++ LK+ G +I  +L+K WADLCKAYL EAK
Sbjct  366   WD-LSAMEFLPYYMKICFHALYNFVNEVAFETLKKSGHYITPYLKKTWADLCKAYLIEAK  424

Query  807   WYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNL--AEDAAVLDCLTDYPEiirlss  634
             WY SGYTPT EEYIENAW +I  P+IL H +F + +    ED   L+   + P+II+ SS
Sbjct  425   WYHSGYTPTVEEYIENAWTSIGDPVILTHAYFLIPHSLKVEDLVRLE---ENPDIIKHSS  481

Query  633   iilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIE  454
             +ILRLAND GT   E   GD  K I CYM+E   S  EA +++   ++  WKKMNK    
Sbjct  482   MILRLANDLGTYKRENDTGDSSKLIGCYMNETGASEVEAHEYVKSMIHAEWKKMNKEAHS  541

Query  453   GGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLF  316
                  S +FI++A+N  R+A  MYQHGDGH I + E Q RI + +F
Sbjct  542   SSF--SHSFIDIAINYGRVAMFMYQHGDGHTIQDTEMQNRIMSFIF  585



>ref|XP_007040296.1| Myrcene synthase, chloroplastic, putative [Theobroma cacao]
 gb|EOY24797.1| Myrcene synthase, chloroplastic, putative [Theobroma cacao]
Length=558

 Score =   439 bits (1129),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 249/547 (46%), Positives = 343/547 (63%), Gaps = 52/547 (10%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
             +  RRS NY P  W+ +YIQSL +  Y  +    R ++L   V+ ML ++E+  +E++E+
Sbjct  41    SNDRRSTNYHPSIWNDNYIQSLES-EYLGKSCYERANKLVGEVRMML-DKEINLLEQLEL  98

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID L+RLG SYHFE EI   L  I            A ++ +L+A A+EFR+LRQ+G+ +
Sbjct  99    IDSLQRLGLSYHFENEIKTILDSISADHINV-----AWKKDNLHAIAIEFRLLRQHGYKV  153

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK----  1384
             +Q+VF  F D +   F ASL ED KGLLNLYE+S+  +EGE  LE ARDF+AK LK    
Sbjct  154   TQEVFSSFTD-EMGNFKASLCEDCKGLLNLYEASYHLVEGEGMLEKARDFAAKRLKEYLK  212

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L++PLHWRMPR EAR FI+ Y++ +    N ILLELA LDFNIVQA
Sbjct  213   QNKDPYLSLLVEHALELPLHWRMPRFEARFFIDVYERRE--DRNPILLELANLDFNIVQA  270

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
             VH +DLK  S+WW    I ++LTFARDR++ENFL+ +G   +P++   R    K+ +FI 
Sbjct  271   VHQDDLKYASKWWTDLDIRKKLTFARDRLMENFLFAVGEASDPQFGYFRRTQTKINTFIT  330

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DD+YD+YGTLDEL+LFT+ +ERW D   ++ LP+YM+ C+LAL NF+NEIA+D+LK  
Sbjct  331   TIDDVYDVYGTLDELELFTEAVERW-DTNAMQLLPEYMQICFLALYNFINEIAFDVLKGK  389

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
             G   +  L+K WADLCK+YL EAKWY SGYTPT +EYI+NAWI+IS P++L+H F   N 
Sbjct  390   GFNTIPFLKKAWADLCKSYLLEAKWYYSGYTPTLQEYIDNAWISISGPVVLSHAFVLTN-  448

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
               +    L+   +Y  II  S +I RL ND GTS  +  R  + K I             
Sbjct  449   -LKTKECLESFKEYSNIIYYSCMICRLVNDLGTSLIQEARRHIWKLI-------------  494

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
                      +  W++MN+  I   S F   FI++A+N+AR AQ MYQH DG+G+ + ET+
Sbjct  495   ---------DATWRRMNEERI-ADSLFPRPFIQIAVNLARTAQFMYQHHDGYGVEDGETK  544

Query  339   TRIQTLL  319
              R+ +L 
Sbjct  545   ERVLSLF  551



>ref|XP_011003243.1| PREDICTED: probable terpene synthase 12 [Populus euphratica]
Length=591

 Score =   440 bits (1131),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 241/549 (44%), Positives = 349/549 (64%), Gaps = 28/549 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
              + RR ANY P TW   ++QSL   + A + +  +  EL+E V+ M+ + +M+ +  +EM
Sbjct  50    VSKRRLANYQPTTWSCDFLQSLKNDN-ADKIYKDKAMELEEEVRCMIHSGDMKMLTMLEM  108

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID+++RLG  + FE++I   L  I   ++          EK L ATAL FR+LRQ+G+ I
Sbjct  109   IDDIQRLGLGHRFEKDIKRKLDRISSSEQSYFET-----EKSLRATALCFRLLRQHGYEI  163

Query  1551  SQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELAR------------  1408
             SQD+FDGF D +   F A L  D +G+L+LYE+S L+ EGE  L+ A             
Sbjct  164   SQDIFDGFTDDQG-NFMAYLHNDIEGMLSLYEASHLACEGEEILDKANKQTSIYLRNHLG  222

Query  1407  ---DFSAKHLKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAV  1237
                  +A+ + H L++PLH +M  LEAR  IESY  GK    N  LL+L+KL+FN+VQ+V
Sbjct  223   NSDSITAERISHALEVPLHHKMIMLEARWHIESY--GKREDANPTLLQLSKLNFNMVQSV  280

Query  1236  HLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICA  1057
                DL+++SRWW    +  +L F+RDR++E F WT+G+   P++ +CR    K+ SFI  
Sbjct  281   LQRDLQAMSRWWHDLGLKNKLRFSRDRLMECFFWTVGMAFEPEFCSCRKGLTKVTSFITT  340

Query  1056  VDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHG  877
             +DD+YD+YG LDEL++FT+ +ERW DV+ V +LPDYM+ C+LAL N VNE+AYD LKE G
Sbjct  341   IDDVYDVYGALDELEVFTEAVERW-DVSAVRNLPDYMKLCFLALFNTVNEMAYDHLKEQG  399

Query  876   VFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN-N  700
               ++ +L K WADLCKA+LQEAKW  +  TP+FEEY+ENAW +IS  +IL   +F +  N
Sbjct  400   EDVIPYLTKAWADLCKAFLQEAKWSYNNITPSFEEYLENAWRSISGTVILIQAYFLLGEN  459

Query  699   LAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANE  520
             +++    LD L +Y E++R  S+I RL ND  TS  E+ RG+   +I CYM E   S  E
Sbjct  460   ISKQ--TLDYLVNYDELLRWPSVIFRLYNDLATSSAEIARGETANSISCYMYETGASEAE  517

Query  519   ARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQ  340
             AR  I   + + W+ MNK  I+  +PF+ +F+   +N+AR+AQC YQHGDGHG  +  ++
Sbjct  518   ARKHIKKLIQKAWRSMNKCQIDNETPFARSFVATVINLARIAQCTYQHGDGHGAPDSRSK  577

Query  339   TRIQTLLFE  313
              RI +L+ E
Sbjct  578   NRISSLIIE  586



>pdb|2J5C|A Chain A, Rational Conversion Of Substrate And Product Specificity 
In A Monoterpene Synthase. Structural Insights Into The 
Molecular Basis Of Rapid Evolution.
 pdb|2J5C|B Chain B, Rational Conversion Of Substrate And Product Specificity 
In A Monoterpene Synthase. Structural Insights Into The 
Molecular Basis Of Rapid Evolution.
Length=569

 Score =   439 bits (1129),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 243/545 (45%), Positives = 345/545 (63%), Gaps = 32/545 (6%)
 Frame = -3

Query  1899  RSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDEL  1720
             R+  Y P  WD+S IQS ++  Y  E  +MR   + ++VK ML+ EE+  + ++E+ID+L
Sbjct  36    RTGGYQPTLWDFSTIQSFDS-EYKEEKHLMRAAGMIDQVKMMLQ-EEVDSIRRLELIDDL  93

Query  1719  KRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDV  1540
             +RLG S HFE EI+E L                 +E+DLY+TAL FR+LRQ  F++SQ+V
Sbjct  94    RRLGISCHFEREIVEIL-------NSKYYTNNEIDERDLYSTALRFRLLRQYDFSVSQEV  146

Query  1539  FDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLKHE------  1378
             FD F + K   F  SL +DT+GLL LYE+SFLS +GE  L LARDF+ K L+        
Sbjct  147   FDCFKNAKGTDFKPSLVDDTRGLLQLYEASFLSAQGEETLRLARDFATKFLQKRVLVDKD  206

Query  1377  ----------LKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLE  1228
                       L++P HWR+    ARSFI++Y +      N  +LELAKLDFN+VQA   +
Sbjct  207   INLLSSIERALELPTHWRVQMPNARSFIDAYKR--RPDMNPTVLELAKLDFNMVQAQFQQ  264

Query  1227  DLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDD  1048
             +LK  SRWW  + +   L F RDR+VE + WT G+    ++   RIM  K+ + +  +DD
Sbjct  265   ELKEASRWWNSTGLVHELPFVRDRIVECYYWTTGVVERRQHGYERIMLTKINALVTTIDD  324

Query  1047  IYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFI  868
             ++DIYGTL+ELQLFT  I+RW D+  ++ LP YM+ CYLAL NFVNE+AYD L++ G   
Sbjct  325   VFDIYGTLEELQLFTTAIQRW-DIESMKQLPPYMQICYLALFNFVNEMAYDTLRDKGFDS  383

Query  867   LHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAED  688
               +LRK+W  L ++YL EAKWY  G+ P+ EEY++N+WI+I    IL+H+FF + +  E+
Sbjct  384   TPYLRKVWVGLIESYLIEAKWYYKGHKPSLEEYMKNSWISIGGIPILSHLFFRLTDSIEE  443

Query  687   AAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDF  508
              A  + +  Y +I+R S  ILRLA+D GTS  E++RGDVPK++QCYM+E   S  EAR+ 
Sbjct  444   EAA-ESMHKYHDIVRASCTILRLADDMGTSLDEVERGDVPKSVQCYMNEKNASEEEAREH  502

Query  507   IDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQH-GDGHGINNFETQTRI  331
             +   +++ WK MNK  +   S FS  F+EV+ N+ARMAQ +YQH  DG G+ +      +
Sbjct  503   VRSLIDQTWKMMNKEMM--TSSFSKYFVEVSANLARMAQWIYQHESDGFGMQHSLVNKML  560

Query  330   QTLLF  316
             + LLF
Sbjct  561   RDLLF  565



>emb|CDX90785.1| BnaA03g24650D [Brassica napus]
Length=593

 Score =   440 bits (1131),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 252/559 (45%), Positives = 346/559 (62%), Gaps = 37/559 (7%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             +    RRSANY P  WD+ ++ S+    Y  +  V  RD LKE V+ ML +E    +E++
Sbjct  41    SPVVLRRSANYQPSLWDHHHLLSVENK-YTKDESVHERDLLKENVRKMLNDERTTHLEQL  99

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E+ID+L++LG SYHFE EI   L   +   K   N  +   E DL+ATALEFR+LRQ+GF
Sbjct  100   ELIDDLQKLGVSYHFEREIDNIL--TFTYHKDRRNFVEYDMEYDLHATALEFRLLRQHGF  157

Query  1557  NISQDVFDGFMDGKRCG-FNASLSEDTKGLLNLYESSFLSMEGETNLEL-ARDFSAKHLK  1384
             N+ +DVFD FM+   CG F+   S D  GLL+LYE+S+LS + +T L+   R F+ + LK
Sbjct  158   NVPEDVFDVFMEN--CGKFD---SHDINGLLSLYEASYLSTKSDTKLQKNVRVFATQQLK  212

Query  1383  --------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
                                   L MP HWRM RL  R +I+ Y  GK    N +LLE +K
Sbjct  213   NFVDTHGSKDLASCDVEMVVQALDMPYHWRMGRLATRWYIDMY--GKRLHKNPMLLEFSK  270

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             LDFNIVQAV+ E+LK VS WW+++ +A +L F+RDR+VEN+ WT G    P++ N R + 
Sbjct  271   LDFNIVQAVYQEELKYVSSWWRETGLANQLHFSRDRIVENYFWTTGQIQEPQFGNVRRII  330

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
              K+ + +  +DDIYDIYGTL+ELQLFT   E W DV +++ LP+YMR C+L + N VN I
Sbjct  331   TKVNALLTTIDDIYDIYGTLEELQLFTAAFENW-DVNRLDDLPEYMRLCFLVVYNEVNNI  389

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
               D+L+   + ++  L+K WAD+CKAYL EA WY  GY P  EEY++NAWI+IS P I  
Sbjct  390   GCDILRNKDINVIPFLKKSWADVCKAYLVEAMWYKGGYKPNLEEYMQNAWISISSPTIFV  449

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirl-ssiilrLANDKGTSPFEMKRGDVPKAIQCYM  547
             H F+ V +      VL+ L+++ + I   SS + RLAND  TSP EM RGDV K+IQCYM
Sbjct  450   H-FYCVFSDQLSVQVLETLSEHQQNIVRCSSSVFRLANDLVTSPDEMARGDVLKSIQCYM  508

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPF-SGTFIEVAMNIARMAQCMYQHGD  370
             +E  VS  +AR  +   +N++W +MN   IE  S      F E  +N+ARM+QCMYQ+GD
Sbjct  509   NETGVSEEKARMHVHKMINDMWDEMNYEKIENHSSLIPQDFAETVINLARMSQCMYQYGD  568

Query  369   GHGI-NNFETQTRIQTLLF  316
             GHG     +   R+ ++LF
Sbjct  569   GHGCPEKSKVIDRVMSVLF  587



>dbj|BAD27257.1| d-limonene synthase [Citrus unshiu]
Length=608

 Score =   440 bits (1132),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 246/558 (44%), Positives = 353/558 (63%), Gaps = 35/558 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y   T  RRSANY P  WD+ ++QSLN+ +Y  E +  R +ELK +VK  +K +    ++
Sbjct  46    YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDETYKRRAEELKGKVKTAIK-DVTEPLD  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG +YHFE EI   L +I+   K  +       +++LYAT+LEFR+LRQ+
Sbjct  104   QLELIDNLQRLGLAYHFEPEIRNILRNIHNHNKDYNW-----RKENLYATSLEFRLLRQH  158

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             G+ +SQ+VF GF D K  GF   + +D KG+L+L+E+S+ S+EGE+ +E A  F++KHLK
Sbjct  159   GYPVSQEVFSGFKDDK-VGF---ICDDFKGILSLHEASYYSLEGESIMEEAWQFTSKHLK  214

Query  1383  --------------------HELKMPLHWR-MPRLEARSFIESYDKGKTTSNNAILLELA  1267
                                   L++PLHW+ +P LEAR FI  Y+K +    N +LLELA
Sbjct  215   EMMITSNSKEEDVFVAEQAKRALELPLHWKKVPMLEARWFIHVYEKRE--DKNHLLLELA  272

Query  1266  KLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIM  1087
             KL+FN +QA++ E+LK +S WWK + + E+L+FAR+R+V +FLW++G+   P++  CR +
Sbjct  273   KLEFNTLQAIYQEELKDISGWWKDTGLGEKLSFARNRLVASFLWSMGIAFEPQFAYCRRV  332

Query  1086  GAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNE  907
                  + I  +DDIYD+YGTLDEL++FTD + RWD    ++HLP YM+ C+LAL NFVNE
Sbjct  333   LTISIALITVIDDIYDVYGTLDELEIFTDAVARWDINYALKHLPGYMKMCFLALYNFVNE  392

Query  906   IAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLIL  727
              AY +LK+    +L  ++  W  L +AYL EAKWY S YTP  EEY+EN  ++I+ PLI+
Sbjct  393   FAYYVLKQQDFDMLLSIKHAWLGLIQAYLVEAKWYHSKYTPKLEEYLENGLVSITGPLII  452

Query  726   AHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYM  547
                +    N       L+ L   P+I+  SS I RL +D GTS  E++RGDVPK+IQCYM
Sbjct  453   TISYLSGTNPIIKKE-LEFLESNPDIVHWSSKIFRLQDDLGTSSDEIQRGDVPKSIQCYM  511

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDG  367
              E   S   AR+ I   M ++WKK+N    +  SP + T  E  +N+ RM+  MY HGDG
Sbjct  512   HETGASEEVAREHIKDMMRQMWKKVNAYTADKDSPLTRTTAEFLLNLVRMSHFMYLHGDG  571

Query  366   HGINNFETQTRIQTLLFE  313
             HG+ N ET     TLLF+
Sbjct  572   HGVQNQETIDVGFTLLFQ  589



>ref|XP_008460930.1| PREDICTED: terpene synthase 10-like isoform X1 [Cucumis melo]
Length=606

 Score =   440 bits (1131),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 245/550 (45%), Positives = 349/550 (63%), Gaps = 30/550 (5%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMRE-VEKME  1735
              T RRSANY P  W   +IQSL ++ +    +  R + L   VK MLK     + +E++E
Sbjct  61    ATVRRSANYHPSIWKDEFIQSL-SSQFKGVTYGKRLNHLIGEVKAMLKKAPSEDSLEQLE  119

Query  1734  MIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFN  1555
             +ID L+RLG SY+FE EI   L  +Y K+           +KDLY T+LEFR+ RQ+GF 
Sbjct  120   LIDTLQRLGISYYFESEIKHVLKTLYNKRDLD------DNKKDLYVTSLEFRLFRQHGFE  173

Query  1554  ISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL----  1387
             ISQ+VF  F D      N S   +   +L+LYE+SF S E E  LE A+ F+  +L    
Sbjct  174   ISQEVFSDFKDEIEISDNISFLGNINRILSLYEASFSSFENEDFLEKAKCFAINYLEKYM  233

Query  1386  -------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIV  1246
                          KH L++PLHWR  R+EAR FI+ Y++ K    N ILLE+AKLDFNI+
Sbjct  234   RRTRVDEVDMAMIKHALELPLHWRTSRMEARWFIDIYERKKDM--NPILLEMAKLDFNIL  291

Query  1245  QAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSF  1066
             Q+++LEDLKS S WW+ + + ++L+FARD+++ENF WTIG+   P++   R MG K+ S 
Sbjct  292   QSIYLEDLKSASSWWRNTELGQKLSFARDQLMENFFWTIGIGFEPEFTYFRRMGTKIVSL  351

Query  1065  ICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLK  886
             I  +DD+YD+YGTLDEL+LFT+ IERW D+  ++ LP+Y++ C+  L N +NEIAY+ L 
Sbjct  352   ITMIDDVYDVYGTLDELKLFTNAIERW-DMAAMDQLPEYLKQCFFTLYNSINEIAYEALI  410

Query  885   EHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYV  706
              HGV ++ +L+K+WADLC +YL E+ WY SGY PT EEY+ NAWI+++ P++L H + +V
Sbjct  411   NHGVDVMQYLKKVWADLCNSYLIESNWYHSGYKPTLEEYMNNAWISVAGPIMLVHSYIFV  470

Query  705   NNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSA  526
             +        L+ LT Y + IR SS I+RLAND  T   E   GDVPK+IQCYM+E   S 
Sbjct  471   SAQISKQE-LERLTKYEDTIRWSSTIMRLANDLLTPLDEQNIGDVPKSIQCYMNETGGSE  529

Query  525   NEARDFIDLEMNELWKKMN-KVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNF  349
              EAR+++   ++ELWKK+N +   E          +++ N+AR++Q MYQ+GDG  I++ 
Sbjct  530   KEAREYLRHLVDELWKKLNDEYDDEKQVSTQAIIGDMSKNLARISQYMYQYGDGRIIDHN  589

Query  348   ETQTRIQTLL  319
             +T+  I  LL
Sbjct  590   KTKESIVALL  599



>ref|XP_009388290.1| PREDICTED: terpene synthase 10-like [Musa acuminata subsp. malaccensis]
Length=584

 Score =   439 bits (1129),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 255/590 (43%), Positives = 363/590 (62%), Gaps = 46/590 (8%)
 Frame = -3

Query  1992  STFTTCKLPSIHRSHASS--SFRMC--------YHTTTTTRRSANYGPPTWDYSYIQSLN  1843
             + F  C L   ++  ASS  S R C          T    RRSA+Y P +W   YIQSL 
Sbjct  7     APFFYCSLIGAYQRTASSKSSPRRCLLLPIRCTVKTPPPPRRSADYQPSSWSDEYIQSLR  66

Query  1842  TTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMD  1663
             T     E    R  +L E VK ++  ++  EV+ +++ID L++LG +YHF+E+  +AL  
Sbjct  67    TDTKVEEDNAKRMGKLTEDVKQLIYMKKGIEVQ-LQLIDHLQQLGVAYHFKEDTKDALWT  125

Query  1662  IymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSED  1483
             IY   ++ S       + +L+ATAL FR+LR++GF +S+ VF+ FMD K     AS    
Sbjct  126   IYGSMEEMSMLL----KDNLHATALMFRLLREHGFAVSEGVFNRFMDEK-GNLKASFRHQ  180

Query  1482  TKGLLNLYESSFLSMEGETNLELARDFSAKHLK----------------HELKMPLHWRM  1351
             T+GL++LYE+S L+ EGE  LE A +F+ K LK                H L++PL+WRM
Sbjct  181   TEGLVSLYEASHLAKEGEHVLEEANNFTTKQLKSLMEGSLEPHLREHVTHALELPLNWRM  240

Query  1350  PRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLT  1171
             PRL++R FIE   +      N +LLELAKLDFN VQ++   +L+ VSRWW    +A+RL 
Sbjct  241   PRLQSRWFIEECQREANI--NPVLLELAKLDFNKVQSIQQRELREVSRWWSNLGLAQRLP  298

Query  1170  FARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIE  991
             F+RDR++EN+ WT+G    P++   R    K    I  +DD+YD+YGT+DEL+LFTD ++
Sbjct  299   FSRDRLMENYFWTVGWAFEPQFARIREAQTKANCLITTIDDVYDVYGTIDELELFTDAVD  358

Query  990   RWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEA  811
             RW DV  ++ LP+YM+ C+LAL N  N+ AY+++KE G+ I+ HL+K WADLCKAY+ EA
Sbjct  359   RW-DVNTIDKLPEYMKICFLALFNSTNDTAYNVMKEKGLDIIPHLKKAWADLCKAYMVEA  417

Query  810   KWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssi  631
             +WY  GYTP  +EY+ENA ++IS PLIL   +   ++L ++A  LD     PEI R +S+
Sbjct  418   RWYHQGYTPNLKEYLENALVSISGPLILNLAYCTSDDLTQEA--LDDFQSCPEIARWASM  475

Query  630   ilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEG  451
             + RL +D GTS  E++RGDV K+IQCYM E  VS + AR  I   +   W+ +N     G
Sbjct  476   VFRLCDDLGTSTDELERGDVSKSIQCYMHETGVSEDAARGHIRGLIKGNWRAIN-----G  530

Query  450   GSPFSGTFIE----VAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
                F+  F E    +AMNIARMAQC+YQ+GDG+G  +   + RI++LL E
Sbjct  531   NRSFTWPFEENLKMMAMNIARMAQCIYQYGDGYGKPDGVIEDRIRSLLIE  580



>ref|XP_011096132.1| PREDICTED: trans-alpha-bergamotene synthase-like [Sesamum indicum]
 ref|XP_011096133.1| PREDICTED: trans-alpha-bergamotene synthase-like [Sesamum indicum]
Length=541

 Score =   437 bits (1125),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 246/545 (45%), Positives = 359/545 (66%), Gaps = 29/545 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
              RRS NY    WD  Y+QSL T+ Y A+ +V + ++LK RVK M+ +E    ++++E+ID
Sbjct  3     ARRSGNYESSIWDDDYVQSL-TSPYTAKEYVEQAEKLKSRVK-MIIDETEDLLDQLELID  60

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
              L+RL  S HF++ I E L+D      ++  +    +E+DLY TAL+FR+LRQ+G+++ Q
Sbjct  61    NLQRLDISNHFQDRI-EKLLD---SIHRTVESDDKHKERDLYVTALQFRLLRQHGYHVPQ  116

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHL-------  1387
             +VF  FM+ +   F   L++D KG+L+LYE+SFLS+EGE  L+LA++FS +HL       
Sbjct  117   EVFCSFME-EDGNFMECLADDVKGILSLYEASFLSLEGEIILDLAKEFSTRHLSERLEQI  175

Query  1386  ---------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVH  1234
                      +H L++PLHWR+ +LEA+ FI  Y+     + N ILLELAKLDFNIVQA +
Sbjct  176   TEPSLADQVRHALELPLHWRVQKLEAKWFIHIYES--RFNANLILLELAKLDFNIVQAKY  233

Query  1233  LEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAV  1054
              +++K +SRW+K++ + E+L FAR R+ E FLW +G TP P +   R +  K+   I  +
Sbjct  234   QDEIKQMSRWYKETGLPEKLRFARHRLAECFLWALGFTPEPHFGYARKILTKIAVLITIM  293

Query  1053  DDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGV  874
             DDIYD+YGTLDEL++FT TIERW D+  ++ LP+YMR C+LAL N  NE+AYD+L++   
Sbjct  294   DDIYDVYGTLDELEVFTQTIERW-DINALDQLPEYMRICFLALFNCANEMAYDVLRDQDF  352

Query  873   FILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLA  694
              I+ +LRK+WA+L +AY  EA WY SGY P+ EEY+  AW++IS P++L H +F + N  
Sbjct  353   NIISNLRKLWAELSRAYYLEATWYHSGYFPSTEEYLNTAWVSISGPVLLFHAYFCITN-P  411

Query  693   EDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEAR  514
              +   L  L  YP IIR  S++LRL +D GT+  E+ +GDVPK+IQCYM E   S  +AR
Sbjct  412   INKGELQSLELYPGIIRWPSMVLRLTDDLGTTSGEIAKGDVPKSIQCYMHETGCSEEDAR  471

Query  513   DFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTR  334
               +   ++   KKMNK  I  G P +  F   AMN+AR+A C+YQ GDG G+ + ET+  
Sbjct  472   KRVKHLIDVTLKKMNK-DILIGKP-AKNFRITAMNLARIALCVYQFGDGFGVPHHETKKN  529

Query  333   IQTLL  319
             + +L+
Sbjct  530   LVSLI  534



>gb|AFZ41786.1| putative gamma-terpinene synthase, partial [Thymus vulgaris]
Length=596

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 240/582 (41%), Positives = 357/582 (61%), Gaps = 30/582 (5%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFR-MCYHTTTT---TRRSANYGPPTWDYSYIQSLNTTHYA  1828
             F   +  KLP + R  +++  R +C  +      TRRS NY  P W+  +IQS +T  Y 
Sbjct  21    FGMGSASKLPMVARRVSTTRLRPICSASLQVEEETRRSGNYQAPVWNNDFIQSFSTDKYK  80

Query  1827  AEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkk  1648
              E F+ +++EL  +VK +L N +M  V+++E+I++L+ LG +Y+FE+E  + L  IY + 
Sbjct  81    DEKFLKKKEELIAQVKVLL-NTKMEAVKQLELIEDLRNLGLTYYFEDEFKKILTSIYNEH  139

Query  1647  kkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLL  1468
             K   N        DLY T+L FR+LR +GF++S+DVF+ F +     F ASL E+TK +L
Sbjct  140   KGFKNEQVG----DLYFTSLAFRLLRLHGFDVSEDVFNFFKNEDGSDFKASLGENTKDVL  195

Query  1467  NLYESSFLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLE  1339
              LYE+SFL   GE  LE AR FS K L                 +H L +PLHWR+ RLE
Sbjct  196   ELYEASFLIRVGEVTLEQARVFSTKILEKKVEEGIKDEKLLAWIQHSLALPLHWRIQRLE  255

Query  1338  ARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARD  1159
             AR F+++Y   K    N I+ EL K+DF+I+Q   L++++ VS+WW  + +AE+L F RD
Sbjct  256   ARWFLDAYKARKDM--NPIIYELGKIDFHIIQETQLQEVQEVSQWWTNTNLAEKLPFVRD  313

Query  1158  RVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDD  979
             R+VE + W +GL    +Y   R M A + +F+  +DD+YD+YGTLDELQLFTD I +W D
Sbjct  314   RIVECYFWALGLFEPHEYGYQRKMAAIIITFVTIIDDVYDVYGTLDELQLFTDAIRKW-D  372

Query  978   VTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYA  799
             V  +  LP YM+ CYLA+  + +E+AYD+LK+ G   + +L++ W  L + + QEAKWY 
Sbjct  373   VESISTLPYYMQVCYLAVFTYASELAYDILKDQGFNSISYLQRSWLSLVEGFFQEAKWYY  432

Query  798   SGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrL  619
             +GYTPT  EY+ENA ++IS P I++ V+F + N  E   V++ +  Y  I+ LS +ILRL
Sbjct  433   AGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSTE-RTVVENVFGYHNILYLSGMILRL  491

Query  618   ANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPF  439
             A+D GT+ FE+KRGDV KAIQCYM++   +  E  + +   + E W++MN    +   P 
Sbjct  492   ADDLGTTQFELKRGDVQKAIQCYMNDNNATEEEGTEHVKYLLREAWQEMNSAMADPDCPL  551

Query  438   SGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             S   +  A N+ R +Q +Y  GDGHG+ + E   ++  L+FE
Sbjct  552   SEDLVFAAANLGRASQFIYLDGDGHGVQHSEIHNQMGGLIFE  593



>sp|Q2XSC5.1|LALIN_LAVAN RecName: Full=R-linalool synthase; Short=LaLINS [Lavandula angustifolia]
 gb|ABB73045.1| linalool synthase [Lavandula angustifolia]
Length=564

 Score =   438 bits (1126),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 246/560 (44%), Positives = 347/560 (62%), Gaps = 33/560 (6%)
 Frame = -3

Query  1935  FRMCYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEM  1756
             FR        TRRS NY P  WD +YIQSLN+  Y  +  + R + L E+VK+ LK  +M
Sbjct  16    FRCSQLHVDETRRSGNYRPSAWDSNYIQSLNS-QYKEKKCLTRLEGLIEQVKE-LKGTKM  73

Query  1755  REVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRV  1576
               V+++E+ID+ + LG SY+F+++I   L  IY   K   ++    E  DLY TAL FR+
Sbjct  74    EAVQQLELIDDSQNLGLSYYFQDKIKHILNLIYNDHKYFYDSE--AEGMDLYFTALGFRL  131

Query  1575  LRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSA  1396
              RQ+GF +SQ+VFD F +     F     +DTKGLL LYE+SFL  EGE  LE AR+F+ 
Sbjct  132   FRQHGFKVSQEVFDRFKNENGTYFK---HDDTKGLLQLYEASFLVREGEETLEQAREFAT  188

Query  1395  KHL-------------------KHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLE  1273
             K L                   +H L++PLHWR  RLEAR F+++Y   +    N ++ E
Sbjct  189   KSLQRKLDEDGDGIDANIESWIRHSLEIPLHWRAQRLEARWFLDAY--ARRPDMNPVIFE  246

Query  1272  LAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCR  1093
             LAKL+FNIVQA   E+LK++SRWW    +AE+L F RDR+VE++ W I L    +Y   R
Sbjct  247   LAKLNFNIVQATQQEELKALSRWWSSLGLAEKLPFVRDRLVESYFWAIPLFEPHQYGYQR  306

Query  1092  IMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFV  913
              +  K+ + I ++DD+YDIYGTLDELQLFT+  ERWD+ + +  LP+Y++  Y A++NFV
Sbjct  307   KVATKIITLITSLDDVYDIYGTLDELQLFTNLFERWDNAS-IGRLPEYLQLFYFAIHNFV  365

Query  912   NEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPL  733
             +E+AYD+LKE G   + +L++ W DL K YL+EAKWY SGYTP+ EEY +NA++TI  P 
Sbjct  366   SEVAYDILKEKGFTSIVYLQRSWVDLLKGYLKEAKWYNSGYTPSLEEYFDNAFMTIGAPP  425

Query  732   ILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQC  553
             +L+  +F + +  E   +++ + +Y  I+R+S +++RL +D GTS FEM+RGDVPK++Q 
Sbjct  426   VLSQAYFTLGSSME-KPIIESMYEYDNILRVSGMLVRLPDDLGTSSFEMERGDVPKSVQL  484

Query  552   YMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHG  373
             YM E   +  EA + +     E WKKMN     G SP     + VA N+ R AQ MY  G
Sbjct  485   YMKETNATEEEAVEHVRFLNREAWKKMNTAEAAGDSPLVSDVVAVAANLGRAAQFMYFDG  544

Query  372   DGHGINNFETQTRIQTLLFE  313
             DG   N    Q  I ++LFE
Sbjct  545   DG---NQSSLQQWIVSMLFE  561



>gb|AAM53946.1|AF514289_1 (+)-limonene synthase 2 [Citrus limon]
Length=606

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 244/556 (44%), Positives = 352/556 (63%), Gaps = 33/556 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y      RRSANY P  WD+ ++QSLN+ +Y  E +  R +ELK +VK  +K +    ++
Sbjct  46    YDNLIVDRRSANYQPSIWDHDFLQSLNS-NYTDETYRRRAEELKGKVKIAIK-DVTEPLD  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG +Y FE EI   L +IY   K          +++LYAT+LEFR+LRQ+
Sbjct  104   QLELIDNLQRLGLAYRFETEIRNILHNIYNNNKDY-----VWRKENLYATSLEFRLLRQH  158

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             G+ +SQ+VF+GF D +  GF   + +D KG+L+L+E+S+ S+EGE+ +E A  F++KHLK
Sbjct  159   GYPVSQEVFNGFKDDQ-GGF---IFDDFKGILSLHEASYYSLEGESIMEEAWQFTSKHLK  214

Query  1383  -------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKL  1261
                                  L++PLHW++P LEAR FI  Y+K +    N +LLELAK+
Sbjct  215   EVMISKSMEEDVFVAEQAKRALELPLHWKVPMLEARWFIHVYEKRE--DKNHLLLELAKM  272

Query  1260  DFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGA  1081
             +FN +QA++ E+LK +S WWK + + E+L+FAR+R+V +FLW++G+   P++  CR +  
Sbjct  273   EFNTLQAIYQEELKEISGWWKDTGLGEKLSFARNRLVASFLWSMGIAFEPQFAYCRRVLT  332

Query  1080  KLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIA  901
                + I  +DDIYD+YGTLDEL++FTD + RWD    ++HLP YM+ C+LAL NFVNE A
Sbjct  333   ISIALITVIDDIYDVYGTLDELEIFTDAVARWDINYALKHLPGYMKMCFLALYNFVNEFA  392

Query  900   YDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAH  721
             Y +LK+    +L  ++  W  L +AYL EAKWY S YTP  EEY+EN  ++I+ PLI+A 
Sbjct  393   YYVLKQQDFDMLLSIKNAWLGLIQAYLVEAKWYHSKYTPKLEEYLENGLVSITGPLIIAI  452

Query  720   VFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
              +    N       L+ L   P+I+  SS I RL +D GTS  E++RGDVPK+IQCYM E
Sbjct  453   SYLSGTNPIIKKE-LEFLESNPDIVHWSSKIFRLQDDLGTSSDEIQRGDVPKSIQCYMHE  511

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
                S   AR+ I   M ++WKK+N    +  SP + T  E  +N+ RM+  MY HGDGHG
Sbjct  512   TGASEEVAREHIKDMMRQMWKKVNAYTADKDSPLTRTTTEFLLNLVRMSHFMYLHGDGHG  571

Query  360   INNFETQTRIQTLLFE  313
             + N ET     TLLF+
Sbjct  572   VQNQETIDVGFTLLFQ  587



>ref|XP_009152106.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Brassica 
rapa]
Length=601

 Score =   439 bits (1129),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 237/535 (44%), Positives = 345/535 (64%), Gaps = 29/535 (5%)
 Frame = -3

Query  1905  TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMID  1726
             +RRS NY P  WD+ Y+ S+N  H A E  V+ RD LKE+V+ ML  E    +E++E+ID
Sbjct  47    SRRSGNYKPSPWDHRYLLSINNEH-AKEEKVIARDLLKEKVRKMLDVETKSRLEQLELID  105

Query  1725  ELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQ  1546
             EL++LG SYHFE EI + LMD + +  +S       +E+DL+ATALEFR+LRQ+GF++S+
Sbjct  106   ELQKLGVSYHFEVEINDILMDFHHQNGRSILK--CVKEEDLHATALEFRLLRQHGFDVSE  163

Query  1545  DVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNL-ELARDFSAKHLK-----  1384
             D+FD  +D  +       S+D   +++LYE+S+LS + +  L E+ R F+ + ++     
Sbjct  164   DIFDVIID--KIESETFKSDDINSIISLYEASYLSTKSDIKLREVIRPFATEQIRKFVDG  221

Query  1383  ------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQA  1240
                         H L+MP HWRM RLE R +I++Y+K   T  N +L+E AK+DFNIVQ 
Sbjct  222   ETCNLEVREKAIHALEMPYHWRMRRLETRWYIDAYEKKHDT--NLVLIEFAKIDFNIVQI  279

Query  1239  VHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFIC  1060
              H EDLK  S WWK++ +   L F RDR+VEN+   +G+   P++ N R + + + + + 
Sbjct  280   AHQEDLKYASSWWKETCLVNHLPFVRDRIVENYFVAVGIIYEPQFGNARRIISIVNALVT  339

Query  1059  AVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEH  880
              +DDIYDIYGTL+EL++FT  ++ W DV +++ LP+YMR C+L L N VN I  D+LK+ 
Sbjct  340   TIDDIYDIYGTLEELEIFTAMVDNW-DVNRLDELPEYMRLCFLILYNEVNSIGCDILKDK  398

Query  879   GVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNN  700
              + ++  L+K WADLCK YL EAKWY  GY PT +EYI+NAWI+IS   IL H +   ++
Sbjct  399   HINVIPFLKKSWADLCKTYLVEAKWYKKGYKPTVKEYIQNAWISISGQTILIHFYCGFSD  458

Query  699   LAEDAAVLDCLTDY-PEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
                   +L+ L  +  +I+R S+ ILRLAND  TSP E+ RGDV K++QCYM E   +  
Sbjct  459   QI-SVQILETLAQHRQDIVRCSATILRLANDLATSPDELARGDVLKSVQCYMHETGATEE  517

Query  522   EARDFIDLEMNELWKKMN-KVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
             EA+  +   + + W++MN +  + G S     F+E AMN+ARMAQC+YQ+GDGHG
Sbjct  518   EAQAHVQQMICDTWEEMNYEAKMAGTSSLPRGFVEAAMNVARMAQCIYQYGDGHG  572



>ref|XP_010267843.1| PREDICTED: alpha-terpineol synthase, chloroplastic-like [Nelumbo 
nucifera]
Length=603

 Score =   439 bits (1129),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 246/574 (43%), Positives = 356/574 (62%), Gaps = 41/574 (7%)
 Frame = -3

Query  1968  PSIHRSHASSSFRM-CYHTTTT------TRRSANYGPPTWDYSYIQSLNTTHYAAEGFVM  1810
             PS HR     ++R+ C     T       R++  Y P  WDY +++SL +  YA+E +  
Sbjct  30    PSSHRP----TWRIRCVANVQTQEDSEAARKAGTYTPTIWDYDFVESLKS-DYASETYAT  84

Query  1809  RRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnn  1630
             R D+LK+ V+  L    +  + ++++ID L+RLG  Y FE+EI EAL  +Y +  K    
Sbjct  85    RADKLKQDVRSRLV-VTVDPLARLKLIDVLERLGVGYLFEKEIQEALQAVYSESSKQIM-  142

Query  1629  yKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESS  1450
                  ++DLYATAL FR+LRQ+G  + QDVF+ F+D K   F  SLS+D +GLL+LYE+S
Sbjct  143   -----KEDLYATALHFRILRQHGHEVPQDVFNEFIDEK-GKFKESLSQDVQGLLSLYEAS  196

Query  1449  FLSMEGETNLELARDFSAKHLKH---------------ELKMPLHWRMPRLEARSFIESY  1315
             +L  EGE+ L+ AR+F+  HLKH                L++PL WRM R E R FIE Y
Sbjct  197   YLGAEGESILDEAREFTKGHLKHLKENVDSRLAKQLSHALEIPLQWRMLRPENRWFIEVY  256

Query  1314  DKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLW  1135
             ++ +    +  +LELAKLDFN+VQAVH  DL++ SRWW+   +A++L+FARDR+VE+FLW
Sbjct  257   EEQEDM--DPTVLELAKLDFNMVQAVHQRDLRTASRWWRNLGLAQKLSFARDRLVESFLW  314

Query  1134  TIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLP  955
             + G+T  P+Y  CR    K+  F+  +DDIYD+YG+L+EL++FTD +ERW D   +  LP
Sbjct  315   SAGVTYEPQYRRCRNWLTKVMKFVLVLDDIYDVYGSLEELEIFTDAVERW-DTAAMAQLP  373

Query  954   DYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFE  775
             DYM+  +LAL N  NE+AY++LKE G  IL +LRK WA   KA  QEAKWY    TP  E
Sbjct  374   DYMKMSFLALFNTTNEMAYEILKEQGWDILPYLRKAWAGFIKAMFQEAKWYHKNSTPPVE  433

Query  774   EYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSP  595
             +Y++N W++ S  + L H FF       +  VLD L + P++I   S+I RL+ND  TS 
Sbjct  434   DYLKNGWVSSSGTVFLVHAFFATGQEI-NKDVLDYLENTPDLIYGPSMIFRLSNDLATSS  492

Query  594   FEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVA  415
              E++RGDV  +I CYM +   S   AR++I     ++WKKMNK      SPFS  F+   
Sbjct  493   AELERGDVSSSIHCYMVQHNASEQVAREYIRGLTLDVWKKMNKSI--SNSPFSLQFVNFC  550

Query  414   MNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             +N+AR + C+YQ+GDG G  + +++  + +L+ +
Sbjct  551   LNLARTSLCIYQYGDGLGAESNKSKDHVLSLIIQ  584



>dbj|BAD27256.1| d-limonene synthase [Citrus unshiu]
Length=606

 Score =   439 bits (1129),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 240/556 (43%), Positives = 345/556 (62%), Gaps = 33/556 (6%)
 Frame = -3

Query  1923  YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVE  1744
             Y   T  RRSANY P  WD+ ++QSLN+ +Y  E +  R +ELK +V   +K +    + 
Sbjct  46    YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDETYKRREEELKGKVMTTIK-DVTEPLN  103

Query  1743  KMEMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQN  1564
             ++E+ID L+RLG +YHFE EI   L DIY              +++LYAT+LEFR+LRQ+
Sbjct  104   QLELIDSLQRLGLAYHFETEIRNILHDIYNSNNDY-----VWRKENLYATSLEFRLLRQH  158

Query  1563  GFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK  1384
             G+ +SQ+VF+GF D +  GF   + +D KG+L+L+E+S+ S+EGE+ +E A  F++KHLK
Sbjct  159   GYPVSQEVFNGFKDDQ-GGF---ICDDFKGVLSLHEASYFSLEGESIMEEAWQFTSKHLK  214

Query  1383  -------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKL  1261
                                  L++PLHW++P LEAR FI+ Y+K +    N +LLELAKL
Sbjct  215   EVMISKSKQGDVFVAEQAKRGLELPLHWKVPMLEARWFIDVYEKRE--DKNHLLLELAKL  272

Query  1260  DFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGA  1081
             +FN++QA++ E+LK VSRWWK   + E+L+FARD +V +F+W++G+   P++  CR +  
Sbjct  273   EFNVLQAIYQEELKDVSRWWKDIGLGEKLSFARDSLVASFVWSMGIVFEPQFAYCRRILT  332

Query  1080  KLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIA  901
               ++ I  +DDIYD+YGTLDEL+LF D +ERWD    + HLPDYM+ C+LAL N VNE  
Sbjct  333   ITFALISVIDDIYDVYGTLDELELFADAVERWDINYALNHLPDYMKICFLALYNLVNEFT  392

Query  900   YDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAH  721
             Y +LK+    IL  ++  W    +AYL EAKWY   YTPT  E++EN  ++I  P++   
Sbjct  393   YYVLKQQDFDILRSIKNAWLRNIQAYLVEAKWYHGKYTPTLGEFLENGLVSIGGPMVTMT  452

Query  720   VFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDE  541
              +    N   +   L+ L    +I   S  ILRL +D GTS  E++RGDVPK+IQCYM E
Sbjct  453   AYLSGTNPIIEKE-LEFLESNQDISHWSFKILRLQDDLGTSSDEIRRGDVPKSIQCYMHE  511

Query  540   AKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHG  361
                S   AR+ I   M ++WKK+N    +   P S T +E  +N+ R++  MY HGDGHG
Sbjct  512   TGASEEVAREHIKDMMRQMWKKVNAYRADKDFPLSQTTVEFILNVVRVSHFMYLHGDGHG  571

Query  360   INNFETQTRIQTLLFE  313
               N ET   + TLLF+
Sbjct  572   AQNQETMDVVFTLLFQ  587



>gb|AGT29345.1| putative gamma-terpinene synthase, partial [Thymus serpyllum]
Length=596

 Score =   439 bits (1128),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 240/582 (41%), Positives = 354/582 (61%), Gaps = 30/582 (5%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFR-MC---YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYA  1828
             F   +  KLP + R  A++  R +C         TRRS NY  P W+  +IQS +T  Y 
Sbjct  21    FGMGSASKLPMVARRVATTRLRPICSASLQVEEKTRRSGNYQAPVWNNDFIQSFSTDKYK  80

Query  1827  AEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkk  1648
              E F+ +++EL  +VK +L N +M  V+++E+I++L+ LG +Y+FE+E  + L  IY + 
Sbjct  81    DEKFLKKKEELIAQVKVLL-NTKMEAVKQLELIEDLRNLGLTYYFEDEFKKILTSIYNEH  139

Query  1647  kkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLL  1468
             K   N        DLY T+L FR+LR +GF++S+DVF+ F +     F ASL E+TK +L
Sbjct  140   KGFKNEQVG----DLYFTSLAFRLLRLHGFDVSEDVFNFFKNEDGSDFKASLGENTKDVL  195

Query  1467  NLYESSFLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLE  1339
              LYE+SFL   GE  LE AR FS K L                 +H L +PLHWR+ RLE
Sbjct  196   ELYEASFLIRVGEVTLEQARVFSTKILEKKVEEGIKDEKLLAWIQHSLALPLHWRIQRLE  255

Query  1338  ARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARD  1159
             AR F+++Y   K    N I+ EL K+DF+I+Q   L++++ VS+WW  + +AE+L F RD
Sbjct  256   ARWFLDAYKARKDM--NPIIFELGKIDFHIIQETQLQEVQEVSQWWTNTNLAEKLPFVRD  313

Query  1158  RVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDD  979
             R+VE + W +GL    +Y   R M A + +F+  +DD+YD+YGTLDELQLFTD +  W D
Sbjct  314   RIVECYFWALGLFEPHEYGYQRKMAAIIITFVTIIDDVYDVYGTLDELQLFTDAVRTW-D  372

Query  978   VTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYA  799
                +  LP YM+ CYLAL  + +E+AYD+LK+ G   + +L++ W  L + + QEAKWY 
Sbjct  373   FESISTLPYYMQVCYLALYTYASELAYDILKDQGFNSISYLQRSWLSLVEGFFQEAKWYY  432

Query  798   SGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrL  619
             +GYTPT  EY+ENA ++IS P I++ V+F + N  E   V++ +  Y  I+ LS +ILRL
Sbjct  433   AGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSTE-RTVVENVFGYHNILYLSGMILRL  491

Query  618   ANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPF  439
             A+D GT+ FE+KRGDV KAIQCYM++   +  E  + +   + E W++MN    +   P 
Sbjct  492   ADDLGTTQFELKRGDVQKAIQCYMNDNNATEQEGTEHVKYLLREAWQEMNSAMADPDCPL  551

Query  438   SGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             S   +  A N+ R +Q +Y  GDGHG+ + E   ++  L+FE
Sbjct  552   SEDLVFAAANLGRASQFIYLDGDGHGVQHSEIHNQMGGLIFE  593



>gb|AFP23130.1| monoterpene synthases [Picrorhiza kurrooa]
Length=540

 Score =   436 bits (1122),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 246/546 (45%), Positives = 361/546 (66%), Gaps = 29/546 (5%)
 Frame = -3

Query  1902  RRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDE  1723
             RRS NY    WD  Y+QSL  + Y A+ ++   DELK+RVK ++ +E   +++++E+ID 
Sbjct  4     RRSGNYEASIWDDDYVQSL-ASQYMAKEYLELADELKKRVK-IIMDETEDQLDQLELIDT  61

Query  1722  LKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNISQD  1543
             L+RL  S+HF++E+   L +IYM  K          +KDLY TAL+FR+LRQ+ + I Q+
Sbjct  62    LQRLDISHHFDDEVRNILENIYMTGKFHDTQI----KKDLYTTALKFRILRQHRYPIPQE  117

Query  1542  VFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFS------------  1399
             VF  FMD +   FNA +S+D +G+++LYE+SFL MEGE+ L++ARDFS            
Sbjct  118   VFCSFMD-EDGNFNAGVSDDIRGVMSLYEASFLCMEGESILDMARDFSTNRLKERLKHIT  176

Query  1398  ----AKHLKHELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHL  1231
                 +K +KH L++PLHWR+ +LEA+ FI  Y      + N  L++LAKLDFNI QA + 
Sbjct  177   DSNLSKQVKHALELPLHWRVQKLEAKWFINIY--AMKFNANITLIKLAKLDFNITQAKYQ  234

Query  1230  EDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVD  1051
             +++K +SRW+K++ + E+LTFAR R+VE FLW +G  P P +   R +  K+   I  +D
Sbjct  235   DEIKQMSRWYKETGLPEKLTFARHRLVECFLWAVGFIPEPHFGYPRKILTKIAVLITIMD  294

Query  1050  DIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVF  871
             D+YD+YGTLDEL LFTD IERW D+  ++ +P+YMR C+LAL N  NE+AYD+L++ G  
Sbjct  295   DMYDVYGTLDELHLFTDAIERW-DINALDCIPEYMRICFLALFNCTNELAYDILRDQGFN  353

Query  870   ILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAE  691
             I+ +L K+WA+L KAY  EA+WY +GY P+ +EY+  AWI+IS P++L H +F + N   
Sbjct  354   IISNLTKLWAELSKAYYLEARWYHNGYFPSLDEYLNTAWISISGPVLLFHAYFTMANPV-  412

Query  690   DAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARD  511
             +   L  L     IIR  S++LRL +D GT+  E+K+GDVPK+IQCYM+E   S +EAR+
Sbjct  413   NKNELQSLEQNDGIIRWPSMVLRLTDDLGTTSDEIKKGDVPKSIQCYMNENGRSEDEARE  472

Query  510   FIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRI  331
             +I   ++E  K+MNK  I   SP     +  AMN+AR++Q  YQ+GDG GI + ET+  +
Sbjct  473   YIKCLIDESLKRMNK-EILMESPVRD-LVPAAMNLARISQSFYQYGDGFGIPHRETKKNL  530

Query  330   QTLLFE  313
              +L+ E
Sbjct  531   VSLIVE  536



>gb|AGK88252.1| gamma-terpinene synthase [Thymus caespititius]
Length=597

 Score =   438 bits (1127),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 242/579 (42%), Positives = 350/579 (60%), Gaps = 32/579 (6%)
 Frame = -3

Query  1980  TCKLPSIHRSHASSSFRM------CYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEG  1819
               KLP + R    S+ R+             TRRS NY    WD ++IQS NT  Y  E 
Sbjct  25    ASKLPMVARRVDVSTTRLRPICSASLQVEEETRRSGNYQASIWDNAFIQSFNTNKYRDEK  84

Query  1818  FVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkks  1639
              + R++EL  +VK +L N +M  V+++E+ID+L+ LG +Y+F++E  + L  IY   K  
Sbjct  85    HLNRKEELIAQVKVLL-NTKMEAVKQLELIDDLRNLGLTYYFQDEFKKILTCIYNDHKCF  143

Query  1638  snnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLY  1459
              N        DLY T+L FR+LR +GF++S+DVF  F +     F ASL E+TK +L LY
Sbjct  144   KNEQVG----DLYFTSLGFRLLRLHGFDVSEDVFSFFKNEDGSDFKASLGENTKDVLQLY  199

Query  1458  ESSFLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLEARS  1330
             E+SFL   GE  LE AR FS K L                 +H L +PLHWR+ RLEAR 
Sbjct  200   EASFLXRVGEVTLEQARVFSTKILEKKVDEGINDEKLLAWIQHSLALPLHWRIQRLEARW  259

Query  1329  FIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVV  1150
             F+++Y   K    N ++ EL K+DF+I+Q   LE+++ VSRWW  S +AE+L F RDR+V
Sbjct  260   FLDAYAARKDM--NPLIFELGKIDFHIIQETQLEEVQEVSRWWTNSNLAEKLPFVRDRIV  317

Query  1149  ENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTK  970
             E + W +GL    +Y   R M A + +F+  +DD+YD+YGTLDELQLFTD I +W D   
Sbjct  318   ECYFWALGLFEPHEYGYQRKMAAIIITFVTIIDDVYDVYGTLDELQLFTDAIRKW-DFES  376

Query  969   VEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGY  790
             +  LP YM+ CYLAL  + +E+AYD+LK+ G   + +L++ W  L + + QEAKWY +GY
Sbjct  377   ISTLPYYMQVCYLALYTYASELAYDILKDQGFNSISYLQRSWLSLVEGFFQEAKWYYAGY  436

Query  789   TPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAND  610
             TPT  EY+ENA ++IS P I++ V+F + N + +  V++ +  Y  I+ LS +ILRLA+D
Sbjct  437   TPTLAEYLENAKVSISSPTIISQVYFTLPN-SXERTVVENVYGYHNILYLSGMILRLADD  495

Query  609   KGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGT  430
              GT+ FE+KRGDV KAIQCYM +   +  E ++ +   + E WK+MN    +   P S  
Sbjct  496   LGTTQFELKRGDVQKAIQCYMKDNNATEKEGQEHVKYLLXEAWKEMNTAMADPDCPLSED  555

Query  429   FIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              ++ A N+ R +Q +Y  GDGHG+ + E   ++  L+FE
Sbjct  556   LVDAAANLGRASQFIYLEGDGHGVQHSEIHNQMGGLIFE  594



>gb|AFZ41787.1| putative gamma-terpinene synthase, partial [Thymus vulgaris]
Length=596

 Score =   438 bits (1127),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 240/582 (41%), Positives = 355/582 (61%), Gaps = 30/582 (5%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFR-MC---YHTTTTTRRSANYGPPTWDYSYIQSLNTTHYA  1828
             F   +  KLP + R  ++   R +C         TRRS NY  P W+  +IQS +T  Y 
Sbjct  21    FGMGSASKLPMVARRVSTIRLRPICSASLQVEEKTRRSGNYQAPVWNNDFIQSFSTDKYK  80

Query  1827  AEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkk  1648
              E F+ +++EL  +VK +L N +M  V+++E+I++L+ LG +Y+FE+E  + L  IY + 
Sbjct  81    DEKFLKKKEELIAQVKVLL-NTKMEAVKQLELIEDLRNLGLTYYFEDEFKKILTSIYNEH  139

Query  1647  kkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLL  1468
             K   N        DLY T+L FR+LR +GF++S+DVF+ F +     F ASL E+TK +L
Sbjct  140   KGFKNEQVG----DLYFTSLAFRLLRLHGFDVSEDVFNFFKNEDGSDFKASLGENTKDVL  195

Query  1467  NLYESSFLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLE  1339
              LYE+SFL   GE  LE AR FS K L                 +H L +PLHWR+ RLE
Sbjct  196   ELYEASFLIRVGEVTLEQARVFSTKILEKKVEEGIKDEKLLAWIQHSLALPLHWRIQRLE  255

Query  1338  ARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARD  1159
             AR F+++Y   K    N I+ EL K+DF+I+Q   L++++ VS+WW  + +AE+L F RD
Sbjct  256   ARWFLDAYKARKDM--NPIIYELGKIDFHIIQETQLQEVQEVSQWWTNTNLAEKLPFVRD  313

Query  1158  RVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDD  979
             R+VE + W +GL    +Y   R M A + +F+  +DD+YD+YGTLDELQLFTD I +W D
Sbjct  314   RIVECYFWALGLFEPHEYGYQRKMAAIIITFVTIIDDVYDVYGTLDELQLFTDAIRKW-D  372

Query  978   VTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYA  799
             V  +  LP YM+ CYLA+  + +E+AYD+LK+ G   + +L++ W  L + + QEAKWY 
Sbjct  373   VESISTLPYYMQVCYLAVFTYASELAYDILKDQGFNSISYLQRSWLSLVEGFFQEAKWYY  432

Query  798   SGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrL  619
             +GYTPT  EY+ENA ++IS P I++ V+F + N  E   V++ +  Y  I+ LS +ILRL
Sbjct  433   AGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSTE-RTVVENVFGYHNILYLSGMILRL  491

Query  618   ANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPF  439
             A+D GT+ FE+KRGDV KAIQCYM++   +  E  + +   + E W++MN    +   P 
Sbjct  492   ADDLGTTQFELKRGDVQKAIQCYMNDNNATEEEGTEHVKYLLREAWQEMNSAMADPDCPL  551

Query  438   SGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             S   +  A N+ R +Q +Y  GDGHG+ + E   ++  L+FE
Sbjct  552   SEDLVFAAANLGRASQFIYLDGDGHGVQHSEIHNQMGGLIFE  593



>gb|AGS42395.1| terpene synthase 2 [Thymus vulgaris]
Length=596

 Score =   438 bits (1127),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 239/582 (41%), Positives = 357/582 (61%), Gaps = 30/582 (5%)
 Frame = -3

Query  1995  FSTFTTCKLPSIHRSHASSSFR-MCYHTTTT---TRRSANYGPPTWDYSYIQSLNTTHYA  1828
             F   +  KLP + R  +++  R +C  +      TRRS NY  P W+  +IQS +T  Y 
Sbjct  21    FGMGSASKLPMVARRVSTTRLRPICSASLQVEEETRRSGNYQAPVWNNDFIQSFSTDKYK  80

Query  1827  AEGFVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkk  1648
              E ++ +++EL  +VK +L N +M  V+++E+I++L+ LG +Y+FE+E  + L  IY + 
Sbjct  81    DEKYLKKKEELIAQVKVLL-NTKMEAVKQLELIEDLRNLGLTYYFEDEFKKILTSIYNEH  139

Query  1647  kkssnnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLL  1468
             K   N        DLY T+L FR+LR +GF++S+DVF+ F +     F ASL E+TK +L
Sbjct  140   KGLKNEQVG----DLYFTSLAFRLLRLHGFDVSEDVFNFFKNEDGSDFKASLGENTKDVL  195

Query  1467  NLYESSFLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLE  1339
              LYE+SFL   GE  LE AR FS K L                 +H L +PLHWR+ RLE
Sbjct  196   ELYEASFLIRVGEVTLEQARVFSTKILEKKVEEGIKDEKLLAWIQHSLALPLHWRIQRLE  255

Query  1338  ARSFIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARD  1159
             AR F+++Y   K    N I+ EL K+DF+I+Q   L++++ VS+WW  + +AE+L F RD
Sbjct  256   ARWFLDAYKARKDM--NPIIYELGKIDFHIIQETQLQEVQEVSQWWTNTNLAEKLPFVRD  313

Query  1158  RVVENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDD  979
             R+VE + W +GL    +Y   R M A + +F+  +DD+YD+YGTLDELQLFTD I +W D
Sbjct  314   RIVECYFWALGLFEPHEYGYQRKMAAIIITFVTIIDDVYDVYGTLDELQLFTDAIRKW-D  372

Query  978   VTKVEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYA  799
             V  +  LP YM+ CYLA+  + +E+AYD+LK+ G   + +L++ W  L + + QEAKWY 
Sbjct  373   VESISTLPYYMQVCYLAVFTYASELAYDILKDQGFNSISYLQRSWLSLVEGFFQEAKWYY  432

Query  798   SGYTPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrL  619
             +GYTPT  EY+ENA ++IS P I++ V+F + N  E   V++ +  Y  I+ LS +ILRL
Sbjct  433   AGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSTE-RTVVENVFGYHNILYLSGMILRL  491

Query  618   ANDKGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPF  439
             A+D GT+ FE+KRGDV KAIQCYM++   +  E  + +   + E W++MN    +   P 
Sbjct  492   ADDLGTTQFELKRGDVQKAIQCYMNDNNATEEEGTEHVKYLLREAWQEMNSAMADPDCPL  551

Query  438   SGTFIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
             S   +  A N+ R +Q +Y  GDGHG+ + E   ++  L+FE
Sbjct  552   SEDLVFAAANLGRASQFIYLDGDGHGVQHSEIHNQMGGLIFE  593



>ref|XP_002275106.1| PREDICTED: probable terpene synthase 9 [Vitis vinifera]
Length=602

 Score =   438 bits (1126),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 235/550 (43%), Positives = 347/550 (63%), Gaps = 37/550 (7%)
 Frame = -3

Query  1911  TTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKMEM  1732
              T RRSANY P  WD  +I+SL +T Y  EG+    ++LKE  K ++K+       ++E+
Sbjct  52    VTERRSANYHPSIWDPKFIESL-STPYTNEGYSNLLEDLKEEAKRLIKDAR-DTSSRLEL  109

Query  1731  IDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGFNI  1552
             ID ++RLG +YH EEEI EA+            +   T   DL  TAL  R+LRQ+G+ +
Sbjct  110   IDSMQRLGVAYHLEEEIKEAI---------DLVHLDDTTTDDLSTTALRLRLLRQHGYPV  160

Query  1551  SQDVFDGFM--DGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLELARDFSAKHLK--  1384
             S +VFD F   DG+   F   +S+D  GLL+LYE+S L +EGE +LE AR FS +HLK  
Sbjct  161   SSEVFDQFRSKDGR---FMDGISQDIAGLLSLYEASHLGLEGEDDLEEARRFSTRHLKSL  217

Query  1383  -------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAKLDFNIVQ  1243
                            L++PLHWRMPRLEAR+FI+ Y +  T   N+ LLELAKLD+N+VQ
Sbjct  218   VGNLESDLADQVQQSLEVPLHWRMPRLEARNFIDIYQRRNT--KNSALLELAKLDYNLVQ  275

Query  1242  AVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMGAKLYSFI  1063
             + + ++LK ++RWW      E+L+F+RDR+VEN+LW++G+ P P +  CRI   K    +
Sbjct  276   SSYQKELKELTRWWTDLGFKEKLSFSRDRLVENYLWSMGIAPEPHFSKCRIGLTKFICIL  335

Query  1062  CAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEIAYDMLKE  883
              A+DD+YDIYG+ DEL+ FTD + RWD    V+ LPDYM+ CYLA+ NF NE+AYD L++
Sbjct  336   TAIDDMYDIYGSPDELRRFTDAVNRWDTGALVD-LPDYMKICYLAMYNFANEMAYDALRD  394

Query  882   HGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILAHVFFYVN  703
             H ++IL +L+  W +LC +Y  EA+W+ +GY P+ +EY+ NAW ++  P  + H +F + 
Sbjct  395   HDLYILPYLKSQWLNLCTSYSMEAQWFYNGYKPSIDEYLSNAWTSVGGPAAMVHAYFLM-  453

Query  702   NLAEDAAVLDCLTDYPEiirlssiilrLANDKGTSPFEMKRGDVPKAIQCYMDEAKVSAN  523
               A    + +CL +   ++  SS+I RL++D GTS  E+ RGDV K+IQCYM E ++S  
Sbjct  454   GCATKGNLNNCLDNASNLLYWSSLITRLSDDLGTSSAEIARGDVAKSIQCYMIEERISEE  513

Query  522   EARDFIDLEMNELWKKMNKVGIEGGSPFSGTFIEVAMNIARMAQCMYQHGDGHGINNFET  343
             +ARD ++  +   WKK+N+  I+   P S   I  ++N+AR AQC++Q GDG G +   T
Sbjct  514   QARDQVEKLIGYSWKKLNEASIDSSLPKS--MINSSLNMARSAQCIFQFGDGIGTSIGVT  571

Query  342   QTRIQTLLFE  313
             + R+ + + +
Sbjct  572   KDRLTSFIIK  581



>gb|AGK88255.1| gamma-terpinene [Thymus caespititius]
Length=597

 Score =   437 bits (1124),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 240/579 (41%), Positives = 350/579 (60%), Gaps = 32/579 (6%)
 Frame = -3

Query  1980  TCKLPSIHRSHASSSFRM------CYHTTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEG  1819
               KLP + R    S+ R+             TRRS NY    WD ++IQS NT  Y  E 
Sbjct  25    ASKLPMVARRVDVSTTRLRPICSASLQVEEETRRSGNYQASIWDNAFIQSFNTNKYRDEK  84

Query  1818  FVMRRDELKERVKDMLKNEEMREVEKMEMIDELKRLGCSYHFEEEIMEALMDIymkkkks  1639
              + R++EL  +VK +L N +M  V+++E+ID+L+ LG +Y+F++E  + L  IY   K  
Sbjct  85    HLNRKEELIAQVKVLL-NTKMEAVKQLELIDDLRNLGLTYYFQDEFKKILTCIYNDHKCF  143

Query  1638  snnyKATEEKDLYATALEFRVLRQNGFNISQDVFDGFMDGKRCGFNASLSEDTKGLLNLY  1459
              N        DLY T+L FR+LR +GF++S+DVF  F +     F ASL E+TK +L LY
Sbjct  144   KNEQVG----DLYFTSLGFRLLRLHGFDVSEDVFSFFKNEDGSDFKASLGENTKDVLQLY  199

Query  1458  ESSFLSMEGETNLELARDFSAKHL-----------------KHELKMPLHWRMPRLEARS  1330
             E+SF    GE  LE AR FS K L                 +H L +PLHWR+ RLEAR 
Sbjct  200   EASFPIRVGEVTLEQARVFSTKILEKKVDEGINDEKLLAWIQHSLALPLHWRIQRLEARW  259

Query  1329  FIESYDKGKTTSNNAILLELAKLDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVV  1150
             F+++Y   K    N ++ EL K+DF+I+Q   LE+++ VSRWW  S +AE+L F RDR+V
Sbjct  260   FLDAYAARKDM--NPLIFELGKIDFHIIQETQLEEVQEVSRWWTNSNLAEKLPFVRDRIV  317

Query  1149  ENFLWTIGLTPNPKYVNCRIMGAKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTK  970
             E + W +GL    +Y   R M A + +F+  +DD+YD+YGTLDELQLFTD I +W D+  
Sbjct  318   ECYFWALGLFEPHEYGYQRKMAAIIITFVTIIDDVYDVYGTLDELQLFTDAIRKW-DLES  376

Query  969   VEHLPDYMRFCYLALNNFVNEIAYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGY  790
             +  LP YM+ CYLAL  + +E+AYD+LK+ G   + +L++ W  L + + QEAKWY +GY
Sbjct  377   ISTLPYYMQVCYLALYTYASELAYDILKDQGFNSISYLQRSWLSLVEGFFQEAKWYYAGY  436

Query  789   TPTFEEYIENAWITISCPLILAHVFFYVNNLAEDAAVLDCLTDYPEiirlssiilrLAND  610
             TPT  EY+ENA ++IS P I++ V+F + N + +  V++ +  Y  ++ LS +ILRLA+D
Sbjct  437   TPTLAEYLENAKVSISSPTIISQVYFTLPN-SNEGTVVENVYGYHNMLYLSGMILRLADD  495

Query  609   KGTSPFEMKRGDVPKAIQCYMDEAKVSANEARDFIDLEMNELWKKMNKVGIEGGSPFSGT  430
              GT+ FE+KRGDV KAIQCYM +   +  E ++ +   + E WK+MN    +   P S  
Sbjct  496   LGTTQFELKRGDVQKAIQCYMKDNNATEKEGQEHVKYLLREAWKEMNTAMADPDCPLSED  555

Query  429   FIEVAMNIARMAQCMYQHGDGHGINNFETQTRIQTLLFE  313
              ++ A N+ R +Q +Y  GDGHG+ + E   ++  L+FE
Sbjct  556   LVDAAANLGRASQFIYLEGDGHGVQHSEIHNQMGGLIFE  594



>ref|XP_010429386.1| PREDICTED: tricyclene synthase, chloroplastic-like [Camelina 
sativa]
Length=593

 Score =   437 bits (1123),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 244/559 (44%), Positives = 340/559 (61%), Gaps = 38/559 (7%)
 Frame = -3

Query  1917  TTTTTRRSANYGPPTWDYSYIQSLNTTHYAAEGFVMRRDELKERVKDMLKNEEMREVEKM  1738
             +T   RRSANY P  WD+ +I S+    YA    V  RD LKE+V+ M  +E+   + ++
Sbjct  42    STIVRRRSANYQPSLWDHHHIISVENG-YANNKNVRERDLLKEKVRKMFDDEKKTYLYQL  100

Query  1737  EMIDELKRLGCSYHFEEEIMEALMDIymkkkkssnnyKATEEKDLYATALEFRVLRQNGF  1558
             E ID+L +LG SYHFE EI   L+           +     E DL+ATALEFR+ RQ GF
Sbjct  101   EFIDDLHKLGVSYHFEAEIKNFLIS------SYQKDRINIRECDLHATALEFRLFRQRGF  154

Query  1557  NISQDVFDGFMDGKRCGFNASLSEDTKGLLNLYESSFLSMEGETNLE-LARDFSAKHLK-  1384
             N+S+DVFD FM+   CG     S+D  G ++LYE+S+LS + +T L+ L R F+ + L+ 
Sbjct  155   NVSEDVFDVFMEN--CGKYIYDSDDINGFISLYEASYLSTKSDTKLQILIRPFATQQLRD  212

Query  1383  --------------------HELKMPLHWRMPRLEARSFIESYDKGKTTSNNAILLELAK  1264
                                   L MP HWRM RL  R +I+ Y  GK  + N +L+ELAK
Sbjct  213   FVDTHSNEDFGSCNVGEMVVQALDMPYHWRMRRLATRWYIDVY--GKRHNKNPVLVELAK  270

Query  1263  LDFNIVQAVHLEDLKSVSRWWKKSYIAERLTFARDRVVENFLWTIGLTPNPKYVNCRIMG  1084
             +DFNIVQA+H E+LK VS WWK++ + ++L FARDR+VEN+ WTIG    P+Y   R + 
Sbjct  271   IDFNIVQAIHQEELKYVSSWWKETGLGKQLHFARDRIVENYFWTIGQIQEPQYGYVRRIM  330

Query  1083  AKLYSFICAVDDIYDIYGTLDELQLFTDTIERWDDVTKVEHLPDYMRFCYLALNNFVNEI  904
              K+ S +  +DDIYDIYGTL+ELQLFT   E W D+  ++ LP+YMR C+  + N VN I
Sbjct  331   TKINSLLTTIDDIYDIYGTLEELQLFTVAFENW-DINCLDELPEYMRLCFCVVYNEVNSI  389

Query  903   AYDMLKEHGVFILHHLRKMWADLCKAYLQEAKWYASGYTPTFEEYIENAWITISCPLILA  724
               D+L+E  + ++  L+K W D+CKAYL EAKWY  G+ P  EEY++NAWI+IS P I  
Sbjct  390   GCDVLREKNINVIPFLKKSWTDVCKAYLIEAKWYKRGHKPNLEEYMQNAWISISAPTIFL  449

Query  723   HVFFYVNNLAEDAAVLDCLTDYPEiirlssiil-rLANDKGTSPFEMKRGDVPKAIQCYM  547
             H F+ V +      VL+ L+ + + +  SS  + RLAND  TSP E+ RGDV K+IQCYM
Sbjct  450   H-FYCVFSDQLSVQVLETLSKHQQNLVRSSASVFRLANDLVTSPDELARGDVHKSIQCYM  508

Query  546   DEAKVSANEARDFIDLEMNELWKKMNKVGI-EGGSPFSGTFIEVAMNIARMAQCMYQHGD  370
             +E   S  +AR  +   +N+LW +MN   +    S  +  F+E  +N+ARM+ CMYQ+GD
Sbjct  509   NETGASEEKARSHVRQMINDLWDEMNYEKMAHNSSLLNHDFMETVINLARMSLCMYQYGD  568

Query  369   GHG-INNFETQTRIQTLLF  316
             GHG     +   R+ ++LF
Sbjct  569   GHGSPEKAKIVDRVMSILF  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6279370614624