BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25066_g3_i1 len=562 path=[8847:0-84 359:85-144 8141:145-176
9678:177-184 9686:185-187 8184:188-212 487:213-237 9712:238-251
7224:252-266 6580:267-279 554:280-329 604:330-330 4527:331-368
4565:369-404 5623:405-416 4607:417-431 700:432-455 9875:456-458
6233:459-482 751:483-561]

Length=562
                                                                      Score     E

gb|AFO59753.1|  chloroplast cineole synthase                            214   5e-63   
gb|ABP88782.1|  plastid 1,8-cineol synthase precursor                   216   6e-63   Nicotiana suaveolens
gb|AFO59752.1|  chloroplast cineole synthase                            214   7e-63   
gb|AHK23027.1|  leucoplast 1,8-cineole synthase                         213   1e-62   
gb|AEX09186.1|  plastid terpineol synthase                              213   1e-62   
gb|AFO63173.1|  chloroplast cineolsynthase                              213   1e-62   
gb|AFB82540.1|  plastid monoterpene synthase                            213   2e-62   
gb|AFO63172.1|  chloroplast cineolsynthase                              213   2e-62   
ref|XP_006351725.1|  PREDICTED: (-)-alpha-terpineol synthase-like       211   2e-61   
ref|XP_004231365.1|  PREDICTED: terpene synthase 10                     211   2e-61   
emb|CDP15198.1|  unnamed protein product                                211   3e-61   
ref|XP_009773703.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    208   2e-60   
emb|CBI40170.3|  unnamed protein product                                198   2e-60   
ref|XP_009609201.1|  PREDICTED: terpene synthase 10-like                208   2e-60   
ref|XP_010088018.1|  Myrcene synthase                                   209   2e-60   
ref|XP_009773702.1|  PREDICTED: terpene synthase 10-like isoform X1     208   2e-60   
emb|CBI40171.3|  unnamed protein product                                197   3e-58   
ref|XP_002533356.1|  (R)-limonene synthase                              194   4e-58   Ricinus communis
gb|AHI50308.2|  limonene-myrcene synthase                               201   2e-57   
sp|Q93X23.1|MYRS_QUEIL  RecName: Full=Myrcene synthase, chloropla...    200   3e-57   Quercus ilex [holly oak]
gb|EYU18419.1|  hypothetical protein MIMGU_mgv1a0036601mg               199   6e-57   
gb|KDP35323.1|  hypothetical protein JCGZ_09482                         199   1e-56   
ref|XP_002266808.1|  PREDICTED: (-)-alpha-terpineol synthase            199   1e-56   Vitis vinifera
ref|XP_010645642.1|  PREDICTED: (-)-alpha-terpineol synthase-like       197   3e-56   
gb|EYU43517.1|  hypothetical protein MIMGU_mgv1a020175mg                195   9e-56   
ref|XP_010659051.1|  PREDICTED: (-)-alpha-terpineol synthase-like       194   5e-55   
ref|XP_006388686.1|  hypothetical protein POPTR_0121s00230g             184   6e-55   
sp|Q6PWU2.1|ATESY_VITVI  RecName: Full=(-)-alpha-terpineol synthase     192   3e-54   Vitis vinifera
ref|NP_001268216.1|  (-)-alpha-terpineol synthase                       192   3e-54   
ref|XP_010106231.1|  hypothetical protein L484_003390                   184   4e-54   
emb|CAN75756.1|  hypothetical protein VITISV_025496                     191   5e-54   Vitis vinifera
gb|AEQ27769.1|  sesquiterpene synthase                                  191   5e-54   
ref|XP_002533355.1|  (R)-limonene synthase, putative                    191   6e-54   Ricinus communis
ref|XP_002267453.1|  PREDICTED: (-)-alpha-terpineol synthase            191   8e-54   Vitis vinifera
emb|CAN60797.1|  hypothetical protein VITISV_016813                     191   8e-54   Vitis vinifera
ref|XP_010645660.1|  PREDICTED: (-)-alpha-terpineol synthase-like       190   2e-53   
emb|CAN62729.1|  hypothetical protein VITISV_003091                     189   4e-53   Vitis vinifera
gb|ADR74201.1|  (+)-alpha-phellandrene synthase                         189   6e-53   
emb|CAN82665.1|  hypothetical protein VITISV_017009                     189   6e-53   Vitis vinifera
emb|CAN74705.1|  hypothetical protein VITISV_032402                     188   7e-53   Vitis vinifera
ref|XP_007048227.1|  Myrcene synthase, chloroplastic, putative is...    188   9e-53   
emb|CAK55186.1|  pinene synthase                                        188   1e-52   Quercus ilex [holly oak]
ref|XP_007048226.1|  Myrcene synthase, chloroplastic, putative is...    189   1e-52   
gb|KDP35335.1|  hypothetical protein JCGZ_09494                         182   1e-52   
ref|XP_009589999.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    179   2e-52   
ref|XP_010109849.1|  Myrcene synthase                                   184   2e-52   
gb|ADR74206.1|  (E)-beta-ocimene/myrcene synthase                       187   2e-52   
ref|XP_009628527.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    180   2e-52   
gb|ADR74202.1|  terpene synthase                                        187   2e-52   
emb|CAN64943.1|  hypothetical protein VITISV_001721                     187   2e-52   Vitis vinifera
ref|NP_001268167.1|  (+)-alpha-phellandrene synthase                    187   3e-52   
emb|CDP21453.1|  unnamed protein product                                187   3e-52   
ref|XP_006388684.1|  terpene synthase/cyclase family protein            186   4e-52   
gb|AII32477.1|  terpene synthase                                        185   1e-51   
ref|XP_006370878.1|  terpene synthase/cyclase family protein            185   2e-51   
ref|XP_009626311.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    182   2e-51   
ref|XP_009757423.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    185   2e-51   
ref|XP_006370889.1|  hypothetical protein POPTR_0019s014601g            183   3e-51   
ref|XP_011009233.1|  PREDICTED: terpene synthase 10-like                184   3e-51   
gb|KDP35332.1|  hypothetical protein JCGZ_09491                         182   4e-51   
ref|XP_009602964.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    181   7e-51   
ref|XP_009602963.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    181   8e-51   
gb|KDP35322.1|  hypothetical protein JCGZ_09481                         179   1e-50   
ref|XP_009602962.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    181   1e-50   
emb|CCM43927.1|  limonene synthase                                      182   2e-50   
sp|B3TPQ7.1|ATESY_MAGGA  RecName: Full=Alpha-terpineol synthase, ...    181   6e-50   Magnolia grandiflora [southern magnolia]
gb|AID55337.1|  terpene synthase                                        181   6e-50   
ref|XP_009586876.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    181   7e-50   
gb|EYU19469.1|  hypothetical protein MIMGU_mgv1a021922mg                179   9e-50   
gb|ABD77416.1|  limonene synthase                                       180   1e-49   Rosmarinus officinalis
gb|KDP35321.1|  hypothetical protein JCGZ_09480                         179   1e-49   
ref|XP_008460926.1|  PREDICTED: terpene synthase 10-like                179   2e-49   
ref|XP_004150682.1|  PREDICTED: (-)-alpha-terpineol synthase-like       177   3e-49   
ref|XP_009791335.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    179   4e-49   
ref|XP_006344475.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    178   4e-49   
ref|XP_006351844.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    178   5e-49   
gb|KDO45502.1|  hypothetical protein CISIN_1g044462mg                   171   8e-49   
ref|XP_004161807.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-alpha-te...    177   8e-49   
ref|XP_010109851.1|  Myrcene synthase                                   177   8e-49   
ref|XP_002512868.1|  (R)-limonene synthase, putative                    177   9e-49   Ricinus communis
ref|XP_008461030.1|  PREDICTED: terpene synthase 10-like                177   1e-48   
ref|XP_004150684.1|  PREDICTED: myrcene synthase, chloroplastic-like    175   1e-48   
ref|XP_006351729.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    176   2e-48   
ref|XP_004230563.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    176   2e-48   
gb|EYU18417.1|  hypothetical protein MIMGU_mgv1a003023mg                177   2e-48   
ref|XP_004230556.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    176   2e-48   
ref|XP_004150681.1|  PREDICTED: myrcene synthase, chloroplastic-like    176   3e-48   
emb|CDP10957.1|  unnamed protein product                                175   5e-48   
ref|XP_009773708.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    175   5e-48   
gb|EYU18420.1|  hypothetical protein MIMGU_mgv1a0244872mg               167   6e-48   
ref|XP_004165181.1|  PREDICTED: myrcene synthase, chloroplastic-like    175   6e-48   
ref|XP_009791607.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    173   7e-48   
ref|XP_004161822.1|  PREDICTED: (-)-alpha-terpineol synthase-like       175   8e-48   
ref|XP_006357106.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    173   9e-48   
ref|XP_011088140.1|  PREDICTED: terpene synthase 10-like                174   1e-47   
ref|XP_008461028.1|  PREDICTED: terpene synthase 10-like                174   1e-47   
ref|XP_008460931.1|  PREDICTED: terpene synthase 10-like isoform X2     174   1e-47   
ref|XP_008460932.1|  PREDICTED: terpene synthase 10-like isoform X3     174   1e-47   
ref|XP_006371106.1|  hypothetical protein POPTR_0019s03980g             174   2e-47   
ref|XP_006351843.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    174   2e-47   
gb|KDP25062.1|  hypothetical protein JCGZ_22597                         176   4e-47   
ref|XP_011088139.1|  PREDICTED: LOW QUALITY PROTEIN: terpene synt...    173   4e-47   
emb|CCM43928.1|  linalool/myrcene synthase                              172   4e-47   
ref|XP_006495349.1|  PREDICTED: gamma-terpinene synthase, chlorop...    167   5e-47   
dbj|BAH57277.1|  AT3G25820                                              164   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090242.1|  Myrcene synthase                                   172   6e-47   
gb|KDO37419.1|  hypothetical protein CISIN_1g014206mg                   169   7e-47   
dbj|BAD27259.1|  gamma-terpinene synthase                               171   1e-46   Citrus unshiu [satsuma mandarin]
sp|Q8L5K4.1|GTPS_CITLI  RecName: Full=Gamma-terpinene synthase, c...    171   2e-46   Citrus limon [lemon]
ref|XP_006351730.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    171   2e-46   
dbj|BAD27258.1|  gamma-terpinene synthase                               171   2e-46   Citrus unshiu [satsuma mandarin]
ref|XP_011088141.1|  PREDICTED: (-)-alpha-terpineol synthase-like       170   2e-46   
gb|AID55338.1|  terpene synthase                                        171   2e-46   
ref|XP_006487820.1|  PREDICTED: gamma-terpinene synthase, chlorop...    171   3e-46   
ref|XP_006487821.1|  PREDICTED: gamma-terpinene synthase, chlorop...    171   3e-46   
ref|XP_009779942.1|  PREDICTED: (-)-alpha-terpineol synthase-like       169   7e-46   
gb|AAL17636.1|  d-limonene synthase                                     169   8e-46   Agastache rugosa
dbj|BAD91045.1|  monoterpene synthase                                   169   1e-45   Citrus unshiu [satsuma mandarin]
ref|XP_010502465.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    169   1e-45   
ref|XP_010502464.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    169   1e-45   
emb|CCM43929.1|  linalool/myrcene synthase                              169   1e-45   
emb|CDP10953.1|  unnamed protein product                                169   1e-45   
ref|XP_010528838.1|  PREDICTED: tricyclene synthase, chloroplasti...    168   2e-45   
ref|NP_001233809.1|  monoterpene synthase 2                             168   3e-45   
ref|XP_010324138.1|  PREDICTED: monoterpene synthase 2 isoform X1       168   3e-45   
gb|AAK06663.1|  limonene synthase                                       167   4e-45   Perilla frutescens var. frutescens
gb|AAG31435.1|  limonene synthase                                       167   4e-45   Perilla citriodora
gb|AAF65545.1|  limonene synthase                                       167   4e-45   Perilla citriodora
ref|XP_010910675.1|  PREDICTED: terpene synthase 10-like                160   4e-45   
gb|AAG31437.1|  limonene synthase                                       167   5e-45   Perilla frutescens [beefsteak-mint]
ref|XP_009600964.1|  PREDICTED: (-)-alpha-terpineol synthase-like       167   5e-45   
ref|XP_010425235.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    167   5e-45   
gb|AAG31438.1|  limonene synthase                                       167   5e-45   Perilla frutescens [beefsteak-mint]
gb|ABW86881.1|  limonene synthase                                       167   5e-45   Mentha x piperita
gb|KHG23712.1|  Myrcene synthase, chloroplastic                         167   6e-45   
dbj|BAD91046.1|  (E)-beta-ocimene synthase                              167   7e-45   Citrus unshiu [satsuma mandarin]
dbj|BAA08367.1|  limonene cyclase                                       166   8e-45   Perilla frutescens var. acuta
gb|AIE41601.1|  1,8-cineole synthase                                    166   8e-45   
ref|XP_004231363.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    166   9e-45   
ref|XP_010514204.1|  PREDICTED: beta-myrcene/(E)-beta-ocimene syn...    160   1e-44   
ref|XP_006365871.1|  PREDICTED: (-)-alpha-terpineol synthase-like       166   1e-44   
pdb|2ONG|A  Chain A, Crystal Structure Of Of Limonene Synthase Wi...    165   2e-44   
gb|AGN90902.1|  limonene synthase                                       166   2e-44   
gb|AGN90905.1|  limonene synthase                                       165   2e-44   
gb|AGN90903.1|  limonene synthase                                       165   2e-44   
gb|AAM53945.1|AF514288_1  (-)-beta-pinene synthase                      165   2e-44   Citrus limon [lemon]
gb|AAC37366.1|  4S-limonene synthase                                    165   3e-44   Mentha spicata
ref|XP_006365870.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    164   4e-44   
gb|AAD50304.1|AF175323_1  limonene synthase                             164   4e-44   Mentha longifolia
gb|AAM89254.1|AF527416_1  3-carene synthase                             164   4e-44   Salvia stenophylla
gb|AGN90915.1|  limonene synthase                                       164   4e-44   
ref|XP_010514206.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    164   5e-44   
dbj|BAF73933.1|  beta-pinene synthase                                   164   6e-44   Citrus jambhiri [citronelle]
gb|KEH38237.1|  monoterpene synthase                                    164   6e-44   
ref|XP_006365869.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    164   6e-44   
ref|NP_189212.1|  1,8-cineole synthase                                  164   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875284.1|  predicted protein                                  164   6e-44   
gb|ABR15422.1|  limonene synthase                                       164   6e-44   
gb|AGN90908.1|  limonene synthase                                       164   7e-44   
gb|KEH38236.1|  monoterpene synthase                                    164   7e-44   
ref|XP_006467491.1|  PREDICTED: gamma-terpinene synthase, chlorop...    163   7e-44   
ref|XP_006369780.1|  hypothetical protein POPTR_0001s315502g            163   8e-44   
ref|XP_002298717.2|  hypothetical protein POPTR_0001s315502g            163   9e-44   Populus trichocarpa [western balsam poplar]
gb|AAG01140.2|  (+)-4R-limonene synthase                                163   1e-43   Schizonepeta tenuifolia
ref|XP_006467489.1|  PREDICTED: gamma-terpinene synthase, chlorop...    163   1e-43   
gb|ABP01684.1|  pinene synthase                                         163   1e-43   Rosmarinus officinalis
ref|XP_006467490.1|  PREDICTED: gamma-terpinene synthase, chlorop...    163   1e-43   
ref|XP_011015877.1|  PREDICTED: terpene synthase 10-like                163   1e-43   
ref|XP_002325741.2|  hypothetical protein POPTR_0019s01270g             162   2e-43   Populus trichocarpa [western balsam poplar]
gb|AII32476.1|  terpene synthase                                        162   2e-43   
ref|NP_189209.2|  beta-myrcene/(E)-beta-ocimene synthase 2              162   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247894.1|  PREDICTED: terpene synthase 10-like                162   2e-43   
gb|AHY21666.1|  multiproduct monoterpene synthase                       162   3e-43   
gb|AII32470.1|  terpene synthase                                        162   3e-43   
ref|XP_007040297.1|  Myrcene synthase, chloroplastic, putative          162   3e-43   
dbj|BAD27260.1|  beta-pinene synthase                                   162   3e-43   Citrus unshiu [satsuma mandarin]
ref|XP_010315132.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    161   4e-43   
ref|XP_002309854.2|  hypothetical protein POPTR_0007s02920g             162   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006369784.1|  hypothetical protein POPTR_0001s31570g             162   4e-43   
gb|ADX01381.1|  pinene synthase                                         162   4e-43   
gb|AGN90911.1|  limonene synthase                                       161   5e-43   
gb|AAF76186.1|  mercene synthase                                        161   5e-43   Perilla frutescens [beefsteak-mint]
emb|CAN82377.1|  hypothetical protein VITISV_019347                     160   6e-43   Vitis vinifera
gb|AAO85532.1|  monoterpene synthase                                    161   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009791411.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    161   6e-43   
gb|AIE41599.1|  beta-myrcene synthase                                   161   7e-43   
ref|XP_008461031.1|  PREDICTED: terpene synthase 10-like                158   9e-43   
ref|XP_010514205.1|  PREDICTED: beta-myrcene/(E)-beta-ocimene syn...    160   1e-42   
gb|AFQ23190.1|  alpha-pinene synthase                                   160   1e-42   
gb|ACM89961.1|  1,8 cineole synthase 2                                  160   2e-42   Salvia fruticosa
ref|XP_006369785.1|  hypothetical protein POPTR_0001s31580g             159   2e-42   
ref|XP_006484917.1|  PREDICTED: gamma-terpinene synthase, chlorop...    160   2e-42   
ref|XP_011009237.1|  PREDICTED: terpene synthase 10-like                159   2e-42   
gb|AFZ41794.1|  putative cineole synthase                               160   2e-42   
gb|AIU39887.1|  terpene synthase                                        159   3e-42   
ref|XP_006388836.1|  hypothetical protein POPTR_0092s00200g             159   4e-42   
emb|CAN64328.1|  hypothetical protein VITISV_027228                     159   4e-42   Vitis vinifera
gb|AIU39888.1|  terpene synthase                                        159   4e-42   
ref|XP_004233802.1|  PREDICTED: (-)-alpha-terpineol synthase-like       158   5e-42   
gb|AEP82768.1|  terpene synthase                                        158   6e-42   
ref|XP_009593950.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    158   6e-42   
ref|XP_010425234.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    158   6e-42   
ref|XP_009152106.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    158   6e-42   
ref|XP_006292532.1|  hypothetical protein CARUB_v10018762mg             158   7e-42   
emb|CDX76827.1|  BnaC08g34130D                                          157   9e-42   
ref|XP_008460928.1|  PREDICTED: (-)-alpha-terpineol synthase-like...    157   1e-41   
emb|CDY13590.1|  BnaA06g33330D                                          158   1e-41   
gb|ABI20515.1|  cinenol synthase                                        157   1e-41   Rosmarinus officinalis
ref|XP_004171730.1|  PREDICTED: myrcene synthase, chloroplastic-like    150   1e-41   
gb|KHG18659.1|  Myrcene synthase, chloroplastic                         157   2e-41   
ref|XP_010514210.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    157   2e-41   
ref|XP_004150683.1|  PREDICTED: (-)-alpha-terpineol synthase-like       157   2e-41   
ref|XP_011090121.1|  PREDICTED: (+)-epi-alpha-bisabolol synthase-...    156   2e-41   
ref|XP_008460927.1|  PREDICTED: terpene synthase 10-like isoform X1     157   2e-41   
gb|EPS65936.1|  mercene synthase                                        156   3e-41   
ref|XP_011016260.1|  PREDICTED: LOW QUALITY PROTEIN: probable ter...    152   3e-41   
ref|XP_004161823.1|  PREDICTED: (-)-alpha-terpineol synthase-like       157   3e-41   
ref|XP_010425238.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    156   4e-41   
ref|XP_009152110.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    156   4e-41   
ref|NP_001268188.1|  uncharacterized protein LOC100243167               155   6e-41   
emb|CAN65805.1|  hypothetical protein VITISV_042691                     155   6e-41   Vitis vinifera
emb|CDY66920.1|  BnaCnng52840D                                          152   6e-41   
gb|ACI32638.1|  MTS2                                                    155   7e-41   Humulus lupulus [common hop]
emb|CDX83558.1|  BnaC07g22980D                                          155   9e-41   
ref|XP_003526313.2|  PREDICTED: tricyclene synthase EBOS, chlorop...    155   1e-40   
gb|AID51203.1|  gamma-terpinene synthase                                154   1e-40   
sp|A7IZZ1.1|TPS1_CANSA  RecName: Full=(-)-limonene synthase, chlo...    155   1e-40   Cannabis sativa [marijuana]
ref|XP_011003243.1|  PREDICTED: probable terpene synthase 12            154   1e-40   
gb|AGK88255.1|  gamma-terpinene                                         154   2e-40   
ref|XP_008461032.1|  PREDICTED: LOW QUALITY PROTEIN: myrcene synt...    152   2e-40   
gb|AEV93498.1|  gamma-terpinene synthase                                154   2e-40   
ref|XP_010528837.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    154   2e-40   
ref|XP_010528836.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    154   2e-40   
ref|XP_010103875.1|  Myrcene synthase                                   154   2e-40   
ref|XP_004148460.1|  PREDICTED: (-)-alpha-terpineol synthase-like       148   3e-40   
ref|XP_004148473.1|  PREDICTED: gamma-terpinene synthase, chlorop...    147   3e-40   
gb|AID51200.1|  gamma-terpinene synthase                                153   3e-40   
gb|AID51201.1|  gamma-terpinene synthase                                153   3e-40   
gb|AID51195.1|  gamma-terpinene synthase                                153   3e-40   
gb|AEJ91556.1|  alpha-thujene synthase/sabinene synthase                153   4e-40   
gb|AEJ91555.1|  alpha-thujene synthase                                  153   4e-40   
gb|ABH07678.1|  sabinene synthase                                       153   4e-40   Salvia pomifera
gb|AID51204.1|  gamma-terpinene synthase                                153   4e-40   
gb|AID51197.1|  gamma-terpinene synthase                                153   4e-40   
ref|XP_008461029.1|  PREDICTED: terpene synthase 10-like                153   5e-40   
emb|CDX90785.1|  BnaA03g24650D                                          153   5e-40   
gb|AEV93493.1|  gamma-terpinene synthase                                153   5e-40   
ref|XP_010544282.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    153   5e-40   
ref|XP_010544281.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    153   5e-40   
gb|ADQ73632.1|  monoterpene synthase-like protein                       152   6e-40   
gb|AID51199.1|  gamma-terpinene synthase                                152   7e-40   
gb|AGK88252.1|  gamma-terpinene synthase                                152   7e-40   
gb|ADK73617.1|  terpene synthase 5                                      152   7e-40   
gb|AID51194.1|  gamma-terpinene synthase                                152   8e-40   
emb|CBI17967.3|  unnamed protein product                                145   8e-40   
gb|AEV93492.1|  gamma-terpinene synthase                                152   9e-40   
ref|XP_002878731.1|  myrcene/ocimene synthase                           151   1e-39   
gb|AEV93497.1|  gamma-terpinene synthase                                152   1e-39   
gb|AGK88263.1|  gamma-terpinene                                         152   1e-39   
sp|Q5SBP2.1|FES_OCIBA  RecName: Full=(-)-endo-fenchol synthase, c...    152   1e-39   Ocimum basilicum [basil]
gb|AGK88261.1|  gamma-terpinene synthase                                152   1e-39   
emb|CDX83560.1|  BnaC07g23000D                                          151   1e-39   
gb|AGK88254.1|  gamma-terpinene                                         152   1e-39   
pdb|2J5C|A  Chain A, Rational Conversion Of Substrate And Product...    151   1e-39   
gb|AID51202.1|  gamma-terpinene synthase                                151   1e-39   
gb|AGK88262.1|  gamma-terpinene                                         152   2e-39   
ref|XP_010533438.1|  PREDICTED: tricyclene synthase, chloroplasti...    152   2e-39   
gb|AEV93499.1|  gamma-terpinene synthase                                152   2e-39   
gb|AGZ58667.1|  putative monoterpene synthase                           151   2e-39   
ref|XP_002878732.1|  predicted protein                                  151   2e-39   
gb|AEV93495.1|  gamma-terpinene synthase                                151   2e-39   
gb|AID51198.1|  gamma-terpinene synthase                                151   2e-39   
sp|E2E2P0.1|GTPS_ORIVU  RecName: Full=Gamma-terpinene synthase, c...    151   2e-39   
ref|XP_010673967.1|  PREDICTED: tricyclene synthase TPS4, chlorop...    151   2e-39   
pdb|1N1B|A  Chain A, Crystal Structure Of (+)-bornyl Diphosphate ...    151   2e-39   
gb|ABH07677.1|  cineole synthase                                        151   2e-39   Salvia fruticosa
gb|AGK88253.1|  gamma-terpinene synthase                                151   2e-39   
sp|O81192.1|BPPS_SALOF  RecName: Full=(+)-bornyl diphosphate synt...    151   2e-39   Salvia officinalis
gb|AGN72804.1|  alpha fenchol                                           151   3e-39   
ref|XP_004488753.1|  PREDICTED: myrcene synthase, chloroplastic-l...    151   3e-39   
ref|XP_006351728.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    150   3e-39   
gb|ADK73620.1|  terpene synthase 2                                      150   3e-39   
gb|AEV93496.1|  gamma-terpinene synthase                                150   4e-39   
gb|AGN72801.1|  alpha fenchol                                           150   4e-39   
gb|AGN72798.1|  alpha fenchol                                           150   4e-39   
ref|NP_001233805.1|  monoterpene synthase 1                             150   4e-39   
ref|XP_004161808.1|  PREDICTED: (-)-alpha-terpineol synthase-like       148   4e-39   
gb|AEO27879.1|  putative gamma-terpinene synthase                       150   5e-39   
gb|AAL38029.1|AF444798_1  linalool synthase                             150   5e-39   
gb|AAM53946.1|AF514289_1  (+)-limonene synthase 2                       150   6e-39   
ref|XP_006471085.1|  PREDICTED: (R)-limonene synthase 1-like            150   6e-39   
ref|XP_006471091.1|  PREDICTED: (R)-limonene synthase 1-like isof...    150   6e-39   
gb|ACN42009.1|  linalool synthase                                       150   7e-39   
dbj|BAD27257.1|  d-limonene synthase                                    150   7e-39   
gb|AGK88258.1|  gamma-terpinene                                         149   8e-39   
gb|AGT29347.1|  putative gamma-terpinene synthase                       149   9e-39   
ref|XP_011090122.1|  PREDICTED: (+)-epi-alpha-bisabolol synthase-...    149   9e-39   
gb|AHC54050.1|  gamma-terpinene synthase                                149   1e-38   
ref|XP_006848526.1|  hypothetical protein AMTR_s00169p00002580          145   1e-38   
sp|A7IZZ2.1|TPS2_CANSA  RecName: Full=(+)-alpha-pinene synthase, ...    149   1e-38   
sp|O81191.1|SCS_SALOF  RecName: Full=1,8-cineole synthase, chloro...    149   1e-38   
gb|AGT29350.1|  putative gamma-terpinene synthase                       149   1e-38   
gb|KHG20211.1|  Myrcene synthase, chloroplastic                         149   1e-38   
ref|XP_008775412.1|  PREDICTED: terpene synthase 10-like                149   1e-38   
ref|XP_002870136.1|  lyase/ magnesium ion binding protein               149   1e-38   
gb|AFZ41788.1|  putative gamma-terpinene synthase                       149   1e-38   
gb|AGT29345.1|  putative gamma-terpinene synthase                       149   1e-38   
gb|AFZ41787.1|  putative gamma-terpinene synthase                       149   2e-38   
gb|AGS42395.1|  terpene synthase 2                                      149   2e-38   
gb|AFZ41786.1|  putative gamma-terpinene synthase                       149   2e-38   
dbj|BAG74774.1|  limonene synthase                                      149   2e-38   
gb|AFP23130.1|  monoterpene synthases                                   148   2e-38   
ref|NP_179998.1|  terpene synthase 10                                   148   2e-38   
gb|AAG09310.1|AF178535_1  myrcene/ocimene synthase                      148   2e-38   
ref|XP_009356064.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    148   2e-38   
gb|AEV93494.1|  gamma-terpinene synthase                                148   2e-38   
gb|KHG08606.1|  Myrcene synthase, chloroplastic                         148   2e-38   
gb|AGT29346.1|  putative gamma-terpinene synthase                       148   2e-38   
gb|AAN65379.1|  E-beta-ocimene synthase                                 147   3e-38   
ref|NP_567511.3|  tricyclene synthase                                   148   3e-38   
gb|AGB14628.1|  (E)-beta-ocimene synthase                               147   3e-38   
gb|AGT29348.1|  putative gamma-terpinene synthase                       147   4e-38   
ref|XP_008460933.1|  PREDICTED: (-)-alpha-terpineol synthase-like       144   4e-38   
ref|XP_006293874.1|  hypothetical protein CARUB_v10022869mg             147   4e-38   
gb|AIE41600.1|  camphene synthase                                       147   4e-38   
gb|ADK73622.1|  terpene synthase 1                                      147   5e-38   
gb|ABY65110.1|  beta-ocimene synthase                                   147   5e-38   
emb|CDY13589.1|  BnaA06g33340D                                          147   7e-38   
ref|XP_010472425.1|  PREDICTED: tricyclene synthase, chloroplasti...    141   7e-38   
sp|Q8L5K3.1|RLC1_CITLI  RecName: Full=(R)-limonene synthase 1; Al...    147   7e-38   
ref|XP_009152109.1|  PREDICTED: LOW QUALITY PROTEIN: 1,8-cineole ...    146   9e-38   
gb|AGT29349.1|  putative gamma-terpinene synthase                       146   1e-37   
sp|Q5SBP1.1|MYRS_OCIBA  RecName: Full=Beta-myrcene synthase, chlo...    146   1e-37   
ref|XP_006469735.1|  PREDICTED: probable terpene synthase 9-like ...    146   1e-37   
ref|XP_006469736.1|  PREDICTED: probable terpene synthase 9-like ...    146   1e-37   
ref|XP_002515689.1|  (R)-limonene synthase, putative                    146   2e-37   
ref|XP_010645413.1|  PREDICTED: (-)-alpha-terpineol synthase            145   2e-37   
ref|XP_004161809.1|  PREDICTED: (-)-alpha-terpineol synthase-like       139   2e-37   
ref|NP_001267945.1|  isoprene synthase, chloroplastic-like              145   2e-37   
ref|XP_003540856.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    146   3e-37   
ref|XP_006293887.1|  hypothetical protein CARUB_v10022874mg             145   3e-37   
dbj|BAH03282.1|  +limonene synthase                                     145   3e-37   
gb|AEX07424.1|  monoterpene synthase                                    145   3e-37   
gb|AEX07421.1|  monoterpene synthase                                    145   3e-37   
ref|XP_010429386.1|  PREDICTED: tricyclene synthase, chloroplasti...    145   3e-37   
gb|AEX07418.1|  monoterpene synthase                                    145   3e-37   
gb|ABD77417.1|  linalool synthase                                       145   4e-37   
ref|XP_010645643.1|  PREDICTED: (-)-alpha-terpineol synthase-like       136   4e-37   
gb|KDP32200.1|  hypothetical protein JCGZ_14948                         138   4e-37   
dbj|BAM24404.1|  +limonene synthase                                     144   5e-37   
ref|XP_010666655.1|  PREDICTED: tricyclene synthase TPS4, chlorop...    144   6e-37   
ref|XP_010550150.1|  PREDICTED: 1,8-cineole synthase 1, chloropla...    144   7e-37   
gb|ACI32637.1|  MTS1                                                    144   7e-37   
dbj|BAD27256.1|  d-limonene synthase                                    144   8e-37   
emb|CAB10448.1|  limonene cyclase like protein                          144   8e-37   
ref|XP_009356063.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    144   8e-37   
gb|AGS42398.1|  terpene synthase 5                                      144   8e-37   
ref|XP_007132584.1|  hypothetical protein PHAVU_011G107200g             144   9e-37   
ref|NP_193406.3|  terpene synthase 02                                   143   9e-37   
ref|XP_006853509.1|  hypothetical protein AMTR_s00032p00219920          143   1e-36   
gb|KFK22267.1|  hypothetical protein AALP_AAs66747U002400               143   1e-36   
ref|XP_010440109.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    143   1e-36   
sp|P0CJ43.1|OCISB_ARATH  RecName: Full=(E)-beta-ocimene synthase,...    143   2e-36   
gb|AGK88259.1|  alpha-terpineol                                         143   2e-36   
ref|XP_004305993.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    142   2e-36   
sp|Q2XSC5.1|LALIN_LAVAN  RecName: Full=R-linalool synthase; Short...    142   2e-36   
ref|XP_006852964.1|  hypothetical protein AMTR_s00033p00244770          138   2e-36   
ref|XP_010449725.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    142   2e-36   
gb|AGB05611.1|  sesquiterpene synthase 2                                142   3e-36   
ref|XP_006495302.1|  PREDICTED: gamma-terpinene synthase, chlorop...    135   3e-36   
emb|CDY62515.1|  BnaC01g41830D                                          141   3e-36   
ref|XP_011009235.1|  PREDICTED: terpene synthase 10-like                137   3e-36   
gb|AGK88256.1|  alpha-terpineol                                         142   3e-36   
ref|XP_010261300.1|  PREDICTED: terpene synthase 10-like                142   3e-36   
ref|XP_010417168.1|  PREDICTED: tricyclene synthase, chloroplasti...    142   3e-36   
ref|XP_010417167.1|  PREDICTED: tricyclene synthase, chloroplasti...    142   4e-36   
emb|CDO97389.1|  unnamed protein product                                141   4e-36   
gb|AGK88257.1|  alpha-terpineol                                         142   4e-36   
gb|AEX07423.1|  monoterpene synthase                                    142   5e-36   
ref|XP_010434776.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    142   5e-36   
ref|XP_010434777.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    142   5e-36   
ref|XP_010472424.1|  PREDICTED: tricyclene synthase, chloroplasti...    141   6e-36   
ref|XP_010109569.1|  Isoprene synthase                                  141   6e-36   
gb|AEX07420.1|  monoterpene synthase                                    141   7e-36   
ref|XP_010089719.1|  Myrcene synthase                                   141   7e-36   
gb|AGK88251.1|  alpha-terpineol                                         141   7e-36   
ref|XP_002534394.1|  (R)-limonene synthase, putative                    141   8e-36   
gb|AEX07419.1|  monoterpene synthase                                    141   8e-36   
sp|O81193.1|SSS_SALOF  RecName: Full=(+)-sabinene synthase, chlor...    141   9e-36   
sp|Q2XSC6.1|LALIM_LAVAN  RecName: Full=(R)-limonene synthase; Sho...    141   1e-35   
ref|XP_003596036.1|  (R)-limonene synthase                              140   1e-35   
gb|AEX07422.1|  monoterpene synthase                                    141   1e-35   
gb|AGK88260.1|  alpha-terpineol                                         140   1e-35   
gb|AEX07425.1|  monoterpene synthase                                    140   2e-35   
emb|CDY53648.1|  BnaA08g30380D                                          135   2e-35   
gb|AIK19222.1|  monoterpene synthase                                    140   2e-35   
ref|XP_006848528.1|  hypothetical protein AMTR_s00169p00016140          139   2e-35   
gb|AGA96120.1|  terpene synthase 7                                      140   2e-35   
gb|EYU19535.1|  hypothetical protein MIMGU_mgv1a004140mg                139   2e-35   
ref|XP_007043367.1|  3R-linalool synthase                               137   3e-35   
sp|Q9SPN1.1|LLOS5_ARTAN  RecName: Full=R-linalool synthase QH5, c...    139   4e-35   
sp|Q8GUE4.2|GERS_CINTE  RecName: Full=Geraniol synthase, chloropl...    139   4e-35   
ref|XP_011096132.1|  PREDICTED: trans-alpha-bergamotene synthase-...    139   4e-35   
ref|XP_004148471.1|  PREDICTED: (-)-alpha-terpineol synthase-like       139   4e-35   
ref|XP_006370873.1|  hypothetical protein POPTR_0019s01290g             138   6e-35   
gb|ADK73623.1|  terpene synthase 1                                      139   7e-35   
ref|XP_004488751.1|  PREDICTED: myrcene synthase, chloroplastic-l...    138   7e-35   
sp|Q672F7.1|TPS2_LOTJA  RecName: Full=Tricyclene synthase EBOS, c...    139   7e-35   
ref|XP_010109567.1|  Isoprene synthase                                  138   7e-35   
ref|XP_009395678.1|  PREDICTED: (-)-alpha-terpineol synthase-like       138   8e-35   
gb|AFL03421.1|  1,8-cineole synthase                                    138   8e-35   
ref|XP_008460930.1|  PREDICTED: terpene synthase 10-like isoform X1     138   8e-35   
gb|KDP41018.1|  hypothetical protein JCGZ_03550                         138   9e-35   
gb|KCW47069.1|  hypothetical protein EUGRSUZ_K00876                     137   9e-35   
gb|AFP23421.1|  linalool synthase                                       138   9e-35   
gb|AFL03423.1|  1,8-cineole synthase                                    138   9e-35   
ref|XP_004488750.1|  PREDICTED: myrcene synthase, chloroplastic-l...    138   1e-34   
sp|Q94G53.1|QH6_ARTAN  RecName: Full=(-)-beta-pinene synthase,chl...    138   1e-34   
gb|KDP27310.1|  hypothetical protein JCGZ_20298                         138   1e-34   
gb|AGS42397.1|  terpene synthase 4                                      137   1e-34   
emb|CDY54750.1|  BnaAnng13440D                                          136   1e-34   
emb|CDP20226.1|  unnamed protein product                                135   1e-34   
ref|XP_010038638.1|  PREDICTED: isoprene synthase, chloroplastic-...    137   1e-34   
gb|KCW47025.1|  hypothetical protein EUGRSUZ_K00828                     137   1e-34   
ref|XP_006853523.1|  hypothetical protein AMTR_s00032p00224550          137   1e-34   
gb|EYU27851.1|  hypothetical protein MIMGU_mgv1a023119mg                137   1e-34   
ref|XP_004306033.1|  PREDICTED: tricyclene synthase EBOS, chlorop...    137   2e-34   
ref|XP_009396629.1|  PREDICTED: terpene synthase 10-like                137   2e-34   
sp|J7LQ09.1|TPS7_PHYDL  RecName: Full=Trans-alpha-bergamotene syn...    137   2e-34   
ref|XP_010038636.1|  PREDICTED: isoprene synthase, chloroplastic-...    137   2e-34   
ref|XP_010035592.1|  PREDICTED: isoprene synthase, chloroplastic-...    137   2e-34   
ref|XP_009388290.1|  PREDICTED: terpene synthase 10-like                137   2e-34   
ref|XP_009145565.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    137   2e-34   
ref|XP_009117301.1|  PREDICTED: LOW QUALITY PROTEIN: 1,8-cineole ...    136   2e-34   
gb|EYU31378.1|  hypothetical protein MIMGU_mgv1a017722mg                137   2e-34   
ref|XP_006283443.1|  hypothetical protein CARUB_v10004490mg             137   2e-34   
sp|Q9SPN0.1|LLOS1_ARTAN  RecName: Full=R-linalool synthase QH1, c...    137   2e-34   
gb|KDO47730.1|  hypothetical protein CISIN_1g045043mg                   136   2e-34   
gb|ACN42011.1|  linalool synthase                                       137   3e-34   
ref|XP_007010143.1|  3R-linalool synthase, putative isoform 1           136   3e-34   
ref|XP_009108267.1|  PREDICTED: tricyclene synthase, chloroplasti...    136   3e-34   
ref|XP_002515704.1|  1,8-cineole synthase, chloroplast precursor,...    133   3e-34   
ref|XP_010417166.1|  PREDICTED: tricyclene synthase, chloroplasti...    136   3e-34   
ref|XP_009108266.1|  PREDICTED: tricyclene synthase, chloroplasti...    136   4e-34   
gb|AEJ91554.1|  trans-ocimene synthase                                  136   4e-34   
gb|EYU27853.1|  hypothetical protein MIMGU_mgv1a019544mg                136   4e-34   
ref|XP_010440107.1|  PREDICTED: tricyclene synthase, chloroplasti...    135   6e-34   
emb|CDX83208.1|  BnaA03g22980D                                          136   6e-34   
ref|XP_009133984.1|  PREDICTED: tricyclene synthase, chloroplasti...    135   7e-34   
gb|ACN42013.2|  linalool synthase                                       135   9e-34   
ref|XP_006495313.1|  PREDICTED: (R)-limonene synthase 1-like            134   1e-33   
ref|XP_003628406.1|  (-)-a-terpineol synthase                           132   1e-33   
gb|AHY39266.1|  linalool synthase                                       135   1e-33   
emb|CDP11842.1|  unnamed protein product                                135   2e-33   
ref|XP_006494717.1|  PREDICTED: (R)-limonene synthase 1-like            132   2e-33   
gb|AAX16075.1|  linalool synthase                                       134   2e-33   
emb|CAB10449.1|  limonene cyclase like protein                          137   2e-33   
ref|XP_010038637.1|  PREDICTED: isoprene synthase, chloroplastic-...    134   2e-33   
gb|KDP32194.1|  hypothetical protein JCGZ_14942                         132   3e-33   
gb|AGA96119.1|  terpene synthase 6                                      134   3e-33   
gb|ADK73614.1|  terpene synthase 7                                      134   3e-33   
emb|CDY21487.1|  BnaC03g27100D                                          134   3e-33   
dbj|BAM29049.1|  geraniol synthase                                      134   4e-33   
gb|AGK88250.1|  alpha-terpineol synthase                                134   4e-33   
gb|EYU27857.1|  hypothetical protein MIMGU_mgv1a020580mg                133   4e-33   
gb|KCW76483.1|  hypothetical protein EUGRSUZ_D00870                     132   4e-33   
gb|AAY88965.1|  geraniol synthase                                       134   5e-33   
ref|XP_002530771.1|  (R)-limonene synthase, putative                    131   5e-33   
gb|ABB30218.1|  geraniol synthase                                       134   5e-33   
ref|XP_010052464.1|  PREDICTED: alpha-farnesene synthase-like           132   5e-33   
gb|KCW76482.1|  hypothetical protein EUGRSUZ_D00870                     132   5e-33   
gb|AGS42396.1|  terpene synthase 3                                      133   6e-33   
gb|AGU13712.1|  9-epi-caryophyllene synthase                            132   6e-33   
ref|XP_009411232.1|  PREDICTED: (-)-alpha-terpineol synthase-like       132   7e-33   
ref|XP_007132583.1|  hypothetical protein PHAVU_011G107100g             129   9e-33   
sp|Q8H2B4.1|LLOS_MENAQ  RecName: Full=R-linalool synthase, chloro...    133   9e-33   
gb|AFI47927.1|  terpene synthase 2                                      132   1e-32   
gb|KCW76471.1|  hypothetical protein EUGRSUZ_D00864                     132   1e-32   
ref|XP_010035623.1|  PREDICTED: isoprene synthase, chloroplastic-...    132   1e-32   
gb|ACN42012.1|  geraniol synthase                                       132   1e-32   
ref|XP_010054446.1|  PREDICTED: alpha-farnesene synthase-like           132   1e-32   
dbj|BAF02832.1|  monoterpene synthase                                   132   1e-32   
ref|XP_002515692.1|  (R)-limonene synthase, putative                    132   1e-32   
gb|ACN42010.1|  geraniol synthase                                       132   1e-32   
ref|XP_006283393.1|  hypothetical protein CARUB_v10004436mg             132   2e-32   
dbj|BAF02831.1|  monoterpene synthase                                   132   2e-32   
sp|Q5SBP0.1|TPSD_OCIBA  RecName: Full=Terpinolene synthase, chlor...    132   2e-32   
emb|CDO99695.1|  unnamed protein product                                132   2e-32   
gb|AET02882.2|  monoterpene synthase                                    132   2e-32   
gb|EYU27849.1|  hypothetical protein MIMGU_mgv1a020487mg                131   2e-32   
ref|XP_010054439.1|  PREDICTED: alpha-farnesene synthase-like           131   2e-32   
gb|KCW76468.1|  hypothetical protein EUGRSUZ_D00861                     130   2e-32   
ref|XP_010550139.1|  PREDICTED: tricyclene synthase, chloroplasti...    132   2e-32   
gb|KCW76470.1|  hypothetical protein EUGRSUZ_D00863                     131   2e-32   
emb|CDO99694.1|  unnamed protein product                                131   2e-32   
ref|XP_010054440.1|  PREDICTED: alpha-farnesene synthase-like           131   2e-32   
ref|XP_010038610.1|  PREDICTED: probable terpene synthase 12            130   3e-32   
gb|KCW47024.1|  hypothetical protein EUGRSUZ_K00827                     130   3e-32   
gb|AFI47928.1|  terpene synthase 3                                      131   3e-32   
gb|KDO36279.1|  hypothetical protein CISIN_1g038218mg                   127   3e-32   



>gb|AFO59753.1| chloroplast cineole synthase, partial [Nicotiana mutabilis]
Length=524

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  349  SYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  405

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  406  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  465

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+++AMN+ARMAQCMYQHGDGHG   +N ETQ  I  LLFE
Sbjct  466  LNEAHDIAAHPFPKMFVKSAMNLARMAQCMYQHGDGHG--GQNSETQNRIMALLFE  519



>gb|ABP88782.1| plastid 1,8-cineol synthase precursor [Nicotiana suaveolens]
Length=610

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F V   NP      LH L +YH
Sbjct  433  AYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLV--ANPVN-KEVLHYLENYH  489

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  490  DIIRWSALILRLANDLGTSSEELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  549

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F++ AMN+ARMAQCMYQHGDGHG    N ET  HI  LLFE
Sbjct  550  LNEAHNVAAHPFPKMFVKCAMNLARMAQCMYQHGDGHGHGDLNSETTNHIMALLFE  605



>gb|AFO59752.1| chloroplast cineole synthase, partial [Nicotiana longiflora]
Length=524

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  349  SYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  405

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  406  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  465

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+++AMN+ARMAQCMYQHGDGHG   +N ETQ  I  LLFE
Sbjct  466  LNEAHNIAAHPFPKMFVKSAMNLARMAQCMYQHGDGHG--GQNSETQNSIMALLFE  519



>gb|AHK23027.1| leucoplast 1,8-cineole synthase, partial [Nicotiana noctiflora]
Length=524

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  349  SYLIEAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  405

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  406  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  465

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+++AMN+ARMAQCMYQHGDGHG   +N ETQ  I  LLFE
Sbjct  466  LNEAHDVAAHPFPKMFVKSAMNLARMAQCMYQHGDGHG--GQNSETQNRIMALLFE  519



>gb|AEX09186.1| plastid terpineol synthase [Nicotiana langsdorffii]
Length=522

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  347  SYLIEAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  403

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  404  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  463

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+++AMN+ARMAQCMYQHGDGHG   +N ETQ  I  LLFE
Sbjct  464  LNEAHNVAAHPFPKMFVKSAMNLARMAQCMYQHGDGHG--GQNSETQNRIMALLFE  517



>gb|AFO63173.1| chloroplast cineolsynthase, partial [Nicotiana bonariensis]
Length=524

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y PT EEY +NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  349  SYLREAKWYFSKYIPTMEEYTDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  405

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  406  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  465

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F++ AMN+ARMAQCMYQHGDGHG   +N ETQ  I  LLFE
Sbjct  466  LNEAHNIAAHPFPKMFVKTAMNLARMAQCMYQHGDGHG--GQNSETQNRIMALLFE  519



>gb|AFB82540.1| plastid monoterpene synthase [Nicotiana alata]
Length=543

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  368  SYLIEAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  424

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  425  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  484

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+++AMN+ARMAQCMYQHGDGHG   +N ETQ  I  LLFE
Sbjct  485  LNEAHNVAAHPFPKMFVKSAMNLARMAQCMYQHGDGHG--GQNSETQNRIMALLFE  538



>gb|AFO63172.1| chloroplast cineolsynthase, partial [Nicotiana forgetiana]
Length=524

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  349  SYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLRNYH  405

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  EAR  I L ++E WKK
Sbjct  406  DIIRWSALILRLANDLGTSSDELKRGDVPKSIQCYMNEKKVSEEEARQHIRLLISETWKK  465

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+++AMN+ARMAQCMYQHGDGHG   +N ETQ  I  L+FE
Sbjct  466  LNEAHNIAAHPFPKMFVKSAMNLARMAQCMYQHGDGHG--GQNSETQNSIMALVFE  519



>ref|XP_006351725.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum tuberosum]
Length=592

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 127/176 (72%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y P+ EEYI+NAWISIS P+ILVH +F V   NP    A  +   +YH
Sbjct  394  SYLREAKWYHSQYIPSMEEYIDNAWISISAPVILVHAYFLV--ANPVNKEALHYLENNYH  451

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            EIIR S++ILRLAND GTS  E+KRGDVPK+IQCYM ET+AS  EAR +I + +++ WKK
Sbjct  452  EIIRCSALILRLANDLGTSSDELKRGDVPKSIQCYMNETQASEEEARQYIRVIISQTWKK  511

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+  AMN+ARMAQCMYQHGDGHG N  N  T+ HI  LLFE
Sbjct  512  LNEAHDLAAHPFPKIFVTCAMNLARMAQCMYQHGDGHGGN--NSTTKNHIMALLFE  565



>ref|XP_004231365.1| PREDICTED: terpene synthase 10 [Solanum lycopersicum]
 gb|AEM05857.1| cineol synthase [Solanum lycopersicum]
Length=597

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y P+ EEY++NAWISIS P+ILVH +F V   NP    A  +   +YH
Sbjct  399  SYLREAKWYHSQYIPSMEEYMDNAWISISAPVILVHAYFLV--ANPVNKEALHYLENNYH  456

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM ET+AS  EAR +I L +++ WKK
Sbjct  457  DIIRCSALILRLANDLGTSSDELKRGDVPKSIQCYMNETQASEEEARQYIRLLISQTWKK  516

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+  AMN+ARMAQCMYQHGDGHG N  N  T+ HI  LLFE
Sbjct  517  LNEAHWLAADPFPKIFVTCAMNLARMAQCMYQHGDGHGGN--NSTTKNHIMALLFE  570



>emb|CDP15198.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEAKWY SGY PT +EY++NAWISIS P+ILVH +F+V++    E   AL CL  YH
Sbjct  424  AYLQEAKWYHSGYVPTLQEYLDNAWISISAPVILVHAYFFVSSPITNE---ALECLDRYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR S+MILRLA+D GTS  E++RGDVPK+IQCYM E+ AS  EAR      + E WK+
Sbjct  481  NIIRCSAMILRLADDLGTSTDELQRGDVPKSIQCYMNESGASEEEAREHTRFLIGEAWKQ  540

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK R+   SPFS+TFI  AMN+ RMAQCMYQ+GDGHG  S N +T+  I+ LL +
Sbjct  541  MNKERVAD-SPFSQTFIGMAMNLGRMAQCMYQYGDGHG--SSNSQTKDRIRALLLD  593



>ref|XP_009773703.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Nicotiana 
sylvestris]
Length=547

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  363  SYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLKNYH  419

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K    +AR  I L ++E WKK
Sbjct  420  DIIRWSALILRLANDLGTSSEELKRGDVPKSIQCYMNEKKVCEEDARQHIKLLISETWKK  479

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+ +AMN+ARMAQCMYQHGDGHG   +N ET+  I  LLFE
Sbjct  480  LNEAHNVAAHPFPKMFVTSAMNLARMAQCMYQHGDGHG--GQNSETKNRIIALLFE  533



>emb|CBI40170.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY + YTPT +EY+ NAWISIS P ILVH FF+V N    +   AL C+  Y 
Sbjct  27   SYLLEAKWYHARYTPTLQEYLSNAWISISAPTILVHAFFFVTNPITED---ALECVEQYC  83

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR  I   + E WKK
Sbjct  84   NIIRWSSIILRLSDDLGTSSDELKRGDVPKSIQCYMHETGASEEDAREHIKCLIGETWKK  143

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   SPFS+TFI  A+N+ARMAQCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  144  MNEDRVME-SPFSQTFIGIAINLARMAQCMYQYGDGHGVQDR--ETKDRVLSLLIE  196



>ref|XP_009609201.1| PREDICTED: terpene synthase 10-like [Nicotiana tomentosiformis]
Length=567

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 127/177 (72%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNN-VNPAEYSAALHCLTDY  385
            +YL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F + N VN  +    LH L +Y
Sbjct  392  SYLREAKWYFSQYIPTMEEYMDNAWISISAPVILVHAYFLIANPVNKED----LHYLKNY  447

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            H+IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K S  +A   I L ++E WK
Sbjct  448  HDIIRWSALILRLANDLGTSSEELKRGDVPKSIQCYMNEKKVSEEDAHQHIRLLISETWK  507

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            K+N+       PF + FI +AMN+ARMAQCMYQHGDGHG    N ET+ HI  LLFE
Sbjct  508  KLNEAHNVAAHPFPKMFIWSAMNLARMAQCMYQHGDGHG--GHNSETKNHIMALLFE  562



>ref|XP_010088018.1| Myrcene synthase [Morus notabilis]
 gb|EXB31237.1| Myrcene synthase [Morus notabilis]
Length=614

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEAKWY SGYTPT +EYIENAWISIS P+ILVH +F+V N    E    L CL +Y 
Sbjct  440  SYLQEAKWYYSGYTPTLQEYIENAWISISAPVILVHAYFFVTNPITKE---GLACLEEYP  496

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS++LRLA+D GTS  E+KRGDVPK+IQCYM E   S +EAR  I   ++E WK+
Sbjct  497  SIIRQSSILLRLADDLGTSSDEIKRGDVPKSIQCYMHEAGVSEDEARQHIKWLISETWKQ  556

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MN  RI   SPFS TF E A N+ARMAQCMYQHGDGHGI  +  ET+  + +LL
Sbjct  557  MNADRIAD-SPFSETFTEIATNLARMAQCMYQHGDGHGIQDR--ETKDRVLSLL  607



>ref|XP_009773702.1| PREDICTED: terpene synthase 10-like isoform X1 [Nicotiana sylvestris]
Length=568

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY S Y PT EEY++NAWISIS P+ILVH +F +   NP     ALH L +YH
Sbjct  384  SYLREAKWYFSKYIPTMEEYMDNAWISISAPVILVHAYFLI--ANPVN-KEALHYLKNYH  440

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++ILRLAND GTS  E+KRGDVPK+IQCYM E K    +AR  I L ++E WKK
Sbjct  441  DIIRWSALILRLANDLGTSSEELKRGDVPKSIQCYMNEKKVCEEDARQHIKLLISETWKK  500

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+       PF + F+ +AMN+ARMAQCMYQHGDGHG   +N ET+  I  LLFE
Sbjct  501  LNEAHNVAAHPFPKMFVTSAMNLARMAQCMYQHGDGHG--GQNSETKNRIIALLFE  554



>emb|CBI40171.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY + YTPT +EY+ NAWISIS P+ILVH FF+V N    +   AL CL  Y 
Sbjct  173  SYLLEAKWYHARYTPTLKEYLSNAWISISAPVILVHAFFFVTNPITED---ALECLEQYC  229

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRL++D GTS  E+KRGDVPK+IQCYM ET A   +AR  I   + E WKK
Sbjct  230  NIIRWSSIILRLSDDLGTSSDELKRGDVPKSIQCYMHETGACEEDAREHIKCLIGETWKK  289

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   SPFS+TFI  A+N+ARM+QCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  290  MNEDRVME-SPFSQTFIGIAINLARMSQCMYQYGDGHGVQDR--ETKDRVLSLLIE  342



>ref|XP_002533356.1| (R)-limonene synthase [Ricinus communis]
 gb|EEF29029.1| (R)-limonene synthase [Ricinus communis]
Length=257

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWISIS P+ILVH +F   +  PA  + AL  L +Y 
Sbjct  76   SYLVEAKWYYSGYTPTMQEYMDNAWISISAPVILVHAYFLEGS--PAS-NEALKSLKEYP  132

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILR AND GTS  E+KRGD PK+IQCYM ET AS  +AR  I   + E WKK
Sbjct  133  DIIRWSSMILRFANDLGTSSDELKRGDNPKSIQCYMYETGASEAKAREHIQYLIGEAWKK  192

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK R     PFS+TFIE A N+ARMAQC+YQ+GDG+GI  +N ET+  + +LL +
Sbjct  193  INKERGLADFPFSKTFIEVAANLARMAQCVYQYGDGYGI--ENGETKDRVLSLLVK  246



>gb|AHI50308.2| limonene-myrcene synthase [Erythranthe lewisii]
 gb|AHI50309.2| limonene-myrcene synthase [Erythranthe lewisii]
Length=615

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEAKWY+ GYTPT EEYI NAWISIS P++L H +F V   NP + + A+  L +YH
Sbjct  438  AYLQEAKWYSKGYTPTLEEYINNAWISISAPVMLSHEYFLV--ANPID-NEAVQSLYEYH  494

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+R S+M+LRL+ND GTSP EMKRGDVPK++QCYM ET     +A+ +I   + E WKK
Sbjct  495  NIVRCSAMVLRLSNDLGTSPDEMKRGDVPKSVQCYMNETGGDTEDAQTYIRTVIYETWKK  554

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   S F + F+ +A+++ RMAQ MYQHGDGHGI+    E +  I +LLFE
Sbjct  555  MNEERVAADSLFQKDFVRSAVDLGRMAQYMYQHGDGHGIHFP--EMKDRISSLLFE  608



>sp|Q93X23.1|MYRS_QUEIL RecName: Full=Myrcene synthase, chloroplastic; Flags: Precursor 
[Quercus ilex]
 emb|CAC41012.1| putative chloroplast terpene synthase [Quercus ilex]
Length=597

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 123/175 (70%), Gaps = 6/175 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            YL EAKWY++ Y P+ +EYIENAWISI  P ILVH +F+V N    E   AL CL +Y  
Sbjct  422  YLVEAKWYSNKYRPSLQEYIENAWISIGAPTILVHAYFFVTNPITKE---ALDCLEEYPN  478

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            IIR SS+I RLA+D GTS  E+KRGDVPKAIQCYM ET AS   AR +I   ++  WKKM
Sbjct  479  IIRWSSIIARLADDLGTSTDELKRGDVPKAIQCYMNETGASEEGAREYIKYLISATWKKM  538

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            NK R    SPFS  FIE A+N+ARMAQC+YQHGDGHG+   N ET+  I +LL +
Sbjct  539  NKDR-AASSPFSHIFIEIALNLARMAQCLYQHGDGHGLG--NRETKDRILSLLIQ  590



>gb|EYU18419.1| hypothetical protein MIMGU_mgv1a0036601mg, partial [Erythranthe 
guttata]
Length=563

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 127/178 (71%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AY+QEAKWY+ GY PT EEYI NAWISIS P+IL H FF V N    E   A+  L +YH
Sbjct  387  AYMQEAKWYSKGYAPTLEEYINNAWISISAPVILSHAFFLVTNPIKKE---AVRSLYEYH  443

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+RLS+MILRLAND GTSP EMKRGDVPK+I+CYM E+ A   EA+ ++   +NE WK+
Sbjct  444  NIVRLSAMILRLANDLGTSPDEMKRGDVPKSIECYMNESGAGREEAQDYVRCLINETWKE  503

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN ++R+   SP F R F+ +A+++ RMAQ MYQ+GDGHGI     E +  I +LLFE
Sbjct  504  MNEELRVITESPLFERDFVRSAVDLGRMAQYMYQYGDGHGIQFP--EMKDRIISLLFE  559



>gb|KDP35323.1| hypothetical protein JCGZ_09482 [Jatropha curcas]
Length=602

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EYI+NAWISIS P+ILVH +F +      +   AL  L +Y 
Sbjct  420  SYLLEAKWYYSGYTPTLQEYIDNAWISISAPVILVHGYFLLKTPITTD---ALKALNEYP  476

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILRLA+D GTS  E+KRGDVPK+IQCYM ET AS  +AR  I   +++IWKK
Sbjct  477  SIIRWSSMILRLADDLGTSSDELKRGDVPKSIQCYMHETGASEAKAREHIQDLISKIWKK  536

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK R+   S FS+TFI  A+N+ RMAQCMYQHGDGHG N  + ET+  + +LL E
Sbjct  537  MNKERVVD-SLFSKTFIGIAINLGRMAQCMYQHGDGHG-NQADQETKDRVLSLLIE  590



>ref|XP_002266808.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=590

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY + YTPT +EY+ NAWISIS P ILVH FF+V N    +   AL C+  Y 
Sbjct  416  SYLLEAKWYHARYTPTLQEYLSNAWISISAPTILVHAFFFVTNPITED---ALECVEQYC  472

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR  I   + E WKK
Sbjct  473  NIIRWSSIILRLSDDLGTSSDELKRGDVPKSIQCYMHETGASEEDAREHIKCLIGETWKK  532

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   SPFS+TFI  A+N+ARMAQCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  533  MNEDRVME-SPFSQTFIGIAINLARMAQCMYQYGDGHGVQDR--ETKDRVLSLLIE  585



>ref|XP_010645642.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=566

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY + YTPT +EY+ NAWISIS P+ILVH FF+V N    +   AL CL  Y 
Sbjct  392  SYLLEAKWYHARYTPTLKEYLSNAWISISAPVILVHAFFFVTNPITED---ALECLEQYC  448

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRL++D GTS  E+KRGDVPK+IQCYM ET A   +AR  I   + E WKK
Sbjct  449  NIIRWSSIILRLSDDLGTSSDELKRGDVPKSIQCYMHETGACEEDAREHIKCLIGETWKK  508

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   SPFS+TFI  A+N+ARM+QCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  509  MNEDRVME-SPFSQTFIGIAINLARMSQCMYQYGDGHGVQDR--ETKDRVLSLLIE  561



>gb|EYU43517.1| hypothetical protein MIMGU_mgv1a020175mg, partial [Erythranthe 
guttata]
Length=531

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY+ GYTPT EEYI NAWISIS P+IL H FF V N    E   A+  L +YH
Sbjct  355  AYLLEAKWYSKGYTPTLEEYINNAWISISAPVILSHAFFLVTNPINKE---AVRSLYEYH  411

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+R S+MILRLAND GTSP EMKRGDVPK+I+CYM E+     EA  ++   +NE WK+
Sbjct  412  NIVRFSAMILRLANDLGTSPDEMKRGDVPKSIECYMNESGVGREEAEEYVRCLINETWKE  471

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN ++R+   SP F R F+ +A+++ RMAQ MYQHGDGHGI     + +  I +LLFE
Sbjct  472  MNEELRVITDSPLFERDFVRSAVDLGRMAQYMYQHGDGHGIQFP--QMKERIISLLFE  527



>ref|XP_010659051.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=551

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 123/177 (69%), Gaps = 8/177 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGY PT +EYI NAWISIS P++LVH +F+V N    E   AL  L  YH
Sbjct  374  SYLLEAKWYYSGYKPTLQEYISNAWISISGPVLLVHSYFFVANPITEE---ALQSLERYH  430

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II  SSMILRL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR  I   + E WKK
Sbjct  431  NIIHWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHISYLIGETWKK  490

Query  201  MNKVR-IEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+ R +E  SPF  TFI  A N+ARMAQCMYQHGDGHGI     ET+  + +LL E
Sbjct  491  LNEDRAVE--SPFPETFIGIATNLARMAQCMYQHGDGHGIEYG--ETKDRVLSLLVE  543



>ref|XP_006388686.1| hypothetical protein POPTR_0121s00230g, partial [Populus trichocarpa]
 gb|ERP47600.1| hypothetical protein POPTR_0121s00230g, partial [Populus trichocarpa]
Length=184

 Score =   184 bits (466),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWISIS P+ILVH +FYV+N    E   A   + +Y 
Sbjct  13   SYLLEAKWYFSGYTPTLQEYMDNAWISISAPVILVHAYFYVSNPTTEE---ASQFMEEYL  69

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILRLA+D GTS  E+KRGD+ K+IQCYM E + S  +AR  I   +   WKK
Sbjct  70   DIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAEVSEEKAREHIRNLIENTWKK  129

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  + +     S+TFI  A+N+ARMAQCMYQ+GDGHG+   + ET+  +++LL +
Sbjct  130  INDYQFDN-PRISQTFIGIAINLARMAQCMYQYGDGHGVG--HLETKDRVKSLLIK  182



>sp|Q6PWU2.1|ATESY_VITVI RecName: Full=(-)-alpha-terpineol synthase [Vitis vinifera]
 gb|AAS79351.1| (-)-a-terpineol synthase [Vitis vinifera]
Length=590

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 10/178 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S YTP+ +EYI N+WISIS P+ILVH +F V N    E   AL  L  YH
Sbjct  413  SYLLEAKWYYSRYTPSLQEYISNSWISISGPVILVHAYFLVANPITKE---ALQSLERYH  469

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILRL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR      + E WKK
Sbjct  470  NIIRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHTSYLIGETWKK  529

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF  TFI  AMN+ARMAQCMYQHGDGHGI     ET+  + +LL E
Sbjct  530  LNE---DGAVESPFPETFIGIAMNLARMAQCMYQHGDGHGIEYG--ETEDRVLSLLVE  582



>ref|NP_001268216.1| (-)-alpha-terpineol synthase [Vitis vinifera]
 gb|AAS79352.1| (-)-a-terpineol synthase [Vitis vinifera]
Length=590

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 10/178 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S YTP+ +EYI N+WISIS P+ILVH +F V N    E   AL  L  YH
Sbjct  413  SYLLEAKWYYSRYTPSLQEYISNSWISISGPVILVHAYFLVANPITKE---ALQSLERYH  469

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILRL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR      + E WKK
Sbjct  470  NIIRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHTSYLIGETWKK  529

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF  TFI  AMN+ARMAQCMYQHGDGHGI     ET+  + +LL E
Sbjct  530  LNE---DGAVESPFPETFIGIAMNLARMAQCMYQHGDGHGIEYG--ETEDRVLSLLVE  582



>ref|XP_010106231.1| hypothetical protein L484_003390 [Morus notabilis]
 gb|EXC08937.1| hypothetical protein L484_003390 [Morus notabilis]
Length=270

 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 4/161 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EA+WY + + PT +EYIENAW+SIS PLILVH +  V N    E   AL  L +Y 
Sbjct  108  AYLVEARWYYNRHKPTLQEYIENAWVSISAPLILVHAYSLVTNPITEE---ALEFLEEYP  164

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRLAND GTSP EM+RGDV K+IQCYM E   S +EAR  ++  + E WK+
Sbjct  165  NIIRQSSIILRLANDLGTSPHEMERGDVLKSIQCYMHEKGVSEDEARKHVEFLIGETWKQ  224

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINS  79
            MN+ ++    P S++FI  A+N+ARMAQCMYQHGDGHG+ +
Sbjct  225  MNENQVTNL-PLSKSFIIIAINVARMAQCMYQHGDGHGVRA  264



>emb|CAN75756.1| hypothetical protein VITISV_025496 [Vitis vinifera]
Length=557

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S YTP+ +EYI N+WISIS P+ LVH +F V N    E   AL  L  YH
Sbjct  380  SYLLEAKWYYSXYTPSLQEYISNSWISISGPVJLVHAYFLVANPITKE---ALQSLERYH  436

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILRL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR      + E WKK
Sbjct  437  NIIRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHTSYLIGETWKK  496

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF  TFI  AMN+ARMAQCMYQHGDGHGI     ET+  + +LL E
Sbjct  497  LNE---DGAVESPFPETFIGIAMNLARMAQCMYQHGDGHGIEYG--ETEDRVLSLLVE  549



>gb|AEQ27769.1| sesquiterpene synthase [Ricinus communis]
Length=551

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GYTPT +EY++NAWISIS P+ILVH +F   +    E   AL  L +Y 
Sbjct  377  SYLVEAKWYYIGYTPTLQEYMDNAWISISAPVILVHAYFLEGSPITNE---ALKSLKEYP  433

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +II+ SSMILR A+D GTS  E+KRGD PK+IQCY+ ET  S  +AR  I   + E WKK
Sbjct  434  DIIQWSSMILRFADDLGTSSDELKRGDNPKSIQCYIYETGVSELKAREHIQYLIGETWKK  493

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +NK R    SPFS+ FIE A N+ARMAQCMYQHGDGHGI  ++ ET+ H+ +LL
Sbjct  494  INKEREYIDSPFSKIFIEVATNLARMAQCMYQHGDGHGI--EDGETKDHVLSLL  545



>ref|XP_002533355.1| (R)-limonene synthase, putative [Ricinus communis]
 sp|B9T536.1|TPS10_RICCO RecName: Full=Terpene synthase 10; Short=RcSeTPS10 [Ricinus communis]
 gb|EEF29028.1| (R)-limonene synthase, putative [Ricinus communis]
Length=551

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GYTPT +EY++NAWISIS P+ILVH +F   +    E   AL  L +Y 
Sbjct  377  SYLVEAKWYYIGYTPTLQEYMDNAWISISAPVILVHAYFLEGSPITNE---ALKSLKEYP  433

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +II+ SSMILR A+D GTS  E+KRGD PK+IQCY+ ET  S  +AR  I   + E WKK
Sbjct  434  DIIQWSSMILRFADDLGTSSDELKRGDNPKSIQCYIYETGVSELKAREHIQYLIGETWKK  493

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +NK R    SPFS+ FIE A N+ARMAQCMYQHGDGHGI  ++ ET+ H+ +LL
Sbjct  494  INKEREYIDSPFSKIFIEVATNLARMAQCMYQHGDGHGI--EDGETKDHVLSLL  545



>ref|XP_002267453.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=594

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 125/177 (71%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GY P+ +EYI NAWISIS PL LVH +F++ N    E   AL CL  + 
Sbjct  419  SYLVEAKWYHEGYMPSLQEYINNAWISISGPLTLVHAYFFITNPMTEE---ALGCLERFS  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMI RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKK
Sbjct  476  DIIRWSSMIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKK  535

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMY-QHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R    SPFS+TFI  AM+I RMAQCMY  + DG+G+  +  ET+ H++TL  E
Sbjct  536  MNEER-NLNSPFSQTFIGMAMDIPRMAQCMYLYYRDGYGVQDR--ETKDHVKTLFIE  589



>emb|CAN60797.1| hypothetical protein VITISV_016813 [Vitis vinifera]
Length=605

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 125/177 (71%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GY P+ +EYI NAWISIS PL LVH +F++ N    E   AL CL  + 
Sbjct  430  SYLVEAKWYHEGYMPSLQEYINNAWISISGPLTLVHAYFFITNPMTEE---ALGCLERFS  486

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMI RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKK
Sbjct  487  DIIRWSSMIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKK  546

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMY-QHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R    SPFS+TFI  AM+I RMAQCMY  + DG+G+  +  ET+ H++TL  E
Sbjct  547  MNEER-NLNSPFSQTFIGMAMDIPRMAQCMYLYYRDGYGVQDR--ETKDHVKTLFIE  600



>ref|XP_010645660.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=597

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 123/177 (69%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GY P+ +EY+ NAWIS+S P+ILVH +F + N    E   AL C   YH
Sbjct  422  SYLVEAKWYHEGYMPSLQEYMNNAWISMSSPVILVHAYFSITNPVTKE---ALGCFERYH  478

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS+I R ++D GTS  E+KRGD PK+IQCYM ET AS ++AR +I   ++E WKK
Sbjct  479  DIIRWSSIIFRFSDDLGTSSGELKRGDAPKSIQCYMHETGASEDDARKYIGFLIDETWKK  538

Query  201  MNKVRIEGCSPFSRTFIE-AAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R    SPF +TFI  A MN+ARMAQCMYQ+GDG+G+  +  ET+  I TL  E
Sbjct  539  MNEDR-NLNSPFPQTFIGIALMNVARMAQCMYQYGDGYGVQDR--ETKDRIMTLFIE  592



>emb|CAN62729.1| hypothetical protein VITISV_003091 [Vitis vinifera]
Length=606

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 122/178 (69%), Gaps = 10/178 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY SGY PT +EYI NAWIS+S P++LVH +F+V N    E   AL  L  YH
Sbjct  409  SFLLEAKWYYSGYKPTLQEYISNAWISMSGPVVLVHAYFFVTNPITKE---ALQSLERYH  465

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMI RL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR  I   +   WKK
Sbjct  466  NIIRWSSMISRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHISYLIXGTWKK  525

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF  TFI  A N ARMAQCMYQHGDGHGI  ++ ET+  + +LL E
Sbjct  526  LNE---DGAVESPFPETFIRIATNFARMAQCMYQHGDGHGI--EDGETKDRVLSLLIE  578



>gb|ADR74201.1| (+)-alpha-phellandrene synthase [Vitis vinifera]
Length=593

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = -2

Query  555  LQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHEI  376
            L EAKWY  GY P+ +EYI NAWIS+S PL LVH +F++ N    E   AL CL  + +I
Sbjct  421  LVEAKWYHEGYKPSLQEYINNAWISVSGPLTLVHAYFFITNPMTEE---ALGCLERFRDI  477

Query  375  IRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKMN  196
            IR SS I RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKKMN
Sbjct  478  IRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKKMN  537

Query  195  KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            + R    SPFS+TFI  AM+I RMAQC+Y + DG+G+  +  ET+ H++TL  E
Sbjct  538  EER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQDR--ETKDHVKTLFIE  588



>emb|CAN82665.1| hypothetical protein VITISV_017009 [Vitis vinifera]
Length=604

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 122/174 (70%), Gaps = 6/174 (3%)
 Frame = -2

Query  555  LQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHEI  376
            L EAKWY  GY P+ +EYI NAWIS+S PL LVH +F++ N    E   AL CL  + +I
Sbjct  432  LVEAKWYHEGYKPSLQEYINNAWISVSGPLTLVHAYFFITNPMTEE---ALGCLERFRDI  488

Query  375  IRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKMN  196
            IR SS I RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKKMN
Sbjct  489  IRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKKMN  548

Query  195  KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            + R    SPFS+TFI  AM+I RMAQC+Y + DG+G+  +  ET+ H++TL  E
Sbjct  549  EER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQDR--ETKDHVKTLFIE  599



>emb|CAN74705.1| hypothetical protein VITISV_032402 [Vitis vinifera]
Length=576

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 119/178 (67%), Gaps = 10/178 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGY PT +EYI NAWISIS P++L H +F+V N    E   AL  L  YH
Sbjct  399  SYLLEAKWYYSGYXPTLQEYISNAWISISGPVVLXHAYFFVTNPITXE---ALQXLERYH  455

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMI RL++D GTS  E+KRGDVPK+IQCYM ET AS  EAR  I   +   WKK
Sbjct  456  NIIRWSSMIXRLSDDLGTSLDELKRGDVPKSIQCYMXETGASEEEARKHISYLIGXTWKK  515

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF  TFI  A N+ARMAQCMYQHGDG GI     ET+  + +LL E
Sbjct  516  LNE---DGAVESPFPETFIGIATNLARMAQCMYQHGDGXGIEYG--ETKDRVLSLLVE  568



>ref|XP_007048227.1| Myrcene synthase, chloroplastic, putative isoform 2 [Theobroma 
cacao]
 gb|EOX92384.1| Myrcene synthase, chloroplastic, putative isoform 2 [Theobroma 
cacao]
Length=595

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 7/174 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GYTPT +EYI+NAWISIS P+IL H +F  N++        L CL ++ 
Sbjct  415  AYLVEAKWYYGGYTPTLKEYIDNAWISISAPVILSHAYFLTNSIR----KECLECLKEHS  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++  +SMILRL ND  TS  E++RGDVPK+IQCYM ET  S  EAR +I   ++  WK 
Sbjct  471  QVVYCTSMILRLVNDLETSSDELERGDVPKSIQCYMHETGFSKEEARHYIRNLIDATWKM  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MN+ RI   SPFS+TFI+ A+N+ARMAQCMYQ+GDGHGI     ET   + +LL
Sbjct  531  MNENRI-AQSPFSQTFIQIALNLARMAQCMYQYGDGHGIEVN--ETNNRVLSLL  581



>emb|CAK55186.1| pinene synthase [Quercus ilex]
Length=597

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY + YTP+ +EYIENAWISIS P ILVHV+F+V N    E   AL CL +Y 
Sbjct  421  SYLLEAKWYYNKYTPSLQEYIENAWISISAPTILVHVYFFVTNPITKE---ALDCLEEYP  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS ILRLA+D GTS  E+KRGDVPKAIQCYM ET AS  +AR +I   ++  WKK
Sbjct  478  NIIRWSSTILRLADDLGTSTDELKRGDVPKAIQCYMNETGASEEDAREYIKYLISATWKK  537

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   SPFS  FIE A+N+ARMAQCMYQHGDGHG  +   ET+  I +LL +
Sbjct  538  MNEDRV-ASSPFSHIFIEIALNLARMAQCMYQHGDGHGHGNH--ETKDRILSLLIQ  590



>ref|XP_007048226.1| Myrcene synthase, chloroplastic, putative isoform 1 [Theobroma 
cacao]
 gb|EOX92383.1| Myrcene synthase, chloroplastic, putative isoform 1 [Theobroma 
cacao]
Length=633

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 7/174 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GYTPT +EYI+NAWISIS P+IL H +F  N++        L CL ++ 
Sbjct  453  AYLVEAKWYYGGYTPTLKEYIDNAWISISAPVILSHAYFLTNSIR----KECLECLKEHS  508

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++  +SMILRL ND  TS  E++RGDVPK+IQCYM ET  S  EAR +I   ++  WK 
Sbjct  509  QVVYCTSMILRLVNDLETSSDELERGDVPKSIQCYMHETGFSKEEARHYIRNLIDATWKM  568

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MN+ RI   SPFS+TFI+ A+N+ARMAQCMYQ+GDGHGI     ET   + +LL
Sbjct  569  MNENRI-AQSPFSQTFIQIALNLARMAQCMYQYGDGHGIEVN--ETNNRVLSLL  619



>gb|KDP35335.1| hypothetical protein JCGZ_09494 [Jatropha curcas]
Length=333

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 125/176 (71%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L EAKWY SGYTPT +EYI+NAWISIS P++L H +F        +   AL  L +  
Sbjct  155  AHLLEAKWYYSGYTPTLQEYIDNAWISISIPVMLGHCYFLSRTPITTD---ALKALKECP  211

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +II+LS+MI+RLA+D GTS  E KRGDVPK+IQCYM ET  S   AR  I   ++E WKK
Sbjct  212  DIIQLSAMIVRLADDLGTSSDEFKRGDVPKSIQCYMHETGVSEVRAREHIQYLISETWKK  271

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK R+   SPFS TF++ A+N+AR+AQC+Y++GDGHGI  +N ET+  I +LL +
Sbjct  272  INKERVVD-SPFSNTFVDMAINLARIAQCIYEYGDGHGI--QNQETKDRISSLLVQ  324



>ref|XP_009589999.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=218

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEA+WY +GYTPT EEY++NAWIS++ P++LVHVF    N    E   A   L+ Y 
Sbjct  41   SYLQEARWYYNGYTPTLEEYMDNAWISVAVPMVLVHVFPLATNPVIKE---AFESLSKYP  97

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++I R A+D G S  E++RGDVPK+IQCYM E  AS  EAR  I L + E WK 
Sbjct  98   DIIRWSAIIFRFADDLGISSEELRRGDVPKSIQCYMNEKGASEEEAREHIRLRIKETWKL  157

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +        S FS TFI  A+NI R  Q +YQHGDGHGI  +NFE +  I  L FE
Sbjct  158  LINTAQRENSLFSETFIGCAVNIVRTGQIIYQHGDGHGI--QNFEIKNRISKLFFE  211



>ref|XP_010109849.1| Myrcene synthase [Morus notabilis]
 gb|EXC24792.1| Myrcene synthase [Morus notabilis]
Length=404

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPTF+EYI+NAWIS+S P+ILV+V+ +  N    E   AL CL +Y 
Sbjct  227  SYLVEAKWYYSGYTPTFQEYIDNAWISMSVPVILVNVYVFAENPTTKE---ALTCLEEYP  283

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR S ++ RL +D GTS  E+KRGDVPK+IQCYM E   S  +AR  I L + E WKK
Sbjct  284  SIIRHSGILFRLLDDLGTSSDEIKRGDVPKSIQCYMHEAGVSEEKARQHIKLLIRETWKK  343

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+ R+   SPFS+TF E A NI RMAQ MY +GDG+ I  +  ET+  + +LL +
Sbjct  344  INEDRVTD-SPFSKTFTEIATNIVRMAQSMYLYGDGYAIQDR--ETKELVMSLLVD  396



>gb|ADR74206.1| (E)-beta-ocimene/myrcene synthase [Vitis vinifera]
Length=589

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY SGY PT +EYI NAWIS+S P++LVH +F+V N    E   AL  L  YH
Sbjct  413  SFLLEAKWYYSGYKPTLQEYISNAWISMSGPVVLVHAYFFVTNPITKE---ALQSLERYH  469

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMI RL++D GTS  E+KRGDVPK+IQCYM ET AS  +AR  I   +   WKK
Sbjct  470  NIIRWSSMISRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHISYLIEGTWKK  529

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF   FI  A N ARMAQCMYQHGDGHGI  ++ ET+  + +LL E
Sbjct  530  LNE---DGAVESPFPEIFIRIATNFARMAQCMYQHGDGHGI--EDGETKDRVLSLLIE  582



>ref|XP_009628527.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++++EA+WY SGY PT +EY++NAWISI+ P++LVH FF V N  P E   AL   + Y 
Sbjct  87   SFIREARWYYSGYVPTLKEYMDNAWISIAVPMVLVHAFFLVTNPVPKE---ALESSSKYP  143

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR S+ I RLA+D  TS  E+KRGDVPK+IQCYM E  AS  EAR  I L + E W++
Sbjct  144  DLIRCSATIFRLADDLATSSDELKRGDVPKSIQCYMNEKGASEEEAREQIRLCIKETWER  203

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN  + E  S FS TF+E   +IAR A CMY HGDGHGI  +N E +     +LFE
Sbjct  204  MNTAQREN-SLFSETFVEITKSIARTAHCMYLHGDGHGI--QNGEVKNSTSKILFE  256



>gb|ADR74202.1| terpene synthase [Vitis vinifera]
Length=593

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GY P+ +EYI NA ISIS PL LVH +F++ N    E   AL CL  + 
Sbjct  419  SYLVEAKWYHEGYMPSLQEYINNAMISISGPLTLVHAYFFITNPMTEE---ALGCLERFR  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKK
Sbjct  476  DIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKK  535

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R    SPFS+TFI  AM+I RMAQC+Y + DG+G+  +  ET+ H++TL  E
Sbjct  536  MNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQDR--ETKDHVKTLFIE  588



>emb|CAN64943.1| hypothetical protein VITISV_001721 [Vitis vinifera]
Length=593

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GY P+ +EYI NA ISIS PL LVH +F++ N    E   AL CL  + 
Sbjct  419  SYLVEAKWYHEGYMPSLQEYINNAMISISGPLTLVHAYFFITNPMTEE---ALGCLERFR  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKK
Sbjct  476  DIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKK  535

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R    SPFS+TFI  AM+I RMAQC+Y + DG+G+  +  ET+ H++TL  E
Sbjct  536  MNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQDR--ETKDHVKTLFIE  588



>ref|NP_001268167.1| (+)-alpha-phellandrene synthase [Vitis vinifera]
 gb|ADR74203.1| (+)-alpha-pinene synthase [Vitis vinifera]
Length=593

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GY P+ +EYI NA ISIS PL LVH +F++ N    E   AL CL  + 
Sbjct  419  SYLVEAKWYHEGYMPSLQEYINNAMISISGPLTLVHAYFFITNPMTEE---ALGCLERFR  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS I RL++D GTS  E+KRGDVPK+IQCYM ET AS ++AR +I   ++E WKK
Sbjct  476  DIIRWSSTIFRLSDDLGTSSDELKRGDVPKSIQCYMYETSASEDDARKYIGFLIDETWKK  535

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R    SPFS+TFI  AM+I RMAQC+Y + DG+G+  +  ET+ H++TL  E
Sbjct  536  MNEER-NLNSPFSQTFIGMAMDIPRMAQCIYLYRDGYGVQDR--ETKDHVKTLFIE  588



>emb|CDP21453.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 120/175 (69%), Gaps = 5/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL+EAKWY +GYTPT EEY+ENAW+SIS P++L+HV+  V N    E   A+  L D H
Sbjct  434  AYLREAKWYYAGYTPTVEEYLENAWVSISVPVMLMHVYAGVTNPMNKE---AMDVL-DTH  489

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R SS +LRLA+D GTSP EMKRGDVPK +QCYM E   S  E+R  +   + E WKK
Sbjct  490  DIVRWSSYLLRLADDLGTSPGEMKRGDVPKLVQCYMKEAGCSEEESREHVWFLLRETWKK  549

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MNK      SPFS+TF+ AA N  R+A  MYQ+GDGHG+NS N E +  I   LF
Sbjct  550  MNKDSEWAESPFSKTFVTAAKNFGRVALVMYQYGDGHGLNS-NPEAKDRILASLF  603



>ref|XP_006388684.1| terpene synthase/cyclase family protein [Populus trichocarpa]
 gb|ERP47598.1| terpene synthase/cyclase family protein [Populus trichocarpa]
Length=548

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 125/177 (71%), Gaps = 8/177 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWISIS P+ILVH +FYV+N    E S     + +Y 
Sbjct  377  SYLLEAKWYFSGYTPTLQEYMDNAWISISAPVILVHAYFYVSNPTTEEAS---QFMEEYL  433

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILRLA+D GTS  E+KRGD+ K+IQCYM E + S  +AR  I   +   WKK
Sbjct  434  DIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAEVSEEKAREHIKSLIGNTWKK  493

Query  201  MNKVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  +    +P  S+TFI  AMN+ARMAQCMYQ+GDGHG+   + ET+  +++LL +
Sbjct  494  INDYQF--VNPRISQTFIGIAMNLARMAQCMYQYGDGHGVG--HLETKDRVKSLLIK  546



>gb|AII32477.1| terpene synthase [Populus trichocarpa]
Length=589

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWISIS P+ILVH +FYV+N    E S     + +Y 
Sbjct  418  SYLLEAKWYFSGYTPTLQEYMDNAWISISAPVILVHAYFYVSNPTTEEAS---QFMEEYP  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILRLA+D GTS  E+KRGD+ K+IQCYM E   S  +AR  I   +   WKK
Sbjct  475  DIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAGVSEEKAREHIRNLIENTWKK  534

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  + +     S+TFI  AMN+ARMAQCMYQ+GDGHG+   + ET+  +++LL +
Sbjct  535  INDYQFDNPR-ISQTFIGIAMNLARMAQCMYQYGDGHGVG--HLETKDRVKSLLIK  587



>ref|XP_006370878.1| terpene synthase/cyclase family protein [Populus trichocarpa]
 gb|ERP48675.1| terpene synthase/cyclase family protein [Populus trichocarpa]
Length=589

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY+ENAWISIS P+ILVH +FYV+N    E S     + +Y 
Sbjct  418  SYLLEAKWYFSGYTPTLQEYMENAWISISAPVILVHAYFYVSNPTTEEAS---QFMEEYP  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILRLA+D GTS  E+KRGD+ K+IQCYM E   S  +AR  I   +   WKK
Sbjct  475  DIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAGVSEEKAREHIRNLIENTWKK  534

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  + +     S+TFI  A+N+ARMAQCMYQ+GDGHG+   + ET+  +++LL +
Sbjct  535  INDYQFDN-PRISQTFIGIAINLARMAQCMYQYGDGHGVG--HLETKDRVKSLLIK  587



>ref|XP_009626311.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=428

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++++EA+WY SGY PT EEY++NAWISI+ P++LVH FF V N  P E   AL  L+ Y 
Sbjct  261  SFIREARWYYSGYVPTLEEYMDNAWISIAVPMVLVHAFFLVTNPVPKE---ALESLSKYP  317

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR S++I RLA+D  TS  E+KRGDVPK+IQCYM E   S  EAR  I   + E W++
Sbjct  318  DLIRCSAIIFRLADDLATSSDELKRGDVPKSIQCYMNEKGTSEEEAREHIRFCIKETWER  377

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MN  + E  S FS TFIE   NIAR A CMY HGDGHGI  +N E +  I  +L
Sbjct  378  MNTTQREN-SLFSDTFIEITKNIARTAHCMYLHGDGHGI--QNGEVKNSISKIL  428



>ref|XP_009757423.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=616

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 120/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YLQEA+W+ +G+ PT +EY++NAWISIS P+IL+H FF V N    E    L  ++ Y 
Sbjct  438  TYLQEARWFYNGHKPTLQEYMDNAWISISMPMILIHAFFSVTNPITKE---ELESISKYP  494

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I+RLA+D GTSP+E+KRGDVPK+IQCY+ E   S  EAR  I   + E W+ 
Sbjct  495  DIIRWSATIIRLADDLGTSPYELKRGDVPKSIQCYINEKGVSEEEAREHIQFLIKETWEM  554

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+ + E    FS TF+E A NIAR  QCMY HGDGHGI  +N +++  I  +LFE
Sbjct  555  LNRAQRENLL-FSGTFVEVAKNIARTGQCMYLHGDGHGI--QNADSENSISKILFE  607



>ref|XP_006370889.1| hypothetical protein POPTR_0019s014601g, partial [Populus trichocarpa]
 gb|ERP48686.1| hypothetical protein POPTR_0019s014601g, partial [Populus trichocarpa]
Length=513

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 123/177 (69%), Gaps = 8/177 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWISIS P+ILVH +FYV+N    E S     + +Y 
Sbjct  342  SYLLEAKWYFSGYTPTLQEYMDNAWISISAPVILVHAYFYVSNPTTEEAS---QFMDEYP  398

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILRLA+D GTS  E+KRGD+ K+IQCYM E   S  +AR  I   +   WKK
Sbjct  399  DIIRWSSMILRLADDLGTSSDELKRGDISKSIQCYMHEAGVSEEKARDHIRNLIGNTWKK  458

Query  201  MNKVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  +    +P  S+TFI  AMN+ RMAQCMYQ+GDGHG+   + ET+  +++LL +
Sbjct  459  INDYQF--ANPHISQTFIGIAMNLTRMAQCMYQYGDGHGVG--HLETKDRVKSLLIK  511



>ref|XP_011009233.1| PREDICTED: terpene synthase 10-like [Populus euphratica]
Length=589

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 123/177 (69%), Gaps = 8/177 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWIS+S P+ILVH +FYV+N    E S     + +Y 
Sbjct  418  SYLLEAKWYFSGYTPTLQEYMDNAWISVSAPVILVHTYFYVSNPTTEEAS---QFMEEYR  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMI RLA+D GTS  E+KRGD+ K+IQCYM E   S  +AR  I   +  IWKK
Sbjct  475  DIIRWSSMIFRLADDLGTSTDELKRGDISKSIQCYMHEAGVSEEKARDHIRNLIGNIWKK  534

Query  201  MNKVRIEGCSPF-SRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  +    +P  S+TFI  AMN+ARMAQCMYQ+GDGHG+   + ET+  +++L  +
Sbjct  535  INDYQF--VNPLISQTFIGIAMNLARMAQCMYQYGDGHGVG--HLETKDKVKSLFIK  587



>gb|KDP35332.1| hypothetical protein JCGZ_09491 [Jatropha curcas]
Length=511

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SGYTPT +EY++NAWISI   ++L+H +F   +  P   + AL  L +YH
Sbjct  339  AYLLEAKWYNSGYTPTLQEYLDNAWISIGNSVVLIHGYFV--SKTPIT-NDALKALNEYH  395

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR S +I RL +D GTS  E+KRGDVPK+IQCYM ET AS   AR  I    +E+WK 
Sbjct  396  NIIRCSCLIFRLTDDLGTSSDELKRGDVPKSIQCYMHETGASEARAREHIRYLTSEMWKT  455

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK  +   SPFS+TFI  A+N ARMA CMYQHGDGHGI  +  ET   + +LL +
Sbjct  456  MNKELLVD-SPFSKTFIHIAINQARMAHCMYQHGDGHGIEDR--ETNGRVLSLLVQ  508



>ref|XP_009602964.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X3 [Nicotiana tomentosiformis]
Length=457

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++++EA+WY SGY PT EEY++NAWISI+ P++LVH FF V N  P E   AL  L+ Y 
Sbjct  263  SFIREARWYYSGYVPTLEEYMDNAWISIAVPMVLVHAFFLVTNPVPKE---ALESLSKYP  319

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR S+ I RLA+D  TS  E+KRGDVPK+IQCYM E   S  EAR  I   + E W++
Sbjct  320  DLIRCSATIFRLADDLATSSDELKRGDVPKSIQCYMNEKGTSEEEAREHIRFCIKETWER  379

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN  + E  S FS TF+E   NIAR A CMY HGDGHGI  +N E +  I  +L 
Sbjct  380  MNTTQREN-SLFSDTFVEITKNIARTAHCMYLHGDGHGI--QNGEVKNSISKILL  431



>ref|XP_009602963.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=492

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++++EA+WY SGY PT EEY++NAWISI+ P++LVH FF V N  P E   AL  L+ Y 
Sbjct  298  SFIREARWYYSGYVPTLEEYMDNAWISIAVPMVLVHAFFLVTNPVPKE---ALESLSKYP  354

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR S+ I RLA+D  TS  E+KRGDVPK+IQCYM E   S  EAR  I   + E W++
Sbjct  355  DLIRCSATIFRLADDLATSSDELKRGDVPKSIQCYMNEKGTSEEEAREHIRFCIKETWER  414

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN  + E  S FS TF+E   NIAR A CMY HGDGHGI  +N E +  I  +L 
Sbjct  415  MNTTQREN-SLFSDTFVEITKNIARTAHCMYLHGDGHGI--QNGEVKNSISKILL  466



>gb|KDP35322.1| hypothetical protein JCGZ_09481 [Jatropha curcas]
Length=422

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 120/174 (69%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY +GYTPT +EYI+NAWISI+ P+ L H +F   +    +   AL  L +Y 
Sbjct  240  SYLLEAKWYYNGYTPTLQEYIDNAWISIAGPVTLAHGYFLSKSPITTD---ALKALNEYP  296

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMI RLAND GTS  E+KRGDV K+IQ Y+ ET AS   AR  I   ++EIWKK
Sbjct  297  NIIRWSSMIFRLANDLGTSSDELKRGDVLKSIQYYIHETGASEARAREHIQDLISEIWKK  356

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MNK R+   S FS+TFI  A+N ARMAQCMYQHGDGHG N  + ET+  + +LL
Sbjct  357  MNKERVVD-SLFSKTFIGIAINPARMAQCMYQHGDGHG-NKADQETKDRVFSLL  408



>ref|XP_009602962.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=514

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++++EA+WY SGY PT EEY++NAWISI+ P++LVH FF V N  P E   AL  L+ Y 
Sbjct  320  SFIREARWYYSGYVPTLEEYMDNAWISIAVPMVLVHAFFLVTNPVPKE---ALESLSKYP  376

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR S+ I RLA+D  TS  E+KRGDVPK+IQCYM E   S  EAR  I   + E W++
Sbjct  377  DLIRCSATIFRLADDLATSSDELKRGDVPKSIQCYMNEKGTSEEEAREHIRFCIKETWER  436

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN  + E  S FS TF+E   NIAR A CMY HGDGHGI  +N E +  I  +L 
Sbjct  437  MNTTQREN-SLFSDTFVEITKNIARTAHCMYLHGDGHGI--QNGEVKNSISKILL  488



>emb|CCM43927.1| limonene synthase [Coffea arabica]
Length=566

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEAKWY +GYTPT EEY+ENAW+S+S P++L+H +  V N    E   A+  L D H
Sbjct  391  AYLQEAKWYYAGYTPTVEEYLENAWVSMSVPVMLMHAYAGVTNPMNKE---AMDVL-DTH  446

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R SS +LR A+D GTSP EMKRGDVPK +QCYM E   S  E+R  +   + E WKK
Sbjct  447  DIVRCSSYLLRFADDLGTSPGEMKRGDVPKLVQCYMKEAGCSEEESREHVWFLLRETWKK  506

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MNK      SPFS+TF+ AA N  R+A  MYQ+GDGHG++S N E +  I   LF
Sbjct  507  MNKDSEWAESPFSKTFVTAAKNFGRVALVMYQYGDGHGLHS-NPEAKDRILASLF  560



>sp|B3TPQ7.1|ATESY_MAGGA RecName: Full=Alpha-terpineol synthase, chloroplastic; Short=Mg17; 
Flags: Precursor [Magnolia grandiflora]
 gb|ACC66282.1| alpha-terpineol synthase [Magnolia grandiflora]
Length=592

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EA+WY SGYTPT +EY+ NAWISI+ P+ILVH   YV+ +      A L C+  Y 
Sbjct  416  AYLVEARWYYSGYTPTLDEYLNNAWISIAGPVILVHA--YVSMIQMITKEALLDCVGSYE  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I++ SSMILRLA+D  TS  E++RGDVPK+IQCYM E  AS   AR  +   +++IWKK
Sbjct  474  SIMQWSSMILRLADDLATSTDELERGDVPKSIQCYMHENTASEVVAREQMRARISDIWKK  533

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK      SP  + F  AA+N+ARMAQCMYQHGDGHG  + + E++ HI +L+ E
Sbjct  534  MNK--DVALSPLPQPFKAAAVNLARMAQCMYQHGDGHG--NPHRESKDHILSLVVE  585



>gb|AID55337.1| terpene synthase [Actinidia chinensis]
Length=603

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 119/175 (68%), Gaps = 5/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S +TP+FEEY+ NAWISI+ P+ L H   YV   NP      L C+  Y 
Sbjct  428  SYLVEAKWYYSRHTPSFEEYMNNAWISIAAPVALAHA--YVLCTNPIA-KEGLKCVEKYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             +IR S+ I RLA+D GTS  EM+RGD+PK+IQCYM ET AS  +AR  +   + E WKK
Sbjct  485  NLIRCSATIFRLADDLGTSTDEMERGDIPKSIQCYMHETGASEKDARKHMKYLIGEAWKK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN+ R+E  S FSRT I  A N+ARM+QCMYQ+GDGHG  ++  ET+  +++LL 
Sbjct  545  MNEARVEDGSLFSRTIIGVAENLARMSQCMYQYGDGHG--AQGPETRDRVKSLLI  597



>ref|XP_009586876.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=620

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL+EA+WY +G+ PT +EY++NAWISIS P+IL+H FF V N    E    L  L+ Y 
Sbjct  437  AYLREARWYYNGHKPTLQEYMDNAWISISIPMILIHAFFLVTNPITKE---ELESLSKYP  493

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS I R  +D GTS  E+KRGDVPK+IQCY+ E   S  EAR  I   + E W+ 
Sbjct  494  DIIRWSSTIFRFVDDLGTSSDELKRGDVPKSIQCYINEKGVSEEEARERIQHLIKETWEM  553

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK + E    FS TF+E A NIAR AQCMY HGDGHGI  +N E +  I  +LFE
Sbjct  554  MNKAQRENLL-FSGTFVEIAKNIARTAQCMYLHGDGHGI--QNAEIKNSISKILFE  606



>gb|EYU19469.1| hypothetical protein MIMGU_mgv1a021922mg, partial [Erythranthe 
guttata]
Length=526

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 118/181 (65%), Gaps = 10/181 (6%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AY+QEA+WY + +TPT EEYIENAWISIS P I+   +F V N    E   A+  L  YH
Sbjct  347  AYMQEAEWYYAKHTPTKEEYIENAWISISAPAIVSQAYFLVTNPIDKE---AVRSLYQYH  403

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+R SSM+LRLAND GTS  EM RGDVPK IQCYM ET A++ EAR ++   M E WKK
Sbjct  404  NIVRCSSMVLRLANDLGTSSDEMSRGDVPKLIQCYMRETSANIEEAREYVMSIMRETWKK  463

Query  201  MN----KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
             N    +V I   S    +  I+ A ++ RMAQ MYQHGDGHGI  +N E +  I +LLF
Sbjct  464  TNEELLRVDINADSQLLPQNVIKIAADLGRMAQYMYQHGDGHGI--QNLEMKDRISSLLF  521

Query  36   E  34
            +
Sbjct  522  D  522



>gb|ABD77416.1| limonene synthase [Rosmarinus officinalis]
Length=594

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AY +EA+WY +G+ PT EEYI+ AWISIS  LIL HVFF +   NP    AA   L +Y 
Sbjct  422  AYAKEAEWYHTGHKPTMEEYIDVAWISISAHLILAHVFFLI--TNPIGKEAA-ESLRNYD  478

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+MILRLA+D GTS +EM+RGDVPKA++CYM E  ASV EAR  +   + E W K
Sbjct  479  DIIRNSAMILRLADDLGTSSYEMQRGDVPKAVECYMNEMGASVEEAREHVKCMIREAWMK  538

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             +  R +  SPFS+ FI +A ++ R AQ MYQHGDGHGI  +N + +  I TL+F+
Sbjct  539  TSAERFKE-SPFSKDFIRSAADLGRHAQYMYQHGDGHGI--RNPQMEERISTLIFQ  591



>gb|KDP35321.1| hypothetical protein JCGZ_09480 [Jatropha curcas]
Length=593

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 120/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L EAKWY  GYTPT EEYI+NA ISI+ PL+LVH +F + N  P    A L  L +Y 
Sbjct  415  AFLLEAKWYNDGYTPTLEEYIDNALISIAGPLLLVHGYFLLKN--PVTIDA-LKVLKEYS  471

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR S++I RLA+D  TS  E+KRGDVPK+IQCYM ET AS   AR  I   +++ W+ 
Sbjct  472  NIIRSSAIIFRLADDLATSSDEIKRGDVPKSIQCYMHETGASEVRAREHIQYLISQTWRN  531

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK R+   SPFS+ F+  A N+ RMAQCMYQ+GDGHGI  +  ET+  + +LL +
Sbjct  532  MNKERVVD-SPFSKPFVGLANNLTRMAQCMYQYGDGHGIEDQ--ETKDRVLSLLIQ  584



>ref|XP_008460926.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=597

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EAKWY + Y PT EEY++NAWISIS P ILVH + +V +         +  L  Y 
Sbjct  417  SYMLEAKWYHTNYKPTLEEYLDNAWISISGPAILVHAYVFVTSPTLEN----MESLKQYV  472

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E++RGDVPK+IQCYM +T AS N AR +I   ++E WKK
Sbjct  473  DMIRWSSTILRLADDLGTSSDELERGDVPKSIQCYMNDTGASENIAREYIGHLIDETWKK  532

Query  201  MNKVRIE-GCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK   E   S + R FIE A N+ARMAQCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  533  LNKTEFENNYSIYPRVFIERAKNLARMAQCMYQYGDGHGMGYQ--ETKDRVMSLLIE  587



>ref|XP_004150682.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=485

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 122/176 (69%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EAKWY + + PT EEY++NAWISIS P++L+H + +V +         +  L  Y 
Sbjct  302  SYMLEAKWYHTNHKPTLEEYLDNAWISISGPVVLIHAYVFVTSPTLEN----MESLKQYV  357

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R SS ILRLA+D GTS  E+ RGDVPK+IQCYM +T  S ++AR  I   ++E WKK
Sbjct  358  DMVRWSSTILRLADDLGTSSNELARGDVPKSIQCYMKDTGGSESDARKHIRHLIDETWKK  417

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NKV++E  S F + FIE A N+ARMAQCMYQ+GDGHGI  +  ET+  + +LL +
Sbjct  418  LNKVQVEN-SIFPKVFIERAKNVARMAQCMYQYGDGHGIVHQ--ETKDRVMSLLIQ  470



>ref|XP_009791335.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=613

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEA+WY +GYTPT EEY++NAWIS++ P++LVH F  V N    +   A   L+ Y 
Sbjct  436  SYLQEARWYYNGYTPTLEEYMDNAWISVAVPMVLVHAFPLVTNPVTKD---AFESLSKYP  492

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I R A+D GTS  E++RGDVPK+IQCYM E  A+  EAR  I + + E WK 
Sbjct  493  DIIRWSATIFRFADDLGTSSEELRRGDVPKSIQCYMNEKGATEEEAREHISICIKEKWKL  552

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +        S FS TFI  A+NIAR  Q +YQHGDGHGI  +NFE +  I  L FE
Sbjct  553  LINTAQRENSLFSETFIGCAINIARTGQSIYQHGDGHGI--QNFEIKNRISKLFFE  606



>ref|XP_006344475.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=601

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YLQEAKWY +GY PT +EY++NAWISI+  ++L+H F +V+N    E   AL  L  Y 
Sbjct  427  TYLQEAKWYYNGYKPTLQEYMDNAWISIAVAVMLLHAFIFVSNPITIE---ALESLNKYP  483

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I R  +D GTS +E+ RGDVPK++QCYM E  AS  EAR  I+L + E+W+ 
Sbjct  484  DIIRRSATISRFVDDLGTSSYELNRGDVPKSMQCYMNEKSASEEEARKHINLLIKEMWEL  543

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK +I     FS  FI   +N +R   CMYQHGDGHGI + + + Q  I  LLFE
Sbjct  544  MNKDQIRKEVLFSEEFIRIVLNFSRTTHCMYQHGDGHGIQNSHIKNQ--ISKLLFE  597



>ref|XP_006351844.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=590

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EA+WY +GY P+ EEY+EN WISI  P++LVH  F V N    E   AL  LT+Y 
Sbjct  414  SYLREARWYHNGYKPSLEEYMENGWISIGGPVVLVHTLFLVTNPITKE---ALDSLTNYP  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS ++RLA+D GTS  EM+RGDVPK+IQCYM E   S  +AR  I+L + E WK 
Sbjct  471  DIIRWSSTVIRLADDLGTSSDEMERGDVPKSIQCYMNEKDVSEEDARKHINLLIKETWKL  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN V+    S FS TFI  A+N AR +Q +YQHGDG+GI  +N  T+  I  L FE
Sbjct  531  MNTVQ-NNNSLFSETFIGCAVNGARTSQTIYQHGDGYGI--QNSHTKNRICKLFFE  583



>gb|KDO45502.1| hypothetical protein CISIN_1g044462mg, partial [Citrus sinensis]
Length=299

 Score =   171 bits (434),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 111/165 (67%), Gaps = 5/165 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGY PT +EY+ENAWIS++ P++L+H + +  N    E   AL  L D  
Sbjct  127  SYLVEAKWYNSGYIPTLQEYMENAWISVTAPVMLLHAYAFTANPITKE---ALEFLQDSP  183

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR+SSMI+RL +D GTS  E+KRGDVPK+IQCYM ET+ S +EAR  I   + E W K
Sbjct  184  DIIRISSMIVRLEDDLGTSSDELKRGDVPKSIQCYMHETRVSEDEAREHIRDLIAETWMK  243

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R          FI  AMN+ RM+QCMY +GDGHG+  N+K+
Sbjct  244  MNSARFGNPPYLPDVFIGMAMNLVRMSQCMYLYGDGHGVQENTKD  288



>ref|XP_004161807.1| PREDICTED: LOW QUALITY PROTEIN: (-)-alpha-terpineol synthase-like 
[Cucumis sativus]
Length=598

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 122/176 (69%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EAKWY + + PT EEY++NAWISIS P++L+H + +V +         +  L  Y 
Sbjct  415  SYMLEAKWYHTNHKPTLEEYLDNAWISISGPVVLIHAYVFVTSPTLEN----MESLKQYV  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R SS ILRLA+D GTS  E+ RGDVPK+IQCYM +T  S ++AR  I   ++E WKK
Sbjct  471  DMVRWSSTILRLADDLGTSSNELARGDVPKSIQCYMKDTGGSESDARKHIRHLIDETWKK  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NKV++E  S F + FIE A N+ARMAQCMYQ+GDGHGI  +  ET+  + +LL +
Sbjct  531  LNKVQVEN-SIFPKVFIERAKNVARMAQCMYQYGDGHGIVHQ--ETKDRVMSLLIQ  583



>ref|XP_010109851.1| Myrcene synthase [Morus notabilis]
 gb|EXC24794.1| Myrcene synthase [Morus notabilis]
Length=584

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPTF+EYI+NAWIS S P+ILV+V+ +  N    E   AL CL +Y 
Sbjct  407  SYLVEAKWYYSGYTPTFQEYIDNAWISFSVPVILVNVYVFAANPTTKE---ALTCLEEYP  463

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR S ++ R  ND  TS  E+KRGDVPK+IQCYM E   S  +AR  I L + E WKK
Sbjct  464  SIIRQSGILCRFLNDLETSLDEIKRGDVPKSIQCYMHEAGVSEEKARQHIKLLIRETWKK  523

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+ R+   S FS+TF E A N+ RMAQ MY HGDG+ I  +  ET+  + +LL +
Sbjct  524  INEDRVADSS-FSKTFTEIATNVVRMAQSMYLHGDGYAIQDR--ETKELVMSLLVD  576



>ref|XP_002512868.1| (R)-limonene synthase, putative [Ricinus communis]
 gb|EEF49371.1| (R)-limonene synthase, putative [Ricinus communis]
Length=599

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT EEY+ENAWISI+ PL+LVH +F + N   +E    + CL DY 
Sbjct  421  SYLLEAKWYYSGYTPTLEEYLENAWISIAGPLLLVHAYFTITNEITSE---GMDCLKDYP  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIRLS  I RL +D GT+  E KRGDVPKA+QCYM ET  S   AR  I+  + E WKK
Sbjct  478  NIIRLSGTISRLTDDLGTASHESKRGDVPKAMQCYMHETGVSEEVAREHIESLIRETWKK  537

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+    G S FS+TF+  A N+ RM+ CMY++GDG G  ++N  T+  + +LL +
Sbjct  538  INEEHF-GNSVFSQTFMRLAKNLGRMSHCMYENGDGFG--AQNRHTKERVVSLLIQ  590



>ref|XP_008461030.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=592

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             Y+ EA WY  GY PT +EY++NAW SIS P+ILVH + +V +    +    +  L  Y 
Sbjct  415  TYMVEATWYHDGYKPTLKEYLDNAWTSISGPVILVHAYVFVTSPTLKD----MENLKQYF  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+KRGDVPK+IQCYM +T AS + AR +I   ++E WKK
Sbjct  471  DLIRYSSTILRLADDLGTSSDELKRGDVPKSIQCYMNDTGASESNARKYIKHLIDETWKK  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK+ +E      R F++ A N+ARMAQCMYQ+GDGHG  + + ET+  + +LL +
Sbjct  531  MNKIEVEN-PIIPRVFVDRAKNLARMAQCMYQYGDGHG--TAHEETKDRVMSLLIQ  583



>ref|XP_004150684.1| PREDICTED: myrcene synthase, chloroplastic-like [Cucumis sativus]
Length=470

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 121/176 (69%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             Y+ EA WY +GY PT +EY++NAW SIS P+ILVH + +V +    +    +  L  Y 
Sbjct  297  TYMVEATWYHNGYKPTLKEYLDNAWTSISGPVILVHAYVFVTSPTLKD----MENLKHYV  352

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+KRGDVPK+IQCYM +T AS + AR +I   ++E WKK
Sbjct  353  DLIRYSSTILRLADDLGTSSDELKRGDVPKSIQCYMNDTGASESNARKYIKHLIDETWKK  412

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK+ +E  S   + F++ A N+ARMAQCMYQ+GDGHG  + + ET+  + +LL +
Sbjct  413  INKIEVEN-SIIPQVFVDRAKNLARMAQCMYQYGDGHG--TAHEETKDRVMSLLIQ  465



>ref|XP_006351729.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=594

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 112/175 (64%), Gaps = 5/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEA+WY +GY P+ EEYI+N WISI+ P++LVH  F V N    E   AL  LT+Y 
Sbjct  420  SYLQEARWYYNGYKPSLEEYIDNGWISIAVPMVLVHALFLVTNQITKE---ALDSLTNYP  476

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I R  ND GTS  E+KRGDVPK+IQCYM E   S  EAR  I   + E W+ 
Sbjct  477  DIIRWSATIFRFNNDLGTSSDELKRGDVPKSIQCYMNEKGVSEEEAREHIRFLIKETWEL  536

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN    +  S FS TFIE A NIAR A CMY  GD HGI  +N + ++ I  +LF
Sbjct  537  MNSSAHKENSLFSETFIEIAKNIARTAHCMYLKGDSHGI--QNTDIKSSISNILF  589



>ref|XP_004230563.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=591

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EA+WY SGY P+ EEY+EN WI+I  P++LVH  F V N    E   AL  LT Y 
Sbjct  414  SYLREARWYHSGYKPSLEEYMENGWITIGAPVVLVHTLFLVTNPITKE---ALESLTSYP  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +II+ S+ I+RL +D GTS  EM+RGDVPK+IQCYM E   S  +AR  I+L + E WK 
Sbjct  471  DIIQCSATIIRLTDDLGTSSDEMERGDVPKSIQCYMNEKGVSEEDARKHINLLIKETWKL  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    +  S FS TFI  A+N AR +  +YQHGDG+GI  +N  T+  I+ L FE
Sbjct  531  MNTALQKENSLFSETFIACAVNGARTSHTIYQHGDGYGI--QNLHTKNRIRQLFFE  584



>gb|EYU18417.1| hypothetical protein MIMGU_mgv1a003023mg [Erythranthe guttata]
Length=614

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTD--  388
             YLQEAKWY  GY PT EEY+  AWISIS P+IL H +F V N  P +   A   L D  
Sbjct  437  TYLQEAKWYWRGYKPTLEEYMSKAWISISVPVILSHAYFLVTN--PIQKVGA-QSLYDED  493

Query  387  --YHEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNE  214
              YH ++R S  I RLAND GTSP EM+RGDVPKAIQCYM ET A   EAR +I   + E
Sbjct  494  QLYHNVVRFSGTIARLANDLGTSPDEMERGDVPKAIQCYMNETGARREEAREYIRFLIYE  553

Query  213  IWKKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             WKKMN+ R+   SP  R  +  A+++ R+A  +YQHGDG+G  +++   +     LLFE
Sbjct  554  TWKKMNEERVITDSPLPRNLVRIAVDLGRIAHYIYQHGDGYG--TQHCRVKNRFSDLLFE  611



>ref|XP_004230556.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum lycopersicum]
 gb|AEM05856.1| beta myrcene/limonene synthase [Solanum lycopersicum]
Length=592

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 116/176 (66%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEAKWY +G+ P  EEY++NAWISI+ PL+L+H F ++ N    E   AL  L +Y 
Sbjct  418  SYLQEAKWYHNGHKPRLEEYMDNAWISIATPLVLLHAFIFLTNPITQE---ALESLNNYP  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR  ++I R  +D GTS  E+KRGDVPK+IQCYM +T AS  EAR  I+L + E+W+ 
Sbjct  475  DIIRRCAIINRFVDDLGTSSDELKRGDVPKSIQCYMNDTGASEEEAREHINLLIKEMWEV  534

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK +I     FS  FI+   N +R + C+YQHGDGHGI  +N      I  LLFE
Sbjct  535  MNKDQISKQVLFSEEFIKIVFNFSRTSHCVYQHGDGHGI--QNSHITNRISKLLFE  588



>ref|XP_004150681.1| PREDICTED: myrcene synthase, chloroplastic-like [Cucumis sativus]
Length=600

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EAKWY + Y PT EEY++NAWISIS  ++LVH + +V +         +  L  + 
Sbjct  420  SYMLEAKWYHTNYKPTLEEYLDNAWISISGTVLLVHTYVFVTSSTLEN----MESLKQHI  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E++RGDVPK+IQCYM +T AS + AR +I   ++E WKK
Sbjct  476  DMIRWSSTILRLADDLGTSSDELERGDVPKSIQCYMNDTGASESNAREYIRHLIDETWKK  535

Query  201  MNKVRIE-GCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK  +E   S F R F+E A N+ARMAQCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  536  LNKTEVENNYSIFPRVFVERAKNLARMAQCMYQYGDGHGMGYQ--ETKDRVMSLLIE  590



>emb|CDP10957.1| unnamed protein product [Coffea canephora]
Length=544

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 120/181 (66%), Gaps = 14/181 (8%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVN---NVNPAEYSAALHCLT  391
            AYLQEAKW+ SG+ PT ++Y+ NAW SIS PL++VH +F V+   N +  EY      L 
Sbjct  367  AYLQEAKWFFSGHIPTLQQYLNNAWTSISAPLVVVHAYFCVDYPINKDHVEY------LE  420

Query  390  DYHEIIRLSSMILRLANDKGTSPFE--MKRGDVPKAIQCYMGETKASVNEARGFIDLEMN  217
              H+ IR SSMI+RLAND GTSP    +K  DVPK+IQCYM ET A   +AR ++   + 
Sbjct  421  KCHKTIRCSSMIIRLANDLGTSPESEVLKSADVPKSIQCYMKETGACEEKAREYLRFLII  480

Query  216  EIWKKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            E WK+MN+ +    SPFS TF   A+N+ARM QCMYQHGDGHG   +N E +  I +LLF
Sbjct  481  EAWKQMNEAQTVD-SPFSSTFKGFAVNVARMGQCMYQHGDGHG--HQNSEPRDRILSLLF  537

Query  36   E  34
            E
Sbjct  538  E  538



>ref|XP_009773708.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=613

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEA+WY  GY PT EEYI+NAWISI+ PLILVH FF+V N    E   AL  L  Y 
Sbjct  439  AYLQEARWYYKGYKPTLEEYIDNAWISIATPLILVHAFFFVTNPITKE---ALESLNKYP  495

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR  ++I R  +D GTS  E+KRGDV K+IQC+M E   S  EA+  I + + E W+ 
Sbjct  496  DIIRRCAIINRFLDDLGTSSEELKRGDVSKSIQCFMNEKGVSEEEAKEGIRILIKETWEL  555

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK ++E    FS TFI  A+N +R + CMYQHGDGHGI  +N      I  LLFE
Sbjct  556  MNKDQMEELL-FSETFIGIALNFSRASHCMYQHGDGHGI--QNSHIINRISKLLFE  608



>gb|EYU18420.1| hypothetical protein MIMGU_mgv1a0244872mg, partial [Erythranthe 
guttata]
Length=224

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 114/176 (65%), Gaps = 3/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +LQEAKWY+  YTPT EEYIEN  IS S P+IL H FF V N    E   +L+    YH
Sbjct  46   TFLQEAKWYSIDYTPTLEEYIENGLISSSVPVILSHAFFVVTNPIHDEAVKSLY-EHKYH  104

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +II+  SMILRL+ND  TS  EMKRGDVPK+++CYM E+ A    A+ +I   + E WK 
Sbjct  105  KIIQCPSMILRLSNDLATSSDEMKRGDVPKSVECYMNESGADREVAQEYIRSIIYETWKT  164

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R+   SPF   F+ +A+ + RMAQ MYQHGDG+G++    E +  I  LLF+
Sbjct  165  MNEERVITDSPFQENFVRSAVELGRMAQYMYQHGDGYGMHIP--EMKDRIANLLFD  218



>ref|XP_004165181.1| PREDICTED: myrcene synthase, chloroplastic-like [Cucumis sativus]
Length=561

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 121/176 (69%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             Y+ EA WY +GY PT +EY++NAW SIS P+ILVH + +V +    +    +  L  Y 
Sbjct  388  TYMVEATWYHNGYKPTLKEYLDNAWTSISGPVILVHAYVFVTSPTLKD----MENLKHYV  443

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+KRGDVPK+IQCYM +T AS + AR +I   ++E WKK
Sbjct  444  DLIRYSSTILRLADDLGTSSDELKRGDVPKSIQCYMNDTGASESNARKYIKHLIDETWKK  503

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK+ +E  S   + F++ A N+ARMAQCMYQ+GDGHG  + + ET+  + +LL +
Sbjct  504  INKIEVEN-SIIPQVFVDRAKNLARMAQCMYQYGDGHG--TAHEETKDRVMSLLIQ  556



>ref|XP_009791607.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=492

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A  QEAKW+ +GY PT +EY++ AWISI  P+ LVH F +V N    E   AL  L+ Y 
Sbjct  316  ASFQEAKWHFNGYNPTLKEYMDIAWISIGAPMYLVHAFIFVTNPITKE---ALESLSKYP  372

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR  S+I+RLA+D GTS  EM RGDVPK+IQCYM E  AS  EAR  I+  + E+WK 
Sbjct  373  DIIRHCSIIIRLADDLGTSSDEMNRGDVPKSIQCYMNENDASEEEAREHINHLIKEMWKL  432

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N    E  S FS T I  A+N+ R AQC+YQHGDGHGI  +N E ++ I  LLFE
Sbjct  433  INTGLHEN-SLFSETLIGCAVNVTRTAQCIYQHGDGHGI--QNSEIKSRISELLFE  485



>ref|XP_004161822.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=600

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EAKWY + Y PT EEY++NAWISIS  ++L+H + +V +         +  L  Y 
Sbjct  420  SYMLEAKWYHTSYKPTLEEYLDNAWISISGTVLLLHTYVFVTSPTLEN----MESLKQYI  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E++RGDVPK+IQCYM +T AS + AR  I   ++E WKK
Sbjct  476  DMIRWSSTILRLADDLGTSSDELERGDVPKSIQCYMNDTGASESNAREHIRHLIDETWKK  535

Query  201  MNKVRIE-GCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NK  +E   S F R F+E A N+ARMAQCMYQ+GDGHG+  +  ET+  + +LL E
Sbjct  536  LNKTEVENNYSIFPRVFVERAKNLARMAQCMYQYGDGHGMGYQ--ETKDRVMSLLIE  590



>ref|XP_006357106.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=509

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A L+EAKWY +GYTP+ EEY++NAW+SI  P+I+++VFF V N    E   A+  L+ Y 
Sbjct  332  ALLREAKWYYNGYTPSLEEYMDNAWMSIGIPVIVINVFFCVTNPITKE---AIESLSKYP  388

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETK-ASVNEARGFIDLEMNEIWK  205
             IIR S+ I+RLA+D  TS  EM+RGDVPK+IQCYM + K AS  EAR  I+  + E WK
Sbjct  389  HIIRCSATIIRLADDLATSMDEMERGDVPKSIQCYMNDHKGASEKEARKHINYLIKETWK  448

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             +N +     S FS++FIE A+NIAR  Q +YQHGDGHGI  +N+E +  I  L FE
Sbjct  449  LLN-ISQHDNSLFSKSFIECAINIARTGQTIYQHGDGHGI--QNYEIKNRISKLFFE  502



>ref|XP_011088140.1| PREDICTED: terpene synthase 10-like [Sesamum indicum]
Length=598

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YLQEA+WY  GYTPT EEY+ NAWISIS P++L H +F V   NP E    +  L  YH
Sbjct  424  TYLQEAEWYLRGYTPTLEEYMNNAWISISAPVVLSHAYFLV--ANPIE-KEVIPSLYKYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R S+ +LRLA+D  TSP E+KRGDV K+IQCYM E+  S  EA  +I   + E WK 
Sbjct  481  DLVRYSATVLRLADDIATSPDEVKRGDVQKSIQCYMNESGGSGEEAVEYIRFVIGETWKN  540

Query  201  MNKVRIEG-CSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN+    G  SPF + F+  A ++ RMAQ MYQ+GDGHG+  +N + +T I + LF
Sbjct  541  MNQEAFAGDDSPFPQDFVRIAADLGRMAQYMYQYGDGHGV--QNCDIKTRISSSLF  594



>ref|XP_008461028.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=598

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 120/176 (68%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EAKWY + Y PT EEY++NAWISIS P++LVH + +V           +  L  Y 
Sbjct  415  SYMLEAKWYHTNYKPTLEEYLDNAWISISGPVVLVHAYVFVTTPTLEN----MESLKQYV  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +T +S ++AR  I   ++E WKK
Sbjct  471  DVIRWSSTILRLADDLGTSSDELARGDVPKSIQCYMNDTGSSESDARKHIRHLIDETWKK  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +NKV+++  S F + FIE A N+AR AQ MYQ+GDGHGI  +  ET+  + +LL +
Sbjct  531  LNKVQVQN-SIFPQVFIERAKNVARTAQFMYQYGDGHGIGHQ--ETKDRVMSLLIQ  583



>ref|XP_008460931.1| PREDICTED: terpene synthase 10-like isoform X2 [Cucumis melo]
Length=602

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEAKWY S Y PT EEY++NAW+SIS P+ILVH + +  +    E    L  L   +
Sbjct  430  SYLQEAKWYHSNYKPTLEEYMDNAWVSISGPVILVHSYVFATSHIAKE---ELESLDKTN  486

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS ILRLA+D  TS  E+KRGDVPK+IQCYM +T  S N+AR +I   +NE WKK
Sbjct  487  DIIRWSSTILRLADDLATSSDELKRGDVPKSIQCYMNDTGVSENDARNYIKHLINETWKK  546

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N+   E  +  S+  I+ + N+ARMAQCMY +GDG+GI     ET+ H+ +L+
Sbjct  547  LNESEAENIA-LSQVIIQMSKNLARMAQCMYLNGDGYGIEQ---ETKDHVLSLI  596



>ref|XP_008460932.1| PREDICTED: terpene synthase 10-like isoform X3 [Cucumis melo]
Length=601

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEAKWY S Y PT EEY++NAW+SIS P+ILVH + +  +    E    L  L   +
Sbjct  429  SYLQEAKWYHSNYKPTLEEYMDNAWVSISGPVILVHSYVFATSHIAKE---ELESLDKTN  485

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS ILRLA+D  TS  E+KRGDVPK+IQCYM +T  S N+AR +I   +NE WKK
Sbjct  486  DIIRWSSTILRLADDLATSSDELKRGDVPKSIQCYMNDTGVSENDARNYIKHLINETWKK  545

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N+   E  +  S+  I+ + N+ARMAQCMY +GDG+GI     ET+ H+ +L+
Sbjct  546  LNESEAENIA-LSQVIIQMSKNLARMAQCMYLNGDGYGIEQ---ETKDHVLSLI  595



>ref|XP_006371106.1| hypothetical protein POPTR_0019s03980g [Populus trichocarpa]
 gb|ERP48903.1| hypothetical protein POPTR_0019s03980g [Populus trichocarpa]
Length=584

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTPT +EY++NAWISI  PL +VH +FY  N    E S   H   +Y 
Sbjct  413  SYLLEAKWYYSGYTPTLQEYLDNAWISIGVPLAIVHAYFYAPNPTAEEAS---HFTEEYP  469

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMI+RLA+D GTS  E+KRGDV K+IQCYM ET+AS  EAR  I   ++  WKK
Sbjct  470  DIIRWSSMIVRLADDLGTSSDEIKRGDVSKSIQCYMHETEASEEEARDHIKKLISYAWKK  529

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  +       S+T I  A+N+ R AQC+YQ+GDGH I  ++ ET+  + +LL +
Sbjct  530  LNASQFSNPH-ISQTIIGVAVNLPRTAQCIYQYGDGHAI--EHLETKDRVMSLLIK  582



>ref|XP_006351843.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=739

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EA+WY SGY P  EEY+EN WISI+ P++LVH    V N    E   AL  LT+Y 
Sbjct  562  SYLREARWYHSGYKPNLEEYMENGWISIAAPMVLVHALLLVTNPITKE---ALDSLTNYS  618

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I+RL +D GTS  EM+RGDVPK+IQCYM E   S  +AR  I+L + E WK 
Sbjct  619  DIIRWSATIIRLTDDLGTSSDEMERGDVPKSIQCYMNEKGVSEEDARIHINLLIKETWKL  678

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    +  S FS TFI  A+N AR +Q +YQHGDGHGI + + + ++    L FE
Sbjct  679  MNTTVQKDNSLFSETFIGCAVNGARTSQTIYQHGDGHGIQNSHIKHRSF--QLFFE  732



>gb|KDP25062.1| hypothetical protein JCGZ_22597 [Jatropha curcas]
Length=1168

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 122/176 (69%), Gaps = 6/176 (3%)
 Frame = -2

Query  561   AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +YL EAKWY  GYTPT EEY++N +ISIS PL+LVH +F V      E S  L    +Y 
Sbjct  995   SYLLEAKWYHDGYTPTLEEYLQNGFISISAPLLLVHAYFTVTGQITEEVSKYLE---EYP  1051

Query  381   EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             +IIR SS+I RLA+D GTS +E KRGD  K+IQCYM ET++S  EAR +I   + E WKK
Sbjct  1052  DIIRYSSLITRLADDLGTSSYEQKRGDNSKSIQCYMHETESSEEEARKYIHYLIGETWKK  1111

Query  201   MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             +N+ +I   +  S+T ++  +N+ARM+QCMYQHGDG G+  +N ET+ +I +LL +
Sbjct  1112  INEEQIRN-THLSQTLMKMGINLARMSQCMYQHGDGFGV--QNVETKNYILSLLVQ  1164


 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 96/170 (56%), Gaps = 28/170 (16%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY                        LVH +F V      E S  L    +Y 
Sbjct  424  SYLLEAKWYHE----------------------LVHAYFTVTGQITEEVSKYLE---EYP  458

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S++I RL +D GTS  E KRGD  K+IQCYM ET +S  EAR +I   + E WKK
Sbjct  459  DIIRYSALISRLVDDLGTSSHEQKRGDNSKSIQCYMHETGSSEKEARKYIHYLIGETWKK  518

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHI  52
            +N+ +I   + FS+T I+  +N+AR++Q +YQ+GDG G  ++N ET+ +I
Sbjct  519  INEEQIRN-NHFSQTLIKLGINLARISQFVYQYGDGFG--AQNVETKNNI  565



>ref|XP_011088139.1| PREDICTED: LOW QUALITY PROTEIN: terpene synthase 10-like [Sesamum 
indicum]
Length=592

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            YLQEA+WY  GYTPT EEY+ NAWIS+S PL L HV+F   N    E   +LH    Y +
Sbjct  416  YLQEAEWYFRGYTPTLEEYMNNAWISVSAPLTLSHVYFAAANRIENEVVGSLH---KYQD  472

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            I+R S MI+RLA+D  TSP EMKRGDV KA++CYM E   S  EA  ++   ++E WKKM
Sbjct  473  IVRYSGMIMRLADDIATSPAEMKRGDVAKAVECYMNERGGSREEAEEYVRYLIDETWKKM  532

Query  198  NK----VRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            N+          SPF   F+  A ++ R AQ  YQHGDGHGI +   + +  I TLLF+
Sbjct  533  NEGAAVAVAADDSPFLEDFVRIAADLGRTAQYFYQHGDGHGIQTP--QIKERIPTLLFQ  589



>emb|CCM43928.1| linalool/myrcene synthase [Coffea arabica]
Length=547

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 14/181 (8%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVN---NVNPAEYSAALHCLT  391
            AYLQEAKW+ SG+ PT ++Y+ NAW SIS PL++VH +F V+   N +  EY      L 
Sbjct  370  AYLQEAKWFFSGHIPTLQQYLNNAWTSISAPLVVVHAYFCVDYPINKDHVEY------LE  423

Query  390  DYHEIIRLSSMILRLANDKGTSPFE--MKRGDVPKAIQCYMGETKASVNEARGFIDLEMN  217
              H+IIR SSMI+RLAND GTSP    +K  DVPK+IQCY+ ET A   +AR ++   + 
Sbjct  424  KCHKIIRCSSMIIRLANDLGTSPESEVLKSADVPKSIQCYVKETGACEEKAREYLRFLII  483

Query  216  EIWKKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            E WK+MN+ +    SPFS TF   A+N+ARM QCMYQHGDGH    +N E +  I +LLF
Sbjct  484  EAWKQMNEAQTVD-SPFSSTFKGFAVNVARMGQCMYQHGDGHA--HQNSEPRDRILSLLF  540

Query  36   E  34
            E
Sbjct  541  E  541



>ref|XP_006495349.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like, partial 
[Citrus sinensis]
Length=301

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY +GY PT +EY+ENAWISIS P+ILVH + Y  N    E    L  + DY 
Sbjct  127  TYLVEAKWYNNGYIPTLQEYMENAWISISAPVILVHAYTYTANPITKE---GLEFVKDYP  183

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRLA+D GTS  E+KRGDV K+IQCYM E   S  EAR  I   + + W K
Sbjct  184  NIIRWSSIILRLADDLGTSLDELKRGDVYKSIQCYMHEAGVSEREAREHIHDLIAQTWMK  243

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN+ R       S  F+  AMN+ARM+QCMYQ GDGHG
Sbjct  244  MNRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHG  281



>dbj|BAH57277.1| AT3G25820 [Arabidopsis thaliana]
Length=225

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 115/179 (64%), Gaps = 7/179 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  41   TYLVEAKWYKRGYKPSLEEYMQNAWISISAPTILIHFYCVFSDQISVQ---NLETLSQHR  97

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTSP E+ RGDV K++QCYM ET AS   AR  +   ++++W 
Sbjct  98   QHIVRCSATVLRLANDLGTSPTELARGDVLKSVQCYMHETGASEERARDHVHQMISDMWD  157

Query  204  KMNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN      C  S  SR F EAAMN+ARM+QCMYQ+GDGHG   K  +T   +Q+LL +
Sbjct  158  DMNSETKTACNSSSRSRGFKEAAMNLARMSQCMYQYGDGHGCPEKA-KTIDRVQSLLVD  215



>ref|XP_010090242.1| Myrcene synthase [Morus notabilis]
 gb|EXB39111.1| Myrcene synthase [Morus notabilis]
Length=591

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 118/176 (67%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY SGYTPTF+EYI+NAWISIS P+ILVH + +    NP +   AL+ L +Y 
Sbjct  419  GFLVEAKWYYSGYTPTFQEYIDNAWISISIPMILVHAYLFA--ANPTK--EALNYLEEYS  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I R S ++ RL +D GTS  E+KRGDVPK+IQCYM E +    +A   I L ++E WK 
Sbjct  475  SIFRHSGILFRLLDDLGTSSNELKRGDVPKSIQCYMYEARVLEEKACQDIKLLIHEKWKH  534

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+ R+   SPFS+TFIE AMN+ R  Q  YQ+GDG+ I  +  ET+ HI +L  +
Sbjct  535  VNEERV-ADSPFSKTFIEIAMNVVRTGQFFYQYGDGYAIQDR--ETKEHIVSLFVD  587



>gb|KDO37419.1| hypothetical protein CISIN_1g014206mg [Citrus sinensis]
Length=429

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 113/169 (67%), Gaps = 9/169 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT +EYIENAW+S+S P+IL+H +  +   NPA+   AL  L +Y 
Sbjct  252  SFLLEAKWYSSGYIPTLDEYIENAWVSVSGPVILLHAYSLI--ANPAK-EEALQFLQEYP  308

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  309  HIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDARLHIRDLITAAWMK  368

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R    +P        F++ AMN+ARMAQC YQ+GDGH +  NSKN
Sbjct  369  MNNKREGDENPDHLLLPNNFVQFAMNLARMAQCTYQNGDGHTVQDNSKN  417



>dbj|BAD27259.1| gamma-terpinene synthase [Citrus unshiu]
Length=600

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 110/165 (67%), Gaps = 5/165 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGY PT +EY+ENAWIS++ P++L+H + +  N    E   AL  L D  
Sbjct  428  SYLVEAKWYNSGYIPTLQEYMENAWISVTAPVMLLHAYAFTANPITKE---ALEFLQDSP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR+SSMI+RL +D GTS  E+KRGDVPK+IQCYM ET  S +EAR  I   + E W K
Sbjct  485  DIIRISSMIVRLEDDLGTSSDELKRGDVPKSIQCYMHETGVSEDEAREHIRDLIAETWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R          FI  AMN+ RM+QCMY +GDGHG+  N+K+
Sbjct  545  MNSARFGNPPYLPDVFIGIAMNLVRMSQCMYLYGDGHGVQENTKD  589



>sp|Q8L5K4.1|GTPS_CITLI RecName: Full=Gamma-terpinene synthase, chloroplastic; Short=ClgammaTS; 
Flags: Precursor [Citrus limon]
 gb|AAM53943.1|AF514286_1 gamma-terpinene synthase [Citrus limon]
Length=600

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 110/165 (67%), Gaps = 5/165 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGY PT +EY+ENAWIS++ P++L+H + +  N    E   AL  L D  
Sbjct  428  SYLVEAKWYNSGYIPTLQEYMENAWISVTAPVMLLHAYAFTANPITKE---ALEFLQDSP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR+SSMI+RL +D GTS  E+KRGDVPK+IQCYM ET  S +EAR  I   + E W K
Sbjct  485  DIIRISSMIVRLEDDLGTSSDELKRGDVPKSIQCYMHETGVSEDEAREHIRDLIAETWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R          FI  AMN+ RM+QCMY +GDGHG+  N+K+
Sbjct  545  MNSARFGNPPYLPDVFIGIAMNLVRMSQCMYLYGDGHGVQENTKD  589



>ref|XP_006351730.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Solanum tuberosum]
Length=609

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTD-Y  385
            AYLQEA+WY +GYTP+ +EY+ENAWIS+   +++V+ FF V   NP       +  ++ Y
Sbjct  431  AYLQEARWYYNGYTPSVDEYMENAWISVGSLVMVVNAFFLV--TNPITKEVLEYVFSNKY  488

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             +IIR S+ I+RL +D  TS  EMKRGDVPK+IQCYM E  AS  EAR  I+L MNE WK
Sbjct  489  PDIIRWSATIIRLTDDLATSSNEMKRGDVPKSIQCYMKENGASEEEARKHINLMMNETWK  548

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             +N  + +  S F   F+  A+N+AR  Q MYQHGDGHGI  +N E Q  I  L FE
Sbjct  549  MINTAQHDN-SLFCEKFMGCAVNVARTGQTMYQHGDGHGI--QNSEIQNRISKLFFE  602



>dbj|BAD27258.1| gamma-terpinene synthase [Citrus unshiu]
Length=600

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 110/165 (67%), Gaps = 5/165 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGY PT +EY+ENAWIS++ P++L+H + +  N    E   AL  L D  
Sbjct  428  SYLVEAKWYNSGYIPTLQEYMENAWISVTAPVMLLHAYAFTANPITKE---ALEFLQDSP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR+SSMI+RL +D GTS  E+KRGDVPK+IQCYM ET  S +EAR  I   + E W K
Sbjct  485  DIIRISSMIVRLEDDLGTSSDELKRGDVPKSIQCYMHETGVSEDEAREHIRDLIAETWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R          FI  AMN+ RM+QCMY +GDGHG+  N+K+
Sbjct  545  MNSARFGNPPYLPDVFIGIAMNLVRMSQCMYLYGDGHGVQENTKD  589



>ref|XP_011088141.1| PREDICTED: (-)-alpha-terpineol synthase-like [Sesamum indicum]
Length=551

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            +LQEA +Y+ GYTPT EEYI NA ISI+ PL+L H +F   N    E   A+  L+ YH+
Sbjct  378  FLQEANYYSKGYTPTLEEYINNACISITIPLMLCHAYFLDTNQIDME---AVQALSTYHD  434

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            I+R S  I RL++D  TS  EM+RGD PK+++CYM E+ AS  EAR +I   ++E WKKM
Sbjct  435  IVRYSGTIARLSDDLATSADEMERGDTPKSVECYMNESGASREEAREYIKFVIDETWKKM  494

Query  198  N-KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            N +V     SPFS+ F+  A ++ R+ Q MYQHGDGHG+   + + +T   +LLF+
Sbjct  495  NAQVVAVDNSPFSKDFVSMAADLGRIGQYMYQHGDGHGVQGSHIKDRT--SSLLFQ  548



>gb|AID55338.1| terpene synthase [Actinidia arguta]
Length=604

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY S YTP+FEEY+ NAWISIS  ++L H +    N+   E    L C+  Y 
Sbjct  426  SYLVEAKWYYSRYTPSFEEYMNNAWISISASVMLAHAYVLCTNLISYE---GLKCVEKYP  482

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             +IR S+ ILRLA+D  TS  EM+RGD+PK+IQCYM ET  S  EAR  +   + E  KK
Sbjct  483  NLIRCSATILRLADDLATSTDEMERGDIPKSIQCYMHETGTSEEEARKHMKYLIGEALKK  542

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MN+ R+E    FSR FI    N+ RM QCMYQ+GDGHG  ++  ET+  +++LL
Sbjct  543  MNEARVEDGPFFSRAFIGVVENLVRMTQCMYQYGDGHG--AQGPETRDRVKSLL  594



>ref|XP_006487820.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=625

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 113/169 (67%), Gaps = 9/169 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT +EYIENAW+S+S P+IL+H +  +   NPA+   AL  L +Y 
Sbjct  448  SFLLEAKWYSSGYIPTLDEYIENAWVSVSGPVILLHAYSLI--ANPAK-EEALQFLQEYP  504

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  505  HIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDARQHIRDLITAAWMK  564

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R    +P        F++ AMN+ARMAQC YQ+GDGH +  NSKN
Sbjct  565  MNNKREGDENPDHLLLPNNFVQFAMNLARMAQCTYQNGDGHTVQDNSKN  613



>ref|XP_006487821.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=617

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 113/169 (67%), Gaps = 9/169 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT +EYIENAW+S+S P+IL+H +  +   NPA+   AL  L +Y 
Sbjct  440  SFLLEAKWYSSGYIPTLDEYIENAWVSVSGPVILLHAYSLI--ANPAK-EEALQFLQEYP  496

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  497  HIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDARQHIRDLITAAWMK  556

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R    +P        F++ AMN+ARMAQC YQ+GDGH +  NSKN
Sbjct  557  MNNKREGDENPDHLLLPNNFVQFAMNLARMAQCTYQNGDGHTVQDNSKN  605



>ref|XP_009779942.1| PREDICTED: (-)-alpha-terpineol synthase-like [Nicotiana sylvestris]
Length=545

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL E KWY S YTP+  E++ NAWI+ + P++++H +F + N    E    L CL +Y 
Sbjct  371  AYLLEVKWYQSRYTPSLNEFLRNAWITNTGPVLIMHAYFCITNPIKEE---ELECLKNYP  427

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II+  S+ILRLAND  TSP E+K+GD  K+I CYM E+  S   AR +I   +++ WKK
Sbjct  428  AIIQSPSLILRLANDLATSPDEIKKGDYLKSIHCYMHESGRSEENARNYIKKLIDQTWKK  487

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK  + G S FS+ F  AAMN+AR+AQCMYQHGDG GI  +  ET+  I +L FE
Sbjct  488  MNKDILRGSS-FSKDFRTAAMNLARIAQCMYQHGDGFGIPDR--ETKDRICSLFFE  540



>gb|AAL17636.1| d-limonene synthase [Agastache rugosa]
Length=613

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 110/175 (63%), Gaps = 5/175 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            YL E+KWY SG+ P+ EEY+EN+WIS+S P +L H FF V +    +    L  L +YH+
Sbjct  441  YLMESKWYYSGHKPSLEEYLENSWISVSGPCVLTHEFFGVTDSLAKD---TLDSLYEYHD  497

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            I+R SS +LRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  I   + E+WKKM
Sbjct  498  IVRWSSYLLRLADDLGTSVEEVSRGDVPKSIQCYMHDNDASEEEARQHIKGLIREMWKKM  557

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            N  R+   SPF R FI    ++ RMAQ MY +GDGHG        Q  I   LF+
Sbjct  558  NVERVSEDSPFCRDFIRCCEDLGRMAQFMYHYGDGHGTQHPKIHQQ--IAACLFQ  610



>dbj|BAD91045.1| monoterpene synthase [Citrus unshiu]
Length=602

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY +GY PT +EY+ENAWISIS P+ILVH + Y  N    E    L  + DY 
Sbjct  428  TYLVEAKWYNNGYIPTLQEYMENAWISISAPVILVHAYTYTANPITKE---GLEFVKDYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRLA+D GTS  E+KRGDV K+IQCYM E   S  EAR  I   + + W K
Sbjct  485  NIIRWSSIILRLADDLGTSSDELKRGDVHKSIQCYMHEAGVSEREAREHIHDLIAQTWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN+ R       S  F+  AMN+ARM+QCMYQ GDGHG
Sbjct  545  MNRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHG  582



>ref|XP_010502465.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=594

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 5/177 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  417  TYLVEAKWYNRGYKPSVEEYMKNAWISISAPTILIHFYCVFSDQISLQ---NLETLSQHR  473

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTSP E+ RGDV K++QCYM ET AS  EAR  +   +++ W 
Sbjct  474  QHIVRCSATVLRLANDLGTSPDELARGDVLKSVQCYMHETGASEEEAREHVQQMISDTWD  533

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN       S FSR F+EAAMN+ARM+QCMYQ+GDGHG  +K  +T   +Q+LL +
Sbjct  534  DMNNETKPARSSFSRGFVEAAMNLARMSQCMYQYGDGHGCPNKA-KTVDRVQSLLVD  589



>ref|XP_010502464.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=595

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 5/177 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  418  TYLVEAKWYNRGYKPSVEEYMKNAWISISAPTILIHFYCVFSDQISLQ---NLETLSQHR  474

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTSP E+ RGDV K++QCYM ET AS  EAR  +   +++ W 
Sbjct  475  QHIVRCSATVLRLANDLGTSPDELARGDVLKSVQCYMHETGASEEEAREHVQQMISDTWD  534

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN       S FSR F+EAAMN+ARM+QCMYQ+GDGHG  +K  +T   +Q+LL +
Sbjct  535  DMNNETKPARSSFSRGFVEAAMNLARMSQCMYQYGDGHGCPNKA-KTVDRVQSLLVD  590



>emb|CCM43929.1| linalool/myrcene synthase [Coffea arabica]
Length=596

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEAKW+ SG  PT ++Y+ NAWISIS P  LVH +F V+     ++   L  L +YH
Sbjct  419  AYLQEAKWFFSGEVPTLQQYLNNAWISISAPAFLVHAYFCVDYPINKDH---LQYLDNYH  475

Query  381  EIIRLSSMILRLANDKGTSPFE--MKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIW  208
            +IIR S+MILRL ND GTSP    +  GDVPK+I+CYM ET A   +AR  +   + E W
Sbjct  476  KIIRCSAMILRLTNDLGTSPESEVLNVGDVPKSIRCYMKETGACEEKAREHLRFLITEAW  535

Query  207  KKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            K+M + +    SPFS TF   A+N+ARM  CMYQHGDGHG   +N E +  I +LLFE
Sbjct  536  KQMEEAQTLD-SPFSSTFNGIAVNLARMGLCMYQHGDGHG--HQNSEPRDRILSLLFE  590



>emb|CDP10953.1| unnamed protein product [Coffea canephora]
Length=598

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 116/178 (65%), Gaps = 8/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEAKW+ SG  PT ++Y+ NAWISIS P  LVH +F V+     ++   L  L +YH
Sbjct  421  AYLQEAKWFFSGEVPTLQQYLNNAWISISAPAFLVHAYFCVDYPINKDH---LQYLDNYH  477

Query  381  EIIRLSSMILRLANDKGTSPFE--MKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIW  208
            +IIR S+MILRL ND GTSP    +  GDVPK+I+CYM ET A   +AR  +   + E W
Sbjct  478  KIIRCSAMILRLTNDLGTSPESEVLNVGDVPKSIRCYMKETGACEEKAREHLRFLITEAW  537

Query  207  KKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            K+M + +    SPFS TF   A+N+ARM  CMYQHGDGHG   +N E +  I +LLFE
Sbjct  538  KQMEEAQTLD-SPFSSTFNGIAVNLARMGLCMYQHGDGHG--HQNSEPRDRILSLLFE  592



>ref|XP_010528838.1| PREDICTED: tricyclene synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=598

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 119/177 (67%), Gaps = 4/177 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AY++EAKWY  GY P F+EYIENAWIS+  P+IL+H +  ++     E   A+   +D  
Sbjct  420  AYIKEAKWYREGYKPRFKEYIENAWISVGAPVILIHSYCILSEPISKETLEAISENSD--  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLE-MNEIWK  205
             I+R SS++LR+AND GTSP E+ RGDV K++QCYM ET AS  EAR  + +  +++ W 
Sbjct  478  PIVRSSSIVLRVANDLGTSPDELARGDVLKSMQCYMHETGASAEEAREHMIMGVISDEWD  537

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN+  +E  SP  R F+  A+++ RMAQCMYQ+GDGHG   K  +T   +Q+L+F+
Sbjct  538  VMNEKIMERSSPLDRRFLRTALDLGRMAQCMYQYGDGHGSPDKA-KTTDRVQSLIFD  593



>ref|NP_001233809.1| monoterpene synthase 2 [Solanum lycopersicum]
 gb|AAX69064.1| monoterpene synthase 2 [Solanum lycopersicum]
 gb|AEM05854.1| beta-phellandrene synthase [Solanum lycopersicum]
Length=590

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEA+WY +GY P+ EEY++N WISI+ P++L H  F V +    E   AL  LT+Y 
Sbjct  416  SYLQEARWYYNGYKPSLEEYMDNGWISIAVPMVLAHALFLVTDPITKE---ALESLTNYP  472

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I RL +D GTS  E+KRGDVPK+IQCYM E   S  EAR  I   + E WK 
Sbjct  473  DIIRCSATIFRLNDDLGTSSDELKRGDVPKSIQCYMNEKGVSEEEAREHIRFLIKETWKF  532

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN    +  S F  TF+E A NIA  A CMY  GD HGI  +N + +  I  +LF
Sbjct  533  MNTAHHKEKSLFCETFVEIAKNIATTAHCMYLKGDSHGI--QNTDVKNSISNILF  585



>ref|XP_010324138.1| PREDICTED: monoterpene synthase 2 isoform X1 [Solanum lycopersicum]
Length=593

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEA+WY +GY P+ EEY++N WISI+ P++L H  F V +    E   AL  LT+Y 
Sbjct  419  SYLQEARWYYNGYKPSLEEYMDNGWISIAVPMVLAHALFLVTDPITKE---ALESLTNYP  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I RL +D GTS  E+KRGDVPK+IQCYM E   S  EAR  I   + E WK 
Sbjct  476  DIIRCSATIFRLNDDLGTSSDELKRGDVPKSIQCYMNEKGVSEEEAREHIRFLIKETWKF  535

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN    +  S F  TF+E A NIA  A CMY  GD HGI  +N + +  I  +LF
Sbjct  536  MNTAHHKEKSLFCETFVEIAKNIATTAHCMYLKGDSHGI--QNTDVKNSISNILF  588



>gb|AAK06663.1| limonene synthase [Perilla frutescens var. frutescens]
Length=604

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKW+ SG+ P  EEY+ NAWISIS P++L HVFF V +    E    +  L  YH
Sbjct  431  TYLVEAKWFYSGHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRE---TVESLFKYH  487

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  +   + E WKK
Sbjct  488  DLIRYSSTILRLADDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHVRWLIAETWKK  547

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+      SPF + FI  A ++ RMAQ MY +GDGHGI  +N +    +  +LFE
Sbjct  548  INEEVWSADSPFCKDFIACAADMGRMAQFMYHNGDGHGI--QNPQIHQQMTDILFE  601



>gb|AAG31435.1| limonene synthase [Perilla citriodora]
Length=604

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKW+ SG+ P  EEY+ NAWISIS P++L HVFF V +    E    +  L  YH
Sbjct  431  TYLVEAKWFYSGHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRE---TVESLFKYH  487

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  +   + E WKK
Sbjct  488  DLIRYSSTILRLADDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHVRWLIAETWKK  547

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+      SPF + FI  A ++ RMAQ MY +GDGHGI  +N +    +  +LFE
Sbjct  548  INEEVWSADSPFCKDFIACAADMGRMAQFMYHNGDGHGI--QNPQIHQQMTDILFE  601



>gb|AAF65545.1| limonene synthase [Perilla citriodora]
Length=604

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKW+ SG+ P  EEY+ NAWISIS P++L HVFF V +    E    +  L  YH
Sbjct  431  TYLVEAKWFYSGHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRE---TVESLFKYH  487

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  +   + E WKK
Sbjct  488  DLIRYSSTILRLADDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHVRWLIAETWKK  547

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+      SPF + FI  A ++ RMAQ MY +GDGHGI  +N +    +  +LFE
Sbjct  548  INEEVWSADSPFCKDFIACAADMGRMAQFMYHNGDGHGI--QNPQIHQQMTDILFE  601



>ref|XP_010910675.1| PREDICTED: terpene synthase 10-like, partial [Elaeis guineensis]
Length=232

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 111/176 (63%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EA WY SGYTPTF+EY++NAWIS SCP++L H +F V+     E    L C   Y 
Sbjct  58   SFLVEANWYHSGYTPTFKEYLDNAWISSSCPVLLTHAYFCVSTEITKE---GLECTMSYP  114

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I++ +S I RL ND   S  E++RGDV  AIQCYM +   S + AR  I   ++  WK+
Sbjct  115  DIVQYTSKIFRLCNDLAGSKKELERGDVSSAIQCYMHDEGVSESVAREHIRDMIDAFWKE  174

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  R +  SPF  +FI  AMN+ARM +CMYQ+GDGH +     ET+  ++ LL +
Sbjct  175  LNGARFDN-SPFEESFIVTAMNVARMVECMYQYGDGHTM--PGHETKDRVKLLLID  227



>gb|AAG31437.1| limonene synthase [Perilla frutescens]
Length=604

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKW+ SG+ P  EEY+ NAWISIS P++L HVFF V +    E    +  L  YH
Sbjct  431  TYLVEAKWFYSGHKPNMEEYLNNAWISISGPVMLCHVFFRVTDSITRE---TVESLFKYH  487

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  +   + E WKK
Sbjct  488  DLIRYSSTILRLADDLGTSLEEVSRGDVPKSIQCYMNDDNASEEEARRHVRWLIAETWKK  547

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+      SPF + FI  A ++ RMAQ MY +GDGHGI  +N +    +  +LFE
Sbjct  548  INEEVWSADSPFCKDFIACAADMGRMAQFMYHNGDGHGI--QNPQIHQQMTDILFE  601



>ref|XP_009600964.1| PREDICTED: (-)-alpha-terpineol synthase-like [Nicotiana tomentosiformis]
Length=546

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL E KWY S YTP+  E++ NAWI+ + P++++H +F + N    E    L CL +Y 
Sbjct  372  AYLLEVKWYQSRYTPSLNEFLRNAWITNTGPVLIMHAYFCITNPIKEE---ELECLKNYP  428

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II+  S+ILRLAND  TSP E+K+GD  K+I CYM E+  S   AR +I   +++ WKK
Sbjct  429  AIIQSPSLILRLANDLATSPDEIKKGDYLKSIHCYMHESGRSEENARNYIKQLIDQTWKK  488

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK  +   S FS+ F   AMN+AR+AQCMYQHGDG GI  +  ET+  I++L FE
Sbjct  489  MNKDILRDSS-FSKDFRTTAMNLARIAQCMYQHGDGFGIPDR--ETKDRIRSLFFE  541



>ref|XP_010425235.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=595

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 116/177 (66%), Gaps = 5/177 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY+ENAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  418  TYLVEAKWYNRGYKPSVEEYMENAWISISAPTILIHFYCVFSDQISLQ---NLETLSQHR  474

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTSP E+ RGDV K++QCYM E  AS  EAR  +   +++ W 
Sbjct  475  QHIVRRSATVLRLANDLGTSPDELARGDVLKSVQCYMHEAGASEEEAREHVQQMISDTWD  534

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN       S FSR F+EAAMN+ARM+QCMYQ+GDGHG  +K  +T   +++LL +
Sbjct  535  DMNNETKPARSSFSRGFVEAAMNLARMSQCMYQYGDGHGCPNKA-KTVDRVRSLLVD  590



>gb|AAG31438.1| limonene synthase [Perilla frutescens]
Length=603

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKW+ SG+ P  EEY+ NAWISIS P++L HVFF V +    E    +  L  YH
Sbjct  430  TYLVEAKWFYSGHKPNLEEYLNNAWISISGPVMLCHVFFRVTDSITRE---TVESLFKYH  486

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  I   + E WKK
Sbjct  487  DLIRYSSTILRLADDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHIRWLIAETWKK  546

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+      SPF + FI  A ++ RMAQ MY +GDGHGI  +N +    +  +LFE
Sbjct  547  INEEVWSVDSPFCKDFIACAADMGRMAQFMYHNGDGHGI--QNPQIHQQMTDILFE  600



>gb|ABW86881.1| limonene synthase [Mentha x piperita]
Length=599

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W+SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWMSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  580



>gb|KHG23712.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=597

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 117/175 (67%), Gaps = 8/175 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GYTPT  EYI+NAWISIS  ++L H +   + +        LH +  Y+
Sbjct  422  SYLLEAKWYYIGYTPTLREYIDNAWISISGSVMLGHSYLATDLIT----EEGLHHIQKYY  477

Query  381  -EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             +II  SS+I+RL +D GTS +E++RGDVPK+IQCYM E+ AS  EAR  I   ++  WK
Sbjct  478  PDIIYWSSIIVRLTDDLGTSSYELQRGDVPKSIQCYMNESGASEEEARDHIRKLIDAAWK  537

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            KMNK ++   SPFS TFIE AMN+AR++  MYQ+GDGH I  K  ET+  + +L 
Sbjct  538  KMNKDQM-AKSPFSYTFIEVAMNLARISLLMYQNGDGHAIEDK--ETKDRVLSLF  589



>dbj|BAD91046.1| (E)-beta-ocimene synthase [Citrus unshiu]
Length=617

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 112/169 (66%), Gaps = 9/169 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT +EYIENAW+S+S P+IL+H +  +   NPA+   AL  L +Y 
Sbjct  440  SFLLEAKWYSSGYIPTLDEYIENAWVSVSGPVILLHAYTLI--ANPAK-EEALQFLQEYP  496

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  497  HIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDARLHIRDLITAAWMK  556

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGI--NSKN  73
            MN  R    +P        F++ AMN+ARMAQC YQ+GD H +  NSKN
Sbjct  557  MNNKREGDENPDHLLLPNNFVQFAMNLARMAQCTYQNGDRHTVQDNSKN  605



>dbj|BAA08367.1| limonene cyclase [Perilla frutescens var. acuta]
 dbj|BAA21629.1| 1-limonene synthase [Perilla frutescens]
Length=603

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKW+ SG+ P  EEY+ NAWISIS P++L HVFF V +    E    +  L  YH
Sbjct  430  TYLVEAKWFYSGHKPNLEEYLNNAWISISGPVMLWHVFFRVTDSITRE---TVESLFKYH  486

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  I   + E WKK
Sbjct  487  DLIRYSSTILRLADDLGTSLEEVSRGDVPKSIQCYMNDNNASEEEARRHIRWLIAETWKK  546

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+      SPF + FI  A ++ RMAQ MY +GDGHGI  +N +    +  +LFE
Sbjct  547  INEEVWSVDSPFCKDFIACAADMGRMAQFMYHNGDGHGI--QNPQIHQQMTDILFE  600



>gb|AIE41601.1| 1,8-cineole synthase [Artemisia annua]
Length=587

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 112/174 (64%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EA+WY SGY PT EEY+ENA++SIS P+IL HV F     +  E    L  +    
Sbjct  412  SYLKEAQWYESGYVPTLEEYLENAYVSISAPVILTHVNFLTTITSKEE---ILQFMETSD  468

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+R SS+ILRLA+D GTS  EM RGDVPK+IQCYM E+ AS +EAR  I   + E WKK
Sbjct  469  NIVRYSSLILRLADDLGTSSLEMARGDVPKSIQCYMHESGASEDEARMHIKDLILETWKK  528

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
             NK R    S  +R F   AMN+ RMAQ MY+ GDGHG  S    T++H+ + L
Sbjct  529  FNKEREHVKSKIAREFTYCAMNLGRMAQFMYREGDGHGHLSD--VTKSHVLSWL  580



>ref|XP_004231363.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic [Solanum 
lycopersicum]
 sp|G1JUH1.1|TPS3_SOLLC RecName: Full=(-)-camphene/tricyclene synthase, chloroplastic; 
Short=SlTPS3; AltName: Full=(4S)-limonene synthase.; AltName: 
Full=Myrcene synthase; Flags: Precursor [Solanum lycopersicum]
 gb|AEM05853.1| camphene/tricyclene synthase [Solanum lycopersicum]
Length=607

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YLQEA+WY SGYTP+ +EY+ENAWIS+   +++V+ FF V N    E    L     Y 
Sbjct  429  SYLQEARWYYSGYTPSLDEYMENAWISVGSLVMVVNAFFLVTNPITKEVLEYLFS-NKYP  487

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR  + I+RL +D  TS  EMKRGDVPK+IQCYM E  AS  EAR  I+L + E WK 
Sbjct  488  DIIRWPATIIRLTDDLATSSNEMKRGDVPKSIQCYMKENGASEEEARKHINLMIKETWKM  547

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  + +  S F   F+  A+NIAR  Q +YQHGDGHGI  +N++ Q  I  L FE
Sbjct  548  INTAQHDN-SLFCEKFMGCAVNIARTGQTIYQHGDGHGI--QNYKIQNRISKLFFE  600



>ref|XP_010514204.1| PREDICTED: beta-myrcene/(E)-beta-ocimene synthase 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=277

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 108/179 (60%), Gaps = 6/179 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GY P+ EEY++NAWISIS P +L+H  FY    +          +    
Sbjct  97   AYLLEAKWYKGGYKPSLEEYMQNAWISISAPTMLIH--FYCAFPDEISIQVLESLVQQRQ  154

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R S+ +LRLAND  TS  E+ RGDV K++QCYM ET AS  EAR  +   +   W +
Sbjct  155  QVVRCSASVLRLANDLATSSDELARGDVLKSVQCYMHETGASEEEAREHVQQMIRHTWNE  214

Query  201  MN---KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN   +      S  S+ F+E AMN+ARM+QCMYQHGDGHG   K  +    IQTL+ +
Sbjct  215  MNYEARTATRSSSLLSQDFVEVAMNLARMSQCMYQHGDGHGCPDKA-KVVDRIQTLIVD  272



>ref|XP_006365871.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum tuberosum]
Length=551

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNN-VNPAEYSAALHCLTDY  385
            AYL E KWY  GYTPT +E++ NAWI+ + P++++H +F + N +N  E    L CL  Y
Sbjct  377  AYLLEVKWYQRGYTPTLDEFLRNAWITNTGPVLIMHAYFCITNPINEDE----LECLNHY  432

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
              II   S+ILRL ND  TSP E+K+GD  K+IQCYM + K S   AR +I   +++ WK
Sbjct  433  PAIIYSPSLILRLVNDLATSPDEIKKGDYLKSIQCYMHDFKCSEENARNYIKKLIDQTWK  492

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            KMN+  +   S FS+ F   +MN+AR+AQCMYQHGDG GI  +  ET+  I +L FE
Sbjct  493  KMNRDILRDQS-FSKDFRRTSMNLARIAQCMYQHGDGFGIPDR--ETKDRILSLFFE  546



>pdb|2ONG|A Chain A, Crystal Structure Of Of Limonene Synthase With 2- Fluorogeranyl 
Diphosphate (Fgpp).
 pdb|2ONG|B Chain B, Crystal Structure Of Of Limonene Synthase With 2- Fluorogeranyl 
Diphosphate (Fgpp).
 pdb|2ONH|A Chain A, Crystal Structure Of Of Limonene Synthase With 2- Fluorolinalyl 
Diphosphate(flpp)
 pdb|2ONH|B Chain B, Crystal Structure Of Of Limonene Synthase With 2- Fluorolinalyl 
Diphosphate(flpp)
Length=543

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  371  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  427

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  428  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  487

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  488  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  524



>gb|AGN90902.1| limonene synthase [Mentha arvensis]
 gb|AGN90909.1| limonene synthase [Mentha suaveolens]
Length=599

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  580



>gb|AGN90905.1| limonene synthase [Mentha canadensis]
 gb|AGN90906.1| limonene synthase [Mentha canadensis]
 gb|AGN90907.1| limonene synthase [Mentha canadensis]
 gb|AGN90910.1| limonene synthase [Mentha suaveolens]
 gb|AGN90912.1| limonene synthase [Mentha spicata]
Length=599

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  580



>gb|AGN90903.1| limonene synthase [Mentha x gracilis]
 gb|AGN90904.1| limonene synthase [Mentha x gracilis]
 gb|AGN90913.1| limonene synthase [Mentha spicata]
 gb|AGN90914.1| limonene synthase [Mentha spicata]
Length=600

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  428  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  484

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  485  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  544

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  545  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  581



>gb|AAM53945.1|AF514288_1 (-)-beta-pinene synthase [Citrus limon]
Length=602

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SGY P  +EY+ENAWISI   +ILVH   +  N    E    L  + DY 
Sbjct  428  AYLVEAKWYNSGYIPPLQEYMENAWISIGATVILVHANTFTANPITKE---GLEFVKDYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILR A+D GTS  E+KRGDV K+IQCYM E   S  EAR  I+  + + W K
Sbjct  485  NIIRWSSMILRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQTWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R       S  F+  AMN+ARM+QCMYQ GDGHG  ++   T+  + +L F+
Sbjct  545  MNRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEI-TKARVLSLFFD  599



>gb|AAC37366.1| 4S-limonene synthase [Mentha spicata]
Length=599

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  580



>ref|XP_006365870.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Solanum 
tuberosum]
Length=501

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL E KWY  GYTPT  E++ NAWIS + P++++H +F +   NP +    L CL  Y 
Sbjct  327  AYLLEVKWYQRGYTPTLNEFLRNAWISNTGPVLIMHAYFCI--TNPIK-EDELECLNHYP  383

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II   S+ILRLAND GTSP E+K+GD  K+IQCYM ++K S   AR +I   +++ W K
Sbjct  384  PIIYSPSLILRLANDLGTSPDEIKKGDHLKSIQCYMHDSKCSEENARNYIQKLIDQTWMK  443

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+  +   S FS+ F   +MN+AR++QC+YQHGDG GI  +  ET+  I +L FE
Sbjct  444  MNRDILRDQS-FSKDFRRTSMNLARISQCIYQHGDGFGIPDR--ETKDRILSLFFE  496



>gb|AAD50304.1|AF175323_1 limonene synthase [Mentha longifolia]
Length=599

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A ++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFIGCAADLGRMAQLMYHNGDGHG  580



>gb|AAM89254.1|AF527416_1 3-carene synthase [Salvia stenophylla]
Length=597

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 104/160 (65%), Gaps = 4/160 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY +G+ P  EEY+EN W SI   ++L H FF V +    E    +     YH
Sbjct  421  GFLLEAKWYHNGHKPKLEEYLENGWRSIGSTVVLTHAFFGVTHSLTKE---NIDQFFGYH  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGET-KASVNEARGFIDLEMNEIWK  205
            EI+RLSSM+LRLA+D GTS  E+ RGDVPKAIQCYM +   AS  EAR  +   + E WK
Sbjct  478  EIVRLSSMLLRLADDLGTSTDEVSRGDVPKAIQCYMNDNIGASEAEAREHVKWCIWETWK  537

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI  85
            KMNKVR+   +PFS+ FI  AM + RM Q MY +GDGHGI
Sbjct  538  KMNKVRVARDTPFSQDFIVCAMGMGRMGQYMYHYGDGHGI  577



>gb|AGN90915.1| limonene synthase [Mentha canadensis]
Length=599

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A ++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFIGCAADLGRMAQLMYHNGDGHG  580



>ref|XP_010514206.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=593

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDY-  385
             YL EAKWY  GY P+ EEY+ENAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  416  TYLVEAKWYNRGYKPSVEEYMENAWISISAPTILIHFYCVFSDQISIQ---NLETLSQHR  472

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             +I+R S+ +LRLAND GTS  E+ RGDV K++QCYM E  AS  EAR  +   +++ W 
Sbjct  473  QQIVRCSATVLRLANDLGTSLDELARGDVLKSVQCYMHEMGASEEEAREHVQQMISDTWD  532

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN       S FSR F+EAAMN+ARM+QCMYQ+GDGHG  +K  +T   +Q+LL +
Sbjct  533  DMNDETNAARSSFSRGFVEAAMNLARMSQCMYQYGDGHGCPNKA-KTVDRVQSLLVD  588



>dbj|BAF73933.1| beta-pinene synthase [Citrus jambhiri]
Length=602

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 110/176 (63%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SGY P+ +EY+ENAWISI   +ILVH + +  N    E    L  + DY 
Sbjct  428  AYLVEAKWYNSGYIPSLQEYMENAWISIGSTVILVHAYTFTANPITKE---GLEFVKDYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILR A+D GTS  E+KRGDV K+IQCYM E   S  EAR  I+  + + W K
Sbjct  485  NIIRWSSVILRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQTWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+ R       S  F+  AMN+ARM+QCMYQ GDGHG  ++   T+  + +L  +
Sbjct  545  MNRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEI-TKARVLSLFID  599



>gb|KEH38237.1| monoterpene synthase [Medicago truncatula]
Length=576

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTP+  EY+ENAWISIS P IL H +F + +    E    L CL +  
Sbjct  399  SYLIEAKWYHSGYTPSLGEYLENAWISISAPAILTHAYFVIPHSFKIE---DLVCLEENS  455

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIRLS++ILRLAND GT   E + GD+PK+IQCYM ET AS  EA  ++   M   WKK
Sbjct  456  DIIRLSAIILRLANDLGTYKRENETGDIPKSIQCYMNETGASEVEACEYVKSMMFIEWKK  515

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK    G S FS+ FI+ A+N+ARMA  MY HGDGH I +   E +  I +L+F+
Sbjct  516  MNK-EAHGSS-FSQCFIDTAVNLARMALFMYHHGDGHTIQAP--EIKNRITSLVFQ  567



>ref|XP_006365869.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X1 [Solanum 
tuberosum]
Length=553

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL E KWY  GYTPT  E++ NAWIS + P++++H +F +   NP +    L CL  Y 
Sbjct  379  AYLLEVKWYQRGYTPTLNEFLRNAWISNTGPVLIMHAYFCI--TNPIK-EDELECLNHYP  435

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II   S+ILRLAND GTSP E+K+GD  K+IQCYM ++K S   AR +I   +++ W K
Sbjct  436  PIIYSPSLILRLANDLGTSPDEIKKGDHLKSIQCYMHDSKCSEENARNYIQKLIDQTWMK  495

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+  +   S FS+ F   +MN+AR++QC+YQHGDG GI  +  ET+  I +L FE
Sbjct  496  MNRDILRDQS-FSKDFRRTSMNLARISQCIYQHGDGFGIPDR--ETKDRILSLFFE  548



>ref|NP_189212.1| 1,8-cineole synthase [Arabidopsis thaliana]
 ref|NP_189210.2| 1,8-cineole synthase [Arabidopsis thaliana]
 sp|P0DI76.1|CIN1_ARATH RecName: Full=1,8-cineole synthase 1, chloroplastic; Short=AtTPS-CIN1; 
AltName: Full=Limonene cyclase; AltName: Full=Terpenoid 
synthase 27; Short=AtTPS27; Flags: Precursor [Arabidopsis 
thaliana]
 sp|P0DI77.1|CIN2_ARATH RecName: Full=1,8-cineole synthase 2, chloroplastic; Short=AtTPS-CIN2; 
AltName: Full=Limonene cyclase; AltName: Full=Terpenoid 
synthase 23; Short=AtTPS23; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01180.1| limonene cyclase [Arabidopsis thaliana]
 dbj|BAB01181.1| limonene cyclase [Arabidopsis thaliana]
 gb|AAU01970.1| 1,8-cineole synthase [Arabidopsis thaliana]
 gb|AEE77073.1| 1,8-cineole synthase [Arabidopsis thaliana]
 gb|AEE77075.1| 1,8-cineole synthase [Arabidopsis thaliana]
Length=600

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 115/179 (64%), Gaps = 7/179 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  416  TYLVEAKWYKRGYKPSLEEYMQNAWISISAPTILIHFYCVFSDQISVQ---NLETLSQHR  472

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTSP E+ RGDV K++QCYM ET AS   AR  +   ++++W 
Sbjct  473  QHIVRCSATVLRLANDLGTSPTELARGDVLKSVQCYMHETGASEERARDHVHQMISDMWD  532

Query  204  KMNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN      C  S  SR F EAAMN+ARM+QCMYQ+GDGHG   K  +T   +Q+LL +
Sbjct  533  DMNSETKTACNSSSRSRGFKEAAMNLARMSQCMYQYGDGHGCPEKA-KTIDRVQSLLVD  590



>ref|XP_002875284.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51543.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 117/179 (65%), Gaps = 7/179 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NAWISIS P +L+H +   ++    +   +L  L+ + 
Sbjct  414  TYLVEAKWYKRGYKPSLEEYMQNAWISISAPTVLIHFYCVFSDQISIQ---SLDTLSQHR  470

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTSP E+ RGDV K++QCYM ET AS  +AR  +   +++ W 
Sbjct  471  QKIVRCSATVLRLANDLGTSPDELARGDVVKSVQCYMHETGASEEKAREHVQQMISDTWD  530

Query  204  KMNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN      C  S  SR F+EAAMN+ARM+QCMYQ+GDGHG   K  +T   +++LL +
Sbjct  531  DMNFETKTACNSSLLSRGFVEAAMNLARMSQCMYQYGDGHGFPDKA-KTVGRVRSLLVD  588



>gb|ABR15422.1| limonene synthase [Mentha canadensis]
Length=599

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WKKM
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A ++ RMAQ MY +GDGHG
Sbjct  544  NAERVPKDSPFGKDFIGCAADLGRMAQLMYHNGDGHG  580



>gb|AGN90908.1| limonene synthase [Mentha canadensis]
Length=599

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  427  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  483

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R SS +LRLA+D GTS  E+ RGDVPK++QCYM +  AS  EAR  +   + E+WK+M
Sbjct  484  LVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKRM  543

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + F+  A+++ RMAQ MY +GDGHG
Sbjct  544  NAERVSKDSPFGKDFVGCAVDLGRMAQLMYHNGDGHG  580



>gb|KEH38236.1| monoterpene synthase [Medicago truncatula]
Length=591

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 116/176 (66%), Gaps = 7/176 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTP+  EY+ENAWISIS P IL H +F + +    E    L CL +  
Sbjct  414  SYLIEAKWYHSGYTPSLGEYLENAWISISAPAILTHAYFVIPHSFKIE---DLVCLEENS  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIRLS++ILRLAND GT   E + GD+PK+IQCYM ET AS  EA  ++   M   WKK
Sbjct  471  DIIRLSAIILRLANDLGTYKRENETGDIPKSIQCYMNETGASEVEACEYVKSMMFIEWKK  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK    G S FS+ FI+ A+N+ARMA  MY HGDGH I +   E +  I +L+F+
Sbjct  531  MNK-EAHGSS-FSQCFIDTAVNLARMALFMYHHGDGHTIQAP--EIKNRITSLVFQ  582



>ref|XP_006467491.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X3 [Citrus sinensis]
Length=522

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 8/167 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT EEY++NAWIS+S P+IL+H +  + N    E   AL  L +Y 
Sbjct  343  SFLLEAKWYSSGYIPTLEEYMDNAWISVSGPVILLHAYTLIANPPTKE---ALQFLEEYP  399

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  400  NIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDAREHIRDLITATWMK  459

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGINSKN  73
            MN  +    +P     S  FI  A+N+ARMAQC YQ+GDGH I  K+
Sbjct  460  MNS-KDGDENPDHLLLSNNFIRFAINLARMAQCTYQNGDGHTIQHKS  505



>ref|XP_006369780.1| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
 gb|ERP66349.1| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
Length=558

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY +GYTPT +EY++NAW+S+S  +IL H FF V N    E   A+ C  +Y 
Sbjct  382  AFLKEAKWYYAGYTPTLQEYLDNAWLSVSGQVILGHAFFLVTNQLTEE---AVRCCMEYP  438

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   + E WKK
Sbjct  439  DLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIYETWKK  498

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N V I    PFS+ F+   M++AR AQC Y+ GD +GI  +  ET   + +L+
Sbjct  499  LN-VEILKPYPFSKKFMGIPMDLARTAQCFYEDGDAYGIQDQ--ETHGRLASLI  549



>ref|XP_002298717.2| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
 gb|EEE83522.2| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
Length=559

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY +GYTPT +EY++NAW+S+S  +IL H FF V N    E   A+ C  +Y 
Sbjct  383  AFLKEAKWYYAGYTPTLQEYLDNAWLSVSGQVILGHAFFLVTNQLTEE---AVRCCMEYP  439

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   + E WKK
Sbjct  440  DLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIYETWKK  499

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N V I    PFS+ F+   M++AR AQC Y+ GD +GI  +  ET   + +L+
Sbjct  500  LN-VEILKPYPFSKKFMGIPMDLARTAQCFYEDGDAYGIQDQ--ETHGRLASLI  550



>gb|AAG01140.2| (+)-4R-limonene synthase [Schizonepeta tenuifolia]
Length=620

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            YL E+KW+ SG+ P+ +EY+EN+WIS+S P +L H FF V +    +    L  L +YH+
Sbjct  448  YLMESKWFYSGHKPSLDEYLENSWISVSGPCVLTHEFFGVTDSLAKD---TLDSLYEYHD  504

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            I+R SS +LRLA+D GTS  E+ RGDVPK+IQCYM +  AS  EAR  +   +  +WKKM
Sbjct  505  IVRWSSYLLRLADDLGTSVEEVSRGDVPKSIQCYMNDNNASEEEAREHVKGLIRVMWKKM  564

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            N  R+   SPF + FI    ++ RMAQ MY +GDGHG        Q  I   LF+
Sbjct  565  NAERVSEDSPFCKDFIRCCEDLGRMAQFMYHYGDGHGTQHAKIHQQ--ITDCLFQ  617



>ref|XP_006467489.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|KDO78141.1| hypothetical protein CISIN_1g006994mg [Citrus sinensis]
Length=622

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 8/167 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT EEY++NAWIS+S P+IL+H +  + N    E   AL  L +Y 
Sbjct  443  SFLLEAKWYSSGYIPTLEEYMDNAWISVSGPVILLHAYTLIANPPTKE---ALQFLEEYP  499

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  500  NIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDAREHIRDLITATWMK  559

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGINSKN  73
            MN  +    +P     S  FI  A+N+ARMAQC YQ+GDGH I  K+
Sbjct  560  MNS-KDGDENPDHLLLSNNFIRFAINLARMAQCTYQNGDGHTIQHKS  605



>gb|ABP01684.1| pinene synthase [Rosmarinus officinalis]
Length=599

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL+EAKWY SGYTP+ EEY+ NA ISI+ P I+  + F + N +  ++S  +  L  YH
Sbjct  426  AYLKEAKWYYSGYTPSLEEYLSNAKISIASPNIISQLHFTLANSSTDKWS--IESLYQYH  483

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS M+LRLA+D GT+PFE+KRGDV KAIQC+M +  AS  EA+  +   + E WK+
Sbjct  484  NILNLSGMLLRLADDVGTAPFELKRGDVQKAIQCHMKDRNASEKEAQEHVMFLLREAWKE  543

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    +G  PF+   + AA N+ R+AQ MY  GDGHG+       Q  +  LLFE
Sbjct  544  MNTAMADGY-PFADELVAAAANLGRVAQFMYLEGDGHGVQHSGIHQQ--MAGLLFE  596



>ref|XP_006467490.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO78140.1| hypothetical protein CISIN_1g006994mg [Citrus sinensis]
Length=616

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 8/167 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY+SGY PT EEY++NAWIS+S P+IL+H +  + N    E   AL  L +Y 
Sbjct  437  SFLLEAKWYSSGYIPTLEEYMDNAWISVSGPVILLHAYTLIANPPTKE---ALQFLEEYP  493

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR  SMI RLAND  TS  E+KRGDVPKAIQCYM ET AS ++AR  I   +   W K
Sbjct  494  NIIRWPSMIFRLANDLATSSDEVKRGDVPKAIQCYMHETGASESDAREHIRDLITATWMK  553

Query  201  MNKVRIEGCSP----FSRTFIEAAMNIARMAQCMYQHGDGHGINSKN  73
            MN  +    +P     S  FI  A+N+ARMAQC YQ+GDGH I  K+
Sbjct  554  MNS-KDGDENPDHLLLSNNFIRFAINLARMAQCTYQNGDGHTIQHKS  599



>ref|XP_011015877.1| PREDICTED: terpene synthase 10-like [Populus euphratica]
Length=603

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY +GYTPT +EY++NAW+SIS  +IL H  F V N    E   A+ C  +Y 
Sbjct  417  AFLKEAKWYYAGYTPTLQEYLDNAWLSISGQVILGHALFLVTNQLTEE---AVRCCMEYP  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IRLSS I+RLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   ++E WKK
Sbjct  474  DLIRLSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKK  533

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N   I    PFS+ F+   M++AR AQC Y+ GD +GI  +  ET   + +L 
Sbjct  534  LN-AEILKPYPFSKKFMGIPMDLARTAQCFYESGDAYGIQDQ--ETHGRLASLF  584



>ref|XP_002325741.2| hypothetical protein POPTR_0019s01270g [Populus trichocarpa]
 gb|EEF00123.2| hypothetical protein POPTR_0019s01270g [Populus trichocarpa]
Length=589

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY SGYTPT +EY++NAWIS+  PL +VH +FY +N    E S   H + +Y 
Sbjct  418  SHLLEAKWYYSGYTPTLQEYLDNAWISVGAPLAIVHAYFYASNPTTKEAS---HFMEEYP  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS+ILRLA+D GTS  EMKRGDV K+IQCYM E++AS  EAR  I   ++  WKK
Sbjct  475  DIIRWSSIILRLADDLGTSSDEMKRGDVSKSIQCYMYESEASEEEARDHIRKLISNAWKK  534

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  +       S+T I   +N+AR AQC+YQ+GDGH I  ++ ET+  + +LL +
Sbjct  535  INAYQFSDPH-ISQTIIGVVVNLARAAQCIYQYGDGHAI--EHLETKDRVMSLLIK  587



>gb|AII32476.1| terpene synthase [Populus trichocarpa]
Length=589

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY SGYTPT +EY++NAWIS+  PL +VH +FY +N    E S   H + +Y 
Sbjct  418  SHLLEAKWYYSGYTPTLQEYLDNAWISVGAPLAIVHAYFYASNPTTKEAS---HFMEEYP  474

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SS+ILRLA+D GTS  EMKRGDV K+IQCYM E++AS  EAR  I   ++  WKK
Sbjct  475  DIIRWSSIILRLADDLGTSSDEMKRGDVSKSIQCYMYESEASEEEARDHIRKLISNAWKK  534

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  +       S+T I   +N+AR AQC+YQ+GDGH I  ++ ET+  + +LL +
Sbjct  535  INAYQFSDPH-ISQTIIGVVVNLARAAQCIYQYGDGHAI--EHLETKDRVMSLLIK  587



>ref|NP_189209.2| beta-myrcene/(E)-beta-ocimene synthase 2 [Arabidopsis thaliana]
 sp|Q9LRZ6.1|MYRS2_ARATH RecName: Full=Beta-myrcene/(E)-beta-ocimene synthase 2, chloroplastic; 
AltName: Full=Terpenoid synthase 24; Short=AtTPS24; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA95770.1| limonene cyclase [Arabidopsis thaliana]
 gb|ACL13990.1| At3g25810 [Arabidopsis thaliana]
 gb|AEE77072.1| beta-myrcene/(E)-beta-ocimene synthase 2 [Arabidopsis thaliana]
Length=598

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 108/179 (60%), Gaps = 6/179 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GY P+ EEY++NAWISIS P +L+H  FY               +    
Sbjct  418  AYLVEAKWYKGGYKPSVEEYMQNAWISISAPTMLIH--FYCAFSGQISVQILESLVQQQQ  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R S+ +LRLAND  TSP E+ RGDV K++QCYM ET  S  EAR  +   ++  W +
Sbjct  476  DVVRCSATVLRLANDLATSPDELARGDVLKSVQCYMHETGVSEEEARTHVQQMISHTWDE  535

Query  201  MN---KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN   +      S  SR F+E AMN+ARM+QCMYQHGDGHG   K  +    +QTLL +
Sbjct  536  MNYEARTAARSSSLLSRRFVETAMNLARMSQCMYQHGDGHGCPDKA-KIVDRVQTLLVD  593



>ref|XP_010247894.1| PREDICTED: terpene synthase 10-like [Nelumbo nucifera]
Length=611

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EA+WY +GY PT EEY+ NAWISIS P ILVH +F V N    E   AL  L +Y 
Sbjct  436  TYLVEAQWYYNGYKPTLEEYLNNAWISISAPTILVHNYFCVENKIKEE---ALEQLDNYP  492

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+R S  +LR ++D GTS  E+KRGDVPK+IQCYM ET A    AR  I     + WKK
Sbjct  493  SIVRSSGALLRYSDDLGTSTDELKRGDVPKSIQCYMHETGAPEEIAREHIRGLRAKEWKK  552

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MNK  +   SPF + F ++A  + RMAQ MYQHGDGHG+ + +  T+  I  LL
Sbjct  553  MNKC-MTAPSPFPQAFKDSAAGLGRMAQFMYQHGDGHGLLADSL-TKNRIMPLL  604



>gb|AHY21666.1| multiproduct monoterpene synthase [Populus nigra]
Length=593

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY + YTPT +EY++NAW+SIS  +IL H FF V N    E   A+ C  +Y 
Sbjct  417  AFLKEAKWYYAAYTPTLQEYLDNAWLSISGQVILGHAFFLVTNQLTEE---AVRCCMEYP  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ILRLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   ++E WKK
Sbjct  474  DLIRYSSTILRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKK  533

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N   I    PFS+ F+   M++AR AQC Y+ GD +GI  +  ET   + +L 
Sbjct  534  LN-AEILKPYPFSKKFMGIPMDLARTAQCFYEAGDAYGIQDQ--ETHGRLASLF  584



>gb|AII32470.1| terpene synthase [Populus trichocarpa]
Length=572

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVN-NVNPAEYSAALHCLTDY  385
            A+LQEAKW  +  TP+FEEY+ENAW S+S  +IL+H +F +  N++      AL  L +Y
Sbjct  397  AFLQEAKWSYNNITPSFEEYLENAWRSVSGTVILIHAYFLMGENIS----KQALDYLVNY  452

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             E++R  S+I RL+ND  TS  E+ RG+   +I CYM ET AS  EAR  I+  + + W+
Sbjct  453  DELLRWPSIIFRLSNDLATSSAEIARGETANSISCYMYETGASEAEARKHIEKLIQKAWR  512

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MNK +I+  +PF+R+F+  A+N+AR+AQC YQHGDGHG  + +  ++  I +L+ E
Sbjct  513  NMNKCQIDNETPFARSFVGTAINLARIAQCTYQHGDGHG--APDSRSKNRISSLIIE  567



>ref|XP_007040297.1| Myrcene synthase, chloroplastic, putative [Theobroma cacao]
 gb|EOY24798.1| Myrcene synthase, chloroplastic, putative [Theobroma cacao]
Length=588

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 114/174 (66%), Gaps = 7/174 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            ++L EAKWY SGYTPT  EYI+NAWIS++ P+IL H +   N     + +       +Y 
Sbjct  415  SFLLEAKWYYSGYTPTLREYIDNAWISVTAPVILSHAYVLTN----LKTNECFESFEEYS  470

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II  SS+I RLAND  TS  E+KRGDVPK+IQCYM ET AS  EAR  I   ++  W++
Sbjct  471  NIIYCSSIIFRLANDLATSSDELKRGDVPKSIQCYMHETGASEEEARRHIWKLIDATWRR  530

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            MN+ +I G S F R FI+ A+N+AR AQ MYQH DG+G+  ++ ET+  + +L 
Sbjct  531  MNEEQIVG-SRFPRPFIQIAVNLARTAQFMYQHHDGYGV--EDGETKERVLSLF  581



>dbj|BAD27260.1| beta-pinene synthase [Citrus unshiu]
Length=602

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SGY P  +EY+ENAWISI   +ILVH   +  N    E    L  + DY 
Sbjct  428  AYLVEAKWYNSGYIPPLQEYMENAWISIGATVILVHANTFTANPITKE---GLEFVKDYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILR A+D GTS  E+KRGDV K+IQCYM E   S  EAR  I+  + + W K
Sbjct  485  NIIRWSSVILRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQTWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+ R       S  F+  AMN+ARM+QCMYQ GDGHG  ++   T+  + +L F+
Sbjct  545  INRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEI-TKARVLSLFFD  599



>ref|XP_010315132.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=528

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 106/166 (64%), Gaps = 5/166 (3%)
 Frame = -2

Query  531  SGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHEIIRLSSMIL  352
            SGY P+ EEY+EN WI+I  P++LVH  F V N    E   AL  LT Y +II+ S+ I+
Sbjct  361  SGYKPSLEEYMENGWITIGAPVVLVHTLFLVTNPITKE---ALESLTSYPDIIQCSATII  417

Query  351  RLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKMNKVRIEGCS  172
            RL +D GTS  EM+RGDVPK+IQCYM E   S  +AR  I+L + E WK MN    +  S
Sbjct  418  RLTDDLGTSSDEMERGDVPKSIQCYMNEKGVSEEDARKHINLLIKETWKLMNTALQKENS  477

Query  171  PFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             FS TFI  A+N AR +  +YQHGDG+GI  +N  T+  I+ L FE
Sbjct  478  LFSETFIACAVNGARTSHTIYQHGDGYGI--QNLHTKNRIRQLFFE  521



>ref|XP_002309854.2| hypothetical protein POPTR_0007s02920g [Populus trichocarpa]
 gb|EEE90304.2| hypothetical protein POPTR_0007s02920g [Populus trichocarpa]
Length=585

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVN-NVNPAEYSAALHCLTDY  385
            A+LQEAKW  +  TP+FEEY+ENAW S+S  +IL+H +F +  N++      AL  L +Y
Sbjct  410  AFLQEAKWSYNNITPSFEEYLENAWRSVSGTVILIHAYFLMGENIS----KQALDYLVNY  465

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             E++R  S+I RL+ND  TS  E+ RG+   +I CYM ET AS  EAR  I+  + + W+
Sbjct  466  DELLRWPSIIFRLSNDLATSSAEIARGETANSISCYMYETGASEAEARKHIEKLIQKAWR  525

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MNK +I+  +PF+R+F+  A+N+AR+AQC YQHGDGHG  + +  ++  I +L+ E
Sbjct  526  NMNKCQIDNETPFARSFVGTAINLARIAQCTYQHGDGHG--APDSRSKNRISSLIIE  580



>ref|XP_006369784.1| hypothetical protein POPTR_0001s31570g [Populus trichocarpa]
 gb|ERP66353.1| hypothetical protein POPTR_0001s31570g [Populus trichocarpa]
Length=593

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY +GYTPT +EY++NAW+S+S  +I+ H FF V N    E   A+ C  +Y 
Sbjct  417  AFLKEAKWYYAGYTPTLQEYLDNAWLSVSGQVIIGHAFFLVTNQLTDE---AVRCCMEYP  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   ++E WKK
Sbjct  474  DLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKK  533

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N   I    PFS+ F+   M++AR AQC Y+ GD +GI  +  ET   + +L+
Sbjct  534  LN-AEILKPYPFSKKFMGIPMDLARTAQCFYEDGDAYGIQDQ--ETHGRLASLI  584



>gb|ADX01381.1| pinene synthase [Citrus hystrix]
Length=602

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 107/175 (61%), Gaps = 4/175 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SGY P  +EY+ENAWISI   +ILVH   +  N    E    L  + DY 
Sbjct  428  AYLVEAKWYNSGYIPPLQEYMENAWISIGATVILVHANTFTANPITKE---GLEFVKDYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILR A+D GTS  E+KRGDV K+IQCYM E   S  EAR  I+  + + W K
Sbjct  485  NIIRWSSVILRFADDLGTSSDELKRGDVHKSIQCYMHEAGVSEGEAREHINDLIAQTWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            MN+ R       S  F+  AMN+ARM+QCMYQ GDGHG  ++   T+  +  L F
Sbjct  545  MNRDRFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHGCGAQEI-TKDRVLPLFF  598



>gb|AGN90911.1| limonene synthase [Mentha spicata]
Length=600

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+W+  G+ P+ EEY+EN+W SIS P +L H+FF V +    E    +  L  YH+
Sbjct  428  YMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKE---TVDSLYKYHD  484

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R S  +LRLA+D GTS  E+ RGDVPK++QCYM    AS  EAR  +   + E+WKKM
Sbjct  485  LVRWSPFVLRLADDLGTSVEEVSRGDVPKSLQCYMSVYNASEAEARKHVKWLIAEVWKKM  544

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            N  R+   SPF + FI  A+++ RMAQ MY +GDGHG
Sbjct  545  NAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHG  581



>gb|AAF76186.1| mercene synthase [Perilla frutescens]
Length=608

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 108/176 (61%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKW+  GY P  EEY+ N WIS+S P IL HVFF V +    E    +  L  YH
Sbjct  425  AYLVEAKWFYGGYKPNLEEYLNNGWISVSGPAILCHVFFGVTDSITME---TVESLFKYH  481

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS ++RLA+D  TS  E+ RGDVPK+IQCYM +  AS  EAR  +   + E WK+
Sbjct  482  DLIRCSSTLVRLADDLATSLDEVSRGDVPKSIQCYMNDNNASEEEARLHVRWLIAETWKE  541

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN   +   SPF + FI  A ++ RMAQ MY +GDGHG+  +N +    +   LF+
Sbjct  542  MNVEMVSADSPFCKDFIACAADMGRMAQYMYHNGDGHGM--QNSQIHQQMTDFLFQ  595



>emb|CAN82377.1| hypothetical protein VITISV_019347 [Vitis vinifera]
Length=516

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 110/178 (62%), Gaps = 23/178 (13%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GYT    E+I N WISIS P+IL                 AL  L  Y 
Sbjct  357  SYLLEAKWYYGGYTLALREHISNTWISISGPVIL----------------EALQSLERYQ  400

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILRL++D GTS  E+KRGDVPK+IQC+M ET  S  +AR  I   + E WKK
Sbjct  401  NIIRWSSMILRLSDDLGTSLHELKRGDVPKSIQCHMYETGGSEEDARKHISYLIGETWKK  460

Query  201  MNKVRIEGC--SPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G   SPF  TFI  A N+AR AQCMYQHGDGHGI  ++ ET+  + +LL +
Sbjct  461  LNE---DGAVESPFLETFIGIATNLARKAQCMYQHGDGHGI--EDGETKDRVLSLLVD  513



>gb|AAO85532.1| monoterpene synthase [Arabidopsis thaliana]
Length=598

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 109/179 (61%), Gaps = 6/179 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GY P+ EEY++NAWISIS P +L+H  FY    +          +    
Sbjct  418  AYLVEAKWYKGGYKPSVEEYMQNAWISISAPTMLIH--FYCAFSDQISVQILESLVQQQQ  475

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R S+ +LRLAND  TSP E+ RGDV K++QCYM ET  S  EAR  +   ++  W +
Sbjct  476  DVVRCSATVLRLANDLATSPDELARGDVLKSVQCYMHETGVSEEEARTHVQQMISHTWDE  535

Query  201  MN---KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN   +      S  SR F+E AMN+ARM+QCMYQHGDGHG   K  +    +QTLL +
Sbjct  536  MNYEARTVARISSLLSRGFVETAMNLARMSQCMYQHGDGHGCPDKA-KIVDRVQTLLVD  593



>ref|XP_009791411.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana sylvestris]
Length=608

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEA+WY  GY PT EEY++NAWIS+   +I+ + FF+V N    E   AL  L+ Y 
Sbjct  432  AYLQEARWYYKGYIPTLEEYMDNAWISVGSLVIVFNAFFFVTNPITKE---ALEYLSKYP  488

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I+RLA+D  T+  EMKRGDV K+IQCYM E   S  +AR  I   +NE WK 
Sbjct  489  DIIRWSATIIRLADDLATTSDEMKRGDVAKSIQCYMNEKGVSEEDARKHISSLINETWKL  548

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  + E  S FS  FI   +NIAR  Q +YQ+GDGHGI +   E +     L FE
Sbjct  549  INTAQREN-SIFSEAFIRCGVNIARTGQSIYQYGDGHGIQNSMIENRN--SELFFE  601



>gb|AIE41599.1| beta-myrcene synthase [Artemisia annua]
Length=586

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +++ EA WY SG+ PT EEY+EN  ISIS P+IL+HV F + +++ AE    + C+    
Sbjct  412  SFVVEANWYQSGHIPTLEEYLENGCISISGPVILMHVHF-ITSISSAE--EIMQCMEISK  468

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R SS+I RL +D GTS  EM+RGD PK++QCYM ET AS +EAR ++   + E WKK
Sbjct  469  DIVRYSSLIFRLTDDLGTSSGEMERGDNPKSLQCYMHETGASEDEARIYMKSLIGETWKK  528

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLF  37
            +NK R    S  +R FI+ A N+ RMAQ MY  GD HG   +   T++H+ +LLF
Sbjct  529  LNKERTHASSDITREFIDFATNLVRMAQFMYGEGDVHG---RPDVTKSHVLSLLF  580



>ref|XP_008461031.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=380

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 7/174 (4%)
 Frame = -2

Query  549  EAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHEIIR  370
            EAKWY + Y PTFEEY+ENAWIS+S  L+LVH + +  N    E   AL CL  Y  IIR
Sbjct  210  EAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFTTNSLTIE---ALECLQFYPNIIR  266

Query  369  LSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKMN-K  193
             SS+I RLAND  +S  E KRG+V K+IQCYM +T AS  EAR ++   + E WKK+N +
Sbjct  267  YSSIIFRLANDLASSSEEAKRGEVAKSIQCYMNDTGASEQEARRYLKDFIMESWKKLNEE  326

Query  192  VRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            V+    SP  S++FIE A+N+AR++  +YQH DGH +  ++ ET+  + +L  +
Sbjct  327  VQTLNNSPLLSKSFIEIALNVARISHTVYQHRDGHTV--EDHETKDRVLSLFIK  378



>ref|XP_010514205.1| PREDICTED: beta-myrcene/(E)-beta-ocimene synthase 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=596

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 108/179 (60%), Gaps = 6/179 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GY P+ EEY++NAWISIS P +L+H  FY    +          +    
Sbjct  416  AYLLEAKWYKGGYKPSLEEYMQNAWISISAPTMLIH--FYCAFPDEISIQVLESLVQQRQ  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R S+ +LRLAND  TS  E+ RGDV K++QCYM ET AS  EAR  +   +   W +
Sbjct  474  QVVRCSASVLRLANDLATSSDELARGDVLKSVQCYMHETGASEEEAREHVQQMIRHTWNE  533

Query  201  MN---KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN   +      S  S+ F+E AMN+ARM+QCMYQHGDGHG   K  +    IQTL+ +
Sbjct  534  MNYEARTATRSSSLLSQDFVEVAMNLARMSQCMYQHGDGHGCPDKA-KVVDRIQTLIVD  591



>gb|AFQ23190.1| alpha-pinene synthase [Gossypium hirsutum]
 gb|AGX84977.1| terpene synthase [Gossypium hirsutum]
Length=595

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EA+WY  GY P  +EYI+NAWISIS P++L H +   N+V        L    +YH
Sbjct  419  SYMLEARWYYIGYKPNLQEYIDNAWISISGPVLLGHAYLETNHVT----KEGLQTFEEYH  474

Query  381  -EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
              IIR SS +LRLAND  TS +E+KRGD+PK+IQCYM ET  S  EAR  I   ++  WK
Sbjct  475  PNIIRWSSTVLRLANDLATSSYEIKRGDIPKSIQCYMHETGRSEEEAREHIKKLIDATWK  534

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI  85
             MN+ R+   S  S+ F E AMN+AR++  +YQ+ DGHGI
Sbjct  535  NMNRDRMAAKSLSSQMFFETAMNLARVSMLVYQNDDGHGI  574



>gb|ACM89961.1| 1,8 cineole synthase 2 [Salvia fruticosa]
Length=596

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SG+ P  EEY+  +WISI   +IL H FF V      E S AL+    YH
Sbjct  424  AYLVEAKWYHSGHKPNLEEYLNTSWISIGGTVILTHAFFRVTESLTKEASDALY---GYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +++R SS+ILRLA+D GTS  E+ RGDVPK+IQCYM +  AS  +AR  +   + E WKK
Sbjct  481  DLVRWSSVILRLADDLGTSVDEVSRGDVPKSIQCYMNDHNASEAQARDHVKWMIAETWKK  540

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGIN  82
            +N+ R+    PF + FI  A+++ R  Q MY +GDGHGI 
Sbjct  541  INQERVAMDPPFCQDFIACAVDMGRKTQYMYHYGDGHGIQ  580



>ref|XP_006369785.1| hypothetical protein POPTR_0001s31580g [Populus trichocarpa]
 gb|ERP66354.1| hypothetical protein POPTR_0001s31580g [Populus trichocarpa]
Length=501

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY +GYTPT +EY++NAW+SIS  +IL H FF V N    E   A+ C  +Y 
Sbjct  325  AFLKEAKWYYAGYTPTLQEYLDNAWLSISGQVILGHAFFLVTNQLTEE---AVRCCMEYP  381

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   ++E WKK
Sbjct  382  DLIRYSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKK  441

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N   I    PFS+ F+   M++AR AQ  Y+ GD +GI  +  ET   + +L 
Sbjct  442  LN-AEILKPYPFSKKFMGIPMDLARTAQSFYEAGDAYGIQDQ--ETHGRLVSLF  492



>ref|XP_006484917.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like [Citrus 
sinensis]
Length=602

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 101/158 (64%), Gaps = 3/158 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAK Y +GY PT +EY+ENAWISIS P+ILVH + Y  N    E    L  + DY 
Sbjct  428  TYLVEAKSYNNGYIPTLQEYMENAWISISAPVILVHAYTYTANPITKE---GLEFVKDYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+ILRLA+D GTS  E+KRGDV K+IQCYM E   S  EAR  I   + + W K
Sbjct  485  NIIRWSSIILRLADDLGTSLDELKRGDVHKSIQCYMHEAGVSEREAREHIHDLIAQTWMK  544

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN  +       S  F+  AMN+ARM+QCMYQ GDGHG
Sbjct  545  MNSDQFGNPHFVSDVFVGIAMNLARMSQCMYQFGDGHG  582



>ref|XP_011009237.1| PREDICTED: terpene synthase 10-like [Populus euphratica]
Length=549

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 107/155 (69%), Gaps = 6/155 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY  GYTPT +EY++NAWISI+ P+ILVH +FYV+N    E   A   + +Y 
Sbjct  395  SYLLEAKWYFGGYTPTLQEYMDNAWISIAAPVILVHAYFYVSNPTTEE---ASQFMEEYA  451

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR SSMILRLA+D GTS  E+KRGD+ K+IQCYM E  AS  +A   I   +   WKK
Sbjct  452  DIIRWSSMILRLADDLGTSTDELKRGDISKSIQCYMHEAAASEEKASDHIRNLIGNTWKK  511

Query  201  MNKVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHG  100
            +N  +    +P  S+TFI  A+N+ARMAQCMYQ+ 
Sbjct  512  INDYQF--INPHISQTFIGIAINLARMAQCMYQYS  544



>gb|AFZ41794.1| putative cineole synthase, partial [Rosmarinus officinalis]
Length=593

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 116/177 (66%), Gaps = 8/177 (5%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EA WY +G+ P+ EEYIENAWISI    IL H+FF + +    E   ++H    YH
Sbjct  421  SYLIEADWYYNGHKPSLEEYIENAWISIGGIPILSHLFFQLTDSIEEEAVESMH---KYH  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R S  ILRLA+D GTS  E++RGDVPK++QCYM E  AS  EAR  +   + + WK 
Sbjct  478  DIVRASCTILRLADDMGTSLDEVERGDVPKSVQCYMNEKNASEEEAREHVRSLIEQTWKT  537

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQH-GDGHGINSKNFETQTHIQTLLFE  34
            MNK  +   SPFS+ F+EAA N+ RMAQC+YQH  DG G+  ++      +++LLF+
Sbjct  538  MNKEMM--MSPFSKYFVEAAANLGRMAQCIYQHERDGFGM--QHSLVNKMLRSLLFD  590



>gb|AIU39887.1| terpene synthase [Gossypium hirsutum]
Length=590

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 110/177 (62%), Gaps = 12/177 (7%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY SGY PT  EY++NAWISI+ PL++ HVF   N            CL  + 
Sbjct  418  AYLVEAKWYYSGYIPTLNEYMDNAWISIAVPLVISHVFSSSNLTTKK-------CLEYWK  470

Query  381  E---IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEI  211
            E   +I  S++I RLA+D GTS  E+KRGDVPK+IQCYM ET  S  +AR ++   ++  
Sbjct  471  EDSNLIYSSAIIFRLADDLGTSMDELKRGDVPKSIQCYMHETGCSEVKAREYVKKLIDAT  530

Query  210  WKKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            WK+MN   +   SP S  F   A+N+ R+AQCMYQ+GD HGI  +  +T  H+  LL
Sbjct  531  WKRMNGEYLMSQSPLSLPFKHIALNLVRIAQCMYQYGDNHGIEDQ--KTNDHVLLLL  585



>ref|XP_006388836.1| hypothetical protein POPTR_0092s00200g [Populus trichocarpa]
 gb|ERP47750.1| hypothetical protein POPTR_0092s00200g [Populus trichocarpa]
Length=593

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKWY +GYTPT +EY++NAW+SIS  +IL H FF V N    E   A+ C  +Y 
Sbjct  417  AFLKEAKWYYAGYTPTLQEYLDNAWLSISGQVILGHAFFLVTNQLTEE---AVRCCMEYP  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++IR SS I+RLA+D GTS  E+ RGD PK+IQCYM ET A+  EAR  +   ++E WKK
Sbjct  474  DLIRHSSTIVRLADDLGTSSDEIARGDNPKSIQCYMHETGATEQEAREHVRYLIHETWKK  533

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N   I    PFS+ F+   M++AR AQ  Y+ GD +GI  +  ET   + +L 
Sbjct  534  LN-AEILKPYPFSKKFMGIPMDLARTAQSFYEAGDAYGIQDQ--ETHGRLASLF  584



>emb|CAN64328.1| hypothetical protein VITISV_027228 [Vitis vinifera]
Length=570

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 109/176 (62%), Gaps = 26/176 (15%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EAKWY SGYTP+ +EYI N+WISIS P+ILVH +F V N    E   AL  L  YH
Sbjct  413  SYLLEAKWYYSGYTPSLQEYISNSWISISGPVILVHAYFLVANPITKE---ALQSLERYH  469

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SSMILRL++D GTS  E+KRGDVPK+IQCYM ET AS  EAR  I   + + WKK
Sbjct  470  NIIRWSSMILRLSDDLGTSLDELKRGDVPKSIQCYMYETGASEEEARKHISYLIVDTWKK  529

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N+   +G                  A  MYQHGDGHGI     ET+  + +LL E
Sbjct  530  LNE---DG------------------AVFMYQHGDGHGIEYG--ETEDRVLSLLVE  562



>gb|AIU39888.1| terpene synthase [Gossypium hirsutum]
Length=598

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 114/174 (66%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GYTPT +EYI+NAWISI C L+L H +   +++        LH + + +
Sbjct  422  AYLVEAKWYYIGYTPTLKEYIDNAWISIGCYLMLAHAYLVTSHIT----EEGLHNIQENY  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
              +   S+I RL+ND GTS +E+KRGDVPK++QCYM E+ AS  EAR  I   ++  WKK
Sbjct  478  IGVYQPSIITRLSNDLGTSSYELKRGDVPKSVQCYMYESGASEEEAREHIRKLIDAAWKK  537

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N+ ++    PFS TFIE+  NIAR++  MYQ+GDGHG   ++ E +  + +L 
Sbjct  538  INEDQMAKL-PFSPTFIESTKNIARVSLLMYQNGDGHGHGMEDKEYKKRVLSLF  590



>ref|XP_004233802.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum lycopersicum]
Length=538

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL E KWY  GYTP+ +E++ NAWI+ + P++++H +F +   NP +    L  L  Y 
Sbjct  364  AYLLEVKWYQRGYTPSLDEFLRNAWITNTGPVLIMHAYFCI--TNPIK-EDELQRLNHYP  420

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II   S+ILRLAND  TSP E+K+GD  K+IQCYM ++K+    AR +I   ++E WKK
Sbjct  421  AIIYSPSLILRLANDLATSPDEIKKGDYLKSIQCYMHDSKSCEENARNYIKKLIDETWKK  480

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+  +   S  S+ F   +MN+AR+AQCMYQHGDG GI  +  ET+  I +L F+
Sbjct  481  MNRDILRDES-LSKDFRRTSMNLARIAQCMYQHGDGFGIPDR--ETKDRILSLFFQ  533



>gb|AEP82768.1| terpene synthase [Solanum lycopersicum]
Length=546

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL E KWY  GYTP+ +E++ NAWI+ + P++++H +F +   NP +    L  L  Y 
Sbjct  372  AYLLEVKWYQRGYTPSLDEFLRNAWITNTGPVLIMHAYFCI--TNPIK-EDELQRLNHYP  428

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II   S+ILRLAND  TSP E+K+GD  K+IQCYM ++K+    AR +I   ++E WKK
Sbjct  429  AIIYSPSLILRLANDLATSPDEIKKGDYLKSIQCYMHDSKSCEENARNYIKKLIDETWKK  488

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN+  +   S  S+ F   +MN+AR+AQCMYQHGDG GI  +  ET+  I +L F+
Sbjct  489  MNRDILRDES-LSKDFRRTSMNLARIAQCMYQHGDGFGIPDR--ETKDRILSLFFQ  541



>ref|XP_009593950.1| PREDICTED: (-)-camphene/tricyclene synthase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=608

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 111/176 (63%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYLQEA+WY  GY PT EEY++NAWI++   +I+ + FF+V N    E   AL  L+ Y 
Sbjct  432  AYLQEARWYYEGYIPTLEEYMDNAWITVGSLVIVFNAFFFVTNPITKE---ALKYLSKYP  488

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +IIR S+ I+RLA+D  T+  EMKRGDV K+IQCYM E   S  +A+  I   + E WK 
Sbjct  489  DIIRWSATIIRLADDLATTSDEMKRGDVAKSIQCYMNEKGVSEEDAKKHISSLIKETWKL  548

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N  + E  S FS  FI  A+NIAR  Q +YQ+GDGHGI  +N+  +     L FE
Sbjct  549  INTAQREN-SIFSEAFIRCAVNIARTGQSIYQYGDGHGI--QNYMIKNRNSELFFE  601



>ref|XP_010425234.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=594

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 116/178 (65%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY+ENAWISIS P IL+H F+ V +   + ++  L  L+ + 
Sbjct  417  TYLVEAKWYNRGYKPSVEEYMENAWISISAPTILIH-FYCVFSDQISIHN--LETLSQHQ  473

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAN  GTSP E+ RGDV K++QCYM ET A   EAR  +   ++  W 
Sbjct  474  QHIVRCSATVLRLANYLGTSPDELARGDVLKSVQCYMHETGALEEEARAHVQQMISHTWY  533

Query  204  KMN-KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +MN + R   CS  SR  +E AMN+ARM+QCMYQHGDGHG   K  +    +QTLL +
Sbjct  534  EMNYEARTATCS-LSRGLVEVAMNLARMSQCMYQHGDGHGSPDKA-KIVDRVQTLLVD  589



>ref|XP_009152106.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Brassica 
rapa]
Length=601

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY PT +EYI+NAWISIS   IL+H  FY    +               
Sbjct  416  TYLVEAKWYKKGYKPTVKEYIQNAWISISGQTILIH--FYCGFSDQISVQILETLAQHRQ  473

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R S+ ILRLAND  TSP E+ RGDV K++QCYM ET A+  EA+  +   + + W++
Sbjct  474  DIVRCSATILRLANDLATSPDELARGDVLKSVQCYMHETGATEEEAQAHVQQMICDTWEE  533

Query  201  MN-KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN + ++ G S   R F+EAAMN+ARMAQC+YQ+GDGHG
Sbjct  534  MNYEAKMAGTSSLPRGFVEAAMNVARMAQCIYQYGDGHG  572



>ref|XP_006292532.1| hypothetical protein CARUB_v10018762mg [Capsella rubella]
 gb|EOA25430.1| hypothetical protein CARUB_v10018762mg [Capsella rubella]
Length=594

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 117/180 (65%), Gaps = 8/180 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NAWISIS P IL+H +   ++    +    L  L+ + 
Sbjct  414  TYLVEAKWYNRGYKPSVEEYMQNAWISISAPTILIHFYCCFSDQISVQ---DLEALSQHR  470

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R S+ +LRLAND GTS  E+ RGDV K++QCYM +T AS  EAR  +   + + W 
Sbjct  471  QHIVRCSATVLRLANDLGTSSDELARGDVLKSVQCYMHDTGASEEEAREHVHQMIIDTWD  530

Query  204  KMNKVRIEGC--SP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MN    E    SP FSR F+EAAMN+ARM+QCMYQ+GDGHG  SK  +T   +++LL +
Sbjct  531  DMNYETKETARRSPLFSRGFMEAAMNLARMSQCMYQYGDGHGCPSKA-KTIDRVESLLVD  589



>emb|CDX76827.1| BnaC08g34130D [Brassica napus]
Length=559

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVF-FYVNNVNPAEYSAALHCLTDY  385
            AYL EAKW+   + P+ EEY++NAWISIS P IL H +  + + ++    S  L  L+ +
Sbjct  381  AYLVEAKWHKKKHKPSVEEYMQNAWISISAPTILAHFYCVFSDKIS----SQVLETLSRH  436

Query  384  HE-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIW  208
             + ++R S+++LRLAND GTSP E+KRGDV K++QCYM ET AS  ++R +++  ++  W
Sbjct  437  QQHVVRCSAIVLRLANDLGTSPDELKRGDVLKSVQCYMNETGASEEKSRAYVEDMISNTW  496

Query  207  KKMNKVRIE-GCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
             +MN   I    S   R F+EAA+N+ARM+QCMYQ+GDGHG   K       + TL+
Sbjct  497  NEMNNEIISHDSSLLPRGFVEAAINLARMSQCMYQYGDGHGSPEKAKTVDRILSTLV  553



>ref|XP_008460928.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Cucumis 
melo]
Length=536

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY + Y PTFEEY+ENAWIS+S  L+LVH + +  N    E   AL CL  Y 
Sbjct  362  TFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFTTNSLTIE---ALECLQLYP  418

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RLAND  +S  E KRG+V K+IQCYM +T AS  EAR +I   + E WKK
Sbjct  419  NIIRYSSIIFRLANDLASSSEEAKRGEVAKSIQCYMNDTGASEQEARRYIKDLIMESWKK  478

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N +V+    SP   + FIE A+N+AR++  +YQH DGH +  ++ ET+  + +L  +
Sbjct  479  LNEEVQTLNNSPLLLKDFIEIALNLARISHTVYQHRDGHTV--EDHETKDRVLSLFMK  534



>emb|CDY13590.1| BnaA06g33330D [Brassica napus]
Length=683

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY PT +EYI+NAWISIS   IL+H  FY    +               
Sbjct  498  TYLVEAKWYKKGYKPTVKEYIQNAWISISGQTILIH--FYCGFSDQISVQILETLAQHRQ  555

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R S+ ILRLAND  TSP E+ RGDV K++QCYM ET A+  EA+  +   + + W++
Sbjct  556  DIVRCSATILRLANDLATSPDELARGDVLKSVQCYMHETGATEEEAQAHVQQMICDTWEE  615

Query  201  MN-KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN + ++ G S   R F+EAAMN+ARMAQC+YQ+GDGHG
Sbjct  616  MNYEAKMAGTSSLPRGFVEAAMNVARMAQCIYQYGDGHG  654



>gb|ABI20515.1| cinenol synthase [Rosmarinus officinalis]
Length=593

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 106/160 (66%), Gaps = 6/160 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL EA WY +G+ P+ EEYIENAWISI    IL H+FF + +    E   ++H    YH
Sbjct  421  SYLIEADWYYNGHKPSLEEYIENAWISIGGIPILSHLFFQLTDSIEEEAVESMH---KYH  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+R S  ILRL +D GTS  E++RGDVPK++QCYM E  AS  EAR  +   + + WK 
Sbjct  478  DIVRASCTILRLPDDLGTSLDEVERGDVPKSVQCYMNEKNASEEEAREHVRSLIEQTWKT  537

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQH-GDGHGI  85
            MNK  +   SPFS+ F+EAA N+ RMAQC+YQH  DG G+
Sbjct  538  MNKEMM--MSPFSKYFVEAAANLGRMAQCIYQHERDGFGM  575



>ref|XP_004171730.1| PREDICTED: myrcene synthase, chloroplastic-like [Cucumis sativus]
Length=201

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY + Y PTFEEY+ENAWIS+S  L+LVH + + +     E   AL CL DY 
Sbjct  27   TFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFTSKSLTTE---ALECLQDYP  83

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RL ND  +   E KRG+V  +IQC M +T AS  EAR +I+  + E WKK
Sbjct  84   NIIRYSSIIFRLTNDLASLSEEAKRGEVANSIQCLMNDTGASEQEARLYIEDLIVESWKK  143

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N +V+    SP  S+ FIE  +N+AR++  +Y+H DGH +  ++ E++  + +L  +
Sbjct  144  LNDEVQTWNNSPLLSKGFIEIVLNVARISHTVYEHRDGHTV--EDHESKDRVLSLFIK  199



>gb|KHG18659.1| Myrcene synthase, chloroplastic [Gossypium arboreum]
Length=598

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GYTPT +EYI+N WISI C L+L H +   +++        LH + + +
Sbjct  422  AYLVEAKWYYIGYTPTLKEYIDNTWISIGCYLMLAHAYLVTSHIT----EEGLHNIQENY  477

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
              +   S+I RL+ND GTS +E+KRGDVPK++QCYM E+ AS  EAR  I   ++  WKK
Sbjct  478  IGVYQPSIITRLSNDLGTSSYELKRGDVPKSVQCYMYESGASEEEAREHIRKLIDAAWKK  537

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +N+ ++    PFS TFIE+  NIAR++  MYQ+GDGHG   ++ E +  + +L 
Sbjct  538  INEDQMAKL-PFSPTFIESTKNIARVSLLMYQNGDGHGHGMEDKEYKKRVLSLF  590



>ref|XP_010514210.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=595

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 7/179 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NA ISIS P IL+H  FY    +    +  L  L+ + 
Sbjct  416  TYLVEAKWYKRGYKPSLEEYMQNARISISAPTILIH--FYCTFSDQIS-TQILESLSQHR  472

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + +IR S+++LRLAND  TSP EM RGDV K++QCYM E  AS   AR  +   +++ W 
Sbjct  473  QHVIRCSAVVLRLANDLATSPDEMTRGDVLKSVQCYMHENGASQEHARAHVQQMISDTWD  532

Query  204  KMNKVRIEG--CSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +MN   I     S  S  F+EAAMN+ARM+QCMYQHGDGHG   K  +T   +Q+L+ +
Sbjct  533  EMNYETITAGRSSSLSIGFVEAAMNLARMSQCMYQHGDGHGSPDKA-KTVDRVQSLIVD  590



>ref|XP_004150683.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=561

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY S Y PTFEEY+ENAWIS+S  L+LVH + + +     E   AL CL  Y 
Sbjct  387  TFLTEAKWYYSNYKPTFEEYLENAWISVSGSLLLVHAYVFTSKSLTIE---ALECLQHYP  443

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RLAND  +S  E KRG+V K+IQCYM +T AS  EAR +I   + + WKK
Sbjct  444  NIIRYSSIIFRLANDLASSSEEAKRGEVAKSIQCYMNDTGASEQEARRYIKDLIMKSWKK  503

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N +V+    SP   + FIE A+N+AR++  +YQH DGH I  ++ ET+  + +L  +
Sbjct  504  LNEEVQTLNNSPLLCKGFIEIALNLARISHTVYQHRDGHTI--EDHETKDRVLSLFIK  559



>ref|XP_011090121.1| PREDICTED: (+)-epi-alpha-bisabolol synthase-like [Sesamum indicum]
Length=543

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 114/175 (65%), Gaps = 6/175 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            Y+ EA+WY SGY P+ +E++ N W+S++ PL LVH +F + N    E    L  L  + E
Sbjct  370  YMVEAQWYHSGYKPSLKEFLGNGWVSVAGPLFLVHAYFSMTNPLKDE---PLEDLQKHPE  426

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            I++ +S++ RLA+D GTS  E+KRGD PK+IQCYM +T     ++R FI   +   WKK+
Sbjct  427  IVKWTSLVCRLADDLGTSSDELKRGDSPKSIQCYMHDTGCCEEDSRSFIKNLIESTWKKI  486

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            NK  I     +S+ FI+A++N AR++QCMYQ+GDGHGI  +  E++  I  LL E
Sbjct  487  NK-DILMNHDYSKDFIKASINFARISQCMYQYGDGHGIPDR--ESKARILALLIE  538



>ref|XP_008460927.1| PREDICTED: terpene synthase 10-like isoform X1 [Cucumis melo]
Length=602

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY + Y PTFEEY+ENAWIS+S  L+LVH + +  N    E   AL CL  Y 
Sbjct  428  TFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFTTNSLTIE---ALECLQLYP  484

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RLAND  +S  E KRG+V K+IQCYM +T AS  EAR +I   + E WKK
Sbjct  485  NIIRYSSIIFRLANDLASSSEEAKRGEVAKSIQCYMNDTGASEQEARRYIKDLIMESWKK  544

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N +V+    SP   + FIE A+N+AR++  +YQH DGH +  ++ ET+  + +L  +
Sbjct  545  LNEEVQTLNNSPLLLKDFIEIALNLARISHTVYQHRDGHTV--EDHETKDRVLSLFMK  600



>gb|EPS65936.1| mercene synthase, partial [Genlisea aurea]
Length=548

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 111/176 (63%), Gaps = 4/176 (2%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y++EA WY++GYTP  EEYI+NAWIS+S PL+L H + ++    P    A      + H
Sbjct  373  SYMKEAMWYSTGYTPNLEEYIDNAWISVSGPLVLTHSYVFL--AKPISDEAIRRLSENPH  430

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            ++I    +++RLAND GTSP EM+RGDV K+IQC   ET +S+ EAR  +   MNE WK+
Sbjct  431  DLIMNVGLVMRLANDLGTSPDEMERGDVAKSIQCCARETGSSIEEARERVREAMNEAWKE  490

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N   ++G  PF   F+  A+ + RMA  +Y+ GDG G  ++++  +  +  L FE
Sbjct  491  LNAAAMDGRVPFPEVFVRHAVELGRMAMHVYEKGDGFGTGNRDW--KRSLTQLFFE  544



>ref|XP_011016260.1| PREDICTED: LOW QUALITY PROTEIN: probable terpene synthase 12 
[Populus euphratica]
Length=325

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 112/177 (63%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVN-NVNPAEYSAALHCLTDY  385
            A+LQE KW  +  TP+FEEY+ENAW SIS  +IL+  +F +  N++       L  L +Y
Sbjct  150  AFLQEEKWSYNNITPSFEEYLENAWRSISGTVILIQAYFLLGENIS----KQTLDYLVNY  205

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             E++R  S+I RL ND  TS  E+ RG+   +I CYM ET AS  EAR  I   + + W+
Sbjct  206  DELLRWPSVIFRLYNDLATSSAEIARGETANSISCYMYETGASEAEARKHIKKLIQKAWR  265

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MNK +I+  +PF+R+F+   +N+AR+AQC YQHGDGHG  + +  ++  I +L+ E
Sbjct  266  SMNKCQIDNETPFARSFVATVINLARIAQCTYQHGDGHG--APDSRSKNRISSLIIE  320



>ref|XP_004161823.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=601

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY S Y PTFEEY+ENAWIS+S  L+LVH + + +     E   AL CL  Y 
Sbjct  427  TFLTEAKWYYSNYKPTFEEYLENAWISVSGSLLLVHAYVFTSKSLTIE---ALECLQHYP  483

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RLAND  +S  E KRG+V K+IQCYM +T AS  EAR +I   + + WKK
Sbjct  484  NIIRYSSIIFRLANDLASSSEEAKRGEVAKSIQCYMNDTGASEQEARRYIKDLIMKSWKK  543

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N +V+    SP   + FIE A+N+AR++  +YQH DGH I  ++ ET+  + +L  +
Sbjct  544  LNEEVQTLNNSPLLCKGFIEIALNLARISHTVYQHRDGHTI--EDHETKDRVLSLFIK  599



>ref|XP_010425238.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Camelina 
sativa]
Length=595

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 114/177 (64%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL EAKWY  GY P+ EEY++NA ISIS P IL+H +   ++    +    L  L+ + 
Sbjct  416  TYLVEAKWYKRGYKPSLEEYMQNARISISAPTILIHFYCAFSDQISIQ---ILESLSQHR  472

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + +IR S+++LRLAND  TSP E+ RGDV K++QCYM E  A+  EAR  +   +++ W 
Sbjct  473  QHVIRCSAVVLRLANDLATSPDELTRGDVLKSVQCYMHENGATQEEARAHVQQMISDTWD  532

Query  204  KMNKVRIEG--CSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLL  40
            +MN   I     S  SR F++AA+N+ARM+QCMYQHGDGHG   K  +T   +Q+L+
Sbjct  533  EMNYETITAGHSSSLSRGFVQAAVNVARMSQCMYQHGDGHGSPDKA-KTVDRVQSLI  588



>ref|XP_009152110.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like [Brassica 
rapa]
 emb|CDY13587.1| BnaA06g33360D [Brassica napus]
Length=589

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 6/159 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDY-  385
            AYL EAKWY  GY P+ EEY++NAWIS S P +L+H +   ++    +    L  L+++ 
Sbjct  414  AYLVEAKWYKRGYKPSLEEYMQNAWISTSVPTMLIHFYCVFSDQISIQ---ILESLSEHG  470

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
              ++R S+ +LRLAND  TSP E+ RGDV K++QCYM ET AS  EARG +   +++ W 
Sbjct  471  QNVVRCSATVLRLANDLATSPDELARGDVLKSVQCYMHETGASEEEARGHVQQMISDTWN  530

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            +MN        P  R F+EA MN+ARM+QC+YQHGDGHG
Sbjct  531  EMNYEAKIALLP--RGFVEATMNLARMSQCIYQHGDGHG  567



>ref|NP_001268188.1| uncharacterized protein LOC100243167 [Vitis vinifera]
 ref|XP_010657361.1| PREDICTED: uncharacterized protein LOC100243167 isoform X1 [Vitis 
vinifera]
 gb|ADR74204.1| (E)-beta-ocimene synthase [Vitis vinifera]
Length=601

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            +L EAKW    YTPTFEEY+EN W S+S   IL+H +F ++     E   AL CL + HE
Sbjct  423  FLVEAKWCHKEYTPTFEEYLENGWRSVSGAAILIHAYFLMSKNITKE---ALECLENDHE  479

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R  S I RL ND  TS  E++RG+   +I CYM +T  S  +AR  + + ++E WKKM
Sbjct  480  LLRWPSTIFRLCNDLATSKAELERGESANSISCYMHQTGVSEEDAREHMKILIDESWKKM  539

Query  198  NKVR-IEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            NKVR ++  SPF++ F+E A+N+AR+AQC YQ+GD HG  + +  ++  + +L+ E
Sbjct  540  NKVREMDSDSPFAKPFVETAINLARIAQCTYQYGDSHG--APDARSKKRVLSLIVE  593



>emb|CAN65805.1| hypothetical protein VITISV_042691 [Vitis vinifera]
Length=601

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            +L EAKW    YTPTFEEY+EN W S+S   IL+H +F ++     E   AL CL + HE
Sbjct  423  FLVEAKWCHKEYTPTFEEYLENGWRSVSGAAILIHAYFLMSKNITKE---ALECLENDHE  479

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            ++R  S I RL ND  TS  E++RG+   +I CYM +T  S  +AR  + + ++E WKKM
Sbjct  480  LLRWPSTIFRLCNDLATSKAELERGESANSISCYMHQTGVSEEDAREHMKILIDESWKKM  539

Query  198  NKVR-IEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            NKVR ++  SPF++ F+E A+N+AR+AQC YQ+GD HG  + +  ++  + +L+ E
Sbjct  540  NKVREMDSDSPFAKPFVETAINLARIAQCTYQYGDSHG--APDARSKKRVLSLIVE  593



>emb|CDY66920.1| BnaCnng52840D [Brassica napus]
Length=331

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GY P+ EEY++NAWIS S P  L+H++   ++    +   +L    D  
Sbjct  156  AYLVEAKWYKRGYKPSLEEYMQNAWISTSVPAFLIHLYCVFSDQISIQILESLS--EDRQ  213

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             ++R S+++LRLAND  TS  E+ RGDV K++ CYM ET AS  EAR  +   +++ W +
Sbjct  214  HVVRCSAIVLRLANDLATSQDELARGDVLKSVHCYMHETGASEKEARAHVQQMISDTWNE  273

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN        P  R F+EAAMN+ RM+QC+YQHGDGHG
Sbjct  274  MNYETKIALVP--RGFVEAAMNLTRMSQCIYQHGDGHG  309



>gb|ACI32638.1| MTS2 [Humulus lupulus]
Length=613

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            YLQEAKWY SGY PT +EYIE AW+SI  P+ILVH +F     NP    +       Y  
Sbjct  436  YLQEAKWYYSGYQPTLQEYIEMAWLSIGGPVILVHAYFCF--TNPITKESMKFFTEGYPN  493

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            II+ S +I+RLA+D GT   E+ RGDVPK+IQCYM +T AS +EAR  I   + E WK M
Sbjct  494  IIQQSCLIVRLADDFGTFSDELNRGDVPKSIQCYMYDTGASEDEAREHIKFLICETWKDM  553

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            NK   E  S FS TF+E   N+AR A  MYQ+GDGH 
Sbjct  554  NK-NDEDNSCFSETFVEVCKNLARTALFMYQYGDGHA  589



>emb|CDX83558.1| BnaC07g22980D [Brassica napus]
Length=589

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 106/159 (67%), Gaps = 6/159 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY  GY P+ EEY++NAWIS S P +L+H +   ++    +    L  L+++ 
Sbjct  414  AYLVEAKWYKRGYKPSLEEYMQNAWISTSVPAMLIHFYCVFSDQISIQ---ILESLSEHR  470

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + ++R S+ +LRLAND  TSP E+ RGDV K++QCYM ET AS  EARG +   +++ W 
Sbjct  471  QNVVRCSATVLRLANDLATSPDELARGDVLKSVQCYMHETGASEEEARGHVQQMISDTWN  530

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            +MN        P  R F+EA +N+ARM+QC+YQHGDGHG
Sbjct  531  EMNYEAKIALLP--RGFVEATVNLARMSQCIYQHGDGHG  567



>ref|XP_003526313.2| PREDICTED: tricyclene synthase EBOS, chloroplastic-like [Glycine 
max]
 gb|KHN41195.1| Isoprene synthase, chloroplastic [Glycine soja]
Length=597

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 6/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L+EAKW    + P F++Y+ NAW+S+S  +IL H +F +N+    E   AL  L +YH
Sbjct  424  AFLEEAKWSRDKHVPKFDDYLNNAWVSVSGVVILTHAYFLLNHSITKE---ALQSLENYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             ++R SS I RL ND GTS  E++RG+   +I CYM E+ AS   A   I   +NE WKK
Sbjct  481  ALLRRSSTIFRLCNDLGTSKAELERGEAASSIVCYMRESGASEEGAYKHIRRLLNETWKK  540

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MNK ++   SPF + FIE A+N+ R++QC YQ+GDGHG      E +  I++L+ E
Sbjct  541  MNKDKVSQ-SPFPKPFIEIAINLGRISQCTYQYGDGHGAPDSTVENR--IRSLIIE  593



>gb|AID51203.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=551

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 107/176 (61%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + +EA+WY SGYTPT EEY+ NA +SIS P I+  V+F    +  +     +  +  YH
Sbjct  378  GFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYF---TLATSTEKVVIESVYGYH  434

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +   +  EA+ ++   + E WK+
Sbjct  435  NILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKEAQEYVRYLIQEAWKE  494

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    E   PFS   + AA N+ R +Q +Y  GDGHG+  ++ E    +  LLFE
Sbjct  495  MNTAMAEPDCPFSEELVMAAANLGRASQFIYLEGDGHGV--QHSEIHKQMGGLLFE  548



>sp|A7IZZ1.1|TPS1_CANSA RecName: Full=(-)-limonene synthase, chloroplastic; AltName: 
Full=(-)-(4S)-limonene synthase; AltName: Full=CsTPS1; Flags: 
Precursor [Cannabis sativa]
 gb|ABI21837.1| (-)-limonene synthase [Cannabis sativa]
Length=622

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 104/158 (66%), Gaps = 4/158 (3%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH-  382
            +LQEAKW+ SGY PT +EY+EN W+S+   +IL+H +F   N    E   AL CL D H 
Sbjct  448  HLQEAKWFYSGYKPTLQEYVENGWLSVGGQVILMHAYFAFTNPVTKE---ALECLKDGHP  504

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+R +S+ILRLA+D GT   E+KRGDVPK+IQCYM +T AS +EAR  I   ++E WK+
Sbjct  505  NIVRHASIILRLADDLGTLSDELKRGDVPKSIQCYMHDTGASEDEAREHIKYLISESWKE  564

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            MN       S FS  F++   N+ R +Q +YQ+GDGH 
Sbjct  565  MNNEDGNINSFFSNEFVQVCQNLGRASQFIYQYGDGHA  602



>ref|XP_011003243.1| PREDICTED: probable terpene synthase 12 [Populus euphratica]
Length=591

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 113/177 (64%), Gaps = 7/177 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVN-NVNPAEYSAALHCLTDY  385
            A+LQEAKW  +  TP+FEEY+ENAW SIS  +IL+  +F +  N++       L  L +Y
Sbjct  416  AFLQEAKWSYNNITPSFEEYLENAWRSISGTVILIQAYFLLGENIS----KQTLDYLVNY  471

Query  384  HEIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
             E++R  S+I RL ND  TS  E+ RG+   +I CYM ET AS  EAR  I   + + W+
Sbjct  472  DELLRWPSVIFRLYNDLATSSAEIARGETANSISCYMYETGASEAEARKHIKKLIQKAWR  531

Query  204  KMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
             MNK +I+  +PF+R+F+   +N+AR+AQC YQHGDGHG  + +  ++  I +L+ E
Sbjct  532  SMNKCQIDNETPFARSFVATVINLARIAQCTYQHGDGHG--APDSRSKNRISSLIIE  586



>gb|AGK88255.1| gamma-terpinene [Thymus caespititius]
Length=597

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 107/176 (61%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + QEAKWY +GYTPT  EY+ENA +SIS P I+  V+F + N N       +  +  YH
Sbjct  424  GFFQEAKWYYAGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSNEG---TVVENVYGYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             ++ LS MILRLA+D GT+ FE+KRGDV KAIQCYM +  A+  E +  +   + E WK+
Sbjct  481  NMLYLSGMILRLADDLGTTQFELKRGDVQKAIQCYMKDNNATEKEGQEHVKYLLREAWKE  540

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    +   P S   ++AA N+ R +Q +Y  GDGHG+  ++ E    +  L+FE
Sbjct  541  MNTAMADPDCPLSEDLVDAAANLGRASQFIYLEGDGHGV--QHSEIHNQMGGLIFE  594



>ref|XP_008461032.1| PREDICTED: LOW QUALITY PROTEIN: myrcene synthase, chloroplastic-like 
[Cucumis melo]
Length=415

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            A+L EA+WY + Y PTF+EY+ENAW+S+   L+LVH + +  N    E   AL CL  Y 
Sbjct  241  AFLIEARWYYTNYIPTFQEYLENAWVSVFASLLLVHAYVFATNSLTIE---ALECLQHYP  297

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             II+ SS+I RLAND  +S  E KRG+V  +IQCYM +T AS  EAR +I   + E WKK
Sbjct  298  YIIQHSSIIFRLANDLASSSEEAKRGEVANSIQCYMNDTGASEQEARRYIKDLIMESWKK  357

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN +V+    SP F + FIE  +N+AR++  +YQH DGH I  +  ET+  + +L  +
Sbjct  358  MNEEVQALSNSPLFCKXFIEIVLNLARISLTIYQHRDGHTIEDR--ETKDRVLSLFIK  413



>gb|AEV93498.1| gamma-terpinene synthase [Thymus caespititius]
Length=597

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             Y QEAKWY +GYTPT  EY+ENA +SIS P I+  V+F + N         +  +  YH
Sbjct  424  GYFQEAKWYYAGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSTE---RTVVENVYGYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS MILRLA+D GT+ FE+KRGDV KAIQCYM +  A+  E +  +   + E WK+
Sbjct  481  NILYLSGMILRLADDLGTTQFELKRGDVQKAIQCYMKDNNATEKEGQEHVKYLLXEAWKE  540

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    +   P S   ++AA N+ R +Q +Y  GDGHG+  ++ E    +  L+FE
Sbjct  541  MNTAMADPDCPLSEDLVDAAANLGRASQFIYLEGDGHGV--QHSEIHNQMGGLIFE  594



>ref|XP_010528837.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=597

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 5/160 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKW+ SGY P FEEYIENAWISIS P+IL H +  +++    E    +   +D  
Sbjct  419  SYLKEAKWHKSGYKPRFEEYIENAWISISAPVILTHTYCILSDRISKETFDTISENSD--  476

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLE-MNEIWK  205
             I+R SS++LR+AND GTSP E+ RGDV K++QCYM ET AS  EAR  +    +++ W 
Sbjct  477  PIVRSSSVVLRVANDLGTSPDELARGDVLKSMQCYMHETGASEEEAREHMTTGVISDAWD  536

Query  204  KMN-KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            +MN  +   G S  SR F   A+++ RMAQCMYQ+GDGHG
Sbjct  537  EMNYNITARGSSVDSR-FFGVALDLGRMAQCMYQYGDGHG  575



>ref|XP_010528836.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=599

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 5/160 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKW+ SGY P FEEYIENAWISIS P+IL H +  +++    E    +   +D  
Sbjct  421  SYLKEAKWHKSGYKPRFEEYIENAWISISAPVILTHTYCILSDRISKETFDTISENSD--  478

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLE-MNEIWK  205
             I+R SS++LR+AND GTSP E+ RGDV K++QCYM ET AS  EAR  +    +++ W 
Sbjct  479  PIVRSSSVVLRVANDLGTSPDELARGDVLKSMQCYMHETGASEEEAREHMTTGVISDAWD  538

Query  204  KMN-KVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHG  88
            +MN  +   G S  SR F   A+++ RMAQCMYQ+GDGHG
Sbjct  539  EMNYNITARGSSVDSR-FFGVALDLGRMAQCMYQYGDGHG  577



>ref|XP_010103875.1| Myrcene synthase [Morus notabilis]
 gb|EXB97316.1| Myrcene synthase [Morus notabilis]
Length=567

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = -2

Query  558  YLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYHE  379
            YL EAKWY SG+TPTF+EY+EN W+SI+ P++LV  +  V N    E +  L  +  Y  
Sbjct  385  YLLEAKWYTSGHTPTFQEYLENGWVSIAAPIVLVIAYICVTNPLRQE-AIMLLAMEGYPS  443

Query  378  IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKKM  199
            IIR +S+I RL ND  T PFE+++G+VP +IQCYM E  AS +EAR  I L ++E WK++
Sbjct  444  IIREASIIGRLTNDLSTLPFELEKGNVPTSIQCYMNEFGASEDEARQHIKLIIDESWKQL  503

Query  198  NKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGI  85
            NK R +  SPFSRTF++   N+ RM    Y   DG G+
Sbjct  504  NKDR-DANSPFSRTFLDICTNLPRMTMWFYDGRDGFGV  540



>ref|XP_004148460.1| PREDICTED: (-)-alpha-terpineol synthase-like [Cucumis sativus]
Length=252

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 109/162 (67%), Gaps = 7/162 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYV-NNVNPAEYSAALHCLTDY  385
            +YL E+ WY SGY PTFEEY+ NAWIS++ P++LVH + +V + ++  E    L  LT Y
Sbjct  77   SYLIESNWYHSGYKPTFEEYMNNAWISVAGPIMLVHSYIFVASQISKQE----LERLTKY  132

Query  384  HEIIRLSSMILRLANDKGTS-PFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIW  208
             + IR SS I+RLAND  T  P E   GDVPK+IQCYM ET +S   AR +I   ++E+W
Sbjct  133  EDTIRWSSTIMRLANDLLTPVPDEQNIGDVPKSIQCYMNETGSSEKNARVYIKHMVDELW  192

Query  207  KKMNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGIN  82
            KK+N+   E     S+ F++ + N+AR++QCMYQ+GDG  ++
Sbjct  193  KKLNEHDDEKLVS-SQPFVKMSKNLARISQCMYQYGDGDMLD  233



>ref|XP_004148473.1| PREDICTED: gamma-terpinene synthase, chloroplastic-like [Cucumis 
sativus]
Length=220

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY + Y PTFEEY+ENAWIS+S  L+LVH + + +     E   AL CL DY 
Sbjct  35   TFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFTSKSLTTE---ALECLQDYP  91

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RL ND  +   E KRG+V  +IQC M +T  S  EAR +I+  + E WKK
Sbjct  92   NIIRYSSIIFRLTNDLASLSEEAKRGEVANSIQCLMNDTGVSEQEARLYIEDLIVESWKK  151

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGI  85
            +N +V+    SP  S+ FIE  +N+AR++  +Y+H DGH +
Sbjct  152  LNDEVQTWNNSPLLSKGFIEIVLNLARISHTVYEHRDGHTV  192



>gb|AID51200.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=550

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + +EA+WY SGYTPT EEY+ NA +SIS P I+  V+F    +  +     +  +  YH
Sbjct  377  GFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYF---TLATSTEKVVIESVYGYH  433

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +   +  EA+  +   + E WK+
Sbjct  434  NILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKEAQEHVRYLIQEAWKE  493

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    E   PFS   + AA N+ R +Q +Y  GDGHG+  ++ E    +  LLFE
Sbjct  494  MNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGV--QHSEIHKQMGGLLFE  547



>gb|AID51201.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=551

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + +EA+WY SGYTPT EEY+ NA +SIS P I+  V+F    +  +     +  +  YH
Sbjct  378  GFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYF---TLATSTEKVVIESVYGYH  434

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +   +  EA+  +   + E WK+
Sbjct  435  NILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEEEAQEHVRYLIQEAWKE  494

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    E   PFS   + AA N+ R +Q +Y  GDGHG+  ++ E    +  LLFE
Sbjct  495  MNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGV--QHSEIHKQMGGLLFE  548



>gb|AID51195.1| gamma-terpinene synthase, partial [Thymus caespititius]
 gb|AID51196.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=554

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + +EA+WY SGYTPT EEY+ NA +SIS P I+  V+F    +  +     +  +  YH
Sbjct  381  GFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYF---TLATSTEKVVIESVYGYH  437

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +   +  EA+  +   + E WK+
Sbjct  438  NILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKEAQEHVRYLIQEAWKE  497

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    E   PFS   + AA N+ R +Q +Y  GDGHG+  ++ E    +  LLFE
Sbjct  498  MNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGV--QHSEIHKQMGGLLFE  551



>gb|AEJ91556.1| alpha-thujene synthase/sabinene synthase [Litsea cubeba]
Length=580

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EA+WY++GY PT EEY+ENAW SI+ P+ L H +F      P E   AL+  ++  
Sbjct  407  SYIVEARWYSNGYKPTLEEYLENAWTSIAGPVALGHAYFSFGQKMPFE---ALN-YSNTS  462

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             +I+ SSMI RL +D  TS  E+ RGDVPK+IQCYM E   S + AR  I   ++E WKK
Sbjct  463  SLIKWSSMIFRLCDDLATSSDEVARGDVPKSIQCYMYEAGVSESVARDHIKYLIDEAWKK  522

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSK  76
            MN+  +   +PF +  I A  N+ARMA CMY+HGDGHG +++
Sbjct  523  MNECLVPS-TPFLQPLINAGFNLARMAHCMYEHGDGHGFSNE  563



>gb|AEJ91555.1| alpha-thujene synthase [Litsea cubeba]
Length=580

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +Y+ EA+WY++GY PT EEY+ENAW SI+ P+ LVH +F      P E   AL+  ++  
Sbjct  407  SYIVEARWYSNGYKPTLEEYLENAWTSIAGPVALVHAYFSFGQKMPFE---ALN-YSNTS  462

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             +I+ SSMI RL +D  TS  E+ RGDVPK+IQCYM E   S + AR  I   ++E WKK
Sbjct  463  SLIKWSSMIFRLCDDLATSSDEVARGDVPKSIQCYMYEAGVSESVARDHIKYLIDEAWKK  522

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSK  76
            MN+  +   +PF +  I A +N+ARMA CMY+ GDGHG +++
Sbjct  523  MNECLVYN-TPFLQPLINAGLNLARMAHCMYERGDGHGFSNE  563



>gb|ABH07678.1| sabinene synthase [Salvia pomifera]
Length=581

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             YL+EA WY +GY P+ EEY+ NA ISIS P I+  ++F + N         +  L +YH
Sbjct  408  GYLKEAYWYYNGYKPSLEEYLNNAKISISAPTIISQLYFTLANSTD---ETVIESLYEYH  464

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GTS  E++RGDVPKAIQCYM +T AS  EA   +   + E WK+
Sbjct  465  NILYLSGTILRLADDLGTSQHELERGDVPKAIQCYMKDTNASEREAVEHVKFLIRETWKE  524

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN V      PF+   +  A N+AR AQ +Y  GDGHG+  ++ E    +  LLF+
Sbjct  525  MNTVTTASDCPFTDDLVAVATNLARAAQFIYLDGDGHGV--QHSEIHQQMGGLLFQ  578



>gb|AID51204.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=551

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 104/176 (59%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + +EA+WY SGYTPT EEY+ NA +SIS P I+  V+F    +  +     +  +  YH
Sbjct  378  GFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYF---TLATSTEKVVIESVYGYH  434

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +   +  EA+  +   + E WK+
Sbjct  435  NILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKEAQEHVRYLIQEAWKE  494

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    E   PFS   + AA N+ R +Q +Y  GDGHG+       Q  +  LLFE
Sbjct  495  MNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSKIHKQ--MGGLLFE  548



>gb|AID51197.1| gamma-terpinene synthase, partial [Thymus caespititius]
Length=554

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 104/176 (59%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             + +EA+WY SGYTPT EEY+ NA +SIS P I+  V+F    +  +     +  +  YH
Sbjct  381  GFFKEAQWYYSGYTPTLEEYLNNAKVSISSPTIISQVYF---TLATSTEKVVIESVYGYH  437

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS  ILRLA+D GT+ FE+KRGDVPKA+QCYM +   +  EA+  +   + E WK+
Sbjct  438  NILYLSGTILRLADDLGTTQFELKRGDVPKAVQCYMKDKNVTEKEAQEHVRYLIQEAWKE  497

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    E   PFS   + AA N+ R +Q +Y  GDGHG+       Q  +  LLFE
Sbjct  498  MNTAMAEPDCPFSEELVTAAANLGRASQFIYLEGDGHGVQHSKIHKQ--MGGLLFE  551



>ref|XP_008461029.1| PREDICTED: terpene synthase 10-like [Cucumis melo]
Length=599

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 7/178 (4%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             +L EAKWY + Y PTFEEY+ENAWIS+S  L+LVH + +  N    E   AL CL  + 
Sbjct  425  TFLIEAKWYYTNYKPTFEEYLENAWISVSGSLLLVHAYVFTTNSLTIE---ALECLQLHP  481

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             IIR SS+I RLAND  +S  E +RG+V K+IQCYM +T AS  EAR ++   + E WKK
Sbjct  482  NIIRYSSIIFRLANDLASSSEEAERGEVAKSIQCYMNDTGASEQEARRYLKDLIVESWKK  541

Query  201  MN-KVRIEGCSP-FSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            +N +V+    SP  S++FIE A+N+AR++  +YQ+ DGH +  ++ ET+  + +L  +
Sbjct  542  LNEEVQTLNNSPLLSKSFIEIALNLARISHTVYQYRDGHTV--EDHETKDRVLSLFIK  597



>emb|CDX90785.1| BnaA03g24650D [Brassica napus]
Length=593

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 105/165 (64%), Gaps = 5/165 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EA WY  GY P  EEY++NAWISIS P I VH +   ++    +    L  L+++ 
Sbjct  415  AYLVEAMWYKGGYKPNLEEYMQNAWISISSPTIFVHFYCVFSDQLSVQ---VLETLSEHQ  471

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + I+R SS + RLAND  TSP EM RGDV K+IQCYM ET  S  +AR  +   +N++W 
Sbjct  472  QNIVRCSSSVFRLANDLVTSPDEMARGDVLKSIQCYMNETGVSEEKARMHVHKMINDMWD  531

Query  204  KMNKVRIEGCSPF-SRTFIEAAMNIARMAQCMYQHGDGHGINSKN  73
            +MN  +IE  S    + F E  +N+ARM+QCMYQ+GDGHG   K+
Sbjct  532  EMNYEKIENHSSLIPQDFAETVINLARMSQCMYQYGDGHGCPEKS  576



>gb|AEV93493.1| gamma-terpinene synthase [Thymus caespititius]
Length=597

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 106/176 (60%), Gaps = 5/176 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
             Y QEAKWY +GYTPT  EY+ENA +SIS P I+  V+F + N         +  +  YH
Sbjct  424  GYFQEAKWYYAGYTPTLAEYLENAKVSISSPTIISQVYFTLPNSTE---RTVVENVYGYH  480

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
             I+ LS MILRLA+D GT+ FE+KRGDV KAIQCYM +  A+  E +  +   + E WK+
Sbjct  481  NILYLSGMILRLADDLGTTQFELKRGDVQKAIQCYMKDNNATEKEGQEHVKYLLLEAWKE  540

Query  201  MNKVRIEGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            MN    +   P S   ++AA N+ R +Q +Y  GDGHG+  ++ E    +  L+FE
Sbjct  541  MNTAMADPDCPLSEDLVDAAANLGRASQFIYLEGDGHGV--QHSEIHNQMGGLIFE  594



>ref|XP_010544282.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=593

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY +GY P+  EY++NA ISIS P IL+  F  +++    E    L  L+++ 
Sbjct  415  AYLTEAKWYKNGYKPSLREYMQNAIISISTPTILLQSFCVLSDQISKE---TLDTLSEHP  471

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + ++R  + + R A+D GTS  E+ RGDVPK+IQCYM ET AS  EAR  +   + + W+
Sbjct  472  QPLVRCCATVFRFADDLGTSTDELARGDVPKSIQCYMHETGASEAEARAHVKQMIRDTWE  531

Query  204  KMNKVRI-EGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            ++N+ R   G +   R FIE AMN+ARM+ CMYQ+GDGHG   K   T   I++LL +
Sbjct  532  EINRERTARGSTSLPRRFIEVAMNLARMSLCMYQYGDGHGCPDKA-NTVDRIRSLLID  588



>ref|XP_010544281.1| PREDICTED: 1,8-cineole synthase 1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=597

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            AYL EAKWY +GY P+  EY++NA ISIS P IL+  F  +++    E    L  L+++ 
Sbjct  419  AYLTEAKWYKNGYKPSLREYMQNAIISISTPTILLQSFCVLSDQISKE---TLDTLSEHP  475

Query  381  E-IIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWK  205
            + ++R  + + R A+D GTS  E+ RGDVPK+IQCYM ET AS  EAR  +   + + W+
Sbjct  476  QPLVRCCATVFRFADDLGTSTDELARGDVPKSIQCYMHETGASEAEARAHVKQMIRDTWE  535

Query  204  KMNKVRI-EGCSPFSRTFIEAAMNIARMAQCMYQHGDGHGINSKNFETQTHIQTLLFE  34
            ++N+ R   G +   R FIE AMN+ARM+ CMYQ+GDGHG   K   T   I++LL +
Sbjct  536  EINRERTARGSTSLPRRFIEVAMNLARMSLCMYQYGDGHGCPDKA-NTVDRIRSLLID  592



>gb|ADQ73632.1| monoterpene synthase-like protein [Lavandula angustifolia]
Length=494

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = -2

Query  561  AYLQEAKWYASGYTPTFEEYIENAWISISCPLILVHVFFYVNNVNPAEYSAALHCLTDYH  382
            +YL+EAKWY SGYTP+ EEY++N  ISI+ P I   V+F    V P+     +  +  YH
Sbjct  354  SYLKEAKWYYSGYTPSLEEYLDNGQISITSPTIASQVYF---TVEPSLDKTVIESMYKYH  410

Query  381  EIIRLSSMILRLANDKGTSPFEMKRGDVPKAIQCYMGETKASVNEARGFIDLEMNEIWKK  202
            +I+ L+ M+LRL +D GT+PFE+KRGDVPKA+QCYM ET AS +EAR  I   + E WKK
Sbjct  411  DILNLAGMLLRLPDDLGTAPFELKRGDVPKAVQCYMKETNASESEAREHIKFLIREYWKK  470

Query  201  MNKVRIEGCSPFSRTFIEAAMNIA  130
            MN V    C PF+  F+  A N+A
Sbjct  471  MNTVIATDC-PFTDDFVVGAANLA  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 608236040074