BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25064_g1_i2 len=492 path=[5142:0-43 1853:44-95 1905:96-134
6902:135-167 4850:168-177 8082:178-195 8100:196-215 2171:216-286
2242:287-317 8384:318-355 1813:356-356 1814:357-389 5785:390-471
1538:472-491]

Length=492
                                                                      Score     E

gb|KFK37630.1|  hypothetical protein AALP_AA3G008200                    111   6e-25   
ref|XP_002324001.2|  hypothetical protein POPTR_0017s10720g             109   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011010496.1|  PREDICTED: uncharacterized protein LOC105115342    107   2e-23   
ref|XP_006299972.1|  hypothetical protein CARUB_v10016185mg             106   4e-23   
ref|NP_186817.1|  uncharacterized protein                               105   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496279.1|  PREDICTED: uncharacterized protein LOC104773380    105   8e-23   
ref|XP_010435652.1|  PREDICTED: uncharacterized protein LOC104719422    105   8e-23   
ref|XP_002884266.1|  hypothetical protein ARALYDRAFT_477347             105   8e-23   
ref|XP_009124817.1|  PREDICTED: uncharacterized protein LOC103849857    104   1e-22   
ref|XP_006408537.1|  hypothetical protein EUTSA_v10020146mg             104   1e-22   
ref|XP_007031665.1|  Uncharacterized protein TCM_017020                 104   2e-22   
emb|CDY28669.1|  BnaCnng05550D                                          102   5e-22   
gb|KHG12713.1|  hypothetical protein F383_04328                         102   5e-22   
ref|XP_010029073.1|  PREDICTED: uncharacterized protein LOC104419196    102   5e-22   
ref|XP_003633800.1|  PREDICTED: uncharacterized protein LOC100244128    102   7e-22   
ref|XP_008449999.1|  PREDICTED: uncharacterized protein LOC103491716    102   9e-22   
ref|XP_009124044.1|  PREDICTED: uncharacterized protein LOC103848...    102   1e-21   
ref|XP_009124045.1|  PREDICTED: uncharacterized protein LOC103848...    102   1e-21   
emb|CDX77080.1|  BnaC04g38750D                                          101   1e-21   
ref|XP_004171463.1|  PREDICTED: uncharacterized protein LOC101229786    101   1e-21   
ref|XP_004145690.1|  PREDICTED: uncharacterized protein LOC101221710    101   1e-21   
emb|CDY37506.1|  BnaA05g33710D                                          101   2e-21   
emb|CDY17992.1|  BnaC03g30640D                                        98.6    2e-21   
ref|XP_002526960.1|  conserved hypothetical protein                   99.8    5e-21   Ricinus communis
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294  99.4    8e-21   
gb|KDP46373.1|  hypothetical protein JCGZ_10213                       99.0    1e-20   
emb|CAN62582.1|  hypothetical protein VITISV_034667                   99.0    1e-20   Vitis vinifera
ref|XP_010660833.1|  PREDICTED: uncharacterized protein LOC100245845  98.2    2e-20   
emb|CAN65452.1|  hypothetical protein VITISV_003896                   97.8    2e-20   Vitis vinifera
emb|CBI34826.3|  unnamed protein product                              97.8    3e-20   
emb|CBI34825.3|  unnamed protein product                              97.8    3e-20   
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991  97.8    3e-20   
ref|XP_010550173.1|  PREDICTED: uncharacterized protein LOC104821101  97.4    3e-20   
ref|XP_010029068.1|  PREDICTED: uncharacterized protein LOC104419192  97.4    3e-20   
ref|XP_011013023.1|  PREDICTED: uncharacterized protein LOC105117152  97.4    4e-20   
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g           97.4    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002271723.2|  PREDICTED: uncharacterized protein LOC100242213  97.1    4e-20   Vitis vinifera
gb|KHN27576.1|  hypothetical protein glysoja_018688                   97.1    6e-20   
ref|NP_001239838.1|  uncharacterized protein LOC100801064             96.7    6e-20   
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...  96.7    6e-20   
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392  96.7    7e-20   
emb|CAN61289.1|  hypothetical protein VITISV_032473                   96.3    9e-20   Vitis vinifera
ref|XP_004516128.1|  PREDICTED: uncharacterized protein LOC101508220  96.3    9e-20   
ref|XP_010029072.1|  PREDICTED: uncharacterized protein LOC104419195  96.3    1e-19   
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666  95.9    1e-19   
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g           95.5    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167  95.1    2e-19   
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g           95.1    2e-19   
gb|KCW55914.1|  hypothetical protein EUGRSUZ_I01712                   93.2    3e-19   
ref|XP_006369948.1|  hypothetical protein POPTR_0001s35900g           94.7    3e-19   
ref|XP_010660831.1|  PREDICTED: uncharacterized protein LOC100264492  94.4    4e-19   
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161  94.4    4e-19   
emb|CBI34821.3|  unnamed protein product                              94.7    5e-19   
ref|XP_007140863.1|  hypothetical protein PHAVU_008G147900g           94.0    6e-19   
ref|XP_010029069.1|  PREDICTED: uncharacterized protein LOC104419193  94.0    6e-19   
ref|XP_010694661.1|  PREDICTED: uncharacterized protein LOC104907426  93.6    8e-19   
ref|XP_011013170.1|  PREDICTED: uncharacterized protein LOC105117262  92.8    1e-18   
ref|XP_010694662.1|  PREDICTED: uncharacterized protein LOC104907427  92.8    2e-18   
ref|XP_006432374.1|  hypothetical protein CICLE_v10000431mg           92.4    2e-18   
gb|KCW55913.1|  hypothetical protein EUGRSUZ_I01711                   92.0    2e-18   
ref|XP_009592492.1|  PREDICTED: uncharacterized protein LOC104089332  91.7    4e-18   
ref|XP_006439978.1|  hypothetical protein CICLE_v10019109mg           91.3    5e-18   
ref|XP_003622294.1|  hypothetical protein MTR_7g032660                90.9    6e-18   
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g           90.9    6e-18   
gb|KDO69425.1|  hypothetical protein CISIN_1g019680mg                 88.6    6e-18   
ref|XP_011046122.1|  PREDICTED: uncharacterized protein LOC105140824  90.9    6e-18   
emb|CBI34823.3|  unnamed protein product                              91.3    7e-18   
ref|XP_006471327.1|  PREDICTED: uncharacterized protein LOC102619778  90.9    7e-18   
ref|XP_006476924.1|  PREDICTED: uncharacterized protein LOC102608...  90.1    1e-17   
ref|XP_010029070.1|  PREDICTED: uncharacterized protein LOC104419194  90.1    1e-17   
ref|XP_007031664.1|  Uncharacterized protein TCM_017019               89.7    1e-17   
ref|XP_006476923.1|  PREDICTED: uncharacterized protein LOC102608...  89.7    1e-17   
emb|CDP15097.1|  unnamed protein product                              89.7    2e-17   
ref|XP_006476925.1|  PREDICTED: uncharacterized protein LOC102608...  89.0    3e-17   
ref|XP_004236293.1|  PREDICTED: uncharacterized protein LOC101251462  89.0    3e-17   
ref|XP_010030737.1|  PREDICTED: uncharacterized protein LOC104420628  89.0    3e-17   
ref|XP_009628800.1|  PREDICTED: uncharacterized protein LOC104119093  89.0    3e-17   
ref|XP_006351433.1|  PREDICTED: uncharacterized protein LOC102598958  89.0    3e-17   
gb|ADN32810.1|  sieve element occlusion a                             89.0    3e-17   
ref|XP_002526961.1|  conserved hypothetical protein                   88.6    4e-17   Ricinus communis
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652  88.6    4e-17   
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...  88.6    4e-17   
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310  88.2    5e-17   
ref|XP_002526959.1|  conserved hypothetical protein                   88.2    5e-17   Ricinus communis
ref|XP_006379953.1|  hypothetical protein POPTR_0008s18360g           88.2    5e-17   
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g           87.4    1e-16   
ref|XP_009769607.1|  PREDICTED: uncharacterized protein LOC104220433  87.4    1e-16   
gb|AFN06072.1|  sieve element occlusion protein 1                     87.0    1e-16   
ref|XP_006388019.1|  hypothetical protein POPTR_0395s002002g          84.3    1e-16   
ref|XP_010248721.1|  PREDICTED: uncharacterized protein LOC104591550  86.3    2e-16   
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695  85.9    4e-16   
gb|KEH20741.1|  sieve element occlusion protein                       85.5    5e-16   
ref|XP_006476926.1|  PREDICTED: uncharacterized protein LOC102609296  85.1    6e-16   
ref|XP_006439977.1|  hypothetical protein CICLE_v10019128mg           84.7    7e-16   
gb|KDO69426.1|  hypothetical protein CISIN_1g044391mg                 84.7    7e-16   
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g           84.7    8e-16   
ref|XP_006378262.1|  hypothetical protein POPTR_0010s060501g          82.8    8e-16   
ref|XP_004236294.1|  PREDICTED: uncharacterized protein LOC101251765  84.7    8e-16   
ref|XP_009415984.1|  PREDICTED: uncharacterized protein LOC103996731  84.7    9e-16   
ref|XP_006848934.1|  hypothetical protein AMTR_s00166p00029650        84.3    1e-15   
ref|XP_002515051.1|  conserved hypothetical protein                   84.3    1e-15   Ricinus communis
emb|CBI34824.3|  unnamed protein product                              84.0    1e-15   
ref|NP_001240968.1|  uncharacterized protein LOC100799626             84.0    1e-15   
gb|KHN29013.1|  hypothetical protein glysoja_008348                   84.0    2e-15   
ref|XP_006440671.1|  hypothetical protein CICLE_v10019121mg           83.6    2e-15   
ref|XP_008786702.1|  PREDICTED: uncharacterized protein LOC103704947  83.6    2e-15   
ref|XP_010674858.1|  PREDICTED: uncharacterized protein LOC104890938  83.6    2e-15   
ref|XP_006477599.1|  PREDICTED: uncharacterized protein LOC102631158  83.6    2e-15   
ref|XP_010912936.1|  PREDICTED: uncharacterized protein LOC105038753  83.6    2e-15   
ref|XP_006440672.1|  hypothetical protein CICLE_v10019121mg           83.6    2e-15   
ref|XP_007225209.1|  hypothetical protein PRUPE_ppa002007mg           82.8    4e-15   
ref|XP_008793697.1|  PREDICTED: uncharacterized protein LOC103709939  82.8    4e-15   
ref|XP_009386688.1|  PREDICTED: uncharacterized protein LOC103973766  82.4    4e-15   
ref|XP_010102927.1|  hypothetical protein L484_018946                 82.4    6e-15   
ref|XP_010904538.1|  PREDICTED: uncharacterized protein LOC105031936  82.0    6e-15   
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                 82.0    8e-15   
ref|XP_004161368.1|  PREDICTED: uncharacterized LOC101204444          81.3    1e-14   
ref|XP_009359246.1|  PREDICTED: uncharacterized protein LOC103949...  81.6    1e-14   
ref|XP_002282172.1|  PREDICTED: uncharacterized protein LOC100261038  81.3    1e-14   Vitis vinifera
emb|CAN83922.1|  hypothetical protein VITISV_026532                   81.3    1e-14   Vitis vinifera
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551  81.3    1e-14   
ref|XP_007044877.1|  Sieve element occlusion e, putative              81.3    1e-14   
ref|XP_004138263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  81.3    1e-14   
ref|XP_004504145.1|  PREDICTED: uncharacterized protein LOC101504...  80.9    2e-14   
ref|XP_004504143.1|  PREDICTED: uncharacterized protein LOC101504...  80.9    2e-14   
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg           80.9    2e-14   
gb|KDP46375.1|  hypothetical protein JCGZ_10215                       80.9    2e-14   
ref|XP_009403632.1|  PREDICTED: uncharacterized protein LOC103987147  80.9    2e-14   
ref|XP_008464491.1|  PREDICTED: uncharacterized protein LOC103502...  80.9    2e-14   
ref|XP_008464490.1|  PREDICTED: uncharacterized protein LOC103502...  80.9    2e-14   
gb|EPS71838.1|  hypothetical protein M569_02915                       80.5    2e-14   
gb|KDO82146.1|  hypothetical protein CISIN_1g005245mg                 80.1    2e-14   
emb|CDP13257.1|  unnamed protein product                              80.5    3e-14   
ref|XP_010026936.1|  PREDICTED: uncharacterized protein LOC104417333  79.7    4e-14   
ref|XP_009359248.1|  PREDICTED: uncharacterized protein LOC103949...  79.7    5e-14   
gb|KDP46379.1|  hypothetical protein JCGZ_10219                       79.3    5e-14   
ref|XP_010087773.1|  hypothetical protein L484_016343                 79.3    6e-14   
ref|XP_004309998.1|  PREDICTED: uncharacterized protein LOC101307854  79.0    7e-14   
gb|KDP26703.1|  hypothetical protein JCGZ_17861                       79.0    8e-14   
gb|ADN32812.1|  sieve element occlusion c                             78.6    1e-13   
ref|XP_008350940.1|  PREDICTED: uncharacterized protein LOC103414321  78.6    1e-13   
ref|XP_006470197.1|  PREDICTED: uncharacterized protein LOC102630205  78.6    1e-13   
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174  78.2    1e-13   
gb|ADN32811.1|  sieve element occlusion b                             78.2    1e-13   
ref|XP_006376885.1|  hypothetical protein POPTR_0012s09220g           77.8    2e-13   
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329  78.2    2e-13   
ref|XP_010044527.1|  PREDICTED: uncharacterized protein LOC104433471  77.8    2e-13   
ref|XP_009359245.1|  PREDICTED: uncharacterized protein LOC103949844  77.8    2e-13   
ref|XP_011040448.1|  PREDICTED: uncharacterized protein LOC105136707  77.4    3e-13   
ref|XP_009769432.1|  PREDICTED: uncharacterized protein LOC104220...  77.0    3e-13   
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...  77.0    3e-13   
ref|XP_009769433.1|  PREDICTED: uncharacterized protein LOC104220...  77.0    4e-13   
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509  77.0    4e-13   
emb|CBI16824.3|  unnamed protein product                              76.6    4e-13   
ref|XP_002282165.1|  PREDICTED: uncharacterized protein LOC100266247  76.6    4e-13   Vitis vinifera
emb|CAN83923.1|  hypothetical protein VITISV_026533                   76.6    5e-13   Vitis vinifera
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214  76.6    5e-13   
ref|XP_002526965.1|  conserved hypothetical protein                   76.6    6e-13   Ricinus communis
ref|XP_007211100.1|  hypothetical protein PRUPE_ppa023699mg           76.3    6e-13   
ref|XP_008389748.1|  PREDICTED: uncharacterized protein LOC103452052  76.3    7e-13   
ref|XP_002526962.1|  conserved hypothetical protein                   76.3    8e-13   Ricinus communis
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193  76.3    8e-13   
ref|XP_008340128.1|  PREDICTED: uncharacterized protein LOC103403085  75.9    1e-12   
emb|CAH59411.1|  hypothetical protein                                 74.3    1e-12   Plantago major [cart-track plant]
ref|XP_011097584.1|  PREDICTED: uncharacterized protein LOC105176465  75.5    1e-12   
ref|XP_002271883.2|  PREDICTED: putative disease resistance prote...  75.9    1e-12   Vitis vinifera
ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849  75.9    1e-12   
emb|CAN64088.1|  hypothetical protein VITISV_006939                   75.9    1e-12   Vitis vinifera
ref|XP_007221911.1|  hypothetical protein PRUPE_ppa001579mg           75.5    1e-12   
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...  75.5    1e-12   
ref|XP_008340127.1|  PREDICTED: uncharacterized protein LOC103403084  75.1    2e-12   
ref|XP_010695991.1|  PREDICTED: uncharacterized protein LOC104908569  75.1    2e-12   
ref|XP_008239606.1|  PREDICTED: uncharacterized protein LOC103338199  74.7    2e-12   
ref|XP_010087771.1|  hypothetical protein L484_016341                 74.7    2e-12   
gb|KDO37241.1|  hypothetical protein CISIN_1g014387mg                 73.9    2e-12   
ref|XP_006446667.1|  hypothetical protein CICLE_v10015478mg           73.6    2e-12   
ref|XP_008221943.1|  PREDICTED: uncharacterized protein LOC103321871  74.7    2e-12   
ref|XP_008224125.1|  PREDICTED: uncharacterized protein LOC103323883  74.7    3e-12   
gb|KDP46378.1|  hypothetical protein JCGZ_10218                       73.9    3e-12   
gb|KDP46380.1|  hypothetical protein JCGZ_10220                       73.9    4e-12   
gb|KHN05808.1|  hypothetical protein glysoja_038722                   73.9    4e-12   
ref|NP_001241263.1|  uncharacterized protein LOC100811452             73.9    4e-12   
ref|XP_011087135.1|  PREDICTED: uncharacterized protein LOC105168700  73.9    4e-12   
ref|XP_008239364.1|  PREDICTED: uncharacterized protein LOC103337969  73.9    4e-12   
ref|XP_004288436.1|  PREDICTED: uncharacterized protein LOC101298363  73.6    5e-12   
ref|XP_008362016.1|  PREDICTED: uncharacterized protein LOC103425707  73.6    5e-12   
gb|ADN32815.1|  sieve element occlusion a                             73.6    5e-12   
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366  73.6    6e-12   
ref|XP_003590760.1|  Sieve element-occluding protein                  73.2    6e-12   
ref|XP_008224124.1|  PREDICTED: uncharacterized protein LOC103323881  73.2    6e-12   
emb|CBI34827.3|  unnamed protein product                              73.2    7e-12   
ref|XP_002271950.2|  PREDICTED: uncharacterized protein LOC100261056  73.2    7e-12   Vitis vinifera
ref|XP_008362017.1|  PREDICTED: uncharacterized protein LOC103425708  72.8    8e-12   
emb|CBI14908.3|  unnamed protein product                              72.8    1e-11   
gb|KDP46383.1|  hypothetical protein JCGZ_10223                       72.4    1e-11   
ref|XP_004310159.1|  PREDICTED: uncharacterized protein LOC101309120  72.4    1e-11   
ref|XP_004288435.1|  PREDICTED: uncharacterized protein LOC101298064  72.4    1e-11   
gb|KCW45067.1|  hypothetical protein EUGRSUZ_L01341                   72.0    1e-11   
gb|KCW83211.1|  hypothetical protein EUGRSUZ_B001511                  68.9    1e-11   
ref|XP_010087772.1|  hypothetical protein L484_016342                 72.0    2e-11   
ref|XP_002526964.1|  conserved hypothetical protein                   72.0    2e-11   Ricinus communis
gb|KHG30244.1|  Acid phosphatase 1                                    70.5    2e-11   
ref|XP_010040608.1|  PREDICTED: uncharacterized protein LOC104429456  71.6    2e-11   
ref|XP_008239602.1|  PREDICTED: uncharacterized protein LOC103338194  71.6    2e-11   
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g           71.6    2e-11   
gb|KHG30263.1|  hypothetical protein F383_10527                       71.2    3e-11   
gb|KHG30262.1|  hypothetical protein F383_10527                       71.2    3e-11   
gb|KEH35012.1|  sieve element occlusion protein                       71.2    3e-11   
gb|KDP46376.1|  hypothetical protein JCGZ_10216                       71.2    4e-11   
ref|XP_008224078.1|  PREDICTED: uncharacterized protein LOC103323835  70.9    4e-11   
ref|XP_007226977.1|  hypothetical protein PRUPE_ppa002363mg           70.9    4e-11   
ref|XP_007137985.1|  hypothetical protein PHAVU_009G171300g           70.5    4e-11   
gb|KHN07967.1|  hypothetical protein glysoja_039841                   70.5    5e-11   
ref|NP_001241461.1|  uncharacterized protein LOC100789215             70.5    5e-11   
ref|XP_004501847.1|  PREDICTED: uncharacterized protein LOC101501922  70.5    5e-11   
ref|XP_007037798.1|  Sieve element occlusion e, putative              70.5    6e-11   
ref|XP_007137986.1|  hypothetical protein PHAVU_009G171300g           70.5    6e-11   
ref|XP_010250966.1|  PREDICTED: uncharacterized protein LOC104593030  70.1    7e-11   
ref|XP_008224076.1|  PREDICTED: uncharacterized protein LOC103323832  70.1    7e-11   
gb|KHG00716.1|  hypothetical protein F383_23634                       70.1    7e-11   
gb|KHG00715.1|  hypothetical protein F383_23634                       70.1    7e-11   
ref|XP_004299166.1|  PREDICTED: uncharacterized protein LOC101294943  70.1    7e-11   
emb|CDX77078.1|  BnaC04g38730D                                        69.7    9e-11   
ref|XP_011071161.1|  PREDICTED: uncharacterized protein LOC105156657  69.7    1e-10   
ref|XP_002526966.1|  conserved hypothetical protein                   69.3    1e-10   Ricinus communis
gb|KHN13158.1|  hypothetical protein glysoja_040438                   69.3    1e-10   
ref|XP_007221903.1|  hypothetical protein PRUPE_ppa015869mg           68.9    1e-10   
ref|NP_001241224.1|  uncharacterized protein LOC100794293             69.3    1e-10   
ref|XP_007225119.1|  hypothetical protein PRUPE_ppa002624mg           68.9    1e-10   
ref|XP_010045508.1|  PREDICTED: uncharacterized protein LOC104434233  69.3    2e-10   
emb|CAN65453.1|  hypothetical protein VITISV_003897                   68.9    2e-10   Vitis vinifera
gb|KDP46382.1|  hypothetical protein JCGZ_10222                       68.6    2e-10   
ref|NP_001280876.1|  uncharacterized LOC103453287                     68.2    3e-10   
emb|CAN65891.1|  hypothetical protein VITISV_041167                   67.8    4e-10   Vitis vinifera
ref|XP_009346429.1|  PREDICTED: uncharacterized protein LOC103938158  67.8    4e-10   
gb|EYU17767.1|  hypothetical protein MIMGU_mgv1a002070mg              67.8    4e-10   
ref|XP_008374367.1|  PREDICTED: uncharacterized protein LOC103437653  67.4    5e-10   
gb|KDP47163.1|  hypothetical protein JCGZ_00054                       67.4    5e-10   
ref|XP_006440670.1|  hypothetical protein CICLE_v10023346mg           67.4    6e-10   
gb|EYU22546.1|  hypothetical protein MIMGU_mgv1a001374mg              67.0    7e-10   
gb|KHG01411.1|  hypothetical protein F383_21965                       66.6    9e-10   
ref|XP_011097560.1|  PREDICTED: uncharacterized protein LOC105176450  66.6    1e-09   
ref|XP_010248720.1|  PREDICTED: uncharacterized protein LOC104591548  65.9    2e-09   
ref|XP_007226973.1|  hypothetical protein PRUPE_ppa002391mg           65.9    2e-09   
gb|KHN01070.1|  hypothetical protein glysoja_000738                   65.9    2e-09   
ref|XP_004304991.1|  PREDICTED: uncharacterized protein LOC101294285  65.5    2e-09   
ref|XP_011100417.1|  PREDICTED: uncharacterized protein LOC105178604  65.5    2e-09   
ref|XP_009124043.1|  PREDICTED: uncharacterized protein LOC103848960  65.5    2e-09   
gb|AAF01550.1|AC009325_20  unknown protein                            65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37507.1|  BnaA05g33720D                                        65.5    3e-09   
ref|NP_566145.1|  uncharacterized protein                             65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224077.1|  PREDICTED: uncharacterized protein LOC103323834  65.1    3e-09   
ref|XP_004310160.1|  PREDICTED: uncharacterized protein LOC101309418  65.1    3e-09   
emb|CDP05462.1|  unnamed protein product                              64.7    4e-09   
gb|KDO40196.1|  hypothetical protein CISIN_1g046837mg                 64.7    4e-09   
ref|XP_004288433.1|  PREDICTED: uncharacterized protein LOC101296807  64.7    5e-09   
gb|KCW83210.1|  hypothetical protein EUGRSUZ_B001512                  63.5    6e-09   
ref|XP_004288434.1|  PREDICTED: uncharacterized protein LOC101297774  64.3    6e-09   
gb|KFK37629.1|  hypothetical protein AALP_AA3G008100                  63.9    8e-09   
ref|XP_010496280.1|  PREDICTED: uncharacterized protein LOC104773381  63.9    9e-09   
ref|XP_010485384.1|  PREDICTED: uncharacterized protein LOC104763723  63.9    9e-09   
ref|XP_002884267.1|  hypothetical protein ARALYDRAFT_477348           63.5    1e-08   
ref|XP_010435651.1|  PREDICTED: uncharacterized protein LOC104719421  63.5    1e-08   
ref|NP_001241173.1|  uncharacterized protein LOC100793771             63.5    1e-08   
gb|KHN13159.1|  hypothetical protein glysoja_040439                   63.2    1e-08   
ref|XP_006408536.1|  hypothetical protein EUTSA_v10020071mg           63.2    1e-08   
emb|CDX91934.1|  BnaC03g32360D                                        63.2    1e-08   
ref|NP_001239846.1|  uncharacterized protein LOC100801833             62.8    2e-08   
gb|KHN01071.1|  Putative nucleoredoxin 2                              62.4    2e-08   
ref|XP_010524284.1|  PREDICTED: uncharacterized protein LOC104802389  62.4    3e-08   
ref|XP_009333910.1|  PREDICTED: uncharacterized protein LOC103926766  60.8    3e-08   
emb|CDX74311.1|  BnaA03g27360D                                        62.0    4e-08   
ref|XP_009134596.1|  PREDICTED: uncharacterized protein LOC103858898  62.0    4e-08   
dbj|BAF01938.1|  hypothetical protein                                 59.3    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143056.1|  PREDICTED: uncharacterized protein LOC101208559  61.2    5e-08   
ref|XP_010550172.1|  PREDICTED: uncharacterized protein LOC104821100  61.6    5e-08   
ref|XP_010040606.1|  PREDICTED: uncharacterized protein LOC104429454  59.3    1e-07   
ref|XP_003590785.1|  Sieve element-occluding protein                  59.7    2e-07   
gb|AES61036.2|  sieve element occlusion protein                       59.7    2e-07   
ref|XP_008444389.1|  PREDICTED: uncharacterized protein LOC103487729  58.9    3e-07   
gb|KDP45230.1|  hypothetical protein JCGZ_15095                       58.9    3e-07   
gb|KDP45223.1|  hypothetical protein JCGZ_15088                       57.8    7e-07   
gb|KDP45224.1|  hypothetical protein JCGZ_15089                       57.8    8e-07   
ref|XP_002515052.1|  conserved hypothetical protein                   57.4    9e-07   
ref|XP_010904539.1|  PREDICTED: uncharacterized protein LOC105031937  57.4    9e-07   
gb|KDP45228.1|  hypothetical protein JCGZ_15093                       57.0    1e-06   
gb|KHG17606.1|  hypothetical protein F383_20800                       57.0    1e-06   
gb|KHG22560.1|  hypothetical protein F383_04018                       57.0    1e-06   
gb|KHG11411.1|  Ornithine aminotransferase                            56.6    2e-06   
ref|XP_007144080.1|  hypothetical protein PHAVU_007G127000g           55.8    3e-06   
ref|XP_010250967.1|  PREDICTED: uncharacterized protein LOC104593...  55.1    4e-06   
ref|XP_009403631.1|  PREDICTED: uncharacterized protein LOC103987146  55.5    4e-06   
ref|XP_002282178.2|  PREDICTED: uncharacterized protein LOC100255...  55.1    5e-06   
ref|XP_010650779.1|  PREDICTED: uncharacterized protein LOC100255...  55.1    5e-06   
ref|XP_010650784.1|  PREDICTED: uncharacterized protein LOC100255...  55.1    5e-06   
emb|CBI16822.3|  unnamed protein product                              55.1    5e-06   
gb|KDO44359.1|  hypothetical protein CISIN_1g008311mg                 54.7    6e-06   
ref|XP_007146209.1|  hypothetical protein PHAVU_006G0215000g          54.7    7e-06   
ref|XP_007146208.1|  hypothetical protein PHAVU_006G021400g           54.7    8e-06   
emb|CAN82617.1|  hypothetical protein VITISV_012086                   54.3    1e-05   
ref|XP_008224079.1|  PREDICTED: uncharacterized protein LOC103323836  53.9    1e-05   
ref|XP_007029300.1|  Uncharacterized protein TCM_025178               53.9    1e-05   
ref|XP_008224131.1|  PREDICTED: uncharacterized protein LOC103323888  53.5    2e-05   
ref|XP_008340363.1|  PREDICTED: uncharacterized protein LOC103403330  52.8    3e-05   
ref|XP_008222003.1|  PREDICTED: uncharacterized protein LOC103321928  52.8    3e-05   
ref|XP_004309997.1|  PREDICTED: uncharacterized protein LOC101307557  51.6    4e-05   
gb|KHG21363.1|  hypothetical protein F383_27730                       52.4    4e-05   
ref|XP_004172103.1|  PREDICTED: uncharacterized LOC101204570          52.0    4e-05   
gb|KGN61636.1|  hypothetical protein Csa_2G194880                     52.0    5e-05   
ref|XP_004150435.1|  PREDICTED: uncharacterized protein LOC101204570  51.6    6e-05   
ref|XP_004495321.1|  PREDICTED: uncharacterized protein LOC101490473  51.6    7e-05   
ref|XP_009359348.1|  PREDICTED: uncharacterized protein LOC103949937  51.2    1e-04   
ref|XP_004308643.1|  PREDICTED: uncharacterized protein LOC101294898  51.2    1e-04   
gb|KHN37707.1|  Putative nucleoredoxin 3                              50.8    1e-04   
ref|XP_006593456.1|  PREDICTED: uncharacterized LOC100807591 isof...  50.8    1e-04   
ref|NP_001242554.1|  uncharacterized LOC100807591                     50.8    1e-04   
ref|XP_008224130.1|  PREDICTED: uncharacterized protein LOC103323887  50.4    2e-04   
ref|XP_002315652.2|  hypothetical protein POPTR_0010s06000g           50.4    2e-04   
gb|KCW86614.1|  hypothetical protein EUGRSUZ_B03242                   50.1    2e-04   
ref|XP_010087775.1|  hypothetical protein L484_016346                 50.1    2e-04   
ref|XP_007221631.1|  hypothetical protein PRUPE_ppb018052mg           50.1    2e-04   
ref|XP_010044529.1|  PREDICTED: uncharacterized protein LOC104433473  50.1    3e-04   
gb|KHN33832.1|  hypothetical protein glysoja_021713                   49.7    3e-04   
ref|XP_007224445.1|  hypothetical protein PRUPE_ppa021991mg           49.3    4e-04   
ref|XP_008222002.1|  PREDICTED: uncharacterized protein LOC103321927  48.9    5e-04   
emb|CBI25482.3|  unnamed protein product                              48.9    5e-04   
ref|XP_008465186.1|  PREDICTED: uncharacterized protein LOC103502848  48.5    7e-04   
ref|XP_008465187.1|  PREDICTED: uncharacterized protein LOC103502849  48.5    7e-04   
ref|XP_008793699.1|  PREDICTED: uncharacterized protein LOC103709...  48.5    7e-04   
gb|KHN37957.1|  hypothetical protein glysoja_042603                   48.5    7e-04   
ref|XP_003590763.1|  Sieve element-occluding protein                  48.5    7e-04   
ref|NP_001240090.1|  uncharacterized protein LOC100818773             48.5    8e-04   
ref|XP_008793698.1|  PREDICTED: uncharacterized protein LOC103709...  48.1    8e-04   
ref|XP_007225527.1|  hypothetical protein PRUPE_ppa026573mg           48.5    8e-04   



>gb|KFK37630.1| hypothetical protein AALP_AA3G008200 [Arabis alpina]
Length=740

 Score =   111 bits (277),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 64/171 (37%), Positives = 103/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + SL+L+V        +D V+ NW + ++YIFLYGG+D++W+R FT      A  
Sbjct  496  WRKETF-SLNLIVD------GIDSVIFNWINPDNYIFLYGGDDLDWIRRFTMAAKATAKD  548

Query  182  IQLKVELAYVGK--------NKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK         K I   +  EN+S+C  + +  +W FWTRL SM  S+I 
Sbjct  549  SNVKLEMAYVGKRNHSHREQTKRISEAVRFENLSHCWTEPAL-MWFFWTRLESMLYSKI-  606

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  607  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIVMITHG  648



>ref|XP_002324001.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
 gb|EEF04134.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
Length=716

 Score =   109 bits (273),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 66/169 (39%), Positives = 101/169 (60%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D V+ NW   E YIF+YGG+D+ WVR+FT+    +A  
Sbjct  486  WREETW-RLELLVD------GIDPVILNWIKEEKYIFMYGGDDVEWVRKFTNTARAVAQA  538

Query  182  IQLKVELAYVGKNK---MIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK++    IR +   I+ E +SY A +    IW FWTRL SM  S+I   
Sbjct  539  ARIPLEMVYVGKSRKREQIRRVMGTINVEKLSY-AWQDLTMIWFFWTRLESMLFSKI---  594

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   D+  +D ++  +KKLL+Y+ +     GWAVLSKG  +VV GHG
Sbjct  595  -QLGKVDD--HDPMMQAIKKLLSYDREG----GWAVLSKGSSVVVNGHG  636



>ref|XP_011010496.1| PREDICTED: uncharacterized protein LOC105115342 [Populus euphratica]
Length=713

 Score =   107 bits (266),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 64/169 (38%), Positives = 99/169 (59%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D V+ NW   E YIFLYGG D+ WVR+FT+    +A  
Sbjct  486  WREETW-RLELLVD------GIDPVILNWIKEEKYIFLYGGGDVEWVRKFTNTARAVAQA  538

Query  182  IQLKVELAYVGKNK------MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK++       +   I+ E +SY A +    +W FWTRL SM  S+I   
Sbjct  539  ARIPLEMVYVGKSREREQIQRVMGTINVEKLSY-AWQDLTMMWFFWTRLESMLYSKI---  594

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   D+  +D ++  +KKLL+Y+ +     GWAVLSKG ++VV GHG
Sbjct  595  -QLGKLDD--HDPMMQEIKKLLSYDREG----GWAVLSKGSRVVVNGHG  636



>ref|XP_006299972.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
 gb|EOA32870.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
Length=1488

 Score =   106 bits (265),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2     WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
             W++E + SL+L++        +D V+ NW + ++YIFLYGG+D++W+R FT      A  
Sbjct  1245  WRKETF-SLNLIID------GIDSVIFNWINPDNYIFLYGGDDLDWIRRFTMAAKATAKD  1297

Query  182   IQLKVELAYVGKN--------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
               +K+E+AYVGK         + I  +I  EN+S+   +    +W FWTRL SM  S+I 
Sbjct  1298  SNVKLEMAYVGKRNHSHREQIRRIGEVIRSENLSHSWAEPPL-MWFFWTRLESMLYSKI-  1355

Query  338   YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
                ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++++  HG
Sbjct  1356  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIIMIVHG  1397


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 7/82 (9%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMIRSIIDKENMSYC  265
            +I LYGG D+ W++ FTS    +A    +++E+ YVGK       + I + I  EN+S+ 
Sbjct  585  FICLYGGEDLQWIKNFTSLWRNVARAANIQLEMVYVGKRNPKNGIQPIINTIRDENLSH-  643

Query  266  ALKSSYSIWRFWTRLRSMFLSR  331
             L   + IW FWTR+ SM+ S+
Sbjct  644  TLPDLFQIWFFWTRIESMWESK  665



>ref|NP_186817.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF01551.1|AC009325_21 unknown protein [Arabidopsis thaliana]
 gb|AAP37684.1| At3g01680 [Arabidopsis thaliana]
 dbj|BAF00055.1| hypothetical protein [Arabidopsis thaliana]
 gb|ADN32814.1| sieve element occlusion b [Arabidopsis thaliana]
 gb|AEE73702.1| uncharacterized protein AT3G01680 [Arabidopsis thaliana]
Length=740

 Score =   105 bits (262),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 101/171 (59%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + SL+L+V        +D V+ NW   ++YIFLYGG+D++W+R FT      A  
Sbjct  497  WRRETF-SLNLIVD------GIDSVIFNWIKPDNYIFLYGGDDLDWIRRFTMAAKATAKD  549

Query  182  IQLKVELAYVGKN--------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              + +E+AYVGK         + I  +I  EN+S+   + +  +W FWTRL SM  S+I 
Sbjct  550  SNVNLEMAYVGKRNHSHREQIRRISEVIRSENLSHSWAEPAL-MWFFWTRLESMLYSKI-  607

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +D+++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  608  ---QLGKADD--HDDVMQGIKKILSYDK----LGGWALLSKGPEIVMIAHG  649



>ref|XP_010496279.1| PREDICTED: uncharacterized protein LOC104773380 [Camelina sativa]
Length=740

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + SL+L++        +D V+ NW + ++YIFLYGG+D++W+R FT      A  
Sbjct  497  WRKETF-SLNLIIDG------IDSVIFNWINPDNYIFLYGGDDLDWIRRFTMAAKATAKD  549

Query  182  IQLKVELAYVGK--------NKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK         + I  +I  EN+S+   +    +W FWTRL SM  S+I 
Sbjct  550  SNVKLEMAYVGKRNHSHREQTRRISEVIRSENLSHSWAEPPL-MWFFWTRLESMLYSKI-  607

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++++  HG
Sbjct  608  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIIMIVHG  649



>ref|XP_010435652.1| PREDICTED: uncharacterized protein LOC104719422 [Camelina sativa]
Length=740

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + SL+L++        +D V+ NW + ++YIFLYGG+D++W+R FT      A  
Sbjct  497  WRKETF-SLNLIIDG------IDSVIFNWINPDNYIFLYGGDDLDWIRRFTMAAKATAKD  549

Query  182  IQLKVELAYVGK--------NKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK         + I  +I  EN+S+   +    +W FWTRL SM  S+I 
Sbjct  550  SNVKLEMAYVGKRNHSHREQTRRISEVIRSENLSHSWAEPPL-MWFFWTRLESMLYSKI-  607

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++++  HG
Sbjct  608  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIIMIVHG  649



>ref|XP_002884266.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60525.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
Length=740

 Score =   105 bits (261),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 63/171 (37%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + SL+L+V        +D V+ NW   ++YIFLYGG+D++W+R FT      A  
Sbjct  497  WRRETF-SLNLIVD------GIDSVIFNWITPDNYIFLYGGDDLDWIRRFTMAAKATAKD  549

Query  182  IQLKVELAYVGK-----NKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              + +E+AYVGK      + IR I   I  EN+S+   + +  +W FWTRL SM  S+I 
Sbjct  550  SNVNLEMAYVGKRNHSHREQIRRISEAIRSENLSHSWAEPAL-MWFFWTRLESMLYSKI-  607

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D++  D+++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  608  ---QLGKADDQ--DDVMQGIKKILSYDK----VGGWALLSKGPEIVMIAHG  649



>ref|XP_009124817.1| PREDICTED: uncharacterized protein LOC103849857 [Brassica rapa]
Length=745

 Score =   104 bits (260),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 62/171 (36%), Positives = 101/171 (59%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E   +L+L+V        +D V+ NW + E+YIFLYGG+D++W+R FT      A  
Sbjct  501  WRRETL-TLNLIVD------GIDSVIFNWINPENYIFLYGGDDLDWIRRFTMAAKATAKD  553

Query  182  IQLKVELAYVGKN--------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK         + I   +  EN+S+   + +  +W FWTRL SM  S+I 
Sbjct  554  SNVKLEMAYVGKRNHSHREHIRRISEAVRAENLSHSWAEPAL-MWFFWTRLESMLYSKI-  611

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  612  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIVMITHG  653



>ref|XP_006408537.1| hypothetical protein EUTSA_v10020146mg [Eutrema salsugineum]
 gb|ESQ49990.1| hypothetical protein EUTSA_v10020146mg [Eutrema salsugineum]
Length=739

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/171 (37%), Positives = 103/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + SL+L+V        +D V+ NW + ++YIFLYGG+D++W+R FT      A  
Sbjct  495  WRRETF-SLNLIVD------GIDSVIFNWINPDNYIFLYGGDDLDWIRRFTMAAKATAKD  547

Query  182  IQLKVELAYVGK-----NKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK      + IR I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  548  SNVKLEMAYVGKRNHSHREQIRRISEAVSAENLSHSWTEPAL-MWFFWARLESMLYSKI-  605

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  606  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIVMIVHG  647



>ref|XP_007031665.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
 gb|EOY02591.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
Length=814

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 57/168 (34%), Positives = 98/168 (58%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D ++ NW   + YIFL+GG+D+ WVR+F +    +A+ 
Sbjct  580  WREETW-RLELLVD------GIDPIILNWIKEDKYIFLFGGDDVEWVRKFATAARSVATA  632

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      + + +II+ E +SY A +    +W FWTRL SM  S+I   
Sbjct  633  ARIPLEMVYVGKSSKREQVRKVTAIINAEKLSY-AWQDQAMVWFFWTRLESMLFSKI---  688

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
             ++   D+  +D ++  +KKLL+Y+ +     GWAV S+G   +V GH
Sbjct  689  -QLGRADD--HDPMMQQIKKLLSYDREG----GWAVFSRGSNTMVNGH  729



>emb|CDY28669.1| BnaCnng05550D [Brassica napus]
Length=745

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 100/171 (58%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E   +L+L+V        +D V+ NW + E+YIFLYGG+D++W+R FT      A  
Sbjct  501  WRRETL-TLNLIVD------GIDSVIFNWINPENYIFLYGGDDLDWIRRFTMAAKATAKD  553

Query  182  IQLKVELAYVGKN--------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK         + I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  554  SNVKLEMAYVGKRNHSHREHIRRISEAVRAENLSHSWAEPAL-MWFFWARLESMLYSKI-  611

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  612  ---QLGKADD--HDEVMQGIKKILSYDK----LGGWALLSKGPEIVMITHG  653



>gb|KHG12713.1| hypothetical protein F383_04328 [Gossypium arboreum]
Length=762

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 63/166 (38%), Positives = 93/166 (56%), Gaps = 28/166 (17%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  LDL+V        +D  +  W   E YIFLYGG+DI W+R F +    +AS 
Sbjct  613  WREETW-RLDLLVD------GIDPTVLTWIKEEKYIFLYGGDDIEWIRRFANSARSVASA  665

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      K +  II+ E +SY A +    IW FW+RL SM  S+I   
Sbjct  666  SRIPLEMVYVGKSNKREQVKKVTGIINAEKLSY-AWQDQAMIWFFWSRLESMLFSKI---  721

Query  344  DEINYFDEECNDEILHGLKKLLAY--EGKNTIIEGWAVLSKGKKMV  475
             ++   D++  D +L  +KKLL+Y  EG      GWAVLS+G  +V
Sbjct  722  -QLGRGDDQ--DPMLQQIKKLLSYGREG------GWAVLSRGSNIV  758



>ref|XP_010029073.1| PREDICTED: uncharacterized protein LOC104419196 [Eucalyptus grandis]
 gb|KCW55917.1| hypothetical protein EUGRSUZ_I01715 [Eucalyptus grandis]
Length=721

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 90/149 (60%), Gaps = 19/149 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D  + NW     YIF+YGG+DI W+R+FTS+  ++A    + +E+ YVGKN   + +R 
Sbjct  501  IDQTILNWIKDGKYIFMYGGDDIEWIRKFTSEARKVALAANISLEMVYVGKNSKREKVRR  560

Query  236  IIDKENMSYCALKSSY----SIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +I  E +++  L  ++     +W FWTRL SM  S+I    ++   DE  +D+++  +K+
Sbjct  561  VI--ETINFEKLSHTWVDLAMVWFFWTRLESMLFSKI----QLGKVDE--SDDLMQQIKR  612

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+++     + GWA+LSKG  + V GHG
Sbjct  613  LLSFDK----VGGWAILSKGSSITVNGHG  637



>ref|XP_003633800.1| PREDICTED: uncharacterized protein LOC100244128 [Vitis vinifera]
Length=825

 Score =   102 bits (254),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 96/169 (57%), Gaps = 26/169 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  591  WKEETW-RLELLVD------GIDPTVLNWVKEGKFIYLYGGTDMEWIRKFTTTAKAVASA  643

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+       K I SI   EN+SYC  +    +W FWTRL SM  S+I  
Sbjct  644  ARIPLEMVYVGKSNKREQVRKCITSIT-TENLSYC-WQDLTMVWFFWTRLESMLFSKI--  699

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++   D++  D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  700  --QLGRGDDD--DSMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  740



>ref|XP_008449999.1| PREDICTED: uncharacterized protein LOC103491716 [Cucumis melo]
Length=714

 Score =   102 bits (253),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 94/168 (56%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW   E YIFLYGG+DI W+R+FT+    +A  
Sbjct  483  WKEETW-RLELLVD------GIDPAVLNWIKEERYIFLYGGDDIEWIRKFTTTAKTVAQA  535

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      K I + I  E + YC  +    IW FWTR+ SM  S+I   
Sbjct  536  ARIPLEMVYVGKSSKRERVKKIITTITTEKLGYC-WQDLTMIWFFWTRIESMLYSKIQLG  594

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
                   ++C D ++  +KKLL+Y+ +     GWAVLSKG  +++ GH
Sbjct  595  KA-----DDC-DPLMQEIKKLLSYDKEG----GWAVLSKGSNVILNGH  632



>ref|XP_009124044.1| PREDICTED: uncharacterized protein LOC103848961 isoform X1 [Brassica 
rapa]
Length=741

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L+L+V        +D ++ NW +  +YIFLYGG+D++W+R FT      A  
Sbjct  497  WRRETF-TLNLIVD------GIDAIIFNWINPGNYIFLYGGDDLDWIRRFTMAAKATAKD  549

Query  182  IQLKVELAYVGK-----NKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK      + IR I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  550  SNVKLEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPAL-MWFFWARLESMLYSKI-  607

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  608  ---QLGKSDD--HDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHG  649



>ref|XP_009124045.1| PREDICTED: uncharacterized protein LOC103848961 isoform X2 [Brassica 
rapa]
Length=739

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L+L+V        +D ++ NW +  +YIFLYGG+D++W+R FT      A  
Sbjct  495  WRRETF-TLNLIVD------GIDAIIFNWINPGNYIFLYGGDDLDWIRRFTMAAKATAKD  547

Query  182  IQLKVELAYVGK-----NKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK      + IR I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  548  SNVKLEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPAL-MWFFWARLESMLYSKI-  605

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  606  ---QLGKSDD--HDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHG  647



>emb|CDX77080.1| BnaC04g38750D [Brassica napus]
Length=739

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L+L+V        +D ++ NW +  +YIFLYGG+D++W+R FT      A  
Sbjct  495  WRRETF-TLNLIVD------GIDAIIFNWINPGNYIFLYGGDDLDWIRRFTMAAKATAKD  547

Query  182  IQLKVELAYVGK-----NKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK      + IR I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  548  SNVKLEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPAL-MWFFWARLESMLYSKI-  605

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  606  ---QLGKSDD--HDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHG  647



>ref|XP_004171463.1| PREDICTED: uncharacterized protein LOC101229786 [Cucumis sativus]
Length=714

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 94/168 (56%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW   E YIFLYGG+DI W+R+FT+    +A  
Sbjct  483  WKEETW-RLELLVD------GIDPAVLNWIKEERYIFLYGGDDIEWIRKFTTTAKTVAQA  535

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      K I + I  E + YC  +    IW FWTR+ SM  S+I   
Sbjct  536  ARIPLEMVYVGKSSKRERVKKIITTITTEKLGYC-WQDLTMIWFFWTRIESMLYSKIQLG  594

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
                   ++C D ++  +KKLL+Y+ +     GWAVLSKG  +++ GH
Sbjct  595  KA-----DDC-DPLMQEIKKLLSYDKEG----GWAVLSKGSNVILNGH  632



>ref|XP_004145690.1| PREDICTED: uncharacterized protein LOC101221710 [Cucumis sativus]
 gb|KGN58227.1| hypothetical protein Csa_3G597260 [Cucumis sativus]
Length=714

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 94/168 (56%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW   E YIFLYGG+DI W+R+FT+    +A  
Sbjct  483  WKEETW-RLELLVD------GIDPAVLNWIKEERYIFLYGGDDIEWIRKFTTTAKTVAQA  535

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      K I + I  E + YC  +    IW FWTR+ SM  S+I   
Sbjct  536  ARIPLEMVYVGKSSKRERVKKIITTITTEKLGYC-WQDLTMIWFFWTRIESMLYSKIQLG  594

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
                   ++C D ++  +KKLL+Y+ +     GWAVLSKG  +++ GH
Sbjct  595  KA-----DDC-DPLMQEIKKLLSYDKEG----GWAVLSKGSNVILNGH  632



>emb|CDY37506.1| BnaA05g33710D [Brassica napus]
Length=739

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 61/171 (36%), Positives = 102/171 (60%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L+L+V        +D ++ NW +  +YIFLYGG+D++W+R FT      A  
Sbjct  495  WRRETF-TLNLIVD------GIDAIIFNWINPGNYIFLYGGDDLDWIRRFTMAAKATAKD  547

Query  182  IQLKVELAYVGK-----NKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK      + IR I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  548  SNVKLEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPAL-MWFFWARLESMLYSKI-  605

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  606  ---QLGKSDD--HDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHG  647



>emb|CDY17992.1| BnaC03g30640D [Brassica napus]
Length=354

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 100/171 (58%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L+L+V        +D V+ NW +  +YIFLYGG+D++W+R FT      A  
Sbjct  110  WRRETF-TLNLIVDG------IDAVIFNWINPGNYIFLYGGDDLDWIRRFTMAAKATAKD  162

Query  182  IQLKVELAYVGKN--------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
              +K+E+AYVGK         + I   +  EN+S+   + +  +W FW RL SM  S+I 
Sbjct  163  SDVKLEMAYVGKRNHSHREQIRRISEAVRAENLSHSWAEPAL-MWFFWARLESMLYSKI-  220

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               ++   D+  +DE++ G+KK+L+Y+     + GWA+LSKG ++V+  HG
Sbjct  221  ---QLGKSDD--HDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHG  262



>ref|XP_002526960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35447.1| conserved hypothetical protein [Ricinus communis]
Length=685

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 20/149 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D ++ NW   E+YIFL+GG+D+ WV+EFT  + +++   Q  VE+ Y+GK+       K
Sbjct  473  IDPMLVNWVGEEEYIFLHGGDDVEWVKEFTEMVRKVSQAAQKPVEMVYLGKSYKKDKVRK  532

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            + ++I D E + +        IW FWTRL SM  S+I    ++   DE  ND + H +KK
Sbjct  533  IAKTITD-EKLGHSW--DPTMIWFFWTRLDSMLFSKI----QLRKIDE--NDTLTHEIKK  583

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L++Y+ +     GWA+LSKG  +VV GH 
Sbjct  584  LISYDKEM----GWALLSKGPNIVVNGHS  608



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 62/169 (37%), Positives = 96/169 (57%), Gaps = 26/169 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  518  WKEETW-RLELLVD------GIDPTVLNWVKEGKFIYLYGGTDMEWIRKFTTTARAVASA  570

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+       K I SI   +N+SYC  +    +W FWTRL SM  S+I  
Sbjct  571  ARIPLEMVYVGKSNKREQVRKCITSIT-TDNLSYC-WQDLTMVWFFWTRLESMLFSKI--  626

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++   D++  D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  627  --QLGRGDDD--DSMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  667



>gb|KDP46373.1| hypothetical protein JCGZ_10213 [Jatropha curcas]
Length=718

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 17/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  + NW     YIFLYGG+D+ W+R+FT+    +A   ++ +E+ YVGK+      + 
Sbjct  498  IDPTILNWIKEGKYIFLYGGDDVEWIRKFTNTARAVAQAARISLEMVYVGKSCKRDKVQR  557

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I S I  E +SY   +    IW FWTRL+SM  S+I    ++   DE  +D ++  +KKL
Sbjct  558  IISTITVEKLSYV-WQDLTMIWFFWTRLQSMLYSKI----QLGKIDE--HDPMMQEIKKL  610

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+Y+ +     GWAVLS+G  +VV GH 
Sbjct  611  LSYDKEG----GWAVLSRGSNIVVNGHS  634



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 90/168 (54%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     YI+LYGG D+ W+R+FT+    +AS 
Sbjct  568  WREESW-KLELLVD------GIDPTILNWIKEGKYIYLYGGTDMEWIRKFTTTARAVAST  620

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+K    +      I  E +SYC    +  +W FW RL SM  S+I   
Sbjct  621  ARIPLEMVYVGKSKKREQVRKCTTAITLEKLSYCWPDLAM-VWFFWIRLESMMFSKIQLG  679

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  680  STVDV------DPMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  717



>ref|XP_010660833.1| PREDICTED: uncharacterized protein LOC100245845 [Vitis vinifera]
Length=712

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 59/169 (35%), Positives = 93/169 (55%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V         D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  478  WKEETW-KLELLVD------GTDPTILNWIKEGKFIYLYGGTDMEWIRKFTTTAKAVASA  530

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+     +      I  E +S+C  +    +W FWTRL SM  S+I   
Sbjct  531  ARIPLEMVYVGKSTKREQVRRCIASITAEKLSHC-WQDLTMVWFFWTRLESMLFSKI---  586

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   D++  D ++H +KKLL+Y+ +     GWAVLSKG    V GHG
Sbjct  587  -QLGQADDQ--DPMMHEIKKLLSYDKEG----GWAVLSKGSFTFVNGHG  628



>emb|CAN65452.1| hypothetical protein VITISV_003896 [Vitis vinifera]
Length=721

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 62/169 (37%), Positives = 95/169 (56%), Gaps = 26/169 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  487  WKEETW-RLELLVD------GIDPTVLNWVKEGKFIYLYGGTDMEWIRKFTTTAKAVASA  539

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+       K I SI    N+SYC  +    +W FWTRL SM  S+I  
Sbjct  540  ARIPLEMVYVGKSNKREQVRKCITSIT-TXNLSYC-WQDLTMVWFFWTRLESMLFSKI--  595

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++   D++  D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  596  --QLGRGDDD--DSMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  636



>emb|CBI34826.3| unnamed protein product [Vitis vinifera]
Length=659

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 96/169 (57%), Gaps = 26/169 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  460  WKEETW-RLELLVD------GIDPTVLNWVKEGKFIYLYGGTDMEWIRKFTTTAKAVASA  512

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+       K I SI   EN+SYC  +    +W FWTRL SM  S+I  
Sbjct  513  ARIPLEMVYVGKSNKREQVRKCITSIT-TENLSYC-WQDLTMVWFFWTRLESMLFSKI--  568

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++   D++  D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  569  --QLGRGDDD--DSMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  609



>emb|CBI34825.3| unnamed protein product [Vitis vinifera]
Length=694

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 62/169 (37%), Positives = 96/169 (57%), Gaps = 26/169 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  460  WKEETW-RLELLVD------GIDPTVLNWVKEGKFIYLYGGTDMEWIRKFTTTARAVASA  512

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+       K I SI   +N+SYC  +    +W FWTRL SM  S+I  
Sbjct  513  ARIPLEMVYVGKSNKREQVRKCITSIT-TDNLSYC-WQDLTMVWFFWTRLESMLFSKI--  568

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++   D++  D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  569  --QLGRGDDD--DSMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  609



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 61/149 (41%), Positives = 87/149 (58%), Gaps = 21/149 (14%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW +   YIFLYGG+D  WVR+FTS    +A   ++ +E+ YVGK+   + IR 
Sbjct  502  IDPVILNWINEGKYIFLYGGDDDEWVRKFTSSARAVAQAARIPLEIVYVGKSSKREKIRR  561

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    +W FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  562  VIATITVEKLSY-VWQDLTMMWFFWTRLESMLYSKI----QLGKLDD--HDPMMQEIKKL  614

Query  407  LAY--EGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y  EG      GWAVLSKG  +VV GH
Sbjct  615  LSYGREG------GWAVLSKGSNVVVNGH  637



>ref|XP_010550173.1| PREDICTED: uncharacterized protein LOC104821101 [Tarenaya hassleriana]
Length=732

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK-NKMIRSII  241
            +D ++ +W   E YIFLYGG D+ W+  FT      A+   +K+E+AYVGK N   R  I
Sbjct  502  IDPIIFSWIKPETYIFLYGGEDMGWIERFTKAARATATDANIKLEMAYVGKRNHSHREQI  561

Query  242  DKENMSYCALKSSYS------IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             + + +  A   SYS      +W FWTRL SM  S+I    ++   D+  +D+++ G+KK
Sbjct  562  RRISETVKARDLSYSWTDPAMMWFFWTRLESMLYSKI----QLGKADD--HDDVMQGIKK  615

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +L+Y+     I GWA+LSKG+++V+  HG
Sbjct  616  ILSYDK----IGGWALLSKGEEIVMIAHG  640



>ref|XP_010029068.1| PREDICTED: uncharacterized protein LOC104419192 [Eucalyptus grandis]
Length=722

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 60/169 (36%), Positives = 97/169 (57%), Gaps = 26/169 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L+L+V        +D  + NW     YIFLYGG+DI W+R+FT+   ++A  
Sbjct  488  WKEEEW-TLELLVD------GMDPTILNWIREGKYIFLYGGDDIEWIRKFTTAARQVAMA  540

Query  182  IQLKVELAYVGKN---KMIRSIIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+   + ++  ID  N     L S++     +W FWTRL SMF S+I  
Sbjct  541  ARIPLEMVYVGKSSKREQVQRAIDTINDE--KLSSTWQDLTLVWYFWTRLESMFFSKI--  596

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++   DE  +  ++  LK+LL+++       GWA+LSKG  +VV GH
Sbjct  597  --QLGKVDE--HGLLIQQLKRLLSFDKAG----GWAILSKGSSIVVNGH  637



>ref|XP_011013023.1| PREDICTED: uncharacterized protein LOC105117152 [Populus euphratica]
Length=724

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 61/149 (41%), Positives = 87/149 (58%), Gaps = 21/149 (14%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW +   YIFLYGG+D  WVR+FTS    +A   ++ +E+ YVGK+   + IR 
Sbjct  503  IDPVILNWINEGKYIFLYGGDDDEWVRKFTSSARAVAQAARIPLEMVYVGKSSKREKIRQ  562

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    +W FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  563  VIATITVEKLSY-VWQDLTMMWFFWTRLESMLNSKI----QLGKLDD--HDPMMQEIKKL  615

Query  407  LAY--EGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y  EG      GWAVLSKG  +VV GH
Sbjct  616  LSYGREG------GWAVLSKGSNVVVNGH  638



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 17/147 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  502  IDPVILNWIKEGKYIFLYGGDDDEWVRKFTNTARAVAQAARIPLEMVYVGKSSKREKIRR  561

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    IW FWTRL SM  SRI    ++   D+  +D ++  +KKL
Sbjct  562  VIATITVEKLSY-VWQDLTMIWFFWTRLESMLYSRI----QLGKLDD--HDPMMQEIKKL  614

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y+ +     GWAVLS G  +VV GH
Sbjct  615  LSYDREG----GWAVLSNGSNVVVNGH  637



>ref|XP_002271723.2| PREDICTED: uncharacterized protein LOC100242213 [Vitis vinifera]
Length=715

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 58/168 (35%), Positives = 91/168 (54%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + +W     YI+LYGG D+ W+R+FT+    +AS 
Sbjct  481  WREESW-KLELLVD------GIDPTILSWIKEGKYIYLYGGTDMEWIRKFTTTARAIAST  533

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      +   + I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  534  ARIPLEMVYVGKSTKREQVRKCTTAITAEKLSYC-WQDLAMVWFFWTRLESMMFSKIQLG  592

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  593  STVDV------DPMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  630



>gb|KHN27576.1| hypothetical protein glysoja_018688 [Glycine soja]
Length=727

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 88/150 (59%), Gaps = 20/150 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  + NW     YIFL+GG+D  WVR F  +  R+A+  Q+ +E+ YVGK+       K
Sbjct  496  IDQEILNWVKDGKYIFLFGGDDPEWVRRFVKEARRVATATQIPLEMVYVGKSNKREQVQK  555

Query  224  MIRSII-DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            +I +II DK N  Y + +S   IW FWTRL+SM  S++    ++   D+  +D ++  +K
Sbjct  556  IIDTIIRDKLNTQYWSEQS--MIWFFWTRLQSMLFSKL----QLKQTDD--DDHVMQEIK  607

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            KLL+Y+ +     GW VL++G  +VV GH 
Sbjct  608  KLLSYDKQG----GWIVLARGSHIVVNGHA  633



>ref|NP_001239838.1| uncharacterized protein LOC100801064 [Glycine max]
 gb|ADN32797.1| sieve element occlusion m [Glycine max]
Length=727

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 88/150 (59%), Gaps = 20/150 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  + NW     YIFL+GG+D  WVR F  +  R+A+  Q+ +E+ YVGK+       K
Sbjct  496  IDQEILNWVKDGKYIFLFGGDDPEWVRRFVKEARRVATATQIPLEMVYVGKSNKREQVQK  555

Query  224  MIRSII-DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            +I +II DK N  Y + +S   IW FWTRL+SM  S++    ++   D+  +D ++  +K
Sbjct  556  IIDTIIRDKLNTQYWSEQS--MIWFFWTRLQSMLFSKL----QLKQTDD--DDHVMQEIK  607

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            KLL+Y+ +     GW VL++G  +VV GH 
Sbjct  608  KLLSYDKQG----GWIVLARGSHIVVNGHA  633



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 56/147 (38%), Positives = 84/147 (57%), Gaps = 17/147 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D V+ NW     YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+      + 
Sbjct  501  IDPVILNWIKEGKYIFLYGGDDDEWVRKFTNTARTVAQSARIHLEMVYVGKSSKREKIRR  560

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            + + I  E +SY A +    IW FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  561  VIATITGEKLSY-AWQDLTMIWFFWTRLESMLYSKI----QLGKLDD--HDPMMQEIKKL  613

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y+ +     GWAVLS G  +V  GH
Sbjct  614  LSYDREG----GWAVLSNGSNVVANGH  636



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 58/168 (35%), Positives = 89/168 (53%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     YI+LYGG D+ W+R+FT+    +AS 
Sbjct  532  WREESW-KLELLVD------GIDPTILNWIKEGKYIYLYGGTDMEWIRKFTTTARAVAST  584

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG +K    +      I  E +SYC    +  +W FW RL SM  S+I   
Sbjct  585  ARIPLEMVYVGNSKKREQVRKCTTAITLEKLSYCWPDLAM-VWFFWIRLESMMFSKIQLG  643

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKLL+Y+ +     GWAVLSKG  + V GH
Sbjct  644  STVDV------DPMLREIKKLLSYDKEG----GWAVLSKGSFVFVNGH  681



>emb|CAN61289.1| hypothetical protein VITISV_032473 [Vitis vinifera]
Length=723

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  489  WREESW-KLELLVD------GIDPTILNWIKEGKFIYLYGGTDMEWIRKFTTTARAVASA  541

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG++K    +      I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  542  ARIPLEMVYVGQSKKREQVRKCTTAITVEKLSYC-WQDLTMVWFFWTRLESMMFSKIQLG  600

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKL++Y+ +     GWAVLS G  + V GH
Sbjct  601  STVDV------DPMLREIKKLISYDKEG----GWAVLSNGSFVFVNGH  638



>ref|XP_004516128.1| PREDICTED: uncharacterized protein LOC101508220 [Cicer arietinum]
Length=729

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D  + NW     YIFLYGG+D +W+R F  +  R+A   Q  +E+ Y+GK+   + ++ 
Sbjct  498  IDTEILNWIKEGKYIFLYGGDDPDWIRRFVKEARRVAQATQTPLEMVYLGKSNKREQVQR  557

Query  236  IID---KENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            ++D   +EN+   +      IW FWTRL+SM  S+I    ++   D+  ND ++  +KKL
Sbjct  558  VVDTIIRENLYSHSWSEQSMIWFFWTRLQSMLFSKI----QLKQVDD--NDIVMQEIKKL  611

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+Y+ +     GW VL++G ++VV GH 
Sbjct  612  LSYDKQG----GWFVLARGSQIVVNGHA  635



>ref|XP_010029072.1| PREDICTED: uncharacterized protein LOC104419195 [Eucalyptus grandis]
 gb|KCW55916.1| hypothetical protein EUGRSUZ_I01714 [Eucalyptus grandis]
Length=722

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 60/170 (35%), Positives = 97/170 (57%), Gaps = 26/170 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     YIFLYGG+DI W+R+FT+   ++A  
Sbjct  490  WREEKW-RLELLVD------GMDPTILNWISDGKYIFLYGGDDIEWIRKFTAAARQVALA  542

Query  182  IQLKVELAYVGKN---KMIRSIIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+   + +R +I   N+    L S++     +W FWTRL SM  S+I  
Sbjct  543  ARIPLEMVYVGKSNKREKVRQVIATINVE--KLSSTWQDPTLVWYFWTRLESMLFSKI--  598

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              ++   DEE  D ++  +K+LL+++       GWAVLS+G  + V GHG
Sbjct  599  --QLGKADEE--DHMMQQIKRLLSFDKAG----GWAVLSRGSAITVNGHG  640



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 60/149 (40%), Positives = 86/149 (58%), Gaps = 21/149 (14%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D  + NW +   YIFLYGG+D  WVR+FTS    +A   ++ +E+ YVGK+   + IR 
Sbjct  503  IDPEILNWINEGKYIFLYGGDDDEWVRKFTSSARAVAQAARIPLEMVYVGKSSKREKIRQ  562

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    +W FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  563  VIATITVEKLSY-VWQDLTMMWFFWTRLESMLYSKI----QLGKLDD--HDPMMQEIKKL  615

Query  407  LAY--EGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y  EG      GWAVLSKG  +VV GH
Sbjct  616  LSYGREG------GWAVLSKGSNVVVNGH  638



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 85/147 (58%), Gaps = 17/147 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIF+YGG+D  WVR+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  502  IDPVILNWIKEGKYIFMYGGDDDEWVRKFTNTARAVAQAARIPLEMVYVGKSSKREKIRR  561

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    IW FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  562  VIATITVEKLSY-VWQDLTMIWFFWTRLESMLYSKI----QLGKLDD--HDPMMQEIKKL  614

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y+ +     GWAVLS G  +VV GH
Sbjct  615  LSYDREG----GWAVLSNGSNVVVNGH  637



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  509  WREESW-KLELLVD------GIDPTILNWIKEGKFIYLYGGTDMEWIRKFTTTARAVASA  561

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG++K    +      I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  562  ARIPLEMVYVGQSKKREQVRKCTTAITVEKLSYC-WQDLTMVWFFWTRLESMMFSKIQLG  620

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKL++Y+ +     GWAVLS G  + V GH
Sbjct  621  STVDV------DPMLREIKKLISYDKEG----GWAVLSNGSFVFVNGH  658



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 84/147 (57%), Gaps = 17/147 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  W R+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  501  IDPVILNWIKEGKYIFLYGGDDDEWARKFTNTARAVAQAARIPLEMVYVGKSSKREKIRR  560

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    IW FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  561  VIATITVEKLSY-VWQDLTMIWFFWTRLESMLYSKI----QLGRLDD--HDPMMQEIKKL  613

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y+ +     GWAVLSKG  +V  GH
Sbjct  614  LSYDREG----GWAVLSKGSNVVANGH  636



>gb|KCW55914.1| hypothetical protein EUGRSUZ_I01712 [Eucalyptus grandis]
Length=449

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 19/148 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D  + NW     YIFLYGG+DI W+R+FT+   ++A   ++ +E+ YVGK+   + ++ 
Sbjct  229  MDPTILNWIREGKYIFLYGGDDIEWIRKFTTAARQVAMAARIPLEMVYVGKSSKREQVQR  288

Query  236  IIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             ID  N     L S++     +W FWTRL SMF S+I    ++   DE  +  ++  LK+
Sbjct  289  AIDTINDE--KLSSTWQDLTLVWYFWTRLESMFFSKI----QLGKVDE--HGLLIQQLKR  340

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            LL+++       GWA+LSKG  +VV GH
Sbjct  341  LLSFDKAG----GWAILSKGSSIVVNGH  364



>ref|XP_006369948.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
 gb|ERP66517.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
Length=722

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 59/149 (40%), Positives = 86/149 (58%), Gaps = 21/149 (14%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW +   YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  501  IDPVILNWINEGKYIFLYGGDDDEWVRKFTNTARAVAQAARIPLEMVYVGKSSKREKIRR  560

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    +W FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  561  VIATITVEKLSY-VWQDLTMMWFFWTRLESMLYSKI----QLGKLDD--HDPMMQEIKKL  613

Query  407  LAY--EGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y  EG      GWAVLS G  +VV GH
Sbjct  614  LSYGREG------GWAVLSNGSNVVVNGH  636



>ref|XP_010660831.1| PREDICTED: uncharacterized protein LOC100264492 [Vitis vinifera]
Length=697

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  463  WREESW-KLELLVD------GIDPTILNWIKEGKFIYLYGGTDLEWIRKFTTTARAVASA  515

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG++K    +      I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  516  ARIPLEMVYVGQSKKREQVRKCTTAITVEKLSYC-WQDLTMVWFFWTRLESMMFSKIQLG  574

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKL++Y+ +     GWAVLS G  + V GH
Sbjct  575  STVDV------DPMLREIKKLISYDKEG----GWAVLSNGSFVFVNGH  612



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 55/147 (37%), Positives = 83/147 (56%), Gaps = 17/147 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D V+ NW     YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+      + 
Sbjct  501  IDPVILNWIKEGKYIFLYGGDDDEWVRKFTNTARTVAQSARIPLEMVYVGKSSKREKIRR  560

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            + + I  E +SY   +    IW FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  561  VIATITGEKLSY-FWQDLTMIWFFWTRLESMLYSKI----QLGKLDD--HDPLMQEIKKL  613

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y+ +     GWAVLS G  +V  GH
Sbjct  614  LSYDREG----GWAVLSNGSNVVANGH  636



>emb|CBI34821.3| unnamed protein product [Vitis vinifera]
Length=1487

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 24/168 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  555  WREESW-KLELLVD------GIDPTILNWIKEGKFIYLYGGTDMEWIRKFTTTARAVASA  607

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG++K    +      I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  608  ARIPLEMVYVGQSKKREQVRKCTTAITVEKLSYC-WQDLTMVWFFWTRLESMMFSKIQLG  666

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++       D +L  +KKL++Y+ +     GWAVLS G  + V GH
Sbjct  667  STVDV------DPMLREIKKLISYDKEG----GWAVLSNGSFVFVNGH  704


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 80/145 (55%), Gaps = 20/145 (14%)
 Frame = +2

Query  2     WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
             W++E +  L+L+V         D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  1323  WKEETW-KLELLVD------GTDPTILNWIKEGKFIYLYGGTDMEWIRKFTTTAKAVASA  1375

Query  182   IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              ++ +E+ YVGK+     +      I  E +S+C  +    +W FWTRL SM  S+I   
Sbjct  1376  ARIPLEMVYVGKSTKREQVRRCIASITAEKLSHC-WQDLTMVWFFWTRLESMLFSKI---  1431

Query  344   DEINYFDEECNDEILHGLKKLLAYE  418
              ++   D++  D ++H +KKLL+Y+
Sbjct  1432  -QLGQADDQ--DPMMHEIKKLLSYD  1453



>ref|XP_007140863.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
 gb|ESW12857.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
Length=727

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 87/150 (58%), Gaps = 20/150 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  + NW     YIFL+GG+D  WVR F  +  R+A   Q+ +E+ YVGK+       K
Sbjct  496  IDQDILNWIKDGKYIFLFGGDDPEWVRRFVKEGRRVAMATQIPLEMVYVGKSNKREQVQK  555

Query  224  MIRSII-DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            +I +II DK N  Y + +S   IW FWTRL+SM  S++    ++   D+  +D ++  +K
Sbjct  556  IIDTIIRDKLNTQYWSEQS--MIWFFWTRLQSMLFSKL----QLKQSDD--DDHVMQEIK  607

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            KLL+Y+ +     GW VL++G  +VV GH 
Sbjct  608  KLLSYDKQG----GWIVLARGSHIVVNGHA  633



>ref|XP_010029069.1| PREDICTED: uncharacterized protein LOC104419193 [Eucalyptus grandis]
Length=705

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 96/169 (57%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  +  W +   YIFLYGG+DI W+R+FT+   ++A  
Sbjct  471  WKEETW-RLELLVD------GIDQTILTWINEGKYIFLYGGDDIEWIRKFTAAARQVALA  523

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      + + + I+ E +SY   +    +W FWTR+ SM  S+I   
Sbjct  524  ARIPLEMVYVGKSNKREKVRQVIATINVEKLSY-TWQDPTLVWYFWTRIESMLFSKI---  579

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   DE+  D ++  +K+LL+++       GWA+LSKG  + V GHG
Sbjct  580  -QLGKVDED--DPMMQQIKRLLSFDKAG----GWAILSKGSSITVNGHG  621



>ref|XP_010694661.1| PREDICTED: uncharacterized protein LOC104907426 [Beta vulgaris 
subsp. vulgaris]
Length=759

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 54/169 (32%), Positives = 100/169 (59%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE +  L+L+V        +D  + +W   E YIFLYGG+D+ W+R+FT++   +A  
Sbjct  507  WEQETW-RLELLVN------GIDQKILDWIREEKYIFLYGGDDLEWIRKFTNEARAVARA  559

Query  182  IQLKVELAYVGKN---KMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            +++ +E+ YVG++   +++R +   I  E +S+C  +    +W FWTR+ SM  S+   L
Sbjct  560  LRVPIEMVYVGRSHNKELVRKVCAAIIVEQLSHC-WQDPTMVWYFWTRIESMIFSKFQ-L  617

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            ++++    +  D IL  +++L +++  +    GWA+L+KG  +VV G G
Sbjct  618  EKVH----DHGDIILQEIQRLHSHDKSHA---GWAILAKGSTIVVHGQG  659



>ref|XP_011013170.1| PREDICTED: uncharacterized protein LOC105117262 [Populus euphratica]
Length=722

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 57/148 (39%), Positives = 84/148 (57%), Gaps = 19/148 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  502  IDPVILNWIKEGKYIFLYGGDDDEWVRKFTNTARTVALAARIPLEMVYVGKSSKREKIRQ  561

Query  236  IIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +I    ++   L S +     IW FWTRL SM  SRI    ++   D+  +D ++  +KK
Sbjct  562  VI--ATITAEKLSSVWPDLTMIWFFWTRLESMLYSRI----QLGKVDD--HDPMMQEIKK  613

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            LL+Y+ +     GWAVLS G  +V  GH
Sbjct  614  LLSYDREG----GWAVLSNGSNVVATGH  637



>ref|XP_010694662.1| PREDICTED: uncharacterized protein LOC104907427 [Beta vulgaris 
subsp. vulgaris]
Length=819

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 54/169 (32%), Positives = 98/169 (58%), Gaps = 22/169 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE +  L+L+V        +D  + +W     YIF+YGG+DI W+R+FT + H +A  
Sbjct  575  WEQETW-RLELLVN------GIDPKILDWIRDGKYIFIYGGDDIEWIRKFTREAHAVARA  627

Query  182  IQLKVELAYVGKN---KMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            +Q+ +E+ YVG++   +++R +   I  E +S+C  +    +W FWTR+ SM  S+I  L
Sbjct  628  LQVSMEMVYVGRSHNKELVRKVGEAIMVEQLSHC-WQDPTQVWYFWTRIESMIFSKIQ-L  685

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              ++    +  D IL  ++++ +++  +    GWA+L+KG  ++V G G
Sbjct  686  GRVH----DHGDVILQEIQRIHSHDKSHG---GWAILAKGSTIMVHGQG  727



>ref|XP_006432374.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
 gb|ESR45614.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
Length=716

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 57/169 (34%), Positives = 98/169 (58%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D ++ +W     YIFLYGG+D+ WVR+FT+    +A+ 
Sbjct  481  WKEETW-RLELLVD------GIDPLVLDWIKEGKYIFLYGGDDVEWVRKFTTAARSVANT  533

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      + I + +  E + +   +    +W FWTRL SM LS+I   
Sbjct  534  ARIPLEMVYVGKSTKREQVRRIMATLAVEKLGH-FWQDLTMVWFFWTRLESMLLSKI---  589

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   D+  +D ++  +KKLL+Y+       GWA+LSKG +++V GHG
Sbjct  590  -QLGRADDH-HDPMVPQIKKLLSYDRDG----GWALLSKGSQVLVNGHG  632



>gb|KCW55913.1| hypothetical protein EUGRSUZ_I01711 [Eucalyptus grandis]
Length=591

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 96/169 (57%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  +  W +   YIFLYGG+DI W+R+FT+   ++A  
Sbjct  357  WKEETW-RLELLVD------GIDQTILTWINEGKYIFLYGGDDIEWIRKFTAAARQVALA  409

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      + + + I+ E +SY   +    +W FWTR+ SM  S+I   
Sbjct  410  ARIPLEMVYVGKSNKREKVRQVIATINVEKLSY-TWQDPTLVWYFWTRIESMLFSKI---  465

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   DE+  D ++  +K+LL+++       GWA+LSKG  + V GHG
Sbjct  466  -QLGKVDED--DPMMQQIKRLLSFDKAG----GWAILSKGSSITVNGHG  507



>ref|XP_009592492.1| PREDICTED: uncharacterized protein LOC104089332 [Nicotiana tomentosiformis]
Length=712

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 84/152 (55%), Gaps = 22/152 (14%)
 Frame = +2

Query  26   LDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELA  205
            L+LVV    +N+        W     YI LYGG D+ W+ +FT+    +A +  + + + 
Sbjct  493  LELVVDGIDQNI------IEWMTAGKYICLYGGEDVEWIEKFTTSAKSVAHRAGIDLHMI  546

Query  206  YVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDE  367
            YVGK+      + I SII KEN+SYC L    S+W FWTRL SMF S++     I     
Sbjct  547  YVGKSNNKDRVRRINSIIRKENLSYC-LDDVMSVWYFWTRLESMFYSKMQLGQTIK----  601

Query  368  ECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              +D+I+  +  +L+++G +   +GWAV+S+G
Sbjct  602  --DDKIMQEVLTMLSFDGSD---QGWAVISRG  628



>ref|XP_006439978.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
 gb|ESR53218.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
Length=698

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 77/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W   E ++ LYGG DI W+R+FT+    +A  +Q+ + +AYVGKN        
Sbjct  485  IDATILEWMKEERFVCLYGGEDIEWIRQFTNSAKAVARAVQINLGMAYVGKNNAKEKLGK  544

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I SI+ +EN+S+  L  S ++W FW RL SM  S++ +   +       ND IL  +  +
Sbjct  545  ISSIVIQENLSH-TLADSTAMWFFWARLESMLYSKLQHGATVE------NDRILKEVTTV  597

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  KG
Sbjct  598  LSFDGSE---QGWAIFWKG  613



>ref|XP_003622294.1| hypothetical protein MTR_7g032660 [Medicago truncatula]
 gb|ABD32254.1| hypothetical protein MtrDRAFT_AC149040g7v2 [Medicago truncatula]
 gb|ADN32809.1| sieve element occlusion e [Medicago truncatula]
 gb|AES78512.1| sieve element occlusion protein [Medicago truncatula]
Length=729

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 83/149 (56%), Gaps = 18/149 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  + NW     YIFLYGG+D  W++ F  +  ++A   +  +E+ YVGK+       K
Sbjct  497  IDSEILNWIKEGKYIFLYGGDDPEWIKRFVKEARKVAQATRTPLEMVYVGKSNKRDQVQK  556

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +  +II +E +   +      IW FWTRL+SM  S+I    ++   D+  ND ++  +KK
Sbjct  557  VCDTII-REKLYTHSWSEQSMIWFFWTRLQSMLFSKI----QLKQVDD--NDRVMQEIKK  609

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+ +     GW VL+KG ++VV GH 
Sbjct  610  LLSYDKQG----GWIVLAKGSQIVVNGHA  634



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 55/147 (37%), Positives = 82/147 (56%), Gaps = 17/147 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  W R+F +    +A   ++ +E+ YVGK+   + IR 
Sbjct  501  IDPVILNWIKEGKYIFLYGGDDDEWARKFANTARAVAQAARIPLEMVYVGKSSKREKIRR  560

Query  236  IIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I     E +SY   +    IW FWTRL SM  S+I    ++   D+  +D ++  +KKL
Sbjct  561  VIATITVEKLSY-VWQDLTMIWFFWTRLESMVYSKI----QLGRLDD--HDPMMQEIKKL  613

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            L+Y+ +     GWAVLS G  +V  GH
Sbjct  614  LSYDREG----GWAVLSNGSNVVANGH  636



>gb|KDO69425.1| hypothetical protein CISIN_1g019680mg [Citrus sinensis]
Length=337

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 76/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W   E ++ LYGG DI W+R+FT+    +A   Q+ + +AYVGKN        
Sbjct  124  IDATILEWMKEERFVCLYGGEDIEWIRQFTNSAKAVARAAQINLGMAYVGKNNAKEKLGK  183

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I SII +EN+S+  L  S ++W FW RL SM  S++ +   +       ND IL  +  +
Sbjct  184  ISSIIIQENLSH-TLADSTAVWFFWARLESMLYSKLQHGATVE------NDRILKEVTTV  236

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  237  LSFDGSE---QGWAIFWRG  252



>ref|XP_011046122.1| PREDICTED: uncharacterized protein LOC105140824 [Populus euphratica]
Length=639

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 84/148 (57%), Gaps = 19/148 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  W+R+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  418  IDPVILNWIKEGKYIFLYGGDDDEWMRKFTNTARTVALAARIPLEMVYVGKSSKREKIRR  477

Query  236  IIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +I    ++   L S +     IW FWTRL SM  SRI    ++   D+  +D ++  +KK
Sbjct  478  VI--ATITAEKLSSVWPDLTMIWFFWTRLESMLYSRI----QLGKLDD--HDPMMQEIKK  529

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            LL+Y+ +     GWAVLS G  +V  GH
Sbjct  530  LLSYDREG----GWAVLSNGSNVVATGH  553



>emb|CBI34823.3| unnamed protein product [Vitis vinifera]
Length=1392

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 85/160 (53%), Gaps = 24/160 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     YI+LYGG D+ W+R+FT+    +AS 
Sbjct  532  WREESW-KLELLVD------GIDPTILNWIKEGKYIYLYGGTDMEWIRKFTTTARAVAST  584

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG +K    +      I  E +SYC    +  +W FW RL SM  S+I   
Sbjct  585  ARIPLEMVYVGNSKKREQVRKCTTAITLEKLSYCWPDLAM-VWFFWIRLESMMFSKIQLG  643

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              ++       D +L  +KKLL+Y+ +     GWAVLSKG
Sbjct  644  STVDV------DPMLREIKKLLSYDKEG----GWAVLSKG  673


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 54/170 (32%), Positives = 89/170 (52%), Gaps = 26/170 (15%)
 Frame = +2

Query  2     WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
             W++E +  L+L+V        +D  + +W     YI+LYGG D+ W+R+FT+    +AS 
Sbjct  1232  WREESW-KLELLVD------GIDPTILSWIKEGKYIYLYGGTDMEWIRKFTTTARAIAST  1284

Query  182   IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              ++ +E+ YVGK+      +   + I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  1285  ARIPLEMVYVGKSTKREQVRKCTTAITAEKLSYC-WQDLAMVWFFWTRLESMMFSKIQLG  1343

Query  344   DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMV--VCGH  487
               ++       D +L  +KKLL+Y+ +     GWA L   +K +  +C H
Sbjct  1344  STVDV------DPMLREIKKLLSYDKEG----GWACLRNMEKYMAFLCCH  1383



>ref|XP_006471327.1| PREDICTED: uncharacterized protein LOC102619778 [Citrus sinensis]
Length=716

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 98/169 (58%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D ++ +W     YIFLYGG+D+ WV++FT+    +A+ 
Sbjct  481  WKEETW-RLELLVD------GIDPLVLDWIKEGKYIFLYGGDDVEWVKKFTTAARSVANT  533

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+      + I + +  E + +   +    +W FWTRL SM LS+I   
Sbjct  534  ARIPLEMVYVGKSTKREQVRRIMAALAVEKLGH-FWQDLTMVWFFWTRLESMLLSKI---  589

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             ++   D+  +D ++  +KKLL+Y+       GWA+LSKG +++V GHG
Sbjct  590  -QLGRADDH-HDPMVPQIKKLLSYDRDG----GWALLSKGSQVLVNGHG  632



>ref|XP_006476924.1| PREDICTED: uncharacterized protein LOC102608617 isoform X2 [Citrus 
sinensis]
Length=693

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 76/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W   E ++ LYGG DI W+R+FT+    +A   Q+ + +AYVGKN        
Sbjct  480  IDATILEWMKEERFVCLYGGEDIEWIRQFTNSAKAVARAAQINLGMAYVGKNNAKEKLGK  539

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I SII +EN+S+  L  S ++W FW RL SM  S++ +   +       ND IL  +  +
Sbjct  540  ISSIIIQENLSH-TLADSTAVWFFWARLESMLYSKLQHGATVE------NDRILKEVTTV  592

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  593  LSFDGSE---QGWAIFWRG  608



>ref|XP_010029070.1| PREDICTED: uncharacterized protein LOC104419194 [Eucalyptus grandis]
 gb|KCW55911.1| hypothetical protein EUGRSUZ_I01709 [Eucalyptus grandis]
Length=720

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 57/170 (34%), Positives = 97/170 (57%), Gaps = 26/170 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     YIFLYGG+DI W+R+FT+   ++A  
Sbjct  488  WKEEKW-RLELLVD------GMDPTILNWIRDGKYIFLYGGDDIEWIRKFTAAARQVAQA  540

Query  182  IQLKVELAYVGKN---KMIRSIIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHY  340
             ++ +E+ YVGK+   + +R +I   N+    L S++     +W FWTRL SM  S+I  
Sbjct  541  ARIPLEMIYVGKSSKREKVRQVIATINVE--KLSSTWQDLTLVWYFWTRLDSMLFSKI--  596

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              ++   DE+  D ++  +K++L+++       GWA+LS+G  + V GHG
Sbjct  597  --QLGKADED--DPMMQQIKRILSFDKTG----GWALLSRGSAIAVNGHG  638



>ref|XP_007031664.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
 gb|EOY02590.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
Length=705

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 56/160 (35%), Positives = 89/160 (56%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ E +  L+L+VG       +D V+ NW     +IFLYGG D++W+R+FT+ +   A  
Sbjct  479  WRAETW-RLELLVG------GIDPVILNWISEGRFIFLYGGEDMDWIRKFTNAVRTFARA  531

Query  182  IQLKVELAYVGKN----KMIRSI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
                +E+ YVGK+    ++ R++  I  E +S+C L +  ++W FW R+ SM+ S+    
Sbjct  532  SGFSLEMVYVGKSNPKERVSRNMATITAEKLSFC-LPNLTAVWYFWIRMESMWYSKYQLG  590

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
             E    DE  ND I   +  LL Y+G     +GWA+LS+G
Sbjct  591  KE----DE--NDPITREIMTLLTYDGSG---DGWALLSRG  621



>ref|XP_006476923.1| PREDICTED: uncharacterized protein LOC102608617 isoform X1 [Citrus 
sinensis]
Length=698

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 76/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W   E ++ LYGG DI W+R+FT+    +A   Q+ + +AYVGKN        
Sbjct  485  IDATILEWMKEERFVCLYGGEDIEWIRQFTNSAKAVARAAQINLGMAYVGKNNAKEKLGK  544

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I SII +EN+S+  L  S ++W FW RL SM  S++ +   +       ND IL  +  +
Sbjct  545  ISSIIIQENLSH-TLADSTAVWFFWARLESMLYSKLQHGATVE------NDRILKEVTTV  597

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  598  LSFDGSE---QGWAIFWRG  613



>emb|CDP15097.1| unnamed protein product [Coffea canephora]
Length=705

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 51/160 (32%), Positives = 89/160 (56%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  +  W  ++ +I LYGG DI W+R FT+   ++A+ 
Sbjct  479  WKEETW-RLELLVD------GIDPAILEWIIQDKFICLYGGADIGWIRSFTTAARKVANA  531

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGKN      + I S I  EN+S+C    +Y +W FWTR+ SM  S++   
Sbjct  532  AGISLEMVYVGKNNTKERVRKINSQITGENLSHCWSDPTY-VWYFWTRVESMLYSKMQNQ  590

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
                      +D+I+  +  +L+++G +   EGWA++S+G
Sbjct  591  KTAQ------DDKIMQEVMTILSFDGSD---EGWALISRG  621



>ref|XP_006476925.1| PREDICTED: uncharacterized protein LOC102608617 isoform X3 [Citrus 
sinensis]
Length=613

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 76/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W   E ++ LYGG DI W+R+FT+    +A   Q+ + +AYVGKN        
Sbjct  400  IDATILEWMKEERFVCLYGGEDIEWIRQFTNSAKAVARAAQINLGMAYVGKNNAKEKLGK  459

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I SII +EN+S+  L  S ++W FW RL SM  S++ +   +       ND IL  +  +
Sbjct  460  ISSIIIQENLSH-TLADSTAVWFFWARLESMLYSKLQHGATVE------NDRILKEVTTV  512

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  513  LSFDGSE---QGWAIFWRG  528



>ref|XP_004236293.1| PREDICTED: uncharacterized protein LOC101251462 [Solanum lycopersicum]
Length=724

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 88/160 (55%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W  E +  L+LVV        +D  + +W     +I LYGG D++W+R FT     +A +
Sbjct  498  WNMESW-RLELVVD------GIDPNLIDWMASGKFICLYGGEDMDWIRNFTKSARSVAQR  550

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +++ YVGK+      + I S+I  EN+SYC +  + S+W FWTR+ SMF S++   
Sbjct  551  AGIDLQMLYVGKSNNKERVRRINSMITAENLSYCLMDLT-SVWYFWTRIESMFYSKMQLG  609

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I        D+++  +  +L+++G +   +GWA++S+G
Sbjct  610  KTIQ------EDKVMQEVLTMLSFDGSD---QGWALISRG  640



>ref|XP_010030737.1| PREDICTED: uncharacterized protein LOC104420628 [Eucalyptus grandis]
Length=667

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/147 (33%), Positives = 84/147 (57%), Gaps = 17/147 (12%)
 Frame = +2

Query  68   DYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMI  229
            D  + NW     YIFLYGG+DI W+R+F  +  ++A   ++ +E+ YVGK+      + +
Sbjct  448  DQTILNWIRDGKYIFLYGGDDIEWLRKFIVEARQVAQGARIPLEMVYVGKSTKREQAQHV  507

Query  230  RSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLL  409
             + I+ E +S+   +    +W FWTRL SM  S+I    ++   DE  ++ ++  +K+LL
Sbjct  508  ITTINNEKLSH-TWQDPTMVWLFWTRLESMLFSKI----QLGKVDE--HNPMMQQIKRLL  560

Query  410  AYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +++       GWA+LS+G  + + GHG
Sbjct  561  SFDKAG----GWAMLSRGSTITMDGHG  583



>ref|XP_009628800.1| PREDICTED: uncharacterized protein LOC104119093 [Nicotiana tomentosiformis]
Length=678

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 79/139 (57%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D+ +  W   E +I LYGG DI W+R FT     +A +  +++ + YVGK+      + 
Sbjct  505  IDHNLIEWMTSEKFICLYGGEDIEWIRSFTKLARSVAQRAGIELLMMYVGKSNNKERVQK  564

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I  ++  EN+SYC +  + S+W FWTR+ SMF S++     I        D+I+  +  +
Sbjct  565  INDMVTAENLSYCLMDLT-SVWYFWTRIESMFYSKMQLGKTIQ------EDKIMQDVLTM  617

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G +   +GWA++S+G
Sbjct  618  LSFDGSD---QGWALISRG  633



>ref|XP_006351433.1| PREDICTED: uncharacterized protein LOC102598958 [Solanum tuberosum]
Length=723

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 88/160 (55%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W  E +  L+LVV        +D  + +W     +I LYGG D++W+R FT     +A +
Sbjct  497  WNMESW-RLELVVD------GIDPNLIDWMASGKFICLYGGEDMDWIRNFTKSARSVAQR  549

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +++ YVGK+      + I S+I  EN+SYC +  + S+W FWTR+ SMF S++   
Sbjct  550  AGIDLQMLYVGKSNNKERVRRINSMITAENLSYCLMDLT-SVWYFWTRIESMFYSKMQLG  608

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I        D+++  +  +L+++G +   +GWA++S+G
Sbjct  609  KTIQ------EDKVMQEVLTMLSFDGSD---QGWALISRG  639



>gb|ADN32810.1| sieve element occlusion a [Solanum phureja]
Length=723

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 88/160 (55%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W  E +  L+LVV        +D  + +W     +I LYGG D++W+R FT     +A +
Sbjct  497  WNMESW-RLELVVD------GIDPNLIDWMASGKFICLYGGEDMDWIRNFTKSARSVAQR  549

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +++ YVGK+      + I S+I  EN+SYC +  + S+W FWTR+ SMF S++   
Sbjct  550  AGIDLQMLYVGKSNNKERVRRINSMITAENLSYCLMDLT-SVWYFWTRIESMFYSKMQLG  608

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I        D+++  +  +L+++G +   +GWA++S+G
Sbjct  609  KTIQ------EDKVMQEVLTMLSFDGSD---QGWALISRG  639



>ref|XP_002526961.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35448.1| conserved hypothetical protein [Ricinus communis]
Length=677

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 83/149 (56%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVG---KNKMIRS  235
            LD  +  W   E +IF++GG+D+ WV+ FT+    +A   + ++EL YVG   K   I+ 
Sbjct  453  LDATILRWAFEEKHIFIFGGDDVEWVKTFTATAREVAHAARFQLELVYVGNRSKRDKIKQ  512

Query  236  IID---KENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            IID   K+ ++        +IW FWTRL SM   +I      N F+E  ND I+  LKKL
Sbjct  513  IIDSIEKDKLNTYFWHDLTAIWYFWTRLESMLFCKIQLG---NKFEE--NDGIMQELKKL  567

Query  407  LAYEGKNTIIEG-WAVLSKGKKMVVCGHG  490
            L+YE      EG WA+L++G  ++V G G
Sbjct  568  LSYEK-----EGRWAMLTRGSNIMVNGAG  591



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/148 (38%), Positives = 83/148 (56%), Gaps = 19/148 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  502  IDPVILNWIKEGKYIFLYGGDDDEWVRKFTNTARTVALAARIPLEMVYVGKSSKREKIRR  561

Query  236  IIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +I    ++   L S +     IW FWTRL SM  S I    ++   D+  +D ++  +KK
Sbjct  562  VI--ATITAEKLSSVWPDLTMIWFFWTRLESMLYSWI----QLGKLDD--HDPMMQEIKK  613

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            LL+Y+ +     GWAVLS G  +V  GH
Sbjct  614  LLSYDREG----GWAVLSNGSNVVANGH  637



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/148 (38%), Positives = 83/148 (56%), Gaps = 19/148 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D V+ NW     YIFLYGG+D  WVR+FT+    +A   ++ +E+ YVGK+   + IR 
Sbjct  501  IDPVILNWIKEGKYIFLYGGDDDEWVRKFTNTARTVALAARIPLEMVYVGKSSKREKIRR  560

Query  236  IIDKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +I    ++   L S +     IW FWTRL SM  S I    ++   D+  +D ++  +KK
Sbjct  561  VI--ATITAEKLSSVWPDLTMIWFFWTRLESMLYSWI----QLGKLDD--HDPMMQEIKK  612

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
            LL+Y+ +     GWAVLS G  +V  GH
Sbjct  613  LLSYDREG----GWAVLSNGSNVVANGH  636



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 51/160 (32%), Positives = 90/160 (56%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  +DL+        ++D  + +W ++  +I LYGG DI W+R+FT+    +A  
Sbjct  480  WKEETW-KIDLLAD------NIDPAISSWIEQGKFICLYGGEDIEWIRKFTATAKAVAKD  532

Query  182  IQLKVELAYVGKNK------MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++++E+ YVGK+K       I  +I  EN+S+  L     IW FW RL SM+ S++ + 
Sbjct  533  ARIQLEMLYVGKSKPKEKARKINGVIVNENLSH-VLPDLTLIWFFWVRLESMWHSKVQHK  591

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
               +      ND I+  +  +L+++G +   +GWAV+SKG
Sbjct  592  RTAD------NDPIMKEIMAMLSFDGSD---QGWAVISKG  622



>ref|XP_002526959.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35446.1| conserved hypothetical protein [Ricinus communis]
Length=718

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 57/168 (34%), Positives = 91/168 (54%), Gaps = 25/168 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  +  W   E YI LYGG+D+ WVR+FT+    ++  
Sbjct  485  WREETW-RLELLVD------GIDSTILTWIKEEKYILLYGGDDVEWVRKFTNTARAVSQA  537

Query  182  IQLKVELAYVGKNK---MIRSIIDK---ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ Y GK+     ++SII     E +S         IW FWTR+ SM  S+I   
Sbjct  538  ARIPLEMVYAGKSSKRDKVQSIIAAIPVEKLS--QYWDPTMIWFFWTRVESMLFSKI---  592

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
             ++   DE   D ++  +KKLL+Y+ +     GWAVLS+G  +VV G+
Sbjct  593  -QLGKIDE--TDPMMQEIKKLLSYDKEG----GWAVLSRGSNVVVNGY  633



>ref|XP_006379953.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
 gb|ERP57750.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
Length=706

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 89/160 (56%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  +DL+        ++D  + +W  +  +I LYGG DI W+R+FT+    +A  
Sbjct  480  WKEETW-KIDLLAD------NIDPALSSWIQQGKFICLYGGEDIEWIRKFTATAKAVAKD  532

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++++E+ YVGK+      + I  +I  EN+S+  L     IW FW RL SM+ S++ + 
Sbjct  533  ARIQLEMLYVGKSNPKEKARKINGVIVNENLSH-VLPDLTLIWFFWVRLESMWHSKVQHQ  591

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
               +      ND I+  +  +L+++G +   +GWAV+SKG
Sbjct  592  RTAD------NDPIMQEIMTMLSFDGSD---QGWAVISKG  622



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D ++ +W D+  YI LYGG DI W+R+FT     +AS+  + +E+ YVGK+   + +R 
Sbjct  494  IDPMILSWIDQGKYICLYGGEDIEWIRKFTVTAKDVASRAGITLEMLYVGKSNPREKVRK  553

Query  233  --SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              SII  E +S+  L     IW FW RL SM+ S++ +   +       ND I+  +  +
Sbjct  554  NNSIITTEKLSH-VLPDLTLIWFFWVRLESMWHSKVQHKRTVE------NDAIMQEIMTM  606

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G +   +GWAV+S+G
Sbjct  607  LSFDGSD---QGWAVISRG  622



>ref|XP_009769607.1| PREDICTED: uncharacterized protein LOC104220433 [Nicotiana sylvestris]
Length=719

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/160 (32%), Positives = 85/160 (53%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W  E +  L+LVV    +N      +  W     +I LYGG DI W+R FT     +A +
Sbjct  493  WSVESW-RLELVVDGIDQN------LIEWMTSGKFICLYGGEDIEWIRSFTKSAKSVAQR  545

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+      + I S++  EN+SYC +  + S+W FWTR+ SMF S++   
Sbjct  546  AGIDLLMMYVGKSNNKERVRRINSMVTAENLSYCLMDLT-SVWYFWTRIESMFYSKMQLG  604

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I        D+I+  +  +L+++G +   +GWA++S+G
Sbjct  605  KTIQ------EDKIMQEVLTMLSFDGSD---QGWALISRG  635



>gb|AFN06072.1| sieve element occlusion protein 1 [Nicotiana tabacum]
Length=719

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/160 (32%), Positives = 85/160 (53%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W  E +  L+LVV    +N      +  W     +I LYGG DI W+R FT     +A +
Sbjct  493  WSVESW-RLELVVDGIDQN------LIEWMTSGKFICLYGGEDIEWIRSFTKSAKSVAQR  545

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+      + I S++  EN+SYC +  + S+W FWTR+ SMF S++   
Sbjct  546  AGIDLLMMYVGKSNNKERVRRINSMVTAENLSYCLMDLT-SVWYFWTRIESMFYSKMQLG  604

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I        D+I+  +  +L+++G +   +GWA++S+G
Sbjct  605  KTIQ------EDKIMQEVLTMLSFDGSD---QGWALISRG  635



>ref|XP_006388019.1| hypothetical protein POPTR_0395s002002g, partial [Populus trichocarpa]
 gb|ERP46933.1| hypothetical protein POPTR_0395s002002g, partial [Populus trichocarpa]
Length=277

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 80/148 (54%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMIRS  235
            +D ++  W D+  YI LYGG DI W+R+FT+    +ASK  + +E+ YVGK    + +R 
Sbjct  65   IDPLILYWIDQGKYICLYGGEDIEWIRKFTATAKEVASKAAITLEMLYVGKCNPREKVRE  124

Query  236  ---IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
               II  E +S+  L     IW FW RL SM+ S++     +       ND I+  +  +
Sbjct  125  NNVIIKNEKLSH-VLPDLTLIWFFWVRLESMWHSKVQLKRTVE------NDAIMQEIMTM  177

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++G +   +GWAV+S+G   +    G
Sbjct  178  LSFDGSD---QGWAVISRGPADMAKAKG  202



>ref|XP_010248721.1| PREDICTED: uncharacterized protein LOC104591550 [Nelumbo nucifera]
Length=718

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 84/160 (53%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W QE +  + +V G       +D  M +W      I LYGG DINW+R+FTS +  +  +
Sbjct  491  WNQERWSMVFVVNG-------IDETMLSWIREGKPICLYGGEDINWIRKFTSTMRSVTDE  543

Query  182  IQLKVELAYVGKN---KMIRS---IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            +++ +E+ YVGK+   + +RS    I  E +SY   + ++ IW FW RL SM+ S+    
Sbjct  544  LKISIEMMYVGKSNPKERVRSNINAISSEKLSYYLPELTF-IWFFWVRLESMWYSKTQQG  602

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I       +D I+  +  LL ++G N   +GWA+L  G
Sbjct  603  RTI------ADDNIMREVMSLLTFDGSN---QGWAILGHG  633



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 81/139 (58%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D ++ +W ++  +I LYGG DI W+R+FT     +ASK  + +E+ YVGK+   + +R 
Sbjct  503  IDPLIVSWIEQGKHICLYGGEDIEWIRKFTVTAKEVASKAAITLEMLYVGKSNPREKVRK  562

Query  233  --SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              SII  E +S+  L     IW FW RL SM+ S++ +   +       ND I+  +  +
Sbjct  563  NNSIITTEKLSH-VLPDLTLIWFFWVRLESMWHSKVQHKRTVE------NDTIMQEIMTM  615

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G +   +GWAV+S+G
Sbjct  616  LSFDGSD---QGWAVISRG  631



>gb|KEH20741.1| sieve element occlusion protein [Medicago truncatula]
Length=704

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 50/148 (34%), Positives = 80/148 (54%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D ++ +W     YI LYGG+D+ W+R+FTS    +A  +Q+ +E+ YVGK+      K 
Sbjct  492  IDPLLFDWVTAGKYICLYGGDDMEWIRKFTSAAKSMARTLQIPLEMMYVGKSNPGQKVKR  551

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I   I  EN+S   L     IW FW RL SM+ S++     +       ND+I+  + ++
Sbjct  552  INKTIYDENLSN-VLTDPTIIWFFWVRLESMWHSKLQQSKTVE------NDQIMLEIMRI  604

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++  +    GWAVLS+G   +  G G
Sbjct  605  LSFDSSDL---GWAVLSQGTVRMTQGKG  629



>ref|XP_006476926.1| PREDICTED: uncharacterized protein LOC102609296 [Citrus sinensis]
Length=693

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W   E +I LYGG DI W+R FT+    +A   Q+ + +AYVGKN      + 
Sbjct  480  IDSTVLEWMKDERFICLYGGEDIEWIRRFTTSAKAVARAAQINLGMAYVGKNNAKERFRK  539

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I  I+ +EN+S+  L     +W FW RL SM  S++ +   +       ND I+  +  +
Sbjct  540  ISRIVIQENLSH-TLTDPAEVWFFWARLESMLYSKLQHGATVE------NDHIMQEVMTI  592

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  593  LSFDGSE---QGWAIFWRG  608



>ref|XP_006439977.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
 gb|ESR53217.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
Length=691

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W   E YI LYGG DI W+R FT+    +A   Q+ + +AYVGKN      + 
Sbjct  479  IDATILEWMKEERYICLYGGGDIEWIRRFTTSAKAVARAAQINLGMAYVGKNNAKERFRK  538

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I  I+ +EN+S+  L     +W FW RL SM  S++ +   +       +D I+  +  +
Sbjct  539  ISRIVIQENLSH-TLTDPTEVWFFWARLESMLYSKLQHGATVE------DDHIMQEVMTI  591

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  592  LSFDGSE---QGWAIFWRG  607



>gb|KDO69426.1| hypothetical protein CISIN_1g044391mg [Citrus sinensis]
Length=691

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 73/139 (53%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W   E YI LYGG DI W+R FT+    +A   Q+ + +AYVGKN      + 
Sbjct  479  IDATILEWMKEERYICLYGGGDIEWIRRFTTSAKAVARAAQINLGMAYVGKNNAKERFRK  538

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I  I+ +EN+S+  L     +W FW RL SM  S++ +   +       +D I+  +  +
Sbjct  539  ISRIVIQENLSH-TLTDPTEVWFFWARLESMLYSKLQHGATVE------DDHIMQEVMTI  591

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWA+  +G
Sbjct  592  LSFDGSE---QGWAIFWRG  607



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 80/139 (58%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D ++ +W D+  YI LYGG D+ W+R+FT     +AS+  + +E+ YVGK+   + +R 
Sbjct  473  IDPMILSWIDQRKYICLYGGEDMEWIRKFTVTAKDVASRAGITLEMLYVGKSNPREKVRK  532

Query  233  --SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              SII  E +S+  L     IW FW RL SM+ S++ +   +       ND I+  +  +
Sbjct  533  NNSIITTEKLSH-VLPDLTLIWFFWVRLESMWHSKVQHKRTVE------NDVIMQEIITM  585

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L ++G +   +GWAV+S+G
Sbjct  586  LIFDGSD---QGWAVISRG  601



>ref|XP_006378262.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
 gb|ERP56059.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
Length=357

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 82/148 (55%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D ++ +W D+  YI LYGG D+ W+R+FT     +AS+  + +E+ YVGK+   + +R 
Sbjct  157  IDPMIVSWIDQRKYICLYGGEDMEWIRKFTVTAKDVASRAGITLEMLYVGKSNPREKVRK  216

Query  233  --SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              SII  E +S+  L     IW FW RL SM+ S++ +   +       ND I+  +  +
Sbjct  217  NNSIITTEKLSHV-LPDLTLIWFFWVRLESMWHSKVQHKRTVE------NDVIMQEIITM  269

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L ++G +   +GWAV+S+G   +    G
Sbjct  270  LIFDGSD---QGWAVISRGSADMAKAKG  294



>ref|XP_004236294.1| PREDICTED: uncharacterized protein LOC101251765 [Solanum lycopersicum]
Length=723

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 85/160 (53%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W  E +  L+LVV        +D  + +W     +I LYGG D++W+R FT     +A +
Sbjct  497  WSMESW-RLELVVD------GIDPNLMDWMASGKFICLYGGEDMDWIRSFTKSAQSVAKR  549

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              +++++ YVGK+      + I S I  E +S C L    S+W FWTR+ SMF S++   
Sbjct  550  AGIELQMLYVGKSNNKERVRKINSTITDEKLSNC-LTDLTSVWYFWTRIESMFYSKMQLG  608

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I        D+I+  +  +L+++G +   +GWA++S+G
Sbjct  609  KTIQ------EDKIMQEVLTMLSFDGSD---QGWALISRG  639



>ref|XP_009415984.1| PREDICTED: uncharacterized protein LOC103996731 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 47/148 (32%), Positives = 81/148 (55%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D VM  W     ++ LYGG DI W+R FT+ + R + + ++ +E+ YVGK+      K 
Sbjct  490  IDPVMLGWVKEGRHVCLYGGEDIEWIRRFTTLMRRASQEARIPLEMVYVGKSSPRDRVKK  549

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              ++I  E +S    +    +W FWTRL SM+ S++H+   +       ND I+  +  +
Sbjct  550  AVTVIANEKLS-GYWQDPVMMWFFWTRLESMWYSKMHHGKTVE------NDPIVQEVLTM  602

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++G +   +GWAV+S+G   +V   G
Sbjct  603  LSFDGSD---DGWAVVSRGSVEMVKAQG  627



>ref|XP_006848934.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
 gb|ERN10515.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
Length=695

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 80/145 (55%), Gaps = 19/145 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D ++ +W      I LYGG D  W+R FTS + ++  + ++ +E+ YVGK+       +
Sbjct  483  IDPLILSWVKEPRIICLYGGEDTEWIRAFTSSIKKVIQETRVPIEMVYVGKSNPRERVRR  542

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            +I +II ++   Y    S   IW FW RL SM+ S+ HY   I+      ND I+  +  
Sbjct  543  IISAIIQEKLSGYW---SDTMIWYFWVRLESMWHSKRHYGRTID------NDPIVQEVMS  593

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVV  478
            +L+++G +   EGWAV+S+G   ++
Sbjct  594  MLSFDGSD---EGWAVMSRGSTEIL  615



>ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47605.1| conserved hypothetical protein [Ricinus communis]
Length=701

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 79/139 (57%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIRS  235
            +D ++ +W  +  YI LYGG DI W+R+FT   + LA    + +E+ YVGK+   + +R 
Sbjct  485  IDPIIHSWIQQGKYICLYGGEDIEWIRKFTMTANALAQAAGIDLEMLYVGKSNPREKVRK  544

Query  236  ---IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
               II  E +S+  L+    IW FW RL SM+ S++ +   +       ND I+  +  +
Sbjct  545  NNIIIQNEKLSH-VLQDLTLIWFFWVRLESMWHSKVQHNRTVE------NDIIMQEIVTM  597

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G +   +GWAV+SKG
Sbjct  598  LSFDGSD---QGWAVISKG  613



>emb|CBI34824.3| unnamed protein product [Vitis vinifera]
Length=664

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 85/161 (53%), Gaps = 24/161 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D  + NW     +I+LYGG D+ W+R+FT+    +AS 
Sbjct  460  WREESW-KLELLVD------GIDPTILNWIKEGKFIYLYGGTDLEWIRKFTTTARAVASA  512

Query  182  IQLKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVG++K    +      I  E +SYC  +    +W FWTRL SM  S+I   
Sbjct  513  ARIPLEMVYVGQSKKREQVRKCTTAITVEKLSYC-WQDLTMVWFFWTRLESMMFSKIQLG  571

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGK  466
              ++       D +L  +KKL++Y+ +     GWA+ S  +
Sbjct  572  STVDV------DPMLREIKKLISYDKEG----GWALHSDSR  602



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/148 (33%), Positives = 77/148 (52%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W     YI LYGG+DI W+R+FT+  + LA  +QL +E+ YVGK+      + 
Sbjct  491  IDPSLLEWISEGKYICLYGGDDIEWIRKFTNTAYSLARTLQLPLEMIYVGKSNPGKKVQE  550

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I + +  E +S      + S W FW RL SM+ S+      +       ND I+H + ++
Sbjct  551  INNAVQTEKLSNVLPDLAIS-WFFWVRLESMWHSKSQQSKTVE------NDHIMHEVMRI  603

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L Y+  +    GWAV+S+G   +  G G
Sbjct  604  LTYDSGDP---GWAVISQGTGKMAQGKG  628



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/148 (33%), Positives = 77/148 (52%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W     YI LYGG+DI W+R+FT+  + LA  +QL +E+ YVGK+      + 
Sbjct  484  IDPSLLEWISEGKYICLYGGDDIEWIRKFTNTAYSLARTLQLPLEMIYVGKSNPGKKVQE  543

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I + +  E +S      + S W FW RL SM+ S+      +       ND I+H + ++
Sbjct  544  INNAVQTEKLSNVLPDLAIS-WFFWVRLESMWHSKSQQSKTVE------NDHIMHEVMRI  596

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L Y+  +    GWAV+S+G   +  G G
Sbjct  597  LTYDSGDP---GWAVISQGTGKMAQGKG  621



>ref|XP_006440671.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53911.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=581

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 87/161 (54%), Gaps = 23/161 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ + +L+L+VG       +D  +  W   E +I LYGGND  W+R+FT+    +ASK
Sbjct  354  WKEKSW-TLELLVG------GIDATILQWMKEERFICLYGGNDAAWIRKFTNSAKAVASK  406

Query  182  IQLKVELAYVGKNKM------IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             Q+   +AYVGK         I SII KE+ S+  +  + ++W FW RL  M  S++ + 
Sbjct  407  AQINWGMAYVGKKNAKKRLEEISSIITKEDSSHIVIDGT-AMWFFWARLERMLYSKLQHG  465

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGK  466
              +        D I+  +  LL+++G +   +GWA+  +GK
Sbjct  466  MSVE------KDNIMREVMTLLSFDGSD---QGWAIFWRGK  497



>ref|XP_008786702.1| PREDICTED: uncharacterized protein LOC103704947 [Phoenix dactylifera]
Length=699

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/148 (32%), Positives = 78/148 (53%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W     Y+ LYGG DI+W+R FT+ L R A + ++ +E+ YVGK+      K 
Sbjct  487  IDPAILGWMGEGQYVCLYGGEDIDWIRRFTTLLRRAAQEAKIPLEMVYVGKSNPKERVKK  546

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            + + I  E +S    +    +W FW RL SM+ S++ +   I       ND I+  +  +
Sbjct  547  VVATIAAEKLS-GYWQDPVMVWFFWVRLESMWHSKMQHGKTIE------NDPIMQEVMTM  599

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L ++G +   EGWA++S+G   +V   G
Sbjct  600  LTFDGSD---EGWALISRGSVEMVKAQG  624



>ref|XP_010674858.1| PREDICTED: uncharacterized protein LOC104890938 [Beta vulgaris 
subsp. vulgaris]
Length=690

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 94/168 (56%), Gaps = 22/168 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE +    LV G Y       Y++ +W     YIF+YGG+DI W+R+FT +   +A  
Sbjct  496  WEQETWRLELLVNGIY------PYIL-SWIRDGKYIFIYGGDDIEWIRKFTMEARTVAHA  548

Query  182  IQLKVELAYVGKN---KMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            +Q+ +E+ YVG++   +++R +   I  E +S+C        W FWTR+ SM  S+I  L
Sbjct  549  LQVPIEMMYVGRSHNKEVVRKVNEYIMCERLSHC-FPDPAQEWYFWTRIESMIFSKIQ-L  606

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGH  487
              ++    +  D IL  ++++ +Y+  ++   GWA+L+KG  ++V G 
Sbjct  607  GRVH----DHGDVILQEIQRINSYDKSHS---GWAILAKGSTIIVHGQ  647



>ref|XP_006477599.1| PREDICTED: uncharacterized protein LOC102631158 [Citrus sinensis]
Length=693

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 87/161 (54%), Gaps = 23/161 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ + +L+L+VG       +D  +  W   E +I LYGGND  W+R+FT+    +ASK
Sbjct  466  WKEKSW-TLELLVG------GIDATILQWMKEERFICLYGGNDAAWIRKFTNSAKAVASK  518

Query  182  IQLKVELAYVGKNKM------IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             Q+   +AYVGK         I SII KE+ S+  +  + ++W FW RL  M  S++ + 
Sbjct  519  AQINWGMAYVGKKNAKKRLEEISSIITKEDSSHIVIDGT-AMWFFWARLERMLYSKLQHG  577

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGK  466
              +        D I+  +  LL+++G +   +GWA+  +GK
Sbjct  578  MSVE------KDNIMREVMTLLSFDGSD---QGWAIFWRGK  609



>ref|XP_010912936.1| PREDICTED: uncharacterized protein LOC105038753 [Elaeis guineensis]
Length=707

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/149 (32%), Positives = 79/149 (53%), Gaps = 18/149 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  +  W     Y+ LYGG DI+W+R FT+ L R+A + ++ +E+ YVG++       K
Sbjct  495  IDPAILAWVREGRYVCLYGGEDIDWIRRFTTALRRVAQEAKIPLEMVYVGRSNPKERVKK  554

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             + +I  ++   Y   +    +W FW RL SM+ S++ +   I       ND I+  +  
Sbjct  555  AVATITAEKLSGY--WQDPVMVWFFWVRLESMWHSKMQHGKTIE------NDPIMQEVMT  606

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL Y+G +   EGWA++S+G   +V   G
Sbjct  607  LLTYDGSD---EGWALISRGSVEMVKAQG  632



>ref|XP_006440672.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53912.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=693

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 87/161 (54%), Gaps = 23/161 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ + +L+L+VG       +D  +  W   E +I LYGGND  W+R+FT+    +ASK
Sbjct  466  WKEKSW-TLELLVG------GIDATILQWMKEERFICLYGGNDAAWIRKFTNSAKAVASK  518

Query  182  IQLKVELAYVGKNKM------IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             Q+   +AYVGK         I SII KE+ S+  +  + ++W FW RL  M  S++ + 
Sbjct  519  AQINWGMAYVGKKNAKKRLEEISSIITKEDSSHIVIDGT-AMWFFWARLERMLYSKLQHG  577

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGK  466
              +        D I+  +  LL+++G +   +GWA+  +GK
Sbjct  578  MSVE------KDNIMREVMTLLSFDGSD---QGWAIFWRGK  609



>ref|XP_007225209.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
 gb|EMJ26408.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
Length=730

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 51/142 (36%), Positives = 75/142 (53%), Gaps = 15/142 (11%)
 Frame = +2

Query  62   HLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------  220
            HL   +  W     Y+ LYGG DI W+R FT     +A +  + +EL YVG++       
Sbjct  505  HLHPNLFTWITDRKYVCLYGGEDIEWIRNFTKSAKSVALEAGIALELLYVGRSKPKEKVV  564

Query  221  KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDE--INYF--DEECNDEIL  388
            K I SII  EN+S+  L+ + +IW FW RL SM+ S+   L E    +F  D   ND I+
Sbjct  565  KQILSIIQTENLSH-TLEWNTTIWYFWVRLESMWQSKGQLLSEQSTTHFKTDNLKNDPIM  623

Query  389  HGLKKLLAYEGKNTIIEGWAVL  454
             G+  +L++   +    GWAV+
Sbjct  624  QGIISMLSFGSSD---RGWAVI  642



>ref|XP_008793697.1| PREDICTED: uncharacterized protein LOC103709939 [Phoenix dactylifera]
Length=712

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/148 (32%), Positives = 79/148 (53%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D V+  W     Y+ LYGG DI+W+R F + L R+A + ++ +E+ YVGK+      K 
Sbjct  500  IDPVILTWVREGRYVCLYGGEDIDWIRRFATSLRRVAQEAKIPLEMVYVGKSNPKERVKK  559

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
               +I  E +S    +    +W FW RL SM+ S++ +   I       +D I+  +  +
Sbjct  560  AVGVIAAEKLS-GYWQDPVMVWFFWVRLESMWHSKMQHGKSIE------DDTIMQEVMTM  612

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++G +   EGWAV+S+G   +V   G
Sbjct  613  LSFDGSD---EGWAVISRGSVEMVKSQG  637



>ref|XP_009386688.1| PREDICTED: uncharacterized protein LOC103973766 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 80/148 (54%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  M  W     ++ LYGG DI W+R FT  + R++ + ++ +E+ YVGK+      + 
Sbjct  490  IDPDMLAWVREGRHVCLYGGEDIEWIRRFTMVMRRVSQEAKIPIEMVYVGKSSPKDRVRK  549

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              S+I +E +S    +    +W FW RL SM+ S++ +   I       ND I+  +  +
Sbjct  550  AISVIAREKLS-GYWQDPVMVWFFWVRLESMWYSKMQHGRTIE------NDPIMLEVMTM  602

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++G +   EGWA++S+G   +V  HG
Sbjct  603  LSFDGSD---EGWAIVSRGSMEMVKAHG  627



>ref|XP_010102927.1| hypothetical protein L484_018946 [Morus notabilis]
 gb|EXB94445.1| hypothetical protein L484_018946 [Morus notabilis]
Length=712

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 81/149 (54%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W  +  YI LYGG+DINW+REFTS+   +A  + +++E+ YVGK+ +      
Sbjct  499  IDAEILQWIAQGKYICLYGGDDINWIREFTSRAKVVAQALGIQLEMIYVGKSNVPKERLR  558

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             I S I+ E +S    + + SIW FW+RL SM  S+  Y   I        D +L  +  
Sbjct  559  KINSTIETEGLSQIWPEMT-SIWFFWSRLESMRCSKARYGKTIEA------DPVLKEIMT  611

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+G +   +GW  + +G+  +   +G
Sbjct  612  LLSYDGSD---QGWVSVWRGQSEMARANG  637



>ref|XP_010904538.1| PREDICTED: uncharacterized protein LOC105031936 [Elaeis guineensis]
Length=707

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 47/147 (32%), Positives = 81/147 (55%), Gaps = 14/147 (10%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMI-RSII  241
            +D ++  W     Y+ LYGG DI+W+R FT+ L R+A + ++ +++ YVGK+    R   
Sbjct  495  IDPMILTWVREGRYVCLYGGEDIDWIRRFTTVLRRVAHEAKIPLDMVYVGKSSSKERVKK  554

Query  242  DKENMSYCALKSSYS----IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLL  409
                ++   L SS+     +W FW RL SM+ S++ +   I+      ND I+  +  LL
Sbjct  555  AVAAIAAEKLSSSWQDPVMVWFFWVRLESMWHSKMQHGKSID------NDSIMQEVMTLL  608

Query  410  AYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +++G +   EGWA++S+G   +V   G
Sbjct  609  SFDGSD---EGWAIISRGSLEMVKSQG  632



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 50/163 (31%), Positives = 87/163 (53%), Gaps = 23/163 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  +DL+         +D V+  W   + +I LYGG D+ WVR+FT+ +  +A  
Sbjct  481  WKEETW-RIDLLADS------VDPVIPTWIMEQKHICLYGGEDLEWVRKFTALMGAVARA  533

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGK+      + I S I  E +S+  L     IW FW RL SM+ S++ + 
Sbjct  534  AGIALEMLYVGKSNPKEKARRIISTISVEKLSH-TLPDPTLIWFFWVRLESMWHSKMKFG  592

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
             ++        D I+  +  +L+++G +   +GWAV+S+G  M
Sbjct  593  TKVQ------QDPIMQEIVTMLSFDGSD---QGWAVISRGPHM  626



>ref|XP_004161368.1| PREDICTED: uncharacterized LOC101204444 [Cucumis sativus]
 gb|KGN63518.1| hypothetical protein Csa_1G002870 [Cucumis sativus]
Length=698

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/154 (30%), Positives = 81/154 (53%), Gaps = 25/154 (16%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D+ + +W     YI +YGG D  W++EFTSK  ++A    + +++AYVGKN      + 
Sbjct  486  IDFSILDWAAEGRYICIYGGEDTEWIKEFTSKTKKVAETANVDLQMAYVGKNNAKERVRK  545

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I  +I    +S+    S+  +W FW RL SM  S+++Y   +       ND I+  +  L
Sbjct  546  ISIMISDNKLSHYWADSTL-VWFFWARLESMMYSKLNYGKTVE------NDPIMQEIMTL  598

Query  407  LAYEGKNTIIEGWAVL---------SKGKKMVVC  481
            L+++G +   +GWA+          +KG+ ++ C
Sbjct  599  LSFDGSD---KGWAIFFGRAGETTRAKGETVLSC  629



>ref|XP_009359246.1| PREDICTED: uncharacterized protein LOC103949845 isoform X1 [Pyrus 
x bretschneideri]
Length=842

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 89/175 (51%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E    ++L+     +N      +  W     YI LYGG DI+W+R FT     +A +
Sbjct  603  WEEEKDWRIELLADAIDQN------LITWITEGKYICLYGGEDIDWIRNFTRSAKNVARE  656

Query  182  IQLKVELAYVG----KNKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
              +++EL YVG    K K++R+I   I  E +SY  L+ S  IW FW RL SM+ S+ H 
Sbjct  657  AGIQLELLYVGKRNPKEKVVRNIMNVIQAEKLSY-TLEWSL-IWFFWMRLESMWQSKGHQ  714

Query  341  L-DEINY----FDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +  E+       D + ND ++ G+  +L++   +    GWAV+  G   +   +G
Sbjct  715  MQSEVRSGRVRTDNKKNDPVMQGIISMLSFGSSD---RGWAVIGAGSSEMAKANG  766



>ref|XP_002282172.1| PREDICTED: uncharacterized protein LOC100261038 [Vitis vinifera]
 emb|CBI16823.3| unnamed protein product [Vitis vinifera]
Length=714

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 76/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D ++ NW     YI L+GG D+ W+R+F      +A    +++E+ YVGK+      + 
Sbjct  502  IDPIIHNWISEGSYICLFGGEDMEWIRKFCILAKAIARAAGIRLEMLYVGKSNPREKIQK  561

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I +II  +N+S+  L   + +W FW RL SM+ S++ +   +       +D I+  +  +
Sbjct  562  INAIISTDNLSH-TLPDLHLVWFFWVRLESMWYSKMQHGKTVE------SDPIMQEIVSM  614

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G +   +GW V SKG
Sbjct  615  LSFDGSD---QGWVVFSKG  630



>emb|CAN83922.1| hypothetical protein VITISV_026532 [Vitis vinifera]
Length=714

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 76/139 (55%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D ++ NW     YI L+GG D+ W+R+F      +A    +++E+ YVGK+      + 
Sbjct  502  IDPIIHNWISEGSYICLFGGEDMEWIRKFCILAKAIARAAGIRLEMLYVGKSNPREKIQK  561

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I +II  +N+S+  L   + +W FW RL SM+ S++ +   +       +D I+  +  +
Sbjct  562  INAIISTDNLSH-TLPDLHLVWFFWVRLESMWYSKMQHGKTVE------SDPIMQEIVSM  614

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G +   +GW V SKG
Sbjct  615  LSFDGSD---QGWVVFSKG  630



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 89/163 (55%), Gaps = 23/163 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  +DL+         +D V+  W   + +I LYGG D+ W+R+FT+ +  +A  
Sbjct  481  WKEETW-RIDLLADS------VDPVIPTWIMEQKHICLYGGEDLEWIRKFTALMGAVARA  533

Query  182  IQLKVELAYVGKN----KMIRSI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGK+    K+ RSI  I  E +S+  L     IW FW RL SM+ S++ + 
Sbjct  534  AGIALEMLYVGKSNPKEKVRRSISTITVEKLSH-TLPDPTLIWFFWVRLESMWHSKMKFG  592

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
             ++        D I+  +  +L+++G +   +GWAV+S+G  M
Sbjct  593  RKVQ------QDPIMQEIVTMLSFDGSD---QGWAVISRGPHM  626



>ref|XP_007044877.1| Sieve element occlusion e, putative [Theobroma cacao]
 gb|EOY00709.1| Sieve element occlusion e, putative [Theobroma cacao]
Length=705

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 81/140 (58%), Gaps = 18/140 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN----KMIR  232
            +D  + NW     +I LYGG D++W+R+FT+    +A    +K+E+ YVGK+    K+ R
Sbjct  491  IDPSIINWLTEGKFICLYGGEDMDWIRKFTTTAKAVAQTANIKLEMLYVGKSNPTEKVRR  550

Query  233  SI--IDKENMSYCALKSSYSIWR-FWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
            ++  I +EN+S   + S  S+ R FW RL SM+ SR+ +   +       ND IL  +  
Sbjct  551  NMTTIQRENLS--RVLSDISLMRFFWVRLESMWHSRVQHGVTVE------NDHILPEIMT  602

Query  404  LLAYEGKNTIIEGWAVLSKG  463
            +L+++G     +GWAV+S+G
Sbjct  603  MLSFDGSE---QGWAVISRG  619



>ref|XP_004138263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101204444 
[Cucumis sativus]
Length=694

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/154 (30%), Positives = 81/154 (53%), Gaps = 25/154 (16%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D+ + +W     YI +YGG D  W++EFTSK  ++A    + +++AYVGKN      + 
Sbjct  476  IDFSILDWAAEGRYICIYGGEDTEWIKEFTSKTKKVAETANVDLQMAYVGKNNAKERVRK  535

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I  +I    +S+    S+  +W FW RL SM  S+++Y   +       ND I+  +  L
Sbjct  536  ISIMISDNKLSHYWADSTL-VWFFWARLESMMYSKLNYGKTVE------NDPIMQEIMTL  588

Query  407  LAYEGKNTIIEGWAVL---------SKGKKMVVC  481
            L+++G +   +GWA+          +KG+ ++ C
Sbjct  589  LSFDGSD---KGWAIFFGRAGETTRAKGETVLSC  619



>ref|XP_004504145.1| PREDICTED: uncharacterized protein LOC101504285 isoform X3 [Cicer 
arietinum]
Length=704

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 81/148 (55%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W     YI LYGG+DI W+R+FTS    +A  +Q+ +E+ YVGK+      + 
Sbjct  492  IDESLFEWVSAGKYICLYGGDDIEWIRKFTSSAKSMAKTLQIPLEIMYVGKSNPGEKIRK  551

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I   I++E +S      + + W FW RL SM+ S++   + +       ND+I+  + ++
Sbjct  552  INKTINEEKLSNVLAYPTIN-WFFWVRLESMWHSKLQQGNTVE------NDQIMLEIVRI  604

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++  +   +GWAV+S+G   +  G G
Sbjct  605  LSFDSSD---QGWAVISQGTVKMTQGKG  629



>ref|XP_004504143.1| PREDICTED: uncharacterized protein LOC101504285 isoform X1 [Cicer 
arietinum]
 ref|XP_004504144.1| PREDICTED: uncharacterized protein LOC101504285 isoform X2 [Cicer 
arietinum]
Length=706

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 81/148 (55%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W     YI LYGG+DI W+R+FTS    +A  +Q+ +E+ YVGK+      + 
Sbjct  494  IDESLFEWVSAGKYICLYGGDDIEWIRKFTSSAKSMAKTLQIPLEIMYVGKSNPGEKIRK  553

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I   I++E +S      + + W FW RL SM+ S++   + +       ND+I+  + ++
Sbjct  554  INKTINEEKLSNVLAYPTIN-WFFWVRLESMWHSKLQQGNTVE------NDQIMLEIVRI  606

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++  +   +GWAV+S+G   +  G G
Sbjct  607  LSFDSSD---QGWAVISQGTVKMTQGKG  631



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 89/163 (55%), Gaps = 23/163 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  +DL+         +D V+  W   + +I LYGG D+ W+R+FT+ +  +A  
Sbjct  481  WKEETW-RIDLLADS------VDPVIPTWIMEQKHICLYGGEDLEWIRKFTALMGAVARA  533

Query  182  IQLKVELAYVGKN----KMIRSI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGK+    K+ RSI  I  E +S+  L     IW FW RL SM+ S++ + 
Sbjct  534  AGIALEMLYVGKSNPKEKVRRSISTITVEKLSH-TLPDPTLIWFFWVRLESMWHSKMKFG  592

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
             ++        D I+  +  +L+++G +   +GWAV+S+G  M
Sbjct  593  RKVQ------QDPIMQEIVTMLSFDGSD---QGWAVISRGPHM  626



>gb|KDP46375.1| hypothetical protein JCGZ_10215 [Jatropha curcas]
Length=702

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 79/138 (57%), Gaps = 13/138 (9%)
 Frame = +2

Query  71   YVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDKE  250
            Y ++     E +I L+GG D+ W+++FT+   ++A + Q+ +++ YVGKN+ +  +    
Sbjct  484  YPIRRSIREEMHILLFGGEDLEWLKDFTTAAGQVAEEAQIPLQMVYVGKNENLEEL---P  540

Query  251  NMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNT  430
            N  Y     +  +W FW R+ SM  S+I    EI  +++  ND IL  +KK++ Y  +  
Sbjct  541  NDLY--WPRTGDVWFFWNRIESMLASKI----EIAKYEDNKNDIILQEIKKVVTYHKEG-  593

Query  431  IIEGWAVLSKGKKMVVCG  484
               GWA+LSKG K++V G
Sbjct  594  ---GWALLSKGDKILVNG  608



>ref|XP_009403632.1| PREDICTED: uncharacterized protein LOC103987147 [Musa acuminata 
subsp. malaccensis]
Length=699

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/149 (30%), Positives = 79/149 (53%), Gaps = 18/149 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D +M  W     ++ LYGG  I W+REFT+ + R++ +  + +E+ YVGK+       K
Sbjct  487  IDPIMLGWVKEGRHVCLYGGEKIEWIREFTNVMKRVSQEANIPIEMVYVGKSNPKERVKK  546

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             I  I +++   Y   +    +W FW RL SM+ S++     I+      ND I+  +  
Sbjct  547  AINVIANEKLSGY--WQDPVMVWFFWVRLESMWHSKMQSGRTID------NDPIMREVMT  598

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +L+++G +   +GWA++S G   +V  HG
Sbjct  599  MLSFDGSD---DGWAIISHGSMDMVKSHG  624



>ref|XP_008464491.1| PREDICTED: uncharacterized protein LOC103502357 isoform X2 [Cucumis 
melo]
Length=697

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 81/153 (53%), Gaps = 23/153 (15%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D  + +W     YI +YGG D  W++EFTSK  ++A    + +++AYVGKN   + +R 
Sbjct  485  IDLSILDWAAEGRYICIYGGEDTEWIKEFTSKTKKVAETANVDLQMAYVGKNNAKERVRK  544

Query  233  -SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLL  409
             SI+  +N        S  +W FWTRL SM  S+++Y   +       ND I+  +  LL
Sbjct  545  ISIMISDNKLSHYWPDSTLVWFFWTRLESMMYSKLNYGKTVE------NDPIMQEIMTLL  598

Query  410  AYEGKNTIIEGWAVL---------SKGKKMVVC  481
            +++G +   +GWA+          +KG+ ++ C
Sbjct  599  SFDGSD---KGWAIFFGRAGETTRAKGETVLSC  628



>ref|XP_008464490.1| PREDICTED: uncharacterized protein LOC103502357 isoform X1 [Cucumis 
melo]
Length=700

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 81/153 (53%), Gaps = 23/153 (15%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D  + +W     YI +YGG D  W++EFTSK  ++A    + +++AYVGKN   + +R 
Sbjct  488  IDLSILDWAAEGRYICIYGGEDTEWIKEFTSKTKKVAETANVDLQMAYVGKNNAKERVRK  547

Query  233  -SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLL  409
             SI+  +N        S  +W FWTRL SM  S+++Y   +       ND I+  +  LL
Sbjct  548  ISIMISDNKLSHYWPDSTLVWFFWTRLESMMYSKLNYGKTVE------NDPIMQEIMTLL  601

Query  410  AYEGKNTIIEGWAVL---------SKGKKMVVC  481
            +++G +   +GWA+          +KG+ ++ C
Sbjct  602  SFDGSD---KGWAIFFGRAGETTRAKGETVLSC  631



>gb|EPS71838.1| hypothetical protein M569_02915, partial [Genlisea aurea]
Length=688

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 77/152 (51%), Gaps = 18/152 (12%)
 Frame = +2

Query  59   VHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVG------KN  220
            V +D  +  W      I LYGG DI W+R FT     +A+ + + +E+ YVG      K 
Sbjct  471  VPVDSRIPEWIGLNKVICLYGGEDIEWIRRFTQTARSVANALNVPLEMLYVGKREPKEKT  530

Query  221  KMIRSIIDKENMSYCALKSSYS--IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHG  394
            +    II +E +S+      YS  +W FW RL SM+ S+     +I   +   NDEI+  
Sbjct  531  RRCHEIIQREGLSHIFPLKDYSDYVWFFWVRLTSMWNSK----KQIGMTE---NDEIMQE  583

Query  395  LKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +K +L ++      +GWAV S+G + +  G+G
Sbjct  584  IKDMLVFDSSE---QGWAVFSRGNQEITKGNG  612



>gb|KDO82146.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=527

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 50/163 (31%), Positives = 87/163 (53%), Gaps = 23/163 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  +DL+         +D V+  W   + +I LYGG D+ WVR+FT+ +  +A  
Sbjct  302  WKEETW-RIDLLADS------VDPVIPTWIMEQKHICLYGGEDLEWVRKFTALMGAVARA  354

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGK+      + I S I  E +S+  L     IW FW RL SM+ S++ + 
Sbjct  355  AGIALEMLYVGKSNPKEKARRIISTISVEKLSH-TLPDPTLIWFFWVRLESMWHSKMKFG  413

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
             ++        D I+  +  +L+++G +   +GWAV+S+G  M
Sbjct  414  TKVQ------QDPIMQEIVTMLSFDGSD---QGWAVISRGPHM  447



>emb|CDP13257.1| unnamed protein product [Coffea canephora]
Length=812

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 48/146 (33%), Positives = 80/146 (55%), Gaps = 16/146 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D  + +W +   YI LYGG DI W+R+FT+ +   A+   +++E+ YVGK+   + +R 
Sbjct  599  IDPNLFHWVNENRYICLYGGEDIEWIRKFTNTVRGAANAAGIRLEMLYVGKSNPKERVRR  658

Query  233  --SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              SII  EN+S+  L     IW FW RL SM+ S+  +   +       ND I+  +  +
Sbjct  659  NNSIIQAENLSHI-LTDLTLIWFFWVRLESMWHSKNQHGMTVE------NDPIMQEIVTM  711

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCG  484
            L+++G +   +GWAV  +G   +  G
Sbjct  712  LSFDGSD---QGWAVFCRGSHEMAKG  734



>ref|XP_010026936.1| PREDICTED: uncharacterized protein LOC104417333 [Eucalyptus grandis]
 gb|KCW83234.1| hypothetical protein EUGRSUZ_B00175 [Eucalyptus grandis]
Length=713

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 79/157 (50%), Gaps = 22/157 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L L++         D  +  W ++  YI LYGG D+ W+R+FT+    +A  
Sbjct  483  WKEESW-KLSLIIDGLD-----DGTISKWTEQGSYICLYGGEDLGWIRKFTNAAKNVAKI  536

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + Y+GK+      K I + I  EN+S+C     Y  W FW RL SM  S++ + 
Sbjct  537  ANIPLGMIYLGKSNAKERVKRIAAAITSENLSHCWKDPRY-FWFFWARLESMLHSKLQHG  595

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVL  454
                      ND ++H +  +L+Y+G +   +GWA+ 
Sbjct  596  MSTE------NDPVMHEIMTILSYDGSD---QGWAIF  623



>ref|XP_009359248.1| PREDICTED: uncharacterized protein LOC103949845 isoform X2 [Pyrus 
x bretschneideri]
Length=775

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 89/175 (51%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E    ++L+     +N      +  W     YI LYGG DI+W+R FT     +A +
Sbjct  536  WEEEKDWRIELLADAIDQN------LITWITEGKYICLYGGEDIDWIRNFTRSAKNVARE  589

Query  182  IQLKVELAYVG----KNKMIRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
              +++EL YVG    K K++R+I   I  E +SY  L+ S  IW FW RL SM+ S+ H 
Sbjct  590  AGIQLELLYVGKRNPKEKVVRNIMNVIQAEKLSY-TLEWSL-IWFFWMRLESMWQSKGHQ  647

Query  341  L-DEINY----FDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +  E+       D + ND ++ G+  +L++   +    GWAV+  G   +   +G
Sbjct  648  MQSEVRSGRVRTDNKKNDPVMQGIISMLSFGSSD---RGWAVIGAGSSEMAKANG  699



>gb|KDP46379.1| hypothetical protein JCGZ_10219 [Jatropha curcas]
Length=711

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 92/169 (54%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W +E +  L+L+V    R + L++V +N    + YIFLYGG+ I W+ +F +    +A+K
Sbjct  475  WNEEKW-GLELLVDSIDRTI-LNWVKEN----KKYIFLYGGDKIEWLTDFITTAREVANK  528

Query  182  IQLKVELAYVGKNK----MIRSIIDK--ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              +++++ YVG+N      ++ +I+K  EN  Y  +  S   W FWTR+ SM  SRI   
Sbjct  529  ATIQLQMVYVGQNARPEDQLQPLINKVRENSYYYTVTES---WIFWTRIESMLSSRIQM-  584

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               NY D E +D IL  +KK++ Y+ +      W +  KG ++ V G  
Sbjct  585  --ANYDDNE-DDTILQEIKKVINYDREG----DWVLFGKGSQVFVNGQS  626



>ref|XP_010087773.1| hypothetical protein L484_016343 [Morus notabilis]
 gb|EXB29854.1| hypothetical protein L484_016343 [Morus notabilis]
Length=686

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 48/157 (31%), Positives = 80/157 (51%), Gaps = 34/157 (22%)
 Frame = +2

Query  38   VGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS------KIQLKVE  199
            +G    N+H    +Q W   E YI  YGG D  W+++F+ K   LA+       +++K+E
Sbjct  474  IGPVVNNIHPS--IQTWIKEEKYILFYGGKDNEWIQQFSKKATALANDPIIKDTLKIKIE  531

Query  200  LAYVGKNKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECND  379
            L  VGK          E++          + RFWT + S+F +++H         ++  D
Sbjct  532  LFCVGKTAK-----GGEDLGI--------LGRFWTSIESLFFTKVH---------QQKAD  569

Query  380  EILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +   ++KLL+Y+ ++    GWAVLSKG+ ++V GHG
Sbjct  570  PVTQEIQKLLSYKNES----GWAVLSKGQSVIVAGHG  602



>ref|XP_004309998.1| PREDICTED: uncharacterized protein LOC101307854 [Fragaria vesca 
subsp. vesca]
Length=596

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 79/153 (52%), Gaps = 16/153 (10%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  + NW     YI LYGG DINW+R FT     +A +  +++EL Y+GK+K       
Sbjct  373  IDQTLLNWIAERKYICLYGGEDINWIRNFTRTAKNVALEAGIQLELLYLGKSKQKERVVK  432

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEI---NYFDEEC-NDEILH  391
             I  +I +E +S+     S  IW FW RL SM+ S+   + E+   N+ D    ND I+ 
Sbjct  433  DIIRVIKEEKLSHTI--DSNLIWFFWVRLESMWQSKGQLMSELSKANFTDHNIKNDIIMQ  490

Query  392  GLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            G+  LL++   +    GWA+++     +   +G
Sbjct  491  GIVSLLSFGSTD---RGWALIALPSSEMAKANG  520



>gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 71/139 (51%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI--  238
            +D  +  W     YI LYGG DI W+R FT     +A +  +++E+ YVGK+     +  
Sbjct  494  IDANILAWIQEGKYICLYGGEDIEWIRRFTKTAAVVAKEANIQLEMLYVGKSNPREKVRK  553

Query  239  ----IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
                I  EN+S+  L     IW FW RL SM+ S++ +   +       ND I+  +  +
Sbjct  554  NNVTIQSENLSH-VLPDLTLIWFFWVRLESMWHSKVQHNRTVE------NDSIMQEIVTM  606

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L+++G     +GWAVLS G
Sbjct  607  LSFDGSE---QGWAVLSHG  622



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 55/169 (33%), Positives = 87/169 (51%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ + +++L+     +NV        W      I LYGG DI W+R FTS    +A+ 
Sbjct  591  WKEQTW-NIELLADSIDQNVF------TWISEGKCICLYGGEDIEWIRSFTSATRAVANA  643

Query  182  IQLKVELAYVGK---NKMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK    + +R   SII  EN+S+  ++    IW FW RL SM+ SR    
Sbjct  644  ARVPLEMLYVGKKNPKERVRKNSSIIQMENLSH-VVQDQTLIWFFWERLESMWHSRT---  699

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             + +   E   D IL  +  +L+Y+G +    GWAV S+G   +  G G
Sbjct  700  -QQDIPGE--TDPILQEIVTILSYDGSDL---GWAVFSRGLAEMTRGKG  742



>ref|XP_008350940.1| PREDICTED: uncharacterized protein LOC103414321 [Malus domestica]
Length=744

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/142 (36%), Positives = 75/142 (53%), Gaps = 14/142 (10%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            LD  +  W     YI LYGG DI W+R FT     +A +  +++EL YVGK+K       
Sbjct  523  LDQNLYTWITDRKYICLYGGEDIEWIRNFTKAARNVAREAGIQLELLYVGKSKAKEKVVK  582

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEIN--YFDEECNDEILHGL  397
             I SII  E +S+  L+ +  IW FW RL SM+ S+   L E +    D   +D I+ G+
Sbjct  583  NIISIIQAEKLSH-TLEVNL-IWFFWIRLESMWQSKGQILSEQSRTQTDHLKSDRIMQGI  640

Query  398  KKLLAYEGKNTIIEGWAVLSKG  463
              +L++   +    GWAV++ G
Sbjct  641  ISMLSFGSSD---RGWAVIALG  659



>ref|XP_006470197.1| PREDICTED: uncharacterized protein LOC102630205 [Citrus sinensis]
Length=845

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 49/169 (29%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        LD V+ NW     YI LYGG D++W+R+FT+  + +A  
Sbjct  618  WREETW-RLELLVD------GLDPVILNWMAEGRYICLYGGEDMDWIRKFTTATNAVAKT  670

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+      +     I  EN+S+   +   SIW FW RL SM+ S++   
Sbjct  671  AGIPLGMVYVGKSNPKDRVRRNNDTIASENLSHI-WQDLTSIWYFWVRLESMWYSKVQLG  729

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
                       D ++  + ++L Y+       GWAV ++G   +    G
Sbjct  730  RNAE------TDHVMQEIMRMLTYDSSEG---GWAVFARGSAEMASAKG  769



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 79/150 (53%), Gaps = 19/150 (13%)
 Frame = +2

Query  68   DYVMQN---WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMI  229
            D + QN   W      I LYGG DI W+R FTS    +A+  ++ +E+ YVGK    + +
Sbjct  580  DSIDQNIFTWISEGKCICLYGGEDIEWIRSFTSSTRAVANAARVPLEMLYVGKKNPKERV  639

Query  230  R---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            R   SII  EN+S+  ++    IW FW RL SM+ SR     + +   E  +D IL  + 
Sbjct  640  RKNSSIIQMENLSH-VVQDQTLIWFFWERLESMWHSRT----QQDIPGE--SDPILQEIV  692

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +L+Y+G +    GWAV S+G   +  G G
Sbjct  693  TILSYDGSDL---GWAVFSRGLAEMTRGKG  719



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 78/150 (52%), Gaps = 19/150 (13%)
 Frame = +2

Query  68   DYVMQN---WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMI  229
            D + QN   W      I LYGG DI W+R FTS    +A+  ++ +E+ YVGK    + +
Sbjct  608  DSIDQNIFTWISEGKCICLYGGEDIEWIRSFTSATRAVANAARVPLEMLYVGKKNPKERV  667

Query  230  R---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            R   SII  EN+S+  ++    IW FW RL SM+ SR     + +   E   D IL  + 
Sbjct  668  RKNSSIIQMENLSH-VVQDQTLIWFFWERLESMWHSRT----QQDIPGE--TDPILQEIV  720

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +L+Y+G +    GWAV S+G   +  G G
Sbjct  721  TILSYDGSDL---GWAVFSRGLAEMTRGKG  747



>ref|XP_006376885.1| hypothetical protein POPTR_0012s09220g [Populus trichocarpa]
 gb|ERP54682.1| hypothetical protein POPTR_0012s09220g [Populus trichocarpa]
Length=733

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 80/168 (48%), Gaps = 21/168 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ +   +L+L++G    N  L   + +W  +   + LYGG DI W+REFT         
Sbjct  503  WEAQQTWTLELLLGGIDNNFSL---VLDWTKQGTIVCLYGGEDIEWIREFTKATKDAVKN  559

Query  182  IQ--LKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
            I      EL YVGKN  I+ +      ID EN+S      S SIW FWTRL SM   ++ 
Sbjct  560  ISSGTSFELVYVGKNNAIKEVENIIKTIDDENLSRYWNDLS-SIWFFWTRLESMLYLKMQ  618

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVC  481
                +       ND I+  +  LL+Y+  +    GWA+  KG +M + 
Sbjct  619  QCKNLK------NDRIMQEVTTLLSYDDSD---RGWALFCKGSEMALA  657



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 55/169 (33%), Positives = 87/169 (51%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ + +++L+     +NV        W      I LYGG DI W+R FTS    +A+ 
Sbjct  584  WKEQTW-NIELLADSIDQNVF------TWISEGKCICLYGGEDIEWIRSFTSATRAVANA  636

Query  182  IQLKVELAYVGK---NKMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK    + +R   SII  EN+S+  ++    IW FW RL SM+ SR    
Sbjct  637  ARVPLEMLYVGKKNPKERVRKNSSIIQIENLSH-VVQDQTLIWFFWERLESMWHSRT---  692

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             + +   E   D IL  +  +L+Y+G +    GWAV S+G   +  G G
Sbjct  693  -QQDIPGE--TDPILQEIVTILSYDGSDL---GWAVFSRGLAEMTRGKG  735



>ref|XP_010044527.1| PREDICTED: uncharacterized protein LOC104433471 [Eucalyptus grandis]
 gb|KCW86613.1| hypothetical protein EUGRSUZ_B03241 [Eucalyptus grandis]
Length=699

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 16/132 (12%)
 Frame = +2

Query  86   WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI------IDK  247
            W     YI LYGG DI W+R+FT+    +A   Q+ +E+ YVGK+     +      I  
Sbjct  495  WISEGKYICLYGGEDIEWIRKFTNTARAVAKAAQIPLEMLYVGKSNTREKLRNNSNTILA  554

Query  248  ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKN  427
            EN+S+  L     IW FW RL SM+ S++     ++      ND I+  +  +L+++G +
Sbjct  555  ENLSH-VLPDLTLIWFFWVRLESMWHSKVQQGKSVD------NDPIMQEIMMMLSFDGSD  607

Query  428  TIIEGWAVLSKG  463
                GWAV+ +G
Sbjct  608  ---HGWAVICRG  616



>ref|XP_009359245.1| PREDICTED: uncharacterized protein LOC103949844 [Pyrus x bretschneideri]
Length=746

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 78/153 (51%), Gaps = 16/153 (10%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  +  W   + YI LYGG DI W+R FT     +A +  +++E+ YVG++       K
Sbjct  523  IDPNLSTWITEKKYICLYGGEDIEWIRNFTKAARNVAVEANIQLEMLYVGRSKPKETVVK  582

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINY----FDEECNDEILH  391
             I +II  E +S+  +     IW FW RL SM+ S+   L E        D   +D I+ 
Sbjct  583  NIMNIIQAEKLSH--ILDLNLIWFFWIRLESMWQSKGQLLSEQGKTHSPTDPLKSDPIMQ  640

Query  392  GLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            G+  +L++   +    GWAV+S+G  ++   +G
Sbjct  641  GIISMLSFGSSD---RGWAVISQGSPVMSRANG  670



>ref|XP_011040448.1| PREDICTED: uncharacterized protein LOC105136707 [Populus euphratica]
Length=733

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 80/171 (47%), Gaps = 21/171 (12%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ +   +L+L++G    N  L   + +W  +   + LYGG DI W+REFT         
Sbjct  503  WEAQHTWTLELLLGGIDNNFSL---VLDWTKQGTIVCLYGGEDIEWIREFTKAKKDAVKN  559

Query  182  IQ--LKVELAYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIH  337
            I      EL YVGK   I+ +      I++EN+S C    S SIW FWTRL SM   ++ 
Sbjct  560  ISSGTSFELVYVGKKNAIKEVENIIKTIEEENLSRCWNDLS-SIWFFWTRLESMLYLKMQ  618

Query  338  YLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
                +       ND I+  +  LL+Y+  +    GWA+  KG   +    G
Sbjct  619  QCKNLK------NDRIMQEVTTLLSYDDSD---RGWALFCKGSSEMALAQG  660



>ref|XP_009769432.1| PREDICTED: uncharacterized protein LOC104220293 isoform X1 [Nicotiana 
sylvestris]
Length=706

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 80/152 (53%), Gaps = 22/152 (14%)
 Frame = +2

Query  26   LDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELA  205
            L+LVV    +N+        W     YI LYGG D+ W+ +FT+    +A +  + + + 
Sbjct  487  LELVVDGIDQNI------IEWMTAGKYICLYGGEDVEWIEKFTTSAKGVAHRAGIDLHMI  540

Query  206  YVGKNK------MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDE  367
            YVGK+        I  II KEN+SYC L    S+W FW RL SMF S++     I     
Sbjct  541  YVGKSSKKDRVRRINIIIRKENLSYC-LDDVMSVWYFWKRLESMFYSKMQLGQTIK----  595

Query  368  ECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              +D+I+  +  +L+++G +   +GW ++S+G
Sbjct  596  --DDKIMQEVLTMLSFDGSD---QGWVLISRG  622



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 57/156 (37%), Positives = 80/156 (51%), Gaps = 21/156 (13%)
 Frame = +2

Query  56   NVHL--DYVMQN---WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK-  217
            NV L  D + QN   W      I LYGG DI W+R FTS    +A+   + +E+ YVGK 
Sbjct  568  NVELLADSIDQNVFTWISEGKCICLYGGEDIEWIRSFTSSTRAVANAAGVPLEMLYVGKK  627

Query  218  --NKMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDE  382
               + +R   SII  EN+S+  ++    IW FW RL SM+ SR     + +   E   D 
Sbjct  628  NPKERVRKNSSIIQMENLSH-VVQDQTLIWFFWERLESMWHSRT----QQDIPGE--TDP  680

Query  383  ILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            IL  +  +L+Y+G +    GWAV S+G   +  G G
Sbjct  681  ILQEIVTILSYDGSDL---GWAVFSRGLAEMTRGKG  713



>ref|XP_009769433.1| PREDICTED: uncharacterized protein LOC104220293 isoform X2 [Nicotiana 
sylvestris]
Length=702

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 80/152 (53%), Gaps = 22/152 (14%)
 Frame = +2

Query  26   LDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELA  205
            L+LVV    +N+        W     YI LYGG D+ W+ +FT+    +A +  + + + 
Sbjct  483  LELVVDGIDQNI------IEWMTAGKYICLYGGEDVEWIEKFTTSAKGVAHRAGIDLHMI  536

Query  206  YVGKNK------MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDE  367
            YVGK+        I  II KEN+SYC L    S+W FW RL SMF S++     I     
Sbjct  537  YVGKSSKKDRVRRINIIIRKENLSYC-LDDVMSVWYFWKRLESMFYSKMQLGQTIK----  591

Query  368  ECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              +D+I+  +  +L+++G +   +GW ++S+G
Sbjct  592  --DDKIMQEVLTMLSFDGSD---QGWVLISRG  618



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ + +++L+     +NV        W      I LYGG DI W+R FTS    +A+ 
Sbjct  561  WKEQTW-NIELLADSIDQNVF------TWISEGKCICLYGGEDIEWIRSFTSATRAVANA  613

Query  182  IQLKVELAYVGK---NKMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK    + IR   SII  EN+S+  ++    IW FW RL SM+ SR    
Sbjct  614  ARVPLEMLYVGKKNPKERIRKNNSIIQIENLSH-VVQDQTLIWFFWERLESMWHSRT---  669

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             + +   E   D IL  +  +L+Y+G +    GWAV S+G   +  G G
Sbjct  670  -QQDIPGE--TDPILQEIVTILSYDGSDL---GWAVFSRGLVEMTRGKG  712



>emb|CBI16824.3| unnamed protein product [Vitis vinifera]
Length=650

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 70/133 (53%), Gaps = 15/133 (11%)
 Frame = +2

Query  83   NWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI------ID  244
            +W     YI LYGG+DI W++ FT     + S   +K+E+ YVGK+ +   +      I 
Sbjct  502  DWISEGKYICLYGGDDIEWIQRFTDVAKAVESAADIKLEMLYVGKSNLREKVRKNNDSIA  561

Query  245  KENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGK  424
            +EN+S+  L    S+W FW RL SM+ S++ +  E         D I+  +  +L+++G 
Sbjct  562  QENLSH-VLPDLSSVWFFWARLESMWHSKVQHGGE-----NAERDPIMQEIVSMLSFDGG  615

Query  425  NTIIEGWAVLSKG  463
            +    GWAV  +G
Sbjct  616  D---HGWAVFGRG  625



>ref|XP_002282165.1| PREDICTED: uncharacterized protein LOC100266247 [Vitis vinifera]
Length=712

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 70/133 (53%), Gaps = 15/133 (11%)
 Frame = +2

Query  83   NWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI------ID  244
            +W     YI LYGG+DI W++ FT     + S   +K+E+ YVGK+ +   +      I 
Sbjct  502  DWISEGKYICLYGGDDIEWIQRFTDVAKAVESAADIKLEMLYVGKSNLREKVRKNNDSIA  561

Query  245  KENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGK  424
            +EN+S+  L    S+W FW RL SM+ S++ +  E         D I+  +  +L+++G 
Sbjct  562  QENLSH-VLPDLSSVWFFWARLESMWHSKVQHGGE-----NAERDPIMQEIVSMLSFDGG  615

Query  425  NTIIEGWAVLSKG  463
            +    GWAV  +G
Sbjct  616  D---HGWAVFGRG  625



>emb|CAN83923.1| hypothetical protein VITISV_026533 [Vitis vinifera]
Length=673

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 70/133 (53%), Gaps = 15/133 (11%)
 Frame = +2

Query  83   NWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI------ID  244
            +W     YI LYGG+DI W++ FT     + S   +K+E+ YVGK+ +   +      I 
Sbjct  463  DWISEGKYICLYGGDDIEWIQRFTDVAKAVESAADIKLEMLYVGKSNLREKVRKNNDSIA  522

Query  245  KENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGK  424
            +EN+S+  L    S+W FW RL SM+ S++ +  E         D I+  +  +L+++G 
Sbjct  523  QENLSH-VLPDLSSVWFFWARLESMWHSKVQHGGE-----NAERDPIMQEIVSMLSFDGG  576

Query  425  NTIIEGWAVLSKG  463
            +    GWAV  +G
Sbjct  577  D---HGWAVFGRG  586



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 88/160 (55%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  LDL+V        ++ ++  W     YI LYGG D++W+++FT++LH  A  
Sbjct  480  WREETW-RLDLLVDA------VEPMIFQWMQEGKYICLYGGEDMDWIQKFTAELHATAQA  532

Query  182  IQLKVELAYVGKNKM---IRSI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             ++ +E+ YVGK+ +   IR I   I  +  S+  L     +W FW RL SM+ S++ + 
Sbjct  533  ARIPLEMLYVGKSNLKEKIRKINNAIVDQGWSH-VLPDVTLVWYFWVRLESMWHSKMQHR  591

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              +       ND I+  +  +++++  +   +GWA++S+G
Sbjct  592  MTVE------NDRIMQEIVTMMSFDASD---QGWALISRG  622



>ref|XP_002526965.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35452.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 50/169 (30%), Positives = 89/169 (53%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D ++ NW +   YI LYGG D+ W+R+FTS    +A  
Sbjct  583  WKEESW-RLELLVA------GIDPIITNWIEEGRYICLYGGEDMEWIRKFTSTARAVAQA  635

Query  182  IQLKVELAYVGKN---KMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+   + +R   S I  E +S+   +   SIW FW R+ SM+ S+    
Sbjct  636  AGIPLGMVYVGKSNPKERVRRNVSTIMVEKLSH-YWQDLTSIWYFWVRIESMWRSK----  690

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +++    E  ND ++  +  +L+++       GWA+ +KG + +V   G
Sbjct  691  NQLGKTSE--NDSLMKEIMAMLSFDSSEG---GWAIFTKGTEELVKAKG  734



>ref|XP_007211100.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
 gb|EMJ12299.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
Length=693

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 45/149 (30%), Positives = 78/149 (52%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRS---  235
            +D ++ +W ++  YI LYGG+D+ W+R+FT +   +A    + +EL YVG++   R    
Sbjct  480  IDPIILDWIEKGKYICLYGGDDLEWIRKFTVRAKVVAGLAGISLELLYVGRSTATRERIR  539

Query  236  ----IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
                +I+ EN+S        S W FW+R+ SM  S+  +   +       NDEIL  +  
Sbjct  540  KVNKVIETENLSR-FWPDYTSNWFFWSRMDSMRCSKAKHHRTVE------NDEILKEVMT  592

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+G +   +GW ++ +G       +G
Sbjct  593  LLSYDGSD---QGWVMVWRGSNETARANG  618



>ref|XP_008389748.1| PREDICTED: uncharacterized protein LOC103452052 [Malus domestica]
Length=832

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 18/146 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNK-------  223
            LD  +  W     YI LYGG DI+W+R FT    ++A +  +++EL YVG++K       
Sbjct  607  LDQNLITWITEGKYICLYGGEDIDWIRNFTKSAKKMAQEAGIQLELLYVGRSKPKEKVVR  666

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINY------FDEECNDEI  385
             I +II  E +S+  L+ +  IW FW RL SM+ S+   +    +       D   ND +
Sbjct  667  NIMNIIQAEKLSH-TLEWNL-IWFFWLRLESMWQSKGQQIQSEAFRSGQFRTDNIKNDAV  724

Query  386  LHGLKKLLAYEGKNTIIEGWAVLSKG  463
            + G+  +L++   +    GWAV+  G
Sbjct  725  MQGIISMLSFGSSD---RGWAVIGAG  747



>ref|XP_002526962.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35449.1| conserved hypothetical protein [Ricinus communis]
Length=1068

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 84/148 (57%), Gaps = 15/148 (10%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN----KMIR  232
            LD  + +W     +I LYGG D+ W+R+FT+ + ++A   ++ +E+ YVGK+    +++R
Sbjct  856  LDSPIIDWIKDGKFICLYGGEDMEWIRKFTNTVRKVAEFARIPLEMLYVGKSNPNERVMR  915

Query  233  SI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            ++  I  E +S+C L+    IW FW R++SM+ SR     +I       +D+I+  L  L
Sbjct  916  NMETIKTEKLSHC-LEQRSLIWLFWYRIQSMWNSRYQLGKKIE------DDQIMQELTSL  968

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++G +    GWA++ K    +V   G
Sbjct  969  LSFDGIDEC--GWALICKETTEMVKARG  994


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 59/141 (42%), Gaps = 17/141 (12%)
 Frame = +2

Query  86   WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI------IDK  247
            W   E  I LYGG D+ W++ FT++   +A    + +E+ YVGK +    +      I  
Sbjct  481  WMREEKCICLYGGEDMEWIKMFTTRAPYVAKAADISLEMVYVGKREPSEQVQRHITTITS  540

Query  248  ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKN  427
              +S+   +     WRFW R+ +M  SR+     I        D I+  +  LL  +   
Sbjct  541  GGLSHSMTREEQ--WRFWKRIVNMGHSRMQLGKTI------YEDPIMQEIISLLNLDATA  592

Query  428  TIIEGWAVLSKGKKMVVCGHG  490
             +   WA       +++   G
Sbjct  593  GV---WAAFGHKSDLIIKAKG  610



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 52/150 (35%), Positives = 80/150 (53%), Gaps = 19/150 (13%)
 Frame = +2

Query  68   DYVMQN---WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMI  229
            D + QN   W      I LYGG DI W+R+FT+    +A+  ++ +E+ YVGK    + +
Sbjct  571  DSIDQNIFTWIGEGKCICLYGGEDIEWIRDFTTVTRAVANAARIPLEMLYVGKRNPKERV  630

Query  230  R---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            R   +II  EN+S+  ++    IW FW RL SM+ SR     + +   E   D IL  + 
Sbjct  631  RKNSAIIQVENLSH-VVQDQTLIWFFWERLESMWHSRT----QQDIPGE--TDPILQEIV  683

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +L+Y+G +   +GWAV S+G   +  G G
Sbjct  684  TILSYDGSD---QGWAVFSRGLAEMTRGKG  710



>ref|XP_008340128.1| PREDICTED: uncharacterized protein LOC103403085 [Malus domestica]
Length=873

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 48/146 (33%), Positives = 75/146 (51%), Gaps = 18/146 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVG----KNKMIR  232
            +D  +  W     YI LYGG DI+W+R FT     +A +  +++EL YVG    K K++R
Sbjct  648  IDQNLITWITEGKYICLYGGEDIDWIRNFTKSAKNVAREAGIQLELLYVGKRNPKEKVVR  707

Query  233  SI---IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINY------FDEECNDEI  385
            +I   I  E +S+  L+ +  IW FW RL SM+ S+ H +            D   ND +
Sbjct  708  NIMNVIQAEKLSH-TLEWNL-IWFFWMRLESMWQSKGHQMQSEAIRSGRLRTDNMKNDPV  765

Query  386  LHGLKKLLAYEGKNTIIEGWAVLSKG  463
            + G+  +L++   +    GWAV+  G
Sbjct  766  MQGIISMLSFGSSD---RGWAVIGAG  788



>emb|CAH59411.1| hypothetical protein [Plantago major]
Length=391

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 17/150 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W      I LYGG DI W+R+FT    ++A+ +Q+ +E+ YVGK       + 
Sbjct  175  IDPRIPEWTRENRVICLYGGEDIEWIRKFTIAARKVATALQIPLEMLYVGKRNPRAKVQH  234

Query  227  IRSIIDKENMSYC-ALKSSYS-IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
               +ID+E +S+  ++K  Y  +W FW RL SM+ S+      ++      ND I+  + 
Sbjct  235  CHEVIDREKLSHVFSVKEYYDYVWYFWIRLWSMWNSKKQLGMTVD------NDLIMQEIM  288

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +L Y+      +GWAV S+G   +  G G
Sbjct  289  DILTYDSSE---QGWAVFSRGNHEMTKGMG  315



>ref|XP_011097584.1| PREDICTED: uncharacterized protein LOC105176465 [Sesamum indicum]
Length=712

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 26/168 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            WQ+E +  L+L+V   G +V L Y    W   E YI LYGG D+  + +FT    R+  +
Sbjct  484  WQEETW-RLELLVN--GIDVSLLY----WIRSERYIILYGGFDLQAISDFTVTARRIIHQ  536

Query  182  IQLKVELAYVGKNKM-------IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
            + + +E+ YVG +         + + I  + +S C  +    +W FWTR+ SM LS+I  
Sbjct  537  LDIPLEMVYVGTSTKSPQELGPLINNIRNQRLSNCWEEE--MMWFFWTRVESMLLSKI--  592

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCG  484
              ++   DE+  D ++  L+KLL Y+   T    WA+ SKG ++++ G
Sbjct  593  --QVEAKDEQ--DPVMQELEKLLMYDRMGT----WALFSKGSEVMLTG  632



>ref|XP_002271883.2| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=1344

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 80/146 (55%), Gaps = 19/146 (13%)
 Frame = +2

Query  74    VMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDK--  247
              +QNW  +  +I LYGG D+ W++ FT+    +AS  ++ +E+ YVGK+ + +S   +  
Sbjct  1159  TIQNWIKKGKFICLYGGTDMKWIQTFTTVAKEVASAERIPLEMVYVGKSNVGKSNHRERV  1218

Query  248   -ENMSYCALKSSYSIWR------FWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              + +++ ++K     W       FW+RL SM  S+I    E    DE+  D +L  +KKL
Sbjct  1219  LQCIAFISMKELSHWWSDRTMVWFWSRLESMLFSKIQLGRE----DEK--DPMLEEIKKL  1272

Query  407   LAYEGKNTIIEGWAVLSKGKKMVVCG  484
             L+Y+ +     GWA+LSKG   +  G
Sbjct  1273  LSYDKEG----GWAMLSKGSSPIFSG  1294



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 52/150 (35%), Positives = 79/150 (53%), Gaps = 19/150 (13%)
 Frame = +2

Query  68   DYVMQN---WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMI  229
            D + QN   W      I LYGG DI W+R FT+    +A+  ++ +E+ YVGK    + +
Sbjct  578  DSIDQNIFTWIGEGKCICLYGGEDIEWIRAFTTATRAVANAARIPLEMLYVGKRNPKERV  637

Query  230  R---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
            R   +II  EN+S+  ++    IW FW RL SM+ SR     + +   E   D IL  + 
Sbjct  638  RKNSAIIQVENLSH-VVQDQTLIWFFWERLESMWHSRT----QQDIPGE--TDPILQEIV  690

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +L+Y+G +   +GWAV S+G   +  G G
Sbjct  691  TILSYDGSD---QGWAVFSRGLAEMTRGKG  717



>emb|CAN64088.1| hypothetical protein VITISV_006939 [Vitis vinifera]
Length=1532

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 80/146 (55%), Gaps = 19/146 (13%)
 Frame = +2

Query  74    VMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDK--  247
              +QNW  +  +I LYGG D+ W++ FT+    +AS  ++ +E+ YVGK+ + +S   +  
Sbjct  1347  TIQNWIKKGKFICLYGGTDMKWIQTFTTVAKEVASAERIPLEMVYVGKSNVGKSNHRERV  1406

Query  248   -ENMSYCALKSSYSIWR------FWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              + +++ ++K     W       FW+RL SM  S+I    E    DE+  D +L  +KKL
Sbjct  1407  LQCIAFISMKELSHWWSDRTMVWFWSRLESMLFSKIQLGRE----DEK--DPMLEEIKKL  1460

Query  407   LAYEGKNTIIEGWAVLSKGKKMVVCG  484
             L+Y+ +     GWA+LSKG   +  G
Sbjct  1461  LSYDKEG----GWAMLSKGSSPIFSG  1482



>ref|XP_007221911.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
 gb|EMJ23110.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
Length=799

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 13/143 (9%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIID  244
            LD  + NW     YI LYGG DI W+R FT    ++A++  +++EL YVGK+K    ++ 
Sbjct  575  LDQNLINWIAEGKYICLYGGEDIEWIRNFTRAAKKVAAESGIQLELLYVGKSKPKEKVVK  634

Query  245  KENMSYCALKSSYS-----IWRFWTRLRSMFLSR-----IHYLDEINYFDEECNDEILHG  394
                +    K S++     IW FW RL SM+ SR        L      D   +D ++ G
Sbjct  635  NIMTTIQFEKLSHTLEWNLIWFFWVRLESMWQSRGQQLQTEALRSGRLTDSLKSDLVMQG  694

Query  395  LKKLLAYEGKNTIIEGWAVLSKG  463
            +  +L++   +    GWAV+  G
Sbjct  695  IISMLSFGSSD---RGWAVIGTG  714



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 57/156 (37%), Positives = 80/156 (51%), Gaps = 21/156 (13%)
 Frame = +2

Query  56   NVHL--DYVMQN---WFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK-  217
            NV L  D + QN   W      I LYGG DI W+R FTS    +A+   + +E+ YVGK 
Sbjct  473  NVELLADSIDQNVFTWISEGKCICLYGGEDIEWIRSFTSSTRAVANAAGVPLEMLYVGKK  532

Query  218  --NKMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDE  382
               + +R   SII  EN+S+  ++    IW FW RL SM+ SR     + +   E   D 
Sbjct  533  NPKERVRKNSSIIQMENLSH-VVQDQTLIWFFWERLESMWHSRT----QQDIPGE--TDP  585

Query  383  ILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            IL  +  +L+Y+G +    GWAV S+G   +  G G
Sbjct  586  ILQEIVTILSYDGSDL---GWAVFSRGLAEMTRGKG  618



>ref|XP_008340127.1| PREDICTED: uncharacterized protein LOC103403084 [Malus domestica]
Length=743

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 46/147 (31%), Positives = 75/147 (51%), Gaps = 12/147 (8%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDKENM  256
            +  W     YI LYGG DI W+R+FT     +AS   +++E+ YVG++K   ++++    
Sbjct  524  LTTWITEGKYICLYGGEDIEWIRKFTKAARNVASDAGIQLEMLYVGRSKAKENVMNNIIK  583

Query  257  SYCALKSSYS-----IWRFWTRLRSMFLSRIHYLDE----INYFDEECNDEILHGLKKLL  409
               A K S++     IW FW RL SM+ S+   L E     +  D   +D ++ G+  LL
Sbjct  584  IIQAEKLSHTLDWNLIWFFWIRLESMWQSKGQLLSEQGKTQSRTDPLKSDPMMQGIISLL  643

Query  410  AYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            ++   +    GWAV+S G   +   +G
Sbjct  644  SFGSSD---RGWAVISLGSAAMSKANG  667



>ref|XP_010695991.1| PREDICTED: uncharacterized protein LOC104908569 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/142 (31%), Positives = 73/142 (51%), Gaps = 16/142 (11%)
 Frame = +2

Query  83   NWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMIRSIID  244
            +W  +  YI +YGG DI+W+R FT    ++A+   + +EL YVGK       + I   I 
Sbjct  492  DWIPQGKYICVYGGEDIDWIRAFTDNAKQVAATAGIDLELMYVGKTNAKERMRKITGNIS  551

Query  245  KENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGK  424
            +EN+S+  L    S+W FWTRL  M  S++ +   +        D I+  +  +L+++G 
Sbjct  552  EENLSH-FLPDLTSMWYFWTRLECMLYSKMQHGRSVE------RDIIMQEVMTVLSFDGS  604

Query  425  NTIIEGWAVLSKGKKMVVCGHG  490
            +   +GWA +  G   +  G G
Sbjct  605  D---QGWATMWFGSHEMARGKG  623



>ref|XP_008239606.1| PREDICTED: uncharacterized protein LOC103338199 [Prunus mume]
Length=557

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 78/149 (52%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRS---  235
            +D ++ +W ++  YI LYGG+D+ W+R+FT +   +A    + +EL YVG++   R    
Sbjct  370  IDPIILDWIEKGKYICLYGGDDLEWIRKFTVRAKVVAGLAGISLELLYVGRSTATRERIR  429

Query  236  ----IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
                +I+ EN+S        S W FW+R+ SM  S+  +   +       NDEIL  +  
Sbjct  430  KVNKVIETENLSR-FWPDYTSNWFFWSRMDSMRCSKAKHHKTVE------NDEILKEVMT  482

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+G +   +GW ++ +G       +G
Sbjct  483  LLSYDGSD---QGWVMVWRGSNETARANG  508



>ref|XP_010087771.1| hypothetical protein L484_016341 [Morus notabilis]
 gb|EXB29852.1| hypothetical protein L484_016341 [Morus notabilis]
Length=709

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 79/156 (51%), Gaps = 29/156 (19%)
 Frame = +2

Query  38   VGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVEL  202
            +G   R++  D V+Q W + E YIF YGG D  W ++F  K+  LA+     + ++ VEL
Sbjct  497  IGPIARDI--DPVIQTWIEEEKYIFFYGGKDKEWRQQFAEKVTTLANDPVFKEARISVEL  554

Query  203  AYVGKNKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDE  382
              VGK        D ++           + RFWT +  +F ++ H   E++   +E    
Sbjct  555  FRVGKTNKGEDEDDGDDHGV--------VGRFWTAIEGLFFTKAH--KEVDPVSQE----  600

Query  383  ILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
                ++KLL+Y+ ++    GW VLSKG  +VV GHG
Sbjct  601  ----IQKLLSYKNES----GWFVLSKGSTVVVAGHG  628



>gb|KDO37241.1| hypothetical protein CISIN_1g014387mg [Citrus sinensis]
Length=425

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 72/148 (49%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI--  238
            LD V+ NW     YI LYGG D++W+R+FT+  + +A    + + + YVGK+     +  
Sbjct  212  LDPVILNWMAEGRYICLYGGEDMDWIRKFTTATNAVAKTAGIPLGMVYVGKSNPKDRVRR  271

Query  239  ----IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
                I  EN+S+   +   SIW FW RL SM+ S++              D ++  + ++
Sbjct  272  NNDTIASENLSHI-WQDLTSIWYFWVRLESMWYSKVQLGRNAE------TDHVMQEIMRM  324

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L Y+       GWAV ++G   +    G
Sbjct  325  LTYDSSEG---GWAVFARGSAEMASAKG  349



>ref|XP_006446667.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
 gb|ESR59907.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
Length=403

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 72/148 (49%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI--  238
            LD V+ NW     YI LYGG D++W+R+FT+  + +A    + + + YVGK+     +  
Sbjct  240  LDPVILNWMAEGRYICLYGGEDMDWIRKFTAATNAVAKTAGIPLGMVYVGKSNPKDRVRR  299

Query  239  ----IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
                I  EN+S+   +   SIW FW RL SM+ S++              D ++  + ++
Sbjct  300  NNDTIASENLSHI-WQDLTSIWYFWVRLESMWYSKVQLGRNAE------TDHVMQEIMRM  352

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L Y+       GWAV ++G   +    G
Sbjct  353  LTYDSSEG---GWAVFARGSAEMASAKG  377



>ref|XP_008221943.1| PREDICTED: uncharacterized protein LOC103321871 [Prunus mume]
Length=843

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 71/143 (50%), Gaps = 13/143 (9%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIID  244
            +D  + NW     YI LYGG D+ W+R FT    ++A++  +++EL YVGK+K    ++ 
Sbjct  619  IDQNLINWIAEGKYICLYGGEDMEWIRNFTRAAKKVAAESGIQLELLYVGKSKPKEKVVK  678

Query  245  KENMSYCALKSSYS-----IWRFWTRLRSMFLSR-----IHYLDEINYFDEECNDEILHG  394
                +    K S++     IW FW RL SM+ SR        L      D   +D ++ G
Sbjct  679  NIMTAIQFEKLSHTLEWNLIWFFWVRLESMWQSRGQQLQTEALRSGRLTDSLKSDAVMQG  738

Query  395  LKKLLAYEGKNTIIEGWAVLSKG  463
            +  +L++   +    GWAV+  G
Sbjct  739  IISMLSFGSSD---RGWAVIGTG  758



>ref|XP_008224125.1| PREDICTED: uncharacterized protein LOC103323883 [Prunus mume]
Length=882

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 47/136 (35%), Positives = 71/136 (52%), Gaps = 32/136 (24%)
 Frame = +2

Query  98   EDYIFLYGGNDINWVREFTSKLHRLASKIQLK-----VELAYVGKNKMIRSIIDKENMSY  262
            ++YIF YGG D +W+++F  K   LA+ + LK     ++L  VGK+        K    +
Sbjct  693  DEYIFFYGGKDKDWIKQFKEKATALANDLILKEAKINIKLFCVGKDS-------KGEDDF  745

Query  263  CALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEG  442
              L      WRFWT + S+F ++IH   +    D          ++KLL+Y+ ++    G
Sbjct  746  GIL------WRFWTGIESLFHTKIHKQADSATLD----------IQKLLSYKNES----G  785

Query  443  WAVLSKGKKMVVCGHG  490
            WAVLSKG  +VV GHG
Sbjct  786  WAVLSKGSSLVVAGHG  801



>gb|KDP46378.1| hypothetical protein JCGZ_10218 [Jatropha curcas]
Length=688

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 83/150 (55%), Gaps = 19/150 (13%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN----KMIR  232
            LD  + NW   E Y+ LYGG+DI W+R+FT+   ++A    + +E+ YVGK+    ++ R
Sbjct  475  LDPAVINWAAEEKYVCLYGGDDIEWIRKFTNTAKQVAKSAGIPLEMLYVGKSNPKKRVAR  534

Query  233  SI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +I  I  EN+S+     +Y IW FW R+ SM+ S+     +        +D I+  + K+
Sbjct  535  NIETIIWENLSHLWEDKTY-IWYFWVRIESMWRSKNQLGGKTK------DDPIMKKIMKV  587

Query  407  LAYEGKNTIIEGWAVLSKG--KKMVVCGHG  490
            L+++ +     GWA+ +KG   ++VV   G
Sbjct  588  LSFDSE----AGWAIFAKGFDNQIVVEARG  613



>gb|KDP46380.1| hypothetical protein JCGZ_10220 [Jatropha curcas]
Length=779

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 78/153 (51%), Gaps = 22/153 (14%)
 Frame = +2

Query  23   SLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVEL  202
            SLDL+         LD ++Q W   ++ I LYGG DI W+R FT    ++A    + V++
Sbjct  556  SLDLITN------DLDPIIQRWKQEDNLICLYGGEDIKWIRNFTRTAKQVAKSAAIGVQM  609

Query  203  AYVGKNKMIRSI------IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFD  364
             YVG + + +        I +E +S+C  K    IW FW+RL+S++ +       +    
Sbjct  610  LYVGMSNLNKRCSSNIVKITEEELSHC-WKERVLIWSFWSRLQSIWHTGYQIGKSMK---  665

Query  365  EECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
               +D I+  L  LL+++ +     GWA++SKG
Sbjct  666  ---DDPIMKELTTLLSFDSREC---GWALMSKG  692



>gb|KHN05808.1| hypothetical protein glysoja_038722 [Glycine soja]
Length=673

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 85/169 (50%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  +  W      I LYGG D+ W+ +FT+    +A  
Sbjct  447  WKQEIW-SLELLVD------GIDPTVLEWMTDGKLICLYGGEDLEWIEKFTTTAISVAKA  499

Query  182  IQLKVELAYVGKNKMIRSIIDKENMSYCALKSSY------SIWRFWTRLRSMFLSRIHYL  343
             + ++E+AYVGK+   +  + K   ++   K SY      SIW FWTRL SM  S++ + 
Sbjct  500  GKFELEMAYVGKSNA-KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHG  558

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +       ND+I+  +  +L+++G +    GWA+  +G   +    G
Sbjct  559  RTVE------NDDIMSQVMTVLSFDGSD---RGWAIFCRGATEMARAKG  598



>ref|NP_001241263.1| uncharacterized protein LOC100811452 [Glycine max]
 gb|ADN32785.1| sieve element occlusion c [Glycine max]
Length=698

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 85/169 (50%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  +  W      I LYGG D+ W+ +FT+    +A  
Sbjct  472  WKQEIW-SLELLVD------GIDPTVLEWMTDGKLICLYGGEDLEWIEKFTTTAISVAKA  524

Query  182  IQLKVELAYVGKNKMIRSIIDKENMSYCALKSSY------SIWRFWTRLRSMFLSRIHYL  343
             + ++E+AYVGK+   +  + K   ++   K SY      SIW FWTRL SM  S++ + 
Sbjct  525  GKFELEMAYVGKSNA-KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHG  583

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +       ND+I+  +  +L+++G +    GWA+  +G   +    G
Sbjct  584  RTVE------NDDIMSQVMTVLSFDGSD---RGWAIFCRGATEMARAKG  623



>ref|XP_011087135.1| PREDICTED: uncharacterized protein LOC105168700 [Sesamum indicum]
Length=712

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 70/139 (50%), Gaps = 11/139 (8%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W   +  I LYGG +  W++EF      +A+  ++ +E+ YVGK       K 
Sbjct  492  IDKSIMTWISEDKVICLYGGENEEWLQEFIMTARNVAAAARISLEMVYVGKKTSKERVKR  551

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +  ++  + +S+C      SIW FWTR+ SM  S+IH+   +    +   D IL  +  +
Sbjct  552  LNEMVTTDRLSHC-WNDPTSIWYFWTRMESMMYSKIHHGSTLATA-QRPGDHILAEVLTM  609

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L Y   +   +GWA+ SKG
Sbjct  610  LTYADSH---QGWALFSKG  625



>ref|XP_008239364.1| PREDICTED: uncharacterized protein LOC103337969 [Prunus mume]
Length=707

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (52%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRS---  235
            +D ++ +W ++  YI LYGG+D+ W+R+FT +   +A    + +EL YVG++   R    
Sbjct  494  IDPIILDWIEKGKYICLYGGDDLEWIRKFTVRAKVVAGLAGISLELLYVGRSTATREQIR  553

Query  236  ----IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
                +I  EN+S        S W FW+R+ SM  S+  +   +       NDEIL  +  
Sbjct  554  KVNKVIKTENLSRF-WPDYTSNWFFWSRMDSMRCSKAKHHKTVE------NDEILKEVMT  606

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+G +   +GW ++ +G       +G
Sbjct  607  LLSYDGSD---QGWVMVWRGSNETARANG  632



>ref|XP_004288436.1| PREDICTED: uncharacterized protein LOC101298363 [Fragaria vesca 
subsp. vesca]
Length=677

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 32/143 (22%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRSII  241
            +Q W   E YIF YGG D  W+++FT K   +A+     ++++ +EL  VGK     S  
Sbjct  478  IQTWIKEEKYIFFYGGKDNEWIQQFTKKATAIANDPFIKELKINIELFCVGK-----SAK  532

Query  242  DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
              E++          + RFW+ + S+F + ++          +  D +   ++KLL+Y+ 
Sbjct  533  GGEDLGI--------LGRFWSGIESLFFTNVN----------KQTDTVTKEVQKLLSYKN  574

Query  422  KNTIIEGWAVLSKGKKMVVCGHG  490
            ++    GWAVLSKG  +VV GHG
Sbjct  575  ES----GWAVLSKGSTVVVSGHG  593



>ref|XP_008362016.1| PREDICTED: uncharacterized protein LOC103425707 [Malus domestica]
Length=681

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 74/143 (52%), Gaps = 32/143 (22%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRSII  241
            +Q W   E YIF YGG D +W+++FT K   +A+     ++++ +EL  VGK     S  
Sbjct  482  IQTWIKEEKYIFFYGGKDNDWIQQFTKKATTIANDPFIKELKINIELFCVGK-----SPK  536

Query  242  DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
              E++          + RFW  + S+F ++++          +  D +   ++KLL+Y+ 
Sbjct  537  GGEDLGI--------LGRFWNGIESLFFTKVN----------KQTDTVTKEVQKLLSYKN  578

Query  422  KNTIIEGWAVLSKGKKMVVCGHG  490
            +     GWAVL+KG  +VV GHG
Sbjct  579  EG----GWAVLTKGSTVVVSGHG  597



>gb|ADN32815.1| sieve element occlusion a [Malus domestica]
Length=681

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 74/143 (52%), Gaps = 32/143 (22%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRSII  241
            +Q W   E YIF YGG D +W+++FT K   +A+     ++++ +EL  VGK     S  
Sbjct  482  IQTWIKEEKYIFFYGGKDNDWIQQFTKKATTIANDPFIKELKINIELFCVGK-----SPK  536

Query  242  DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
              E++          + RFW  + S+F ++++          +  D +   ++KLL+Y+ 
Sbjct  537  GGEDLGI--------LGRFWNGIESLFFTKVN----------KQTDTVTKEVQKLLSYKN  578

Query  422  KNTIIEGWAVLSKGKKMVVCGHG  490
            +     GWAVL+KG  +VV GHG
Sbjct  579  EG----GWAVLTKGSTVVVSGHG  597



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 83/160 (52%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L L+V        +D  +  W ++  YI +YGG + +W+  F +    +A  
Sbjct  480  WKEETW-RLKLLVD------DIDATIFAWVNQGKYICMYGGVNSDWILNFNTAAREVAKA  532

Query  182  IQLKVELAYVGKN---KMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              +++E+ YVGK+   + +R   + ID  ++ YC    + +IW FWTR+ SM  S+  + 
Sbjct  533  AGIQLEMVYVGKSNAKEQVRKTITFIDSRSLGYCWTDPT-NIWFFWTRMESMLYSKTQHG  591

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              I       ND I  G+  +L+++G +   +GW+V+  G
Sbjct  592  KTIE------NDSIFAGVLTMLSFDGSD---QGWSVICHG  622



>ref|XP_003590760.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32808.1| sieve element occlusion c [Medicago truncatula]
 gb|AES61011.1| sieve element occlusion protein [Medicago truncatula]
Length=671

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 47/157 (30%), Positives = 79/157 (50%), Gaps = 43/157 (27%)
 Frame = +2

Query  35   VVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLK-----VE  199
            VVG   RN+ +      W ++  +IF YGG+D  W+++FT     LA+   +K     +E
Sbjct  469  VVGNIDRNISI------WTEQNKHIFFYGGHDKEWIQQFTKYATALANDATIKEAKISIE  522

Query  200  LAYVGKNKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECND  379
            L YV          DKE+ +  +        RFW+ + S+F+++IH          +  D
Sbjct  523  LFYV----------DKEDKNLVS--------RFWSGIESLFVTKIH----------KTTD  554

Query  380  EILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +   ++K+L+Y+ +     GWA+LSKG  +V+ GHG
Sbjct  555  VVTQEVQKMLSYKNET----GWALLSKGPSVVLSGHG  587



>ref|XP_008224124.1| PREDICTED: uncharacterized protein LOC103323881 [Prunus mume]
Length=666

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 47/136 (35%), Positives = 71/136 (52%), Gaps = 32/136 (24%)
 Frame = +2

Query  98   EDYIFLYGGNDINWVREFTSKLHRLASKIQLK-----VELAYVGKNKMIRSIIDKENMSY  262
            ++YIF YGG D +W+++F  K   LA+ + LK     ++L  VGK+        K    +
Sbjct  477  DEYIFFYGGKDKDWIKQFKEKATALANDLILKEAKINIKLFCVGKDS-------KGEDDF  529

Query  263  CALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEG  442
              L      WRFWT + S+F ++IH   +    D          ++KLL+Y+ ++    G
Sbjct  530  GIL------WRFWTGIESLFHTKIHKQADSATLD----------IQKLLSYKNES----G  569

Query  443  WAVLSKGKKMVVCGHG  490
            WAVLSKG  +VV GHG
Sbjct  570  WAVLSKGSSLVVAGHG  585



>emb|CBI34827.3| unnamed protein product [Vitis vinifera]
Length=685

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (52%), Gaps = 18/149 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W      I LYGG+DI W++ FT+   ++A    + +E+ YVGK+        
Sbjct  473  IDPRISEWIAAGKIICLYGGDDIEWIQRFTTIAKKVAESAGISLEMVYVGKSNPKELVYT  532

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             I++II+ + +S+  LK   SIW FW R+ SM  S++     +        D  +  + K
Sbjct  533  NIKTIIE-DKLSH-HLKGLTSIWYFWVRIESMLYSKMRLGQTVE------KDPTMQEILK  584

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +L+++  +   EGWA+LSKG + +    G
Sbjct  585  MLSFDNSH---EGWALLSKGSEEITKAKG  610



>ref|XP_002271950.2| PREDICTED: uncharacterized protein LOC100261056 [Vitis vinifera]
Length=713

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (52%), Gaps = 18/149 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W      I LYGG+DI W++ FT+   ++A    + +E+ YVGK+        
Sbjct  501  IDPRISEWIAAGKIICLYGGDDIEWIQRFTTIAKKVAESAGISLEMVYVGKSNPKELVYT  560

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             I++II+ + +S+  LK   SIW FW R+ SM  S++     +        D  +  + K
Sbjct  561  NIKTIIE-DKLSH-HLKGLTSIWYFWVRIESMLYSKMRLGQTVE------KDPTMQEILK  612

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +L+++  +   EGWA+LSKG + +    G
Sbjct  613  MLSFDNSH---EGWALLSKGSEEITKAKG  638



>ref|XP_008362017.1| PREDICTED: uncharacterized protein LOC103425708 [Malus domestica]
Length=681

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 74/143 (52%), Gaps = 32/143 (22%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRSII  241
            +Q W   E YIF YGG D +W+++FT K   +A+     ++++ +EL  VGK     S  
Sbjct  482  IQTWIXEEKYIFFYGGKDNDWIQQFTKKATTIANDPFIKELKINIELFCVGK-----SPK  536

Query  242  DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
              E++          + RFW  + S+F ++++          +  D +   ++KLL+Y+ 
Sbjct  537  GGEDLGI--------LGRFWNGIESLFFTKVN----------KQTDTVTKEVQKLLSYKN  578

Query  422  KNTIIEGWAVLSKGKKMVVCGHG  490
            +     GWAVL+KG  +VV GHG
Sbjct  579  EG----GWAVLTKGSTVVVSGHG  597



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 76/148 (51%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR-  232
            +D  +  W ++  YI +YGG + +W+  F +    +A    +++E+ YVGK+   + +R 
Sbjct  496  IDATIFAWVNQGKYICMYGGVNSDWILNFNTAAREVAKAAGIQLEMVYVGKSNAKEQVRK  555

Query  233  --SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
              + ID  ++ YC    + +IW FWTR+ SM  S+  +   I       ND I  G+  +
Sbjct  556  TITFIDSRSLGYCWTDPT-NIWFFWTRMESMLYSKTQHGKTIE------NDSIFAGVLTM  608

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L+++G +   +GW+V+  G   +    G
Sbjct  609  LSFDGSD---QGWSVICHGPTEMAKAKG  633



>gb|KDP46383.1| hypothetical protein JCGZ_10223 [Jatropha curcas]
Length=709

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 25/170 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D ++ NW     YI LYGG D+ W+R+FT+    +A  
Sbjct  483  WKEESW-RLELLVD------GIDPMVLNWMQEGRYICLYGGEDMEWIRKFTNTARAVAQS  535

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
              + + + YVGK+       + I +II ++   Y   +   SIW FW R+ SM+ S+   
Sbjct  536  AGIPLGMVYVGKSNPKERVRRNIATIIVEKLSHY--WQDLTSIWYFWVRIESMWRSK---  590

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +++    E  ND I+  +  +L+++G +    GWA+ ++G   +V   G
Sbjct  591  -NQLGRTPE--NDPIMKEIMTMLSFDGSDG---GWAIFTRGSDEIVRAKG  634



>ref|XP_004310159.1| PREDICTED: uncharacterized protein LOC101309120 [Fragaria vesca 
subsp. vesca]
Length=779

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/149 (34%), Positives = 75/149 (50%), Gaps = 21/149 (14%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            LD  +  W     YI LYGG DI W+REFT     +A +  +++EL YVGK+K       
Sbjct  551  LDQNLVTWIHEGKYICLYGGEDITWIREFTRAAKSVALEAGIQLELLYVGKSKAKEQKLK  610

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL-------DEINYFDEEC--N  376
             I  +I++E +S+  +     IW FW RL SM+ S+   L        +++  D     N
Sbjct  611  SIMRMIEEEKLSH--VLHWNLIWFFWIRLESMWQSKGQQLKNELLSSSQLSTTDSFSLRN  668

Query  377  DEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
            D +L G+  LL++    +   GWAV+  G
Sbjct  669  DPVLKGIISLLSF---GSTERGWAVIGTG  694



>ref|XP_004288435.1| PREDICTED: uncharacterized protein LOC101298064 [Fragaria vesca 
subsp. vesca]
Length=680

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 74/141 (52%), Gaps = 32/141 (23%)
 Frame = +2

Query  83   NWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLK-----VELAYVGKNKMIRSIIDK  247
            +W     YIF YGG D  W+++FT K   LA+   LK     +EL  VGKN    S  + 
Sbjct  484  SWLKENRYIFFYGGKDNEWIQQFTKKATALANDPILKEAKIYIELVCVGKN----SKGED  539

Query  248  ENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKN  427
            +N           + RFWT + S+FL+++         D++  D +   ++KLL+Y+ ++
Sbjct  540  DNG---------ILGRFWTNIESLFLTKV---------DKQV-DSVSQEIQKLLSYKNES  580

Query  428  TIIEGWAVLSKGKKMVVCGHG  490
                GWAVL++G  ++V GHG
Sbjct  581  ----GWAVLTRGSTVLVTGHG  597



>gb|KCW45067.1| hypothetical protein EUGRSUZ_L01341 [Eucalyptus grandis]
Length=499

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/163 (28%), Positives = 82/163 (50%), Gaps = 23/163 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L L++G       +D  ++ W  +   I L+G  D+ W+R+FT+   + A  
Sbjct  332  WREESW-TLKLIIGGL-----IDGTIKEWVTQGSSICLFGSEDLEWIRKFTATAKQAAKT  385

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGK+      + I ++I  E +SYC    ++  W FW RL S+  S+ H+ 
Sbjct  386  DGITLEMVYVGKSDSKERVQRIAAMITSEKLSYCWNDPTF-FWLFWARLESILHSKAHH-  443

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
                      ND ++  + K+  Y+      +GWA+L +G  M
Sbjct  444  ------GITRNDPVIDEIMKIRTYD---KTAQGWAILCQGAGM  477


 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 16/126 (13%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMIRSIIDKENMSYC  265
            YI L+GG D+ W+R+ T+    +A    + + + YVGK+      +   + I  E +SYC
Sbjct  22   YICLFGGEDLEWIRKLTATAKEVAKTAGIVLGMVYVGKSNSKERVRRTAATITSEKLSYC  81

Query  266  ALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGW  445
                 +  W FW RL SM  S++H  + I       ND +L  ++ +L +   +   EGW
Sbjct  82   WNDPRF-FWLFWARLESMLHSKVHLGNSIE------NDPLLPRIQTILNFGLSD---EGW  131

Query  446  AVLSKG  463
            AV  +G
Sbjct  132  AVFCQG  137



>gb|KCW83211.1| hypothetical protein EUGRSUZ_B001511, partial [Eucalyptus grandis]
Length=177

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (52%), Gaps = 17/128 (13%)
 Frame = +2

Query  107  IFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMIRSIIDKENMSYCA  268
            I L+G  D+ W+R+FT+   + A    + +E+ YVGK+      + I ++I  E +SYC 
Sbjct  7    ICLFGSEDLEWIRKFTATAKQAAKTDGITLEMVYVGKSDSKERVQSIAAMITSEKLSYCW  66

Query  269  LKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWA  448
               ++  W FW RL S+  S+ HY           ND ++  ++K+  Y+      +GWA
Sbjct  67   NDPTF-FWLFWARLESILHSKAHY-------GITGNDPVIDEIRKIRTYD---RTAQGWA  115

Query  449  VLSKGKKM  472
            +L +G  M
Sbjct  116  ILCQGAGM  123



>ref|XP_010087772.1| hypothetical protein L484_016342 [Morus notabilis]
 gb|EXB29853.1| hypothetical protein L484_016342 [Morus notabilis]
Length=682

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/151 (30%), Positives = 72/151 (48%), Gaps = 34/151 (23%)
 Frame = +2

Query  53   RNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK-----IQLKVELAYVGK  217
            RN+H    ++ W   E YIF YGG D   +++FT K+  L ++      ++ +EL  VGK
Sbjct  478  RNIHP--TIETWIKEEKYIFFYGGKDTELIQQFTKKVTALQNEPAFKDTKINIELFLVGK  535

Query  218  NKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGL  397
                              + S  I RFW  + S+F+S+ H          +  D +   +
Sbjct  536  TTR-------------GGEDSSIIGRFWNGIESLFVSKSH----------KQVDPVTQDI  572

Query  398  KKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +KLLAY+ ++     WAVLSKG  ++  GHG
Sbjct  573  QKLLAYKNES----AWAVLSKGSTVITAGHG  599



>ref|XP_002526964.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35451.1| conserved hypothetical protein [Ricinus communis]
Length=805

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 49/169 (29%), Positives = 88/169 (52%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +  L+L+V        +D ++ NW +   YI LYGG D+ W+R+FTS    +A  
Sbjct  579  WKEESW-RLELLVD------GIDPIITNWIEEGRYICLYGGEDMEWIRKFTSTARAVAQA  631

Query  182  IQLKVELAYVGKN----KMIRSI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+    ++ R+I  I  E +S+   +   SIW FW R+ SM+ S+    
Sbjct  632  AGIPLGMVYVGKSNPKERVRRNIATIMVEKLSH-YWQDLTSIWYFWVRIESMWRSK----  686

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +++    E  ND ++  +  +L+++       GWA+ + G   +V   G
Sbjct  687  NQLGKTSE--NDSLMKEIMAMLSFDSSEG---GWAIFTGGTDEIVKAKG  730



>gb|KHG30244.1| Acid phosphatase 1 [Gossypium arboreum]
Length=326

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 7/139 (5%)
 Frame = +2

Query  77   MQNWFD-REDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDKEN  253
            +++W + R  ++ L+GG DI+W++EFT K+   A    + ++L +VGKNK    +   + 
Sbjct  119  LRSWIENRTTFVCLFGGGDISWIQEFTEKVKYAAYAAGVTLKLVFVGKNKAKLGLSKTDL  178

Query  254  MSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTI  433
                 +  S   WRFWT+L S+  ++I +      +     D ++H   K++ + GK   
Sbjct  179  SRDIKVIESEIRWRFWTKLESILHAKIRHGKTTTAYK---TDVVIHEALKVVGHGGKG--  233

Query  434  IEGWAVLSKGKKMVVCGHG  490
             E WAV S G   +V   G
Sbjct  234  -ESWAVFSMGPDPMVTTDG  251



>ref|XP_010040608.1| PREDICTED: uncharacterized protein LOC104429456 [Eucalyptus grandis]
Length=633

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/163 (28%), Positives = 82/163 (50%), Gaps = 23/163 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L L++G       +D  ++ W  +   I L+G  D+ W+R+FT+   + A  
Sbjct  466  WREESW-TLKLIIGGL-----IDGTIKEWVTQGSSICLFGSEDLEWIRKFTATAKQAAKT  519

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVGK+      + I ++I  E +SYC    ++  W FW RL S+  S+ H+ 
Sbjct  520  DGITLEMVYVGKSDSKERVQRIAAMITSEKLSYCWNDPTF-FWLFWARLESILHSKAHH-  577

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
                      ND ++  + K+  Y+      +GWA+L +G  M
Sbjct  578  ------GITRNDPVIDEIMKIRTYD---KTAQGWAILCQGAGM  611


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 46/160 (29%), Positives = 77/160 (48%), Gaps = 22/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L L++         D  M+ W     YI L+GG D+ W+R+ T+    +A  
Sbjct  99   WREESW-TLKLIIDGLD-----DGTMEEWVRLGSYICLFGGEDLEWIRKLTATAKEVAKT  152

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+      +   + I  E +SYC     +  W FW RL SM  S++H  
Sbjct  153  AGIVLGMVYVGKSNSKERVRRTAATITSEKLSYCWNDPRF-FWLFWARLESMLHSKVHLG  211

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
            + I       ND +L  ++ +L +   +   EGWAV  +G
Sbjct  212  NSIE------NDPLLPRIQTILNFGLSD---EGWAVFCQG  242



>ref|XP_008239602.1| PREDICTED: uncharacterized protein LOC103338194 [Prunus mume]
Length=603

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 75/149 (50%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRS---  235
            +D  + +W ++  YI LYGG+D+ W+R+FT +   +A    + +EL YVG++   R    
Sbjct  390  IDPTILDWIEKGKYICLYGGDDLEWIRKFTVRAKVVAGLAGISLELLYVGRSTATRERIR  449

Query  236  ----IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
                +I+ EN+S        S W FW+R+ SM  S+  +   +       NDEIL  +  
Sbjct  450  KVNKVIETENLSRF-WPDYTSNWFFWSRMDSMRCSKAKHHKTVK------NDEILKEVMT  502

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+G      GW ++ +G       +G
Sbjct  503  LLSYDGSGG---GWVMVWRGSNETARANG  528



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 79/148 (53%), Gaps = 16/148 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSI--  238
            +D  +  W     YI LYGG+D++W+R+FT   + LA+ +QL +E+ YVGK+   + +  
Sbjct  490  IDPSLLYWISEGKYICLYGGDDMDWIRKFTRTAYALAAALQLPLEMIYVGKSNPGKKVQE  549

Query  239  ----IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
                I  E +S   L     IW FW RL SM+ S+  +   +       ND I+H + ++
Sbjct  550  TINAIQAEKLSN-VLPDLAIIWFFWVRLESMWHSKSQHSKTVE------NDNIMHEVMRI  602

Query  407  LAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            L Y+  ++   GWAV+S+G   +  G G
Sbjct  603  LTYDSGDS---GWAVISEGTGSMAQGKG  627



>gb|KHG30263.1| hypothetical protein F383_10527 [Gossypium arboreum]
Length=633

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 80/169 (47%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ E + +L+L+V R   N      +  W  ++  +  YGG  + W+  FT+    +A  
Sbjct  408  WKAEAW-TLELLVDRLEPN------LPTWVSQQKVVCFYGGVQMEWIESFTTATKGVAKA  460

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            + + +E+ YVGKN      K I  +I ++ +S+       ++W FW RL SM  S+  + 
Sbjct  461  LDIGLEMVYVGKNNAKERVKKITGLIKEKQLSHAW--EDDNVWFFWNRLESMLYSKTQHG  518

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +       ND I   +  +LAY+G+     GWAV   G   +V  +G
Sbjct  519  KTVE------NDAIKQEVMTMLAYDGREN---GWAVFFSGSDEMVRANG  558



>gb|KHG30262.1| hypothetical protein F383_10527 [Gossypium arboreum]
Length=646

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 80/169 (47%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ E + +L+L+V R   N      +  W  ++  +  YGG  + W+  FT+    +A  
Sbjct  408  WKAEAW-TLELLVDRLEPN------LPTWVSQQKVVCFYGGVQMEWIESFTTATKGVAKA  460

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            + + +E+ YVGKN      K I  +I ++ +S+       ++W FW RL SM  S+  + 
Sbjct  461  LDIGLEMVYVGKNNAKERVKKITGLIKEKQLSHAW--EDDNVWFFWNRLESMLYSKTQHG  518

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +       ND I   +  +LAY+G+     GWAV   G   +V  +G
Sbjct  519  KTVE------NDAIKQEVMTMLAYDGREN---GWAVFFSGSDEMVRANG  558



>gb|KEH35012.1| sieve element occlusion protein [Medicago truncatula]
Length=706

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 80/168 (48%), Gaps = 21/168 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  + +W      I LYGG D+ W+  FT     +A  
Sbjct  480  WKQEIW-SLELLVD------GIDPALLDWMTEGKIICLYGGEDLEWIETFTKTAMNVART  532

Query  182  IQLKVELAYVGKN----KMIRSIIDKENMSYC-ALKSSYSIWRFWTRLRSMFLSRIHYLD  346
               ++E+ YVGK+    +M R I    N  +     +  SIW FW RL SM  S++ +  
Sbjct  533  SNFELEMVYVGKSNAKERMQRMITTFNNKKFSYFFPNVTSIWFFWARLESMLYSKLQHGR  592

Query  347  EINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +       ND+I+  +  +L+++G +    GWA+  +G   +    G
Sbjct  593  TVE------NDKIMSEVMTVLSFDGSD---RGWAIFCRGPSEMARAKG  631



>gb|KDP46376.1| hypothetical protein JCGZ_10216 [Jatropha curcas]
Length=1116

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 82/162 (51%), Gaps = 22/162 (14%)
 Frame = +2

Query  23    SLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVEL  202
             SLDL+V        L+  ++ W + +  + LYGG DINW++ FT     ++    + +E+
Sbjct  894   SLDLIVD------ELNPRIRKWVENDYIVCLYGGGDINWIKNFTRTAKEVSKSATIHLEM  947

Query  203   AYVGKNKMI----RSI--IDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFD  364
              YVGK+ +     R+I   ++E +S+        IW FW R++SM+LSR   +  I    
Sbjct  948   LYVGKSNLNHRGWRNIESFEEEELSHVWRDRLGLIW-FWYRIKSMWLSRYQIVKTIE---  1003

Query  365   EECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
                 DEI+  L  LL+++       GWA+++KG K  V    
Sbjct  1004  ---GDEIMQELTTLLSFDSSEC---GWAIMNKGSKPGVIAKA  1039



>ref|XP_008224078.1| PREDICTED: uncharacterized protein LOC103323835 [Prunus mume]
Length=681

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 73/143 (51%), Gaps = 32/143 (22%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRSII  241
            +Q W   E +IF YGG D +W+++FT K   +A+      +++ +EL  VGK     S  
Sbjct  482  IQTWIKEEKFIFFYGGKDNDWIQQFTKKATIIANDPLIKDLKINIELFCVGK-----SPK  536

Query  242  DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
              E++          + RFW  + S+F + ++          +  D +   ++KLL+Y+ 
Sbjct  537  GGEDLGV--------LGRFWNGIESLFFTNVN----------KQTDTVTKEIQKLLSYKN  578

Query  422  KNTIIEGWAVLSKGKKMVVCGHG  490
            ++    GWAVLSKG  +VV GHG
Sbjct  579  ES----GWAVLSKGSTVVVSGHG  597



>ref|XP_007226977.1| hypothetical protein PRUPE_ppa002363mg [Prunus persica]
 gb|EMJ28176.1| hypothetical protein PRUPE_ppa002363mg [Prunus persica]
Length=681

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 73/143 (51%), Gaps = 32/143 (22%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRSII  241
            +Q W   E +IF YGG D +W+++FT K   +A+      +++ +EL  VGK     S  
Sbjct  482  IQTWIKEEKFIFFYGGKDNDWIQQFTKKATIIANDPSIKDLKINIELFCVGK-----SPK  536

Query  242  DKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
              E++          + RFW  + S+F + ++          +  D +   ++KLL+Y+ 
Sbjct  537  GGEDLGV--------LGRFWNGIESLFFTNVN----------KQTDTVTKEIQKLLSYKN  578

Query  422  KNTIIEGWAVLSKGKKMVVCGHG  490
            ++    GWAVLSKG  +VV GHG
Sbjct  579  ES----GWAVLSKGSTVVVSGHG  597



>ref|XP_007137985.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09979.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=584

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 84/170 (49%), Gaps = 25/170 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  +  W      + LYGG D+ W+ +FT+    +A  
Sbjct  358  WKQEIW-SLELLVD------GIDPTVLEWMADGKLVCLYGGEDLEWIEKFTATALSVAKA  410

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             + ++E+ YVGK+       KMI++  +    SY    +  SIW FWTRL SM  S++ +
Sbjct  411  GKFQLEMVYVGKSNAKERMQKMIKT-FNTRKFSYF-WPNVTSIWFFWTRLESMLYSKLQH  468

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               +       NDE++  +  +L+++G +    GWA+   G   +    G
Sbjct  469  GRTVE------NDEVMSEVMTVLSFDGSD---RGWAIFCNGATEMARAKG  509



>gb|KHN07967.1| hypothetical protein glysoja_039841 [Glycine soja]
Length=550

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  +  W      I LYGG D+ W+ +FT+    +A  
Sbjct  324  WKQEIW-SLELLVD------GIDPTVLEWMTEGKLICLYGGEDLEWIEKFTATAISVAKA  376

Query  182  IQLKVELAYVGKNKMIRSIIDKENMSYCALKSSY------SIWRFWTRLRSMFLSRIHYL  343
             + ++E+AY GK+   +  + K   ++   K SY      SIW FWTRL SM  S++ + 
Sbjct  377  GKFELEMAYAGKSNA-KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLLHG  435

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +        DEI+  +  +L+++G +    GWA+  +G   +    G
Sbjct  436  RTVE------KDEIMSEVMTVLSFDGSD---RGWAIFCRGATEMARAKG  475



>ref|NP_001241461.1| uncharacterized protein LOC100789215 [Glycine max]
 gb|ADN32786.1| sieve element occlusion d [Glycine max]
Length=705

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  +  W      I LYGG D+ W+ +FT+    +A  
Sbjct  479  WKQEIW-SLELLVD------GIDPTVLEWMTEGKLICLYGGEDLEWIEKFTATAISVAKA  531

Query  182  IQLKVELAYVGKNKMIRSIIDKENMSYCALKSSY------SIWRFWTRLRSMFLSRIHYL  343
             + ++E+AY GK+   +  + K   ++   K SY      SIW FWTRL SM  S++ + 
Sbjct  532  GKFELEMAYAGKSNA-KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLLHG  590

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +        DEI+  +  +L+++G +    GWA+  +G   +    G
Sbjct  591  RTVE------KDEIMSEVMTVLSFDGSD---RGWAIFCRGATEMARAKG  630



>ref|XP_004501847.1| PREDICTED: uncharacterized protein LOC101501922 [Cicer arietinum]
Length=705

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 49/160 (31%), Positives = 78/160 (49%), Gaps = 23/160 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  + +W      I LYGG D+ W+  FT     LA  
Sbjct  479  WKQEIW-SLELLVD------GIDPTVLDWMTEGKIICLYGGEDLEWIETFTQTAMNLART  531

Query  182  IQLKVELAYVGKN----KMIR--SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
                +E+ YVGK+    +M R  S  + +  SY    +  SIW FW RL SM  S++   
Sbjct  532  GNFDLEMVYVGKSNAKERMQRMISTFNTKKFSY-FWPNVTSIWFFWARLESMLYSKLQQG  590

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
              +       ND+I+  +  +L+++G +    GWA+  +G
Sbjct  591  KTVE------NDKIMSEVMTVLSFDGSD---RGWAIFCRG  621



>ref|XP_007037798.1| Sieve element occlusion e, putative [Theobroma cacao]
 gb|EOY22299.1| Sieve element occlusion e, putative [Theobroma cacao]
Length=705

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 83/171 (49%), Gaps = 28/171 (16%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ + + +++L+V     N+H       W  ++  I LYGG +++W+  FTS+  ++A  
Sbjct  480  WKTQAW-TIELLVDGLEANLH------TWMKQQKVICLYGGEELDWIESFTSETKKVAQA  532

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY-  340
            + + +E+ YVGKN      + I   I+++ +S+       +IW FW RL SM  S+  + 
Sbjct  533  LGIGLEMVYVGKNNARERVRKITGFINEKQLSHAWQDG--TIWFFWNRLESMLFSKTRHG  590

Query  341  -LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              +E +   +E        +  LL Y+G      GWAV   G   +V   G
Sbjct  591  KTNETDVIKQE--------VMTLLGYDGSE---HGWAVFFLGSIEMVRAKG  630



>ref|XP_007137986.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09980.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=747

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 84/170 (49%), Gaps = 25/170 (15%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+QE + SL+L+V        +D  +  W      + LYGG D+ W+ +FT+    +A  
Sbjct  521  WKQEIW-SLELLVD------GIDPTVLEWMADGKLVCLYGGEDLEWIEKFTATALSVAKA  573

Query  182  IQLKVELAYVGKN-------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY  340
             + ++E+ YVGK+       KMI++  +    SY    +  SIW FWTRL SM  S++ +
Sbjct  574  GKFQLEMVYVGKSNAKERMQKMIKT-FNTRKFSYF-WPNVTSIWFFWTRLESMLYSKLQH  631

Query  341  LDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
               +       NDE++  +  +L+++G +    GWA+   G   +    G
Sbjct  632  GRTVE------NDEVMSEVMTVLSFDGSD---RGWAIFCNGATEMARAKG  672



>ref|XP_010250966.1| PREDICTED: uncharacterized protein LOC104593030 [Nelumbo nucifera]
Length=747

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 45/172 (26%), Positives = 82/172 (48%), Gaps = 29/172 (17%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ +  LD VV        +D  + NW     Y+ LYGG D+ W+ +F +    +A +
Sbjct  502  WKEQTW-RLDFVVD------GIDPTILNWVAEGRYVCLYGGEDLEWIEKFVTAARYVAQE  554

Query  182  IQLKVELAYVGKNK------MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHY-  340
              + +E  YVGK+K       I   I  +N+     + +  IW FW RL+SM+ S+    
Sbjct  555  ENIPLEFVYVGKSKPRLPLSRIIDFIKAKNLGNYWTERTL-IWFFWARLQSMYYSKTQLP  613

Query  341  ----LDEINYFDEEC-------NDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
                 D  N   +         +D ++H +  +L+++  +   +GWA++S+G
Sbjct  614  SKTTTDNDNKIQQHLPSSKTSESDHVMHEIMNMLSFDSSD---QGWAIISRG  662



>ref|XP_008224076.1| PREDICTED: uncharacterized protein LOC103323832 [Prunus mume]
Length=685

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 47/159 (30%), Positives = 78/159 (49%), Gaps = 34/159 (21%)
 Frame = +2

Query  29   DLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLK  193
            D  VG   +++H    + NW   E YIF YGG D +W+++FT K   LA+     + ++ 
Sbjct  473  DRWVGNVVQDIHPS--LPNWIKEEKYIFFYGGKDNDWIQQFTKKASALANDPVFKEAKIH  530

Query  194  VELAYVGKNKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEEC  373
            +EL  VGK        D   +          +  FW+ + S+F ++ H          + 
Sbjct  531  IELFCVGKGSKGE---DDHGI----------LGHFWSGIESLFFTKGH----------KQ  567

Query  374  NDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             D +   ++KLL+Y+ ++    GWAVLSKG  +++ GHG
Sbjct  568  VDPVTQEIQKLLSYKNES----GWAVLSKGSSVLLTGHG  602



>gb|KHG00716.1| hypothetical protein F383_23634 [Gossypium arboreum]
Length=706

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 80/169 (47%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ E + +L+L+V R   N      +  W +++  +  YGG  + W+  FT+    +A  
Sbjct  481  WKAEAW-TLELLVDRLEPN------LPTWVNQQKVVCFYGGVQMEWIESFTTVTKGVAKA  533

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            + + +E+ YVGKN      K I  +I ++ +S+       ++W FW RL SM  S+  + 
Sbjct  534  LDIGLEMVYVGKNNAKERVKKITGLIKEKQLSHAW--EDENVWFFWNRLESMLYSKTQHG  591

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              I       ND I   +  +LAY+G      GWAV   G   +V  +G
Sbjct  592  KTIE------NDVIKQEVMTMLAYDGSEN---GWAVFFTGSDEMVRANG  631



>gb|KHG00715.1| hypothetical protein F383_23634 [Gossypium arboreum]
Length=715

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 80/169 (47%), Gaps = 24/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+ E + +L+L+V R   N      +  W +++  +  YGG  + W+  FT+    +A  
Sbjct  481  WKAEAW-TLELLVDRLEPN------LPTWVNQQKVVCFYGGVQMEWIESFTTVTKGVAKA  533

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
            + + +E+ YVGKN      K I  +I ++ +S+       ++W FW RL SM  S+  + 
Sbjct  534  LDIGLEMVYVGKNNAKERVKKITGLIKEKQLSHAW--EDENVWFFWNRLESMLYSKTQHG  591

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
              I       ND I   +  +LAY+G      GWAV   G   +V  +G
Sbjct  592  KTIE------NDVIKQEVMTMLAYDGSEN---GWAVFFTGSDEMVRANG  631



>ref|XP_004299166.1| PREDICTED: uncharacterized protein LOC101294943 [Fragaria vesca 
subsp. vesca]
Length=703

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 17/149 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W D+  YI L+G  DI W+R FT +   +A +  + +EL Y G++        
Sbjct  490  IDPEILKWIDQGKYICLFGSEDIEWIRRFTVRAKDVAKRAGIPLELVYAGRSTASKEKLW  549

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             +  II+ EN+S        S W FW+RL SM  S+  +   I+      +D IL  +  
Sbjct  550  KLNKIIEAENLSR-TWSDYTSTWFFWSRLDSMRCSKAKHHKTID------DDTILREVMS  602

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            LL+Y+G +    GW +L  G    V  +G
Sbjct  603  LLSYDGSD---HGWVMLWLGSADTVRANG  628



>emb|CDX77078.1| BnaC04g38730D [Brassica napus]
Length=822

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 9/110 (8%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMIRSIID---KENMSYC  265
            YI +YGG D+ W+R FTS   R+A    +++E+ YVGK    K I  II+   ++N+S+ 
Sbjct  615  YICIYGGEDMQWIRNFTSLWRRVAKAANIQLEMVYVGKRNPKKGIEPIINTIREDNLSH-  673

Query  266  ALKSSYSIWRFWTRLRSMFLSRIHYLDE--INYFDEECNDEILHGLKKLL  409
             L   + IW FWTR+ SM+ S+   L       F EE  D +L  +  LL
Sbjct  674  TLPDLFQIWFFWTRIESMWESKQRMLKAHGTKGFKEEEKDLVLQEIVALL  723



>ref|XP_011071161.1| PREDICTED: uncharacterized protein LOC105156657 [Sesamum indicum]
Length=768

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 43/150 (29%), Positives = 72/150 (48%), Gaps = 17/150 (11%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  + +W      I +YGG+DI W+R+FT      A+ + + +E+ YVGK       ++
Sbjct  552  IDPRIPDWIKENYVICIYGGDDIEWIRKFTLAARAAATSLHIHLEMLYVGKRNPKEKVRL  611

Query  227  IRSIIDKENMSYCALKSSY--SIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLK  400
               +IDKE +S     + Y   +W FW RL SM+ S+      +       ND I+  + 
Sbjct  612  CHEVIDKEKLSNVFSVTEYYDYVWYFWVRLWSMWNSKKQMGMTVE------NDRIMQEIM  665

Query  401  KLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             +LA +      +GWAV S+    +   +G
Sbjct  666  DVLALDSSE---KGWAVFSRANFEITKSNG  692



>ref|XP_002526966.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35453.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 49/169 (29%), Positives = 84/169 (50%), Gaps = 23/169 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E +    LV G       +D ++ NW D   Y+ LYGG D+ W+R FT+    +A  
Sbjct  566  WKEESWRLEILVDG-------IDPIITNWIDEGRYVCLYGGEDMEWIRNFTNTARAVAQA  618

Query  182  IQLKVELAYVGKN---KMIR---SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+   + +R   S I  E +S+   +   SIW FW R+ SM+ S+    
Sbjct  619  SGIPLGMVYVGKSNPKERVRRNVSTIMVEKLSH-YWQDLTSIWYFWVRIESMWRSK----  673

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +++    E  ND ++  +  +L+++       GWA+ S+    VV   G
Sbjct  674  NQLGKNSE--NDLVMKEIMSMLSFDSSEG---GWAIFSRMADEVVKAKG  717



>gb|KHN13158.1| hypothetical protein glysoja_040438 [Glycine soja]
Length=669

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 40/131 (31%), Positives = 70/131 (53%), Gaps = 27/131 (21%)
 Frame = +2

Query  98   EDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDKENMSYCALKS  277
            + YIF YGGND +W+++FT  +  LA+   +K       K  +    +DKE+ S      
Sbjct  482  QKYIFFYGGNDKDWIQQFTKYVTALANDAAIK-----EAKISIELFCVDKEDKSL-----  531

Query  278  SYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLS  457
               + RFW+ + S+F++++H          +  D +   ++K+L+Y+ +     GW++LS
Sbjct  532  ---VRRFWSGIESLFVTKVH----------KQADAVTQEVQKMLSYKNET----GWSLLS  574

Query  458  KGKKMVVCGHG  490
            KG  +VV GHG
Sbjct  575  KGPSVVVSGHG  585



>ref|XP_007221903.1| hypothetical protein PRUPE_ppa015869mg [Prunus persica]
 gb|EMJ23102.1| hypothetical protein PRUPE_ppa015869mg [Prunus persica]
Length=647

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/136 (34%), Positives = 73/136 (54%), Gaps = 32/136 (24%)
 Frame = +2

Query  98   EDYIFLYGGNDINWVREFTSKLHRLASKIQLK-----VELAYVGKNKMIRSIIDKENMSY  262
            ++YIF YGG D +W+++F  K   LA+ + LK     ++L  VGK+        K    +
Sbjct  458  DEYIFFYGGKDKDWMKQFKEKATALANDLILKEAKINIKLFCVGKDS-------KGEDDF  510

Query  263  CALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEG  442
              L      WRFWT + S+F ++I         +++ +   L  ++KLL+Y+ ++    G
Sbjct  511  GIL------WRFWTGIESLFHTKI---------NKQADSATLE-IQKLLSYKNES----G  550

Query  443  WAVLSKGKKMVVCGHG  490
            WAVLSKG  +VV GHG
Sbjct  551  WAVLSKGSSLVVAGHG  566



>ref|NP_001241224.1| uncharacterized protein LOC100794293 [Glycine max]
 gb|ADN32801.1| sieve element occlusion s [Glycine max]
Length=669

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 40/131 (31%), Positives = 70/131 (53%), Gaps = 27/131 (21%)
 Frame = +2

Query  98   EDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDKENMSYCALKS  277
            + YIF YGGND +W+++FT  +  LA+   +K       K  +    +DKE+ S      
Sbjct  482  QKYIFFYGGNDKDWIQQFTKYVTALANDAAIK-----EAKISIELFCVDKEDKSL-----  531

Query  278  SYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLS  457
               + RFW+ + S+F++++H          +  D +   ++K+L+Y+ +     GW++LS
Sbjct  532  ---VRRFWSGIESLFVTKVH----------KQADAVTQEVQKMLSYKNET----GWSLLS  574

Query  458  KGKKMVVCGHG  490
            KG  +VV GHG
Sbjct  575  KGPSVVVSGHG  585



>ref|XP_007225119.1| hypothetical protein PRUPE_ppa002624mg [Prunus persica]
 gb|EMJ26318.1| hypothetical protein PRUPE_ppa002624mg [Prunus persica]
Length=651

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 47/159 (30%), Positives = 77/159 (48%), Gaps = 34/159 (21%)
 Frame = +2

Query  29   DLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLK  193
            D  VG    ++H    + NW   E YIF YGG D +W+++FT K   LA+     + ++ 
Sbjct  439  DRWVGNVVHDIHPS--LPNWIKEEKYIFFYGGKDNDWIQQFTKKASALANDPVFKEAKIH  496

Query  194  VELAYVGKNKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEEC  373
            +EL  VGK        D   +          +  FW+ + S+F ++ H          + 
Sbjct  497  IELFCVGKGSKGE---DDHGI----------LGHFWSGIESLFFTKGH----------KQ  533

Query  374  NDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             D +   ++KLL+Y+ ++    GWAVLSKG  +++ GHG
Sbjct  534  VDPVTQEIQKLLSYKNES----GWAVLSKGSSVLLTGHG  568



>ref|XP_010045508.1| PREDICTED: uncharacterized protein LOC104434233 [Eucalyptus grandis]
Length=1094

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 81/163 (50%), Gaps = 23/163 (14%)
 Frame = +2

Query  2     WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
             W++E + +L L++G        D  ++ W  +   I L+G  D+ W+R+FT+   + A  
Sbjct  927   WREESW-TLKLIIGGLD-----DGTIKEWVTQGSSICLFGSEDLEWIRKFTATAKQAAKT  980

Query  182   IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
               + +E+ YVGK+      + I ++I  E +SYC    ++    FW RL S+  S+ HY 
Sbjct  981   DGITLEMVYVGKSDSKERVQSIAAMITSEKLSYCWNDPTF-FSLFWARLESILHSKAHY-  1038

Query  344   DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKGKKM  472
                       ND ++  ++K+  Y+      +GWA+L +G  M
Sbjct  1039  ------GITRNDPVIDEIRKICTYDRTT---QGWAILCQGAGM  1072


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 16/138 (12%)
 Frame = +2

Query  68   DYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMI  229
            D  M  W  R  YI L+GG D+  +R+ T+    +A    + + + YVGK+      +  
Sbjct  229  DGTMVEWVRRGSYICLFGGEDLECIRKLTATAKEVAKIAGIMLGMVYVGKSNSKEGVRRT  288

Query  230  RSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLL  409
             + I  E +SYC     +  W FW RL SM  S++H  + I       ND +L  ++ +L
Sbjct  289  AATITSEKLSYCWNDPRF-FWLFWARLESMLHSKVHLGNSIE------NDPLLPWIQTIL  341

Query  410  AYEGKNTIIEGWAVLSKG  463
             ++  +   EGWAV  +G
Sbjct  342  NFDRSD---EGWAVFCQG  356


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 75/153 (49%), Gaps = 19/153 (12%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W++E + +L L+VG        D  ++ W  +  YI L+GG D+ W+R+ T+    +A  
Sbjct  580  WREERW-TLKLIVGGLD-----DGTIKEWVRQGSYICLFGGEDLEWIRKLTATTKEVAKI  633

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + + + YVGK+      +   + I  E +S+C        W FW RL SMF S++H  
Sbjct  634  AGIMLGMVYVGKSNSKEGLQRTAATIISEELSHC-WNDPIFFWLFWARLESMFHSKMHLR  692

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEG  442
              I       ND +L G++++L     N ++E 
Sbjct  693  KSIE------NDPLLQGIQEILRDIPGNNVLES  719



>emb|CAN65453.1| hypothetical protein VITISV_003897 [Vitis vinifera]
Length=689

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 76/149 (51%), Gaps = 18/149 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W      I LYGG+DI W++ FT+   ++A    + +E+ YVGK+        
Sbjct  471  IDPRISEWIAAGKIICLYGGDDIEWIQRFTTIAKKVAESAGISLEMVYVGKSNPKELVYT  530

Query  227  -IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             I++II+ + +S+  LK   SIW FW R+ SM  S++     +        D  +  + K
Sbjct  531  NIKTIIE-DKLSH-HLKGLTSIWYFWVRIESMLYSKMRLGQTVE------KDPTMQEILK  582

Query  404  LLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +L+++  +   EG A+LSKG + +    G
Sbjct  583  MLSFDNSH---EGXALLSKGSEEITKAKG  608



>gb|KDP46382.1| hypothetical protein JCGZ_10222 [Jatropha curcas]
Length=714

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 82/159 (52%), Gaps = 23/159 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W Q     LDL+         +D  + +W + E YI +YGG++++W+++FT K   +A  
Sbjct  457  WDQNTSWKLDLLFD------GIDKTVMDWGEEEKYICIYGGDELDWIQKFTKKARDVADD  510

Query  182  IQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E+ YVG+       K I   I+ E +S  +L+    IW FW R+ SM+ S+    
Sbjct  511  ANIPLEMVYVGRRNSKERVKKIIETIESEKLSR-SLQDQRLIWYFWVRIASMWYSK----  565

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSK  460
            +++    E  ND  +  + K+L ++ ++    GWA+ ++
Sbjct  566  NQLKKTTE--NDPTMKEIMKMLIFDSES----GWAIFTQ  598



>ref|NP_001280876.1| uncharacterized LOC103453287 [Malus domestica]
 gb|ADN32816.1| sieve element occlusion b [Malus domestica]
Length=682

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 74/145 (51%), Gaps = 33/145 (23%)
 Frame = +2

Query  74   VMQNWFDRED-YIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRS  235
            V Q+   +ED YIF YGG D  W++EFT K   LA+     + ++ +EL  VGK      
Sbjct  482  VSQSVTIKEDKYIFFYGGKDNGWIQEFTKKATALANDPIFKEAKIHIELFCVGKGSKGE-  540

Query  236  IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAY  415
              D   +          + +FWT + S+F +++H             D++   ++KLL+Y
Sbjct  541  --DDHGI----------LGKFWTGIESLFFTKVH----------RPADQVGQEVQKLLSY  578

Query  416  EGKNTIIEGWAVLSKGKKMVVCGHG  490
            + ++    GWAVLSKG  +V+ GHG
Sbjct  579  KNES----GWAVLSKGHSVVLTGHG  599



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 70/135 (52%), Gaps = 16/135 (12%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN---KMIR---SIIDKENMSYC  265
            YI +YGG + +W+  F +    +A    +++E+ YVGK+   + +R   + ID  ++ YC
Sbjct  494  YICMYGGVNSDWILNFNTAAREVAKAAGIQLEMVYVGKSNAKEQVRKTITFIDSRSLGYC  553

Query  266  ALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTIIEGW  445
                + +IW FWTR+ SM  S+  +   I       ND I  G+  +L+++G +   +GW
Sbjct  554  WTDPT-NIWFFWTRMESMLYSKTQHGKTIE------NDSIFAGVLTMLSFDGSD---QGW  603

Query  446  AVLSKGKKMVVCGHG  490
            +V+  G   +    G
Sbjct  604  SVICHGPTEMAKAKG  618



>ref|XP_009346429.1| PREDICTED: uncharacterized protein LOC103938158 [Pyrus x bretschneideri]
Length=682

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 74/145 (51%), Gaps = 33/145 (23%)
 Frame = +2

Query  74   VMQNWFDRED-YIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVELAYVGKNKMIRS  235
            V Q+   +ED YIF YGG D  W++EFT K    A+     + ++ +EL  VGK      
Sbjct  482  VSQSVTIKEDKYIFFYGGKDNGWIQEFTKKATAFANDPIFKEAKIHIELFCVGKGSKGE-  540

Query  236  IIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAY  415
              D   +          + +FWT + S+F ++IH          +  D++   ++KLL+Y
Sbjct  541  --DDHGI----------LGKFWTGIESLFFTKIH----------KPADQVGQEIQKLLSY  578

Query  416  EGKNTIIEGWAVLSKGKKMVVCGHG  490
            + ++    GWAVLSKG  +V+ GHG
Sbjct  579  KNES----GWAVLSKGHSVVLTGHG  599



>gb|EYU17767.1| hypothetical protein MIMGU_mgv1a002070mg [Erythranthe guttata]
Length=719

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 65/139 (47%), Gaps = 9/139 (6%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KM  226
            +D  +  W +    I LYGG+ I W+R+F       AS   + +E+ Y+GKN      K 
Sbjct  497  IDKSILTWINEGKVICLYGGDKIEWIRDFIRTARNAASSAGIGLEMVYIGKNATKERMKR  556

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            +   +    +S+C    + SIW FWTR+ SM  S+  +       D+   D I   +  +
Sbjct  557  LNETVTSNGLSHCWTDPT-SIWYFWTRIESMMHSKYSHNKGAKIDDDGDVDHIRREVLTM  615

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L + G      GWA+ S+G
Sbjct  616  LTFGGDGD--RGWAMFSQG  632



>ref|XP_008374367.1| PREDICTED: uncharacterized protein LOC103437653 [Malus domestica]
Length=712

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 76/140 (54%), Gaps = 17/140 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN-------K  223
            +D  +    ++  ++ LYG +D++W+R+FT+K   +A    + ++L YVG++       +
Sbjct  499  IDQSILEGIEKGTFVCLYGSDDLDWIRKFTNKAKNVAKLAGISLDLVYVGRSTATKERIR  558

Query  224  MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKK  403
             +   I+ EN+S C  + + S W FW+R+ SM  S+  +   +       +D IL  +  
Sbjct  559  KVNKTIETENLSRCWPEYT-STWFFWSRMDSMRCSKAKHHKTLE------SDNILKEVMT  611

Query  404  LLAYEGKNTIIEGWAVLSKG  463
            LL+Y+G +   +GW ++ +G
Sbjct  612  LLSYDGSD---QGWVMVWRG  628



>gb|KDP47163.1| hypothetical protein JCGZ_00054 [Jatropha curcas]
Length=748

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 69/139 (50%), Gaps = 16/139 (12%)
 Frame = +2

Query  65   LDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKM------  226
            +D  +  W     YI LYGG DI W+R FT+    +A +  +++E+ YVGK  +      
Sbjct  534  IDANIPAWIQEGKYICLYGGEDIEWIRRFTTTAAAVAIEANIQLEMLYVGKINLREKVRK  593

Query  227  IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKL  406
            I +II  E +S+  L     +  FW RL SM+ S++     +        D I+  +  +
Sbjct  594  INTIIQIEKLSH-VLSDLALMQFFWFRLESMYYSKVKNNRTVE------KDSIMQEIITM  646

Query  407  LAYEGKNTIIEGWAVLSKG  463
            L ++      +GWAV+SKG
Sbjct  647  LTFDATE---QGWAVVSKG  662



>ref|XP_006440670.1| hypothetical protein CICLE_v10023346mg [Citrus clementina]
 gb|ESR53910.1| hypothetical protein CICLE_v10023346mg [Citrus clementina]
Length=757

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 74/146 (51%), Gaps = 20/146 (14%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++P+ +L+L+VG       +D  +  W   E +I LYGGND  W+R+F +    +ASK
Sbjct  461  WKEKPW-TLELLVG------DIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASK  513

Query  182  IQLKVELAYVGKNKM------IRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
             Q+   +AYVGK         I S I K   S+  + ++  +W FW RL  M   ++ + 
Sbjct  514  AQINWGMAYVGKKNAKKRLEEISSSITKTESSHIVIDAT-KMWFFWARLERMLYWKLQHG  572

Query  344  DEINYFDEECNDEILHGLKKLLAYEG  421
              +        D I+  +  LL+++G
Sbjct  573  MSVE------KDNIMREMMTLLSFDG  592



>gb|EYU22546.1| hypothetical protein MIMGU_mgv1a001374mg [Erythranthe guttata]
Length=831

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 75/152 (49%), Gaps = 17/152 (11%)
 Frame = +2

Query  62   HLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMIR  232
            ++D  +  W +    I LYGG DI W+R FT K   +A  + + +E+ YVGK    + +R
Sbjct  612  NIDARIPLWVEENKVICLYGGEDIQWIRNFTRKAREVAEALHVPLEMLYVGKRNPKEKVR  671

Query  233  S---IIDKENMS--YCALKSSYS-IWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHG  394
            S    I KE +S  + A    Y  +W FW RL  ++ SR     +I    E  ND I+  
Sbjct  672  SCNETIAKERLSNVFAAGDDYYDYVWFFWVRLWGLWNSR----KKIGMTVE--NDVIMRE  725

Query  395  LKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +  +LAY+  N   +GWA  S   + +  G+ 
Sbjct  726  ILDVLAYDSSNH--QGWAAFSWSNRDITKGNA  755



>gb|KHG01411.1| hypothetical protein F383_21965 [Gossypium arboreum]
Length=741

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 43/114 (38%), Positives = 65/114 (57%), Gaps = 21/114 (18%)
 Frame = +2

Query  170  LASKIQLKVELAYVGKN------KMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSR  331
            +AS   + +E+ YVGK+      K + +II +  +S+C  +    +W FWTRL SM  S+
Sbjct  554  VASAFGIPLEMVYVGKSNKREQVKKVAAIIKERKLSHC-WEDPAMVWFFWTRLESMMFSK  612

Query  332  IHYLDEINYFDEECNDEILHGLKKLLAY--EGKNTIIEGWAVLSKGKKMVVCGH  487
            I    ++   D+   D I+ G+KKLL+Y  EG      GWAVLS+G  ++V GH
Sbjct  613  I----QLGRADDL--DPIVQGIKKLLSYGREG------GWAVLSEGSNILVNGH  654



>ref|XP_011097560.1| PREDICTED: uncharacterized protein LOC105176450 [Sesamum indicum]
Length=704

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (51%), Gaps = 16/146 (11%)
 Frame = +2

Query  77   MQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK--------NKMIR  232
            ++NW     Y+ LYGG+D+ W+R F S   ++     + +E+ Y G+        N +I 
Sbjct  489  IENWVKEGKYVILYGGDDVEWIRNFVSSTRQVKEAGHIPLEMLYAGRSNQKEQDMNNLIN  548

Query  233  SIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLA  412
            SI++++        ++ S+  FW R+  M  SRI         D+   D +L  + KLL+
Sbjct  549  SIVNEKLGEILGDVNTISL--FWNRIEHMKRSRIRLGSGKVGEDQ---DPLLQDITKLLS  603

Query  413  YEGKNTIIEGWAVLSKGKKMVVCGHG  490
            Y   + I+  WA L KG ++V+ G+G
Sbjct  604  Y---DQIMGRWASLFKGNELVLTGYG  626



>ref|XP_010248720.1| PREDICTED: uncharacterized protein LOC104591548 [Nelumbo nucifera]
Length=700

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/160 (27%), Positives = 81/160 (51%), Gaps = 21/160 (13%)
 Frame = +2

Query  2    WQQEPYCSLDLVVGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASK  181
            W+++ +  LD +V        +D  + NW   E YI LYGG+++ W+  F + L  +A +
Sbjct  472  WKEQTW-KLDFLVD------GIDQQILNWIVEERYICLYGGDNLEWMEAFVNALRAVALE  524

Query  182  IQLKVELAYVGKNK------MIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYL  343
              + +E  YVGK+K       I  +I  + + +  L     IW FW RL+ M+ S++   
Sbjct  525  DNISIEFMYVGKSKPKEPQAKINGVIMSKKLGH-FLSERALIWFFWDRLQRMYYSKMKQP  583

Query  344  DEINYFDEECNDEILHGLKKLLAYEGKNTIIEGWAVLSKG  463
             +    +   +D I+  +  +L+++  +   + WAV+S+G
Sbjct  584  RK----NAGEHDHIMQEVMTMLSFDSSD---QEWAVISRG  616



>ref|XP_007226973.1| hypothetical protein PRUPE_ppa002391mg [Prunus persica]
 gb|EMJ28172.1| hypothetical protein PRUPE_ppa002391mg [Prunus persica]
Length=678

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 73/156 (47%), Gaps = 34/156 (22%)
 Frame = +2

Query  38   VGRYGRNVHLDYVMQNWFDREDYIFLYGGNDINWVREFTSKLHRLAS-----KIQLKVEL  202
            VG   + +H    + N    + Y+F YGG D  W+ +FT K     +     + ++ +EL
Sbjct  469  VGNVVKEIHP--TLPNMMKDDKYVFFYGGKDNEWINQFTKKATAFVNDPIFKEAKIHIEL  526

Query  203  AYVGKNKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDE  382
              VGK        D   +          + RFWT + S+F ++IH          +  D 
Sbjct  527  FCVGKGSKGE---DDHGI----------LGRFWTGIESLFHTKIH----------KEPDS  563

Query  383  ILHGLKKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
            +   ++KLL+Y+ ++    GWAVLSKG  +VV GHG
Sbjct  564  VSQEIQKLLSYKNES----GWAVLSKGHSLVVTGHG  595



>gb|KHN01070.1| hypothetical protein glysoja_000738 [Glycine soja]
Length=631

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 36/144 (25%)
 Frame = +2

Query  74   VMQNWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKNKMIRSIIDKEN  253
            ++  W   + YIFLYGG D  W+++FT  +  LAS                  + I + N
Sbjct  438  IINTWIKEKKYIFLYGGKDKEWIQQFTKNVSALASD-----------------AAITEAN  480

Query  254  MS---YCALKSSYSIW-RFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEG  421
            +S    C  K   S+  RFW  + S+F++++H          +  D +   ++K+L+Y+ 
Sbjct  481  ISIEWLCVEKEDRSVMRRFWGGIESLFVTKVH----------KAVDAVTLEVQKMLSYKN  530

Query  422  KNTIIEGWAVL-SKGKKMVVCGHG  490
            +     GW++L S+G  +VVCGHG
Sbjct  531  E----AGWSLLISEGSSVVVCGHG  550



>ref|XP_004304991.1| PREDICTED: uncharacterized protein LOC101294285 [Fragaria vesca 
subsp. vesca]
Length=670

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 33/138 (24%)
 Frame = +2

Query  95   RED-YIFLYGGNDINWVREFTSKLHRLASKIQLK-----VELAYVGKNKMIRSIIDKENM  256
            RE+ YIF YGG D  W+++FT K   LA+   LK     +EL  VGK        D E  
Sbjct  477  RENKYIFFYGGKDNEWIQQFTKKATALANDPILKEAKIYIELVCVGK--------DSEGE  528

Query  257  SYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGLKKLLAYEGKNTII  436
                +     + RFWT + S+FL+++H      +F     D I   ++KL++Y+ ++   
Sbjct  529  DDHGI-----LGRFWTGIESLFLTKVH-----KHF-----DPIGQEIQKLVSYKNES---  570

Query  437  EGWAVLSKGKKMVVCGHG  490
             GW +++KG  ++V GHG
Sbjct  571  -GWVLVTKGSTLLVTGHG  587



>ref|XP_011100417.1| PREDICTED: uncharacterized protein LOC105178604 [Sesamum indicum]
Length=665

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 78/151 (52%), Gaps = 15/151 (10%)
 Frame = +2

Query  47   YGRNVHLDYVMQ---NWFDREDYIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK  217
            +G  + L+YV+    +W     +I LYGG DI W+R+FTS L  ++   Q+++++ ++ +
Sbjct  452  WGVELLLNYVVPSAIDWVKEGKHICLYGGTDIEWIRQFTSTLLGVSQHAQIQLKMIHMDQ  511

Query  218  NKMIRSIIDKENMSYCALKSSYSIWRFWTRLRSMFLSRIHYLDEINYFDEECNDEILHGL  397
               + + I   +     LK + +   FW RL S++ SR+        F E  +DEI+  +
Sbjct  512  RVKMNNTIATSDDVTLDLKQTMA---FWARLHSIWQSRVQS----GMFPE--SDEIIRNV  562

Query  398  KKLLAYEGKNTIIEGWAVLSKGKKMVVCGHG  490
             K+ +    N    GWA++S G K +  G G
Sbjct  563  FKMFSL---NQSGRGWAIVSSGAKEMAIGMG  590



>ref|XP_009124043.1| PREDICTED: uncharacterized protein LOC103848960 [Brassica rapa]
Length=818

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMIRSIID---KENMSYC  265
            YI LYGG D+ W+R FTS    +A    +++E+ YVGK    K I+ II+   ++N+S+ 
Sbjct  616  YICLYGGEDMQWIRNFTSLWRSVAKAANIQLEMVYVGKRNPKKGIQPIINTIREDNLSH-  674

Query  266  ALKSSYSIWRFWTRLRSMFLSR  331
             L   + IW FWTR+ SM+ S+
Sbjct  675  TLPDLFQIWFFWTRIESMWESK  696



>gb|AAF01550.1|AC009325_20 unknown protein [Arabidopsis thaliana]
Length=846

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 12/113 (11%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGKN------KMIRSIIDKENMSYC  265
            YI LYGG D+ W++ FTS    +A    +++E+ YVGK       + I + I +EN+S+ 
Sbjct  636  YICLYGGEDMQWIKNFTSLWRNVAKAANIQLEMVYVGKRNPKNGIQPIINTIREENLSH-  694

Query  266  ALKSSYSIWRFWTRLRSMFLS-----RIHYLDEINYFDEECNDEILHGLKKLL  409
             L   + IW FWTR+ SM+ S     + H +     F EE  D +L  +  +L
Sbjct  695  TLPDLFQIWFFWTRVESMWESKQRMLKAHGIKGREGFKEEEKDLVLQEVVAML  747



>emb|CDY37507.1| BnaA05g33720D [Brassica napus]
Length=818

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +2

Query  104  YIFLYGGNDINWVREFTSKLHRLASKIQLKVELAYVGK---NKMIRSIID---KENMSYC  265
            YI LYGG D+ W+R FTS    +A    +++E+ YVGK    K I+ II+   ++N+S+ 
Sbjct  616  YICLYGGEDMQWIRNFTSLWRSVAKAANIQLEMVYVGKRNPKKGIQPIINTIREDNLSH-  674

Query  266  ALKSSYSIWRFWTRLRSMFLSR  331
             L   + IW FWTR+ SM+ S+
Sbjct  675  TLPDLFQIWFFWTRIESMWESK  696



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511129456992