BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25060_g1_i3 len=809 path=[1103:0-45 1153:46-57 1165:58-92
933:93-106 947:107-108 4453:109-113 4458:114-139 1245:140-148
1254:149-203 1309:204-283 1389:284-287 1102:288-438 1541:439-460
4573:461-463 1566:464-537 1640:538-557 1660:558-576 4635:577-578
4637:579-581 1683:582-616 1717:617-729 1830:730-808]

Length=809
                                                                      Score     E

ref|XP_011086209.1|  PREDICTED: ankyrin repeat-containing protein...    126   9e-30   
emb|CDP09408.1|  unnamed protein product                              98.6    3e-20   
ref|XP_010654862.1|  PREDICTED: uncharacterized protein LOC104880282  93.2    2e-19   
ref|XP_003552476.1|  PREDICTED: uncharacterized protein LOC100805925  85.1    1e-16   
ref|XP_008232384.1|  PREDICTED: uncharacterized protein LOC103331532  84.3    2e-16   
ref|NP_001235831.1|  uncharacterized protein LOC100500285             84.3    3e-16   
ref|XP_010241720.1|  PREDICTED: uncharacterized protein LOC104586248  83.2    5e-16   
ref|XP_010097817.1|  Ankyrin repeat-containing protein                87.0    5e-16   
gb|KCW76914.1|  hypothetical protein EUGRSUZ_D01263                   83.6    6e-16   
ref|XP_007220388.1|  hypothetical protein PRUPE_ppa021699mg           82.8    6e-16   
ref|XP_011032497.1|  PREDICTED: uncharacterized protein LOC105131279  83.6    6e-16   
ref|XP_010054567.1|  PREDICTED: uncharacterized protein LOC104442889  82.8    7e-16   
gb|KDP28882.1|  hypothetical protein JCGZ_14653                       82.4    9e-16   
ref|XP_007052377.1|  Ankyrin repeat family protein                    85.9    1e-15   
ref|XP_010247943.1|  PREDICTED: uncharacterized protein LOC104590881  82.0    1e-15   
emb|CDP09409.1|  unnamed protein product                              85.5    1e-15   
ref|XP_007052366.1|  Ankyrin repeat family protein                    84.7    3e-15   
ref|XP_007052365.1|  Ankyrin repeat family protein                    80.9    6e-15   
ref|XP_006370503.1|  hypothetical protein POPTR_0001s43430g           80.1    7e-15   
ref|XP_007025564.1|  Uncharacterized protein TCM_029825               80.1    1e-14   
ref|XP_007052376.1|  Ankyrin repeat family protein                    81.3    1e-14   
emb|CBI16686.3|  unnamed protein product                              79.3    1e-14   
ref|XP_007139677.1|  hypothetical protein PHAVU_008G049700g           78.6    2e-14   
ref|XP_010241719.1|  PREDICTED: uncharacterized protein LOC104586247  78.6    2e-14   
ref|XP_006375173.1|  hypothetical protein POPTR_0014s04950g           77.8    5e-14   
ref|XP_007052372.1|  Uncharacterized protein TCM_005766               77.8    5e-14   
ref|XP_002270425.2|  PREDICTED: uncharacterized protein LOC100242687  79.3    7e-14   Vitis vinifera
ref|XP_002526474.1|  hypothetical protein RCOM_0658430                76.6    1e-13   Ricinus communis
ref|XP_004308693.1|  PREDICTED: uncharacterized protein LOC101313462  75.9    2e-13   
ref|XP_006370511.1|  hypothetical protein POPTR_0001s43480g           75.9    2e-13   
ref|XP_002270460.1|  PREDICTED: uncharacterized protein LOC100264971  72.8    2e-12   Vitis vinifera
ref|XP_010242098.1|  PREDICTED: uncharacterized protein LOC104586528  71.6    6e-12   
emb|CAN78752.1|  hypothetical protein VITISV_043005                   70.9    1e-11   Vitis vinifera
ref|XP_010052777.1|  PREDICTED: uncharacterized protein LOC104441349  70.1    2e-11   
ref|XP_008234034.1|  PREDICTED: ankyrin repeat-containing protein...  73.2    2e-11   
ref|XP_007052374.1|  Uncharacterized protein TCM_005768               69.7    3e-11   
ref|XP_008366945.1|  PREDICTED: uncharacterized protein LOC103430577  70.1    4e-11   
ref|XP_007052364.1|  Uncharacterized protein TCM_005755               68.2    1e-10   
ref|XP_010054692.1|  PREDICTED: uncharacterized protein LOC104443024  69.7    4e-10   
ref|XP_008234121.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...  68.9    6e-10   
ref|XP_008359974.1|  PREDICTED: ankyrin repeat-containing protein...  68.6    6e-10   
ref|XP_007038230.1|  Ankyrin repeat family protein, putative          67.8    1e-09   
ref|XP_010056381.1|  PREDICTED: uncharacterized protein LOC104444417  64.3    2e-09   
ref|XP_008388993.1|  PREDICTED: ankyrin repeat-containing protein...  67.0    2e-09   
ref|XP_008388999.1|  PREDICTED: ankyrin repeat-containing protein...  67.0    3e-09   
emb|CAN70132.1|  hypothetical protein VITISV_030400                   66.2    3e-09   Vitis vinifera
ref|XP_008375178.1|  PREDICTED: ankyrin repeat-containing protein...  66.2    4e-09   
emb|CBI26580.3|  unnamed protein product                              65.9    5e-09   
ref|XP_010662157.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...  65.9    5e-09   
ref|XP_007052361.1|  Uncharacterized protein TCM_005751               63.9    6e-09   
ref|XP_010536562.1|  PREDICTED: ankyrin repeat-containing protein...  65.9    6e-09   
ref|XP_009373993.1|  PREDICTED: ankyrin repeat-containing protein...  65.5    8e-09   
ref|XP_010654960.1|  PREDICTED: uncharacterized protein LOC104880325  62.8    1e-08   
ref|XP_007220754.1|  hypothetical protein PRUPE_ppa024013mg           64.7    1e-08   
ref|XP_008364900.1|  PREDICTED: uncharacterized protein LOC103428565  61.6    2e-08   
ref|XP_010276201.1|  PREDICTED: uncharacterized protein LOC104611001  62.0    3e-08   
ref|XP_006437041.1|  hypothetical protein CICLE_v10031687mg           63.5    3e-08   
ref|XP_007038229.1|  Ankyrin repeat family protein, putative          63.5    3e-08   
ref|XP_006295666.1|  hypothetical protein CARUB_v10024782mg           63.5    3e-08   
gb|KDO57717.1|  hypothetical protein CISIN_1g046832mg                 63.2    3e-08   
ref|XP_010260927.1|  PREDICTED: uncharacterized protein LOC104599880  61.6    5e-08   
ref|XP_008366860.1|  PREDICTED: ankyrin repeat-containing protein...  62.8    7e-08   
ref|XP_008388996.1|  PREDICTED: ankyrin repeat-containing protein...  62.8    7e-08   
ref|XP_010242324.1|  PREDICTED: ankyrin repeat-containing protein...  62.8    7e-08   
ref|XP_006375176.1|  hypothetical protein POPTR_0014s04980g           60.8    7e-08   
emb|CBI36460.3|  unnamed protein product                              62.4    8e-08   
ref|XP_004309013.1|  PREDICTED: ankyrin repeat-containing protein...  62.0    1e-07   
gb|KDO57720.1|  hypothetical protein CISIN_1g042799mg                 61.6    1e-07   
ref|XP_007219523.1|  hypothetical protein PRUPE_ppa022541mg           61.2    2e-07   
ref|XP_010654964.1|  PREDICTED: uncharacterized protein LOC104880328  59.3    2e-07   
ref|XP_006375177.1|  hypothetical protein POPTR_0014s04990g           60.1    4e-07   
ref|XP_003635081.1|  PREDICTED: ankyrin repeat-containing protein...  60.5    4e-07   
emb|CBI40931.3|  unnamed protein product                              60.1    5e-07   
ref|XP_008376967.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.1    5e-07   
gb|KDO57716.1|  hypothetical protein CISIN_1g0128361mg                59.3    9e-07   
ref|XP_010052784.1|  PREDICTED: ankyrin repeat-containing protein...  59.3    9e-07   
ref|XP_004309014.1|  PREDICTED: ankyrin repeat-containing protein...  59.3    9e-07   
ref|XP_002321785.1|  ankyrin repeat family protein                    58.5    1e-06   Populus trichocarpa [western balsam poplar]
gb|KCW76859.1|  hypothetical protein EUGRSUZ_D01212                   59.3    1e-06   
emb|CDY38856.1|  BnaA03g13230D                                        58.9    1e-06   
ref|XP_009132618.1|  PREDICTED: ankyrin repeat-containing protein...  58.9    1e-06   
ref|XP_006279812.1|  hypothetical protein CARUB_v10028013mg           58.2    2e-06   
ref|XP_008388997.1|  PREDICTED: ankyrin repeat-containing protein...  57.8    3e-06   
ref|XP_010507738.1|  PREDICTED: ankyrin repeat-containing protein...  57.8    3e-06   
ref|XP_006437043.1|  hypothetical protein CICLE_v10033891mg           57.8    3e-06   
ref|XP_006375174.1|  hypothetical protein POPTR_0014s04960g           55.5    4e-06   
ref|NP_199929.1|  ankyrin repeat-containing protein                   57.4    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74683.1|  BnaA05g04290D                                        57.4    4e-06   
emb|CDY32636.1|  BnaC03g16040D                                        57.4    4e-06   
ref|XP_006376955.1|  ankyrin repeat family protein                    57.0    5e-06   
ref|XP_009143063.1|  PREDICTED: ankyrin repeat-containing protein...  57.0    5e-06   
ref|XP_010508259.1|  PREDICTED: ankyrin repeat-containing protein...  57.0    6e-06   
ref|XP_011085716.1|  PREDICTED: uncharacterized protein LOC105167627  54.7    6e-06   
ref|XP_010680067.1|  PREDICTED: ankyrin repeat-containing protein...  57.0    6e-06   
ref|XP_010482448.1|  PREDICTED: ankyrin repeat-containing protein...  56.6    7e-06   
gb|KFK26730.1|  hypothetical protein AALP_AA8G285300                  56.6    7e-06   
gb|AFJ66184.1|  hypothetical protein 11M19.23                         56.6    8e-06   
ref|XP_011003549.1|  PREDICTED: alpha-latrotoxin-Lt1a-like            56.6    8e-06   
emb|CDY48256.1|  BnaC04g05150D                                        56.6    8e-06   
gb|KDO46882.1|  hypothetical protein CISIN_1g023199mg                 56.2    8e-06   
ref|XP_006485162.1|  PREDICTED: ankyrin repeat-containing protein...  56.2    1e-05   
ref|XP_010442600.1|  PREDICTED: ankyrin repeat-containing protein...  56.2    1e-05   
ref|XP_010054546.1|  PREDICTED: uncharacterized protein LOC104442870  55.5    1e-05   
ref|XP_008388990.1|  PREDICTED: ankyrin repeat-containing protein...  55.5    2e-05   
ref|XP_006375175.1|  hypothetical protein POPTR_0014s04970g           53.5    2e-05   
ref|XP_008343936.1|  PREDICTED: uncharacterized protein LOC103406722  53.1    2e-05   
ref|XP_009759429.1|  PREDICTED: ankyrin repeat-containing protein...  54.7    3e-05   
ref|XP_010426299.1|  PREDICTED: ankyrin repeat-containing protein...  54.7    3e-05   
emb|CDP09407.1|  unnamed protein product                              54.3    5e-05   
ref|XP_006401542.1|  hypothetical protein EUTSA_v10015398mg           53.9    6e-05   
ref|XP_008370254.1|  PREDICTED: ankyrin repeat-containing protein...  53.5    7e-05   
gb|KCW76855.1|  hypothetical protein EUGRSUZ_D01209                   53.5    7e-05   
ref|XP_010054542.1|  PREDICTED: ankyrin repeat-containing protein...  53.5    8e-05   
gb|KCW76854.1|  hypothetical protein EUGRSUZ_D01208                   51.2    1e-04   
ref|XP_006402007.1|  hypothetical protein EUTSA_v10015548mg           53.1    1e-04   
ref|XP_010089784.1|  hypothetical protein L484_008034                 50.8    1e-04   
ref|XP_011093263.1|  PREDICTED: ankyrin repeat-containing protein...  52.8    1e-04   
ref|XP_007024264.1|  Ankyrin repeat family protein                    52.8    1e-04   
ref|XP_011032506.1|  PREDICTED: uncharacterized protein LOC105131287  50.8    1e-04   
ref|XP_006375172.1|  hypothetical protein POPTR_0014s04940g           50.8    2e-04   
ref|XP_006437040.1|  hypothetical protein CICLE_v10033865mg           52.4    2e-04   
gb|EYU42336.1|  hypothetical protein MIMGU_mgv11b017551mg             52.4    2e-04   
ref|XP_010242097.1|  PREDICTED: uncharacterized protein LOC104586527  49.7    2e-04   
ref|XP_002515991.1|  ankyrin repeat-containing protein, putative      52.0    3e-04   Ricinus communis
ref|XP_006397654.1|  hypothetical protein EUTSA_v10001761mg           51.6    3e-04   
ref|XP_009363736.1|  PREDICTED: ankyrin repeat-containing protein...  51.2    4e-04   
ref|XP_011040333.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...  50.4    7e-04   



>ref|XP_011086209.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Sesamum 
indicum]
Length=474

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 34/179 (19%)
 Frame = +3

Query  114  DMLPNGKPENW---IEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK--  278
            + LP  KP+NW   I++FEF++ RD+P +AR+A+LVV  L+  VT++AGINPP Y+++  
Sbjct  269  NHLPGEKPKNWRDIIKHFEFQWQRDSPGEARSALLVVTTLIATVTFEAGINPPSYLFEPS  328

Query  279  --------------------NKATEF---------STFSLTVFLVANTLSLSSAMAMIEY  371
                                +  TE          S  S+ +FLVAN+++L+SA ++I+Y
Sbjct  329  NEAIITVSSNGTALLNPNISSNGTELMQRSSAEMASMASIIIFLVANSVALTSATSIIDY  388

Query  372  LTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
            LT  +P+QRELR+A   M+F YGWS  +T+P    K  L++VA   P  +R LPN+  K
Sbjct  389  LTQGLPFQRELRVAMSAMIFAYGWSLGNTKPTGTLKDVLLIVALSVPLFLRVLPNMISK  447



>emb|CDP09408.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 94/158 (59%), Gaps = 22/158 (14%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY--------KNKATE  293
            ++W  YF+F+  R++PSD RN +LVVAAL+  VT+QAG+ PP  I         +N+A  
Sbjct  231  KDWFNYFKFQIQRESPSDTRNVLLVVAALIATVTFQAGVTPPSSILDMSNQPNDENQAAI  290

Query  294  FSTFSLT-VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPIS  470
            F + + + +FL +N+L L++++++I YLT   P+QREL I  F MMF YG+S      + 
Sbjct  291  FGSHATSYLFLFSNSLGLTASLSIIIYLTRGFPFQRELLICVFAMMFSYGFSVSGI--LK  348

Query  471  GTKTA-------LIVVASLAPYLIRTLPN----LFKKC  551
            G K         L+ VA L P+LIR LP      +KKC
Sbjct  349  GQKQEKEMAGYILLTVAFLLPFLIRWLPTWGKMAWKKC  386



>ref|XP_010654862.1| PREDICTED: uncharacterized protein LOC104880282 [Vitis vinifera]
 emb|CAN65074.1| hypothetical protein VITISV_032900 [Vitis vinifera]
Length=169

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 86/156 (55%), Gaps = 17/156 (11%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK------  284
            P    +++  Y+ F  SRDTPSDARN +LVV  L+   T+QAGINPP  ++++K      
Sbjct  8    PEDVSDDFYAYYRFNPSRDTPSDARNTLLVVGTLIAAATFQAGINPPGGVWQDKTIVDGV  67

Query  285  ---------ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGY  437
                      +E + F  TVFL  NTL+ SS++ MI YL ++ P+  E+  A + M   Y
Sbjct  68   PTHPGKAILGSEKAAF--TVFLFFNTLAFSSSLQMIHYLIIDCPFSFEVLTAIYSMSGTY  125

Query  438  GWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFK  545
            G+S  + EP    K   I++A L PY +R    +FK
Sbjct  126  GFSIAAVEPPGAVKFWYIMIAFLLPYAVRLSQQIFK  161



>ref|XP_003552476.1| PREDICTED: uncharacterized protein LOC100805925 [Glycine max]
Length=175

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 85/168 (51%), Gaps = 9/168 (5%)
 Frame = +3

Query  129  GKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF----  296
            G+ +NW+ YF+++  RDTPSD RN +L++  L+  VT+QAG+NPP  +++    E     
Sbjct  7    GRGKNWLRYFQYEEERDTPSDTRNILLIIFTLVAAVTFQAGVNPPGGVWQETNGEHIAGR  66

Query  297  -----STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTE  461
                    +  VFL+ NTL+ S+++ +I  LT   P+  E+ +A   M   YG S  +  
Sbjct  67   AIYASDKQAYYVFLIFNTLAFSNSILVILSLTHKFPFHFEICVATISMAVTYGSSIFAVS  126

Query  462  PISGTKTALIVVASLAPYLIRTLPNLFKKCC*DRGQGNTCDPCSLSYK  605
            P    +   I++ +  P++ R L  +F        Q     P S S +
Sbjct  127  PDDSVRFRYILITAAGPFVFRFLVLIFNLLLRKHVQSQNLLPESDSVR  174



>ref|XP_008232384.1| PREDICTED: uncharacterized protein LOC103331532 [Prunus mume]
Length=170

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 88/159 (55%), Gaps = 17/159 (11%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK------  284
            P  K  NW++ F++    D+P DARN +L+VAAL+  VT+QAG+NPP  ++++       
Sbjct  7    PPNKGWNWLKSFQYDEGNDSPGDARNVLLIVAALITAVTFQAGVNPPGGVWQDSQNGHTA  66

Query  285  -----ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSS  449
                 AT  + F   VFL++NTL+LS+A+ +I  LT   P+  E+ +A   M+  YG + 
Sbjct  67   GRAIYATHKAPFY--VFLISNTLALSTAIFIIISLTHRFPFHLEVLVATVSMIVTYGSAV  124

Query  450  CSTEPISGTKTALIVVASLAPYLIRTLPNLFK----KCC  554
             +  P    +   ++ A+  P++IR    +FK    KC 
Sbjct  125  FAVTPNEAVQFRYLLTAAALPFIIRIFIQVFKMYKPKCV  163



>ref|NP_001235831.1| uncharacterized protein LOC100500285 [Glycine max]
 gb|ACU15320.1| unknown [Glycine max]
Length=175

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 9/171 (5%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF-  296
            LP G  +NW+ YF+++  RDTPS+ RN +L++  L+  VT+QAG+NPP  +++       
Sbjct  4    LPIGIRKNWLTYFQYEEVRDTPSETRNILLIIFTLVAAVTFQAGVNPPGGVWQEDKDGHV  63

Query  297  --------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSC  452
                     T +  VFL+ NTL+ S+++ +I  LT   P+  E+ +A   M   YG S  
Sbjct  64   AGRAIYASDTQAYYVFLIFNTLAFSNSILVILSLTHKFPFHFEICVATISMAVTYGSSIF  123

Query  453  STEPISGTKTALIVVASLAPYLIRTLPNLFKKCC*DRGQGNTCDPCSLSYK  605
            +  P    +   I++ +  P++ R L  +F        Q     P S S +
Sbjct  124  AVSPDDSVRFRYILITAAGPFVFRFLVLIFNLLLRKHVQSQNLLPESDSVR  174



>ref|XP_010241720.1| PREDICTED: uncharacterized protein LOC104586248 [Nelumbo nucifera]
Length=160

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 80/143 (56%), Gaps = 9/143 (6%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF--  296
            P     N  +YF F  +RD+PS  RNA+LVVAAL+  VT+QAG NPP  ++++       
Sbjct  11   PERPSSNLFKYFRFHINRDSPSATRNALLVVAALIATVTFQAGANPPGGVWQDTKLGHEP  70

Query  297  -------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCS  455
                   S    T+FLVANT+ LS+++++I YLT+  P   E+  A + M+  Y  S  +
Sbjct  71   GTSIYSKSPVPFTLFLVANTVGLSASISIITYLTIGFPLYAEVITALYSMILTYASSVIA  130

Query  456  TEPISGTKTALIVVASLAPYLIR  524
              P    K   +++ +L P+L+R
Sbjct  131  VTPKGSVKYRYVLIGALLPFLLR  153



>ref|XP_010097817.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB72240.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=475

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 85/167 (51%), Gaps = 36/167 (22%)
 Frame = +3

Query  141  NWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKA-----------  287
            +WI YF+F+  RD+PSD RNA+LVVAAL+  VT+QAG+NPP      K+           
Sbjct  288  DWIRYFQFQKKRDSPSDTRNALLVVAALIATVTFQAGVNPPGGFVAEKSQPNVNSTNTTS  347

Query  288  ------------TEFSTFSLTV-------------FLVANTLSLSSAMAMIEYLTVNMPY  392
                        +  ST  L+              FL  N+L  ++++ ++ YLT   P+
Sbjct  348  YAPPPSSPDQSYSPVSTVGLSAISAALGSIATSDWFLFGNSLGFAASVNVLIYLTAGFPF  407

Query  393  QRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLP  533
            QREL+I+ + MMF YG S    +P    +  ++ +A L P L+R  P
Sbjct  408  QRELQISLYSMMFAYGCSVNDIQPKEIARCLILAIAFLVPILVRWPP  454



>gb|KCW76914.1| hypothetical protein EUGRSUZ_D01263, partial [Eucalyptus grandis]
Length=183

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 89/181 (49%), Gaps = 11/181 (6%)
 Frame = +3

Query  54   ETNMA-SVEMGNMSNREGDRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallv  230
            E  MA  +E GN +N    R    P    ENW  YF++    D P D RN +L++A L+ 
Sbjct  1    EKKMAPEMENGNDNNYRRKR-SPPPTNIAENWFRYFQYDPDNDLPGDVRNILLIIATLIA  59

Query  231  QVTYQAGINPPDYIYKNKATEFST---------FSLTVFLVANTLSLSSAMAMIEYLTVN  383
             +T+QAG+NPP  ++++     S           +  VFL++NT +LS+++ +I YLT  
Sbjct  60   TITFQAGVNPPGGVWQDNEDSHSAGMAIYASRQIAFYVFLISNTFALSTSLLVIVYLTYK  119

Query  384  MPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKCC*DR  563
             P   E+ +A   MM  Y  +  +  P    +   +++A   P + R +   + K C  +
Sbjct  120  FPLHPEIWVATASMMVTYASAIFAVTPHESVRFRYVLLAGALPVICRCVFQAYGKFCRTK  179

Query  564  G  566
            G
Sbjct  180  G  180



>ref|XP_007220388.1| hypothetical protein PRUPE_ppa021699mg, partial [Prunus persica]
 gb|EMJ21587.1| hypothetical protein PRUPE_ppa021699mg, partial [Prunus persica]
Length=160

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 83/146 (57%), Gaps = 13/146 (9%)
 Frame = +3

Query  141  NWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-----------A  287
            NW + F++    D+P DARN +LVVAAL+  VT+QAG+NPP  ++++            A
Sbjct  12   NWFKSFQYDEGNDSPGDARNVLLVVAALITAVTFQAGVNPPGGVWQDSQNGHTAGRAIYA  71

Query  288  TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
            T  + F   VFL++NTL+LS+A+ +I  LT   P+  E+ +A   M+  YG +  +  P 
Sbjct  72   THKTAFY--VFLISNTLALSTAIFIIISLTHKFPFHLEVLVATVSMIVTYGSAVFAVTPN  129

Query  468  SGTKTALIVVASLAPYLIRTLPNLFK  545
               +   I+ A+  P++IR    +FK
Sbjct  130  ESVQFRYILTAAALPFIIRIFVQVFK  155



>ref|XP_011032497.1| PREDICTED: uncharacterized protein LOC105131279 [Populus euphratica]
Length=185

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 84/144 (58%), Gaps = 6/144 (4%)
 Frame = +3

Query  141  NWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-----NKATEFS-T  302
            +W + F++   RD+PSDARN +LVV AL+  VT+QAG+NPP  +++      +A   S T
Sbjct  14   SWFKKFQYDPDRDSPSDARNVLLVVVALIAAVTFQAGVNPPGGVWQEGDRAGRAIYASKT  73

Query  303  FSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKT  482
             +  VFL++NTL+LS+ + +I  LT   P+  E+ +A   MM  Y  +  +  P    + 
Sbjct  74   GAYYVFLLSNTLALSTCILVITSLTYRFPFHFEIWVATASMMITYASAVFAVTPHESVRF  133

Query  483  ALIVVASLAPYLIRTLPNLFKKCC  554
              +++A+  P+++R     FKK C
Sbjct  134  RYLLIAASVPFVMRCFGYFFKKYC  157



>ref|XP_010054567.1| PREDICTED: uncharacterized protein LOC104442889 [Eucalyptus grandis]
Length=176

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 86/174 (49%), Gaps = 10/174 (6%)
 Frame = +3

Query  72   VEMGNMSNREGDRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAG  251
            +E GN +N    R    P    ENW  YF++    D P D RN +L++A L+  +T+QAG
Sbjct  1    MENGNDNNYRRKR-SPPPTNIAENWFRYFQYDPDNDLPGDVRNILLIIATLIATITFQAG  59

Query  252  INPPDYIYKNKATEFST---------FSLTVFLVANTLSLSSAMAMIEYLTVNMPYQREL  404
            +NPP  ++++     S           +  VFL++NT +LS+++ +I YLT   P   E+
Sbjct  60   VNPPGGVWQDNEDSHSAGMAIYASRQIAFYVFLISNTFALSTSLLVIVYLTYKFPLHPEI  119

Query  405  RIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKCC*DRG  566
             +A   MM  Y  +  +  P    +   +++A   P + R +   + K C  +G
Sbjct  120  WVATASMMVTYASAIFAVTPHESVRFRYVLLAGALPVICRCVFQAYGKFCRTKG  173



>gb|KDP28882.1| hypothetical protein JCGZ_14653 [Jatropha curcas]
Length=162

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = +3

Query  123  PN-GKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-----  284
            PN  +  +W  YF+++  RD+PS+ARN +L+VAAL+  VT+QAG+NPP  ++++      
Sbjct  4    PNLSRGRSWFSYFQYEDGRDSPSEARNVLLLVAALITAVTFQAGVNPPGGVWQDDEGGHV  63

Query  285  ------ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWS  446
                  AT+ + +   +FL++NT++LS+++ +I  LT   P+  E+ +A F M+  Y  +
Sbjct  64   AGRAIYATQKNAY--YIFLISNTVALSTSLLLIVSLTYRFPFHFEIWVATFSMIVTYASA  121

Query  447  SCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
              +  P    +   I++A+  P+L R    +F K
Sbjct  122  IFAVTPDESVRFRYILLAASVPFLARCSIQIFNK  155



>ref|XP_007052377.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96534.1| Ankyrin repeat family protein [Theobroma cacao]
Length=443

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 86/163 (53%), Gaps = 25/163 (15%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK------------N  281
            ++W +YF+F+  RD+PSD RN +LVVAAL+  VT+QAG+NPP  + +             
Sbjct  263  KDWFKYFKFQLERDSPSDTRNVLLVVAALIASVTFQAGLNPPSGLLEYDSQSNPASGNVT  322

Query  282  KATEFSTFSLT-------------VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFC  422
            +A    T +L              +FL  N+  +++++++I YLT   P+QREL I+   
Sbjct  323  RAGPAVTSALVAASALLGTQATSYLFLFWNSFGITASLSIIIYLTGGFPFQRELLISMLS  382

Query  423  MMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKC  551
            MMF YG+S        G    L+ VA + P+ +R LP    K 
Sbjct  383  MMFSYGFSIYGMTEKDGVAFVLLTVAFVLPFALRWLPTWVNKA  425



>ref|XP_010247943.1| PREDICTED: uncharacterized protein LOC104590881 [Nelumbo nucifera]
Length=157

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 74/147 (50%), Gaps = 8/147 (5%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-NKATEFSTFS  308
            +P+ W E++ F+  RD P DARN +LVVA L+  VT+QAGINPP  +++ NK  E     
Sbjct  11   QPDKWFEFYRFQPGRDLPGDARNTMLVVATLIATVTFQAGINPPGGVWQDNKGHEAGKSI  70

Query  309  L-------TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
            L        +F++ANTL  S+A  +I Y     P   E+ IA   M   YG +     P 
Sbjct  71   LGDKHAVYNIFILANTLGFSAACNIIGYFVTGCPMFMEVYIAILSMSATYGAAVVDITPN  130

Query  468  SGTKTALIVVASLAPYLIRTLPNLFKK  548
                  L   A   P L+R L N  KK
Sbjct  131  GTLNFGLFAFALFLPCLLRWLVNCSKK  157



>emb|CDP09409.1| unnamed protein product [Coffea canephora]
Length=470

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 100/176 (57%), Gaps = 20/176 (11%)
 Frame = +3

Query  105  DRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY---  275
            D++   PN +  N + YF+F+  RD+PS  RNA+LVVAAL+  VT+QAG+ PP  +    
Sbjct  290  DKLRDSPN-EVRNTLLYFKFQVQRDSPSATRNALLVVAALIATVTFQAGVTPPSGVLDKP  348

Query  276  ------KNKATEFSTFSLT-VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
                  +N+A  F + + + +FL +N+L L++++++I YLT   P+QREL I+ F MM  
Sbjct  349  NQPNPDQNQAAIFGSHATSYLFLFSNSLGLTASLSIIIYLTGGFPFQRELLISIFAMMST  408

Query  435  YGWSSCSTEPISGTKTA-----LIVVASLAPYLIRTLPN----LFKKCC*DRGQGN  575
            YG+S          +       L+ VA L P+L+R LP      +KKC     +GN
Sbjct  409  YGFSVSGILKKQRREKEVVGYILLTVAFLLPFLMRWLPTCGKMAWKKCNRRFSKGN  464



>ref|XP_007052366.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96523.1| Ankyrin repeat family protein [Theobroma cacao]
Length=442

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 85/163 (52%), Gaps = 25/163 (15%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK------------N  281
            ++W +YF+F+  RD+PSD RN +LVVAAL+  VT+Q G+NPP  + +             
Sbjct  262  KDWFKYFKFQLERDSPSDTRNVLLVVAALIASVTFQEGLNPPSGLLEYDSQSNPASGNVT  321

Query  282  KATEFSTFSLT-------------VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFC  422
            +A    T +               +FL  N+  L++++++I YLT   P+QREL I+   
Sbjct  322  RAGPAVTSAFVAASALLGTQATSYLFLFWNSFGLTASLSIIIYLTGGFPFQRELLISMLS  381

Query  423  MMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKC  551
            MMF YG+S        G   AL+ VA + P+ +R LP    K 
Sbjct  382  MMFSYGFSIYGMTEKDGVAYALLTVAFVLPFALRWLPTWVNKA  424



>ref|XP_007052365.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96522.1| Ankyrin repeat family protein [Theobroma cacao]
Length=209

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 78/142 (55%), Gaps = 9/142 (6%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF-----  296
            K  +W +YF++   RD+PSD RN +L+VA L+  VT+QAG+NPP  ++++          
Sbjct  6    KGRSWFKYFQYDEGRDSPSDVRNILLIVATLIAAVTFQAGVNPPGGVWQDNGNGHYAGRA  65

Query  297  ----STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEP  464
                 T    VFL++NTL+LS+++ +I  LT   P+  E+ +A   M+  Y  +  +  P
Sbjct  66   IYASQTVPFYVFLISNTLALSASVLVIISLTYRFPFHLEVIVATISMIVTYASAVFAVTP  125

Query  465  ISGTKTALIVVASLAPYLIRTL  530
                K   ++ A+  P+ IR L
Sbjct  126  REFLKFRYVMAAAAVPFAIRRL  147



>ref|XP_006370503.1| hypothetical protein POPTR_0001s43430g, partial [Populus trichocarpa]
 gb|ERP67072.1| hypothetical protein POPTR_0001s43430g, partial [Populus trichocarpa]
Length=179

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK--------A  287
            +   W + F++   RD+PSDARN +LVV AL+  VT+QAG+NPP  +++          A
Sbjct  8    RSAGWFKKFQYDEVRDSPSDARNVLLVVVALIAAVTFQAGVNPPGGVWQEGDRVGRAIYA  67

Query  288  TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
            ++   F   VFL++NTL+LS+ + +I  LT   P+  E+  A   +M  Y  +  +  P 
Sbjct  68   SQKRAF--YVFLISNTLALSTCILVITSLTYRFPFHLEIWAATASIMITYASAVFAVTPN  125

Query  468  SGTKTALIVVASLAPYLIRTLPNLFKKCC  554
               +   +++A+  P+++R     FKK C
Sbjct  126  ESVRFRYLLIAASVPFVMRCFGYFFKKYC  154



>ref|XP_007025564.1| Uncharacterized protein TCM_029825 [Theobroma cacao]
 gb|EOY28186.1| Uncharacterized protein TCM_029825 [Theobroma cacao]
Length=209

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 91/163 (56%), Gaps = 16/163 (10%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK------  284
            P G   +W  YF+F+ S+D+PS ARN +LVV  L+  VT+QAG+ PP  ++++       
Sbjct  23   PAGINRSWFRYFQFEESKDSPSQARNDLLVVFTLIATVTFQAGVTPPGGVWQDDTNGSDR  82

Query  285  ------ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWS  446
                  A++   F   VFL++NT++ ++++ +I  LT   P+Q E+R+A   M+  Y  +
Sbjct  83   AGRAIYASQPGAF--YVFLISNTVAFATSIFVIVSLTHRFPFQLEIRVAAASMLATYASA  140

Query  447  SCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKCC*DRGQGN  575
              +  P        +++A + P+++R L ++F K   +R + N
Sbjct  141  IFAITP-EEVHFRYVLIAVVVPFVLRFLVHMFTKFT-NRSRQN  181



>ref|XP_007052376.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX96533.1| Ankyrin repeat family protein [Theobroma cacao]
Length=301

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 85/152 (56%), Gaps = 15/152 (10%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-----  284
            L  GK  +W ++F++   RD PSD RN +L+VA L+  VT+QAG++PP  ++++      
Sbjct  147  LSTGK--SWYKHFQYDEGRDKPSDLRNVMLIVATLIAAVTFQAGVSPPGGVWQDSEHGHV  204

Query  285  ------ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWS  446
                  A++   +   VFL+ANTL+LS+++ +I  LT   P+  E+ +A   MM  YG +
Sbjct  205  AGRAIYASQAPAY--YVFLIANTLALSASILVIISLTYRFPFHLEVIVATISMMVTYGSA  262

Query  447  SCSTEPISGTKTALIVVASLAPYLIRTLPNLF  542
              +  P    +   I+ A+  P+ IR L  LF
Sbjct  263  VFAVTPHESVRFRYIMAAAAVPFAIRFLIQLF  294


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 85/161 (53%), Gaps = 12/161 (7%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF-------  296
            ++W ++F++   RD+PSD RN +L+VA L+  VT+QAG+NPP  ++++            
Sbjct  8    KSWFKHFQYDEGRDSPSDVRNILLIVATLIAAVTFQAGVNPPGGVWQDNGNGHYAGRAIY  67

Query  297  --STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPIS  470
               T    VFL++NTL+LS+++ +I  LT   P+  E+ +A   M+  Y  +  +  P  
Sbjct  68   ASQTVPFYVFLISNTLALSASVLVIISLTYRFPFHLEVIVATISMIVTYASAVFAVTPRE  127

Query  471  GTKTALIVVASLAPYLIRTL---PNLFKKCC*DRGQGNTCD  584
              K   ++ A+  P+ IR L    + +K    D G+    D
Sbjct  128  FVKFRYVMAAAAVPFAIRRLSTGKSWYKHFQYDEGRDKPSD  168



>emb|CBI16686.3| unnamed protein product [Vitis vinifera]
Length=176

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 83/146 (57%), Gaps = 9/146 (6%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++W  YF++   ++TP+DARN +L+VA L+  VT+QAGINPP  ++++            
Sbjct  4    KSWFRYFQYDERKETPADARNVLLIVAGLIAAVTFQAGINPPGGVWQDDKDGHRPGRAIY  63

Query  291  EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPIS  470
             + T    VFL++NT++ S+++ ++  LT   P+  E+ +A   M+  Y  S  +  P  
Sbjct  64   SYQTKEFYVFLISNTVAFSTSILLLISLTHKFPFHFEVILATTSMVVTYASSVFAVTPDE  123

Query  471  GTKTALIVVASLAPYLIRTLPNLFKK  548
              K   I+ A+ AP++IR L  ++ +
Sbjct  124  LVKFRYILFAAAAPFIIRCLLQVWAR  149



>ref|XP_007139677.1| hypothetical protein PHAVU_008G049700g [Phaseolus vulgaris]
 gb|ESW11671.1| hypothetical protein PHAVU_008G049700g [Phaseolus vulgaris]
Length=173

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (54%), Gaps = 9/162 (6%)
 Frame = +3

Query  129  GKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKN----KATEF  296
            G  +NW+ YF+++  RDTPS+  N +L++ +L+  VT+QA +NPP  +++     K    
Sbjct  6    GTWKNWLRYFQYEERRDTPSETINILLIIFSLVAAVTFQAAVNPPGGVWEETEDGKHAGK  65

Query  297  STFSLT-----VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTE  461
            +T+SL      VFL+ NTL+ ++++ +I  LT   P+Q E+  A   M   YG +  +  
Sbjct  66   ATYSLDKKGYYVFLIFNTLAFANSVFIILSLTHKFPFQLEIWTATVSMSVSYGSAIFAIT  125

Query  462  PISGTKTALIVVASLAPYLIRTLPNLFKKCC*DRGQGNTCDP  587
            P        +++ + AP+++R L  +F      R   +T  P
Sbjct  126  PKDPIHLRYVLITATAPFVLRILVLMFNLFLRKRFMKDTHTP  167



>ref|XP_010241719.1| PREDICTED: uncharacterized protein LOC104586247 [Nelumbo nucifera]
Length=179

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 87/158 (55%), Gaps = 19/158 (12%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK------  284
            P    ++  +YF F   RD+PSD R+A+L+VAAL+  VT+QAGI PP  ++++       
Sbjct  10   PENPSKSLFKYFRFHLDRDSPSDTRDALLIVAALIAAVTFQAGITPPGGVWQDVDENGKD  69

Query  285  ----------ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
                      A + + F   +FL+ANTL LS+++++I YLT+  P   E+ IA + ++  
Sbjct  70   PHHVAGRSIYAAQPTPF--FIFLMANTLGLSASISIITYLTIGFPLYMEVVIASYSLLLT  127

Query  435  YGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
            Y  +  +  P        I++A+  PYL+R +   F+K
Sbjct  128  YASAIIAITP-EDVSFRYILIAAAVPYLVRFIMQTFRK  164



>ref|XP_006375173.1| hypothetical protein POPTR_0014s04950g [Populus trichocarpa]
 gb|ERP52970.1| hypothetical protein POPTR_0014s04950g [Populus trichocarpa]
Length=182

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 80/147 (54%), Gaps = 6/147 (4%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK--NKATEFSTF  305
            +  +W + F++    D+PSDARN +LVV AL+  VT+QAG+NPP  +++  N A      
Sbjct  11   RSHSWFKKFQYDPKTDSPSDARNVLLVVVALIAAVTFQAGVNPPGGVWQEGNHAGRAIYA  70

Query  306  SLT----VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISG  473
            S      VFLV+NTL+LS+ + +I  LT   P+  E+  A   MM  Y  +  +  P   
Sbjct  71   SQKRAYYVFLVSNTLALSTCILVITSLTYRFPFHLEIWAATASMMITYASAVFAVTPHES  130

Query  474  TKTALIVVASLAPYLIRTLPNLFKKCC  554
             +    ++A+  P+++R     FKK C
Sbjct  131  VRFRYPLIAASVPFVMRCFGYFFKKYC  157



>ref|XP_007052372.1| Uncharacterized protein TCM_005766 [Theobroma cacao]
 gb|EOX96529.1| Uncharacterized protein TCM_005766 [Theobroma cacao]
Length=192

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 87/152 (57%), Gaps = 16/152 (11%)
 Frame = +3

Query  138  ENWIEYFEFKY-----SRD-TPSDARNailvvaallvQVTYQAGINPPDYIYKN-KATEF  296
            ++W  YF++K       RD   +DARNA+LVVA L+  VT+QAG+NPP  +++  KA   
Sbjct  7    KDWCRYFQYKEGANEEDRDKNRADARNALLVVATLIAAVTFQAGVNPPGGVWQETKADHI  66

Query  297  STFSLT--------VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSC  452
            +  ++         VFL +NTL+ S+A+ +I  LT N P++ E+R+AG  M+  YG +  
Sbjct  67   AGTAICASDSDAYYVFLTSNTLAFSAAVLVIMSLTHNFPFKFEVRVAGVSMIITYGSAIF  126

Query  453  STEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
            +  P  G    L ++ + AP ++R L  L  K
Sbjct  127  AVTP-DGETFQLALITAAAPLILRCLIQLLVK  157



>ref|XP_002270425.2| PREDICTED: uncharacterized protein LOC100242687 [Vitis vinifera]
Length=328

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 83/148 (56%), Gaps = 9/148 (6%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++W  YF++   ++TP+DARN +L+VA L+  VT+QAGINPP  ++++            
Sbjct  156  KSWFRYFQYDERKETPADARNVLLIVAGLIAAVTFQAGINPPGGVWQDDKDGHRPGRAIY  215

Query  291  EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPIS  470
             + T    VFL++NT++ S+++ ++  LT   P+  E+ +A   M+  Y  S  +  P  
Sbjct  216  SYQTKEFYVFLISNTVAFSTSILLLISLTHKFPFHFEVILATTSMVVTYASSVFAVTPDE  275

Query  471  GTKTALIVVASLAPYLIRTLPNLFKKCC  554
              K   I+ A+ AP++IR L  ++ +  
Sbjct  276  LVKFRYILFAAAAPFIIRCLLQVWARLT  303


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 82/137 (60%), Gaps = 13/137 (9%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-----------  284
             +W +YF+++  RD+PS+ARN +L++  L+  VT+QAG+NPP  ++++            
Sbjct  13   RSWHKYFQYQEGRDSPSEARNVLLIIFGLIATVTFQAGVNPPGGVWQDNDNGHVPGTAIY  72

Query  285  ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEP  464
            A++ +TF L  FL+ NT++LS+++ ++ YLT   P+  E+ +A   M   YG +  +  P
Sbjct  73   ASQKATFYL--FLIFNTMALSTSLLLVLYLTHRFPFYVEIWVAIMGMGVTYGSAIFAVTP  130

Query  465  ISGTKTALIVVASLAPY  515
                +   +++A++ P+
Sbjct  131  GHSVRFRYVMLAAVVPW  147



>ref|XP_002526474.1| hypothetical protein RCOM_0658430 [Ricinus communis]
 gb|EEF35865.1| hypothetical protein RCOM_0658430 [Ricinus communis]
Length=179

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 80/150 (53%), Gaps = 8/150 (5%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATE---  293
            P      W  YF +  ++D+P++ARN +LVV AL+  VT+Q+G+NPP  ++++       
Sbjct  15   PRNTWRGWFRYFHYDETKDSPNEARNVLLVVMALIAAVTFQSGVNPPGGVWQDNDGHHAG  74

Query  294  -----FSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCST  458
                 F   +  VFLV++TL+LS+++ +I  LT   P   E+ +A   M+  Y  +  + 
Sbjct  75   RAIYAFQPHTFYVFLVSSTLALSTSLLVIVSLTYRFPLHLEIWVATASMIVTYASAIFAV  134

Query  459  EPISGTKTALIVVASLAPYLIRTLPNLFKK  548
             P    K   I++ +  P ++R L  + ++
Sbjct  135  TPRENVKVCYILITAALPLIMRILIQMLRQ  164



>ref|XP_004308693.1| PREDICTED: uncharacterized protein LOC101313462 [Fragaria vesca 
subsp. vesca]
Length=182

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 91/184 (49%), Gaps = 17/184 (9%)
 Frame = +3

Query  87   MSNREGDRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD  266
            M++     V+  P     +W   FE+    D P DARN +LVVAAL+  VT+QAG+NPP 
Sbjct  1    MASPPEKPVENPPRKSGWSWFTSFEYNKENDKPGDARNVLLVVAALITAVTFQAGVNPPG  60

Query  267  YIYKNK-----------ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIA  413
             ++++            AT    F   VFL++NTL+LSS++ +I  LT   P+  E+ IA
Sbjct  61   GVWQDDGNGHTAGRAIYATHKGPF--YVFLISNTLALSSSIFIIVMLTHRFPFHFEVMIA  118

Query  414  GFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNL---FKKCC-*DRGQGNTC  581
               M+  YG +  +  P    K   I+  +  PY++R    +   +K C    R   N C
Sbjct  119  TLSMIVTYGSAVFAVTPNESVKFRYILFTAALPYVLRFFYQMCRKYKHCVRLLRSCQNPC  178

Query  582  DPCS  593
              C+
Sbjct  179  SGCA  182



>ref|XP_006370511.1| hypothetical protein POPTR_0001s43480g [Populus trichocarpa]
 ref|XP_006370712.1| hypothetical protein POPTR_0001s45110g [Populus trichocarpa]
 gb|ERP67080.1| hypothetical protein POPTR_0001s43480g [Populus trichocarpa]
 gb|ERP67281.1| hypothetical protein POPTR_0001s45110g [Populus trichocarpa]
Length=182

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 79/141 (56%), Gaps = 10/141 (7%)
 Frame = +3

Query  156  FEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK--------ATEFSTFSL  311
            F++   RD+PSDARN +LVV AL+  VT+QAG+NPP  +++          A++   F  
Sbjct  19   FQYDEVRDSPSDARNVLLVVVALIAAVTFQAGVNPPGGVWQEGDRVGRAIYASQKRAF--  76

Query  312  TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALI  491
             VFL++NTL+LS+ + +I  LT   P+  E+  A   +M  Y  +  +  P    +   +
Sbjct  77   YVFLISNTLALSTCILVITSLTYRFPFHLEIWAATASIMITYASAVFAVTPNESVRFRYL  136

Query  492  VVASLAPYLIRTLPNLFKKCC  554
            ++A+  P+++R     FKK C
Sbjct  137  LIAASVPFVMRCFGYFFKKYC  157



>ref|XP_002270460.1| PREDICTED: uncharacterized protein LOC100264971 [Vitis vinifera]
 emb|CBI16685.3| unnamed protein product [Vitis vinifera]
Length=176

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 82/148 (55%), Gaps = 9/148 (6%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++W  YF++   ++T +DARN +LVVA L+  VT+QAG+ PP  ++++            
Sbjct  4    KSWFRYFQYDERKETLADARNVLLVVAGLIAAVTFQAGVTPPGGVWQDDKDGHRPGRAIY  63

Query  291  EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPIS  470
             + T    VFL++NT++ S+++ ++  LT   P+  E+ +A   M+  Y  S  +  P  
Sbjct  64   SYQTKEFYVFLISNTVAFSTSILLLISLTHKFPFHFEVILATTSMVVTYASSVFAVTPDE  123

Query  471  GTKTALIVVASLAPYLIRTLPNLFKKCC  554
              K   I++A+ AP++IR L  ++ +  
Sbjct  124  LVKFRYILLAAAAPFIIRFLLQVWARLT  151



>ref|XP_010242098.1| PREDICTED: uncharacterized protein LOC104586528 [Nelumbo nucifera]
Length=175

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 79/165 (48%), Gaps = 26/165 (16%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFSTFS-  308
            +P+ W EY+ F+ SRD P DARN +LVVA L+  VT+QAG+NPP  ++++     +  + 
Sbjct  11   QPDKWFEYYRFQRSRDPPGDARNTMLVVATLIATVTFQAGLNPPGGVWQDNDGHEAGINP  70

Query  309  -------------------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIA  413
                                       +F++ANTL  S+A  +I Y     P   E+ IA
Sbjct  71   PGGAWQDTADGHEAGKSILGYNHSVYKLFILANTLGFSAACNIIGYFVKGCPMYMEVYIA  130

Query  414  GFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
               M F YG +  +  P     ++L  +A   P L+R L N  KK
Sbjct  131  ILSMCFTYGVAVGAISPDGALNSSLFAIALFLPCLLRLLVNCSKK  175



>emb|CAN78752.1| hypothetical protein VITISV_043005 [Vitis vinifera]
Length=176

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 79/146 (54%), Gaps = 9/146 (6%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++W  YF++   ++T +DARN +L VA L+  VT+QAG  PP  ++++            
Sbjct  4    KSWFRYFQYDERKETXADARNVLLXVAGLIAAVTFQAGXXPPGGVWQDDKDGHRPGRAIY  63

Query  291  EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPIS  470
             + T    VFL++NT++ S+++ ++  LT   P+  E+ +A   M+  Y  S  +  P  
Sbjct  64   SYQTKEFYVFLISNTVAFSTSILLLISLTHKFPFHFEVILATTSMVVTYASSVFAVTPDE  123

Query  471  GTKTALIVVASLAPYLIRTLPNLFKK  548
              K   I+ A+ AP++IR L  ++ +
Sbjct  124  LVKFRYILXAAAAPFIIRCLLQVWAR  149



>ref|XP_010052777.1| PREDICTED: uncharacterized protein LOC104441349 [Eucalyptus grandis]
 gb|KCW76845.1| hypothetical protein EUGRSUZ_D01200 [Eucalyptus grandis]
Length=174

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 74/151 (49%), Gaps = 9/151 (6%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFST  302
            P    ENW  +F++    D P   R+ +L++A L+  +T+QAG+NPP  I+++     + 
Sbjct  9    PRNLAENWFRFFQYDPEHDKPGHVRDILLIIATLIATITFQAGVNPPGGIWQDDKDGHTA  68

Query  303  ---------FSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCS  455
                      +  VFL++NT + S+++ +I  LT   P   E+ +A   MM  Y  +  +
Sbjct  69   GRAIYASHHIAFYVFLISNTFAFSTSLLVIVCLTYRFPLHAEIWVATASMMVTYASAIFA  128

Query  456  TEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
              P    K   +++A   P + R +  L+ +
Sbjct  129  VTPHESVKFRYVLIAGSLPVICRCIVQLWGR  159



>ref|XP_008234034.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Prunus 
mume]
Length=446

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 77/151 (51%), Gaps = 22/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKA--------  287
            +P N +EYF+FK  RD+PSDAR A+LVVA L+   T+Q G++PP+ ++++ A        
Sbjct  277  QPNNLMEYFKFKKGRDSPSDARTALLVVAVLVATATFQVGLSPPNGVWQDNAGLTKNGTG  336

Query  288  -------------TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
                           +S  +   F   NT+  S ++ MI  LT N P Q EL+I  F M 
Sbjct  337  SAEPANLAGKSIMGSYSAVAFVFFESFNTIGFSVSLHMINVLTSNFPLQLELQICIFAMY  396

Query  429  FGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
              Y  +  S  P   TK  +IV  S+ P L+
Sbjct  397  CTYNAAMTSIAP-DNTKVFVIVFTSVFPALV  426



>ref|XP_007052374.1| Uncharacterized protein TCM_005768 [Theobroma cacao]
 gb|EOX96531.1| Uncharacterized protein TCM_005768 [Theobroma cacao]
Length=192

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 81/152 (53%), Gaps = 18/152 (12%)
 Frame = +3

Query  141  NWIEYFEFKY------SRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKA-----  287
            +W  YF++K            +DARNA+LVVA L+  VT+QAG+NPP  +++        
Sbjct  8    DWCRYFQYKEGAKEEDKEKNRADARNALLVVATLISAVTFQAGVNPPGGVWQETKDGHTA  67

Query  288  ----TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCS  455
                 E  + +  VFL +NTL+ S+A+ +I  LT N P++ E+R+A   M+  YG +  +
Sbjct  68   GTAICESESSAYYVFLTSNTLAFSAAVLVIMSLTHNFPFKFEVRVAAVSMIITYGSAIFA  127

Query  456  TEPISGT-KTALIVVASLAPYLIRTLPNLFKK  548
              P   T + ALI  A  AP  +R L  L  K
Sbjct  128  VTPDEETFRLALITAA--APLAMRCLIQLLVK  157



>ref|XP_008366945.1| PREDICTED: uncharacterized protein LOC103430577 [Malus domestica]
Length=229

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 78/153 (51%), Gaps = 23/153 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W +YF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++ +        
Sbjct  47   KTNRW-KYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNNNGTG  105

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S  S  +F+V N++    ++  +  LTVN P Q EL+I    +
Sbjct  106  SSNEPVHLAGRSIMGSYSEVSFVIFVVFNSIGFYFSLYTMIVLTVNFPLQLELQICIIAV  165

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYLIR  524
               Y  +  +  P   T   + V  S+ P+L+R
Sbjct  166  YTTYSTAVANIAPSYNTLLFITVFTSVLPFLVR  198



>ref|XP_007052364.1| Uncharacterized protein TCM_005755 [Theobroma cacao]
 gb|EOX96521.1| Uncharacterized protein TCM_005755 [Theobroma cacao]
Length=192

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 84/153 (55%), Gaps = 18/153 (12%)
 Frame = +3

Query  138  ENWIEYFEFKY-----SRD-TPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS  299
            ++W  YF++K       RD   +DARNA+LVVA L+  VT+QAG+NPP  +++ +  ++ 
Sbjct  7    KDWCRYFQYKEGANEEDRDKNRADARNALLVVATLIAAVTFQAGVNPPGGVWQ-ETNDYH  65

Query  300  TFSLT----------VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSS  449
            T              VFL +NTL+ S+A+ +I  LT N P++ E+R+A   M+  YG S+
Sbjct  66   TAGTAICASDSDAYYVFLTSNTLAFSAAVLVIMSLTHNFPFKFEVRVACVSMIITYG-SA  124

Query  450  CSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
                     K  L ++ + AP ++R L  L  K
Sbjct  125  IFAVTGDEDKFQLALITAAAPLILRCLIQLLVK  157



>ref|XP_010054692.1| PREDICTED: uncharacterized protein LOC104443024 [Eucalyptus grandis]
Length=692

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 10/131 (8%)
 Frame = +3

Query  72   VEMGNMSNREGDRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAG  251
            +E GN  N +G +  + P    ENW  YF++    D PSD RN +L++A L+  +T+QAG
Sbjct  1    MEEGNGGNYQG-QSPIPPANIAENWFRYFQYNPKGDKPSDVRNIMLIIATLIAAITFQAG  59

Query  252  INPPDYIYKNKATEFST---------FSLTVFLVANTLSLSSAMAMIEYLTVNMPYQREL  404
            +NPP  ++++     S              VFLV+NT +LS+++ +I  LT   P   E+
Sbjct  60   VNPPGGVWQDNEDGHSAGMAIYASRQIPFYVFLVSNTFALSTSLLVIVSLTYRFPLHFEI  119

Query  405  RIAGFCMMFGY  437
             +A   MM  Y
Sbjct  120  WVATASMMVTY  130



>ref|XP_008234121.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At2g01680-like [Prunus mume]
Length=419

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 69/143 (48%), Gaps = 23/143 (16%)
 Frame = +3

Query  114  DMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-----  278
            D  P  +P+N +++ EFK  RD+PSD RNA+LVV  L+   TYQ   NPP  +++     
Sbjct  269  DTNPLQQPDNLVKFVEFKKGRDSPSDPRNALLVVTVLVATATYQVAANPPGGVWQDAVLN  328

Query  279  ---------NKATEFSTFSL---------TVFLVANTLSLSSAMAMIEYLTVNMPYQREL  404
                     N +T ++   +           F V N++  S ++ MI+ LT N P Q EL
Sbjct  329  KNGTTSNTSNASTHYAGTDILGSYYPAFFIAFAVFNSIGFSMSLHMIKILTTNFPLQLEL  388

Query  405  RIAGFCMMFGYGWSSCSTEPISG  473
             +    M F Y  S  +  P +G
Sbjct  389  HVCIVAMYFTYCSSVLTVAPGAG  411



>ref|XP_008359974.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=435

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 77/152 (51%), Gaps = 23/152 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++ +        
Sbjct  253  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNNNGTG  311

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S  S  +F+V N++    ++  +  LTVN P Q EL+I    +
Sbjct  312  SSNEPVHLAGRSIMGSYSEVSFVIFVVFNSIGFYFSLYTMIVLTVNFPLQLELQICIIAV  371

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
               Y  +  +  P   T   + V  S+ P+L+
Sbjct  372  YTTYSTAVVNIAPSYNTWLFITVFTSVLPFLV  403



>ref|XP_007038230.1| Ankyrin repeat family protein, putative [Theobroma cacao]
 gb|EOY22731.1| Ankyrin repeat family protein, putative [Theobroma cacao]
Length=481

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 81/163 (50%), Gaps = 26/163 (16%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFST---  302
            + +N +EYF+FK  RD PS+AR+A+LV+A L+   T+Q G++PP   +++ ++   T   
Sbjct  306  QTDNLVEYFKFKKGRDPPSEARSALLVIAVLVATATFQVGLSPPGGTWQDNSSPNQTNGT  365

Query  303  ------------------FSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
                               +  +F++ N++  S ++ MI  LT   P Q EL+I    M 
Sbjct  366  SITSAYSAGTSIMGTSNGIAFALFVLFNSIGFSMSLFMINILTSKFPLQFELQICMIAMF  425

Query  429  FGYGWSSCSTEPISGTKTALIVV----ASLAPYLIRTLPNLFK  545
            F Y  +  S  P S  K   I++    +S+ P L R +  L K
Sbjct  426  FTYNTAMASIAP-SSVKLFTIIITTVFSSITPLLTRLVKQLLK  467



>ref|XP_010056381.1| PREDICTED: uncharacterized protein LOC104444417 [Eucalyptus grandis]
Length=161

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 80/149 (54%), Gaps = 12/149 (8%)
 Frame = +3

Query  135  PENWIEYFEFKYS---RDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-----  290
            PEN ++     ++   RD+P++ RN +LVVA L+  VT+QAG++PP  ++++ ++     
Sbjct  5    PENPLKLLTVLFNHEGRDSPTEVRNVLLVVATLIAAVTFQAGVSPPGGVWQDSSSGRVPG  64

Query  291  ----EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCST  458
                   T    VFLV NTL+L+S++ +I  LT   P+  E+ +A   M   YG +  + 
Sbjct  65   QAIYASQTGPFYVFLVCNTLALASSINLIISLTWGFPFFLEVVVATVSMAVTYGSAIFAV  124

Query  459  EPISGTKTALIVVASLAPYLIRTLPNLFK  545
             P S  +   ++     P+L+R L  + K
Sbjct  125  TPKSDEQFRWLLFTGCVPFLLRLLIQMGK  153



>ref|XP_008388993.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=460

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 75/152 (49%), Gaps = 23/152 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++          
Sbjct  279  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSXDVNNXGTG  337

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S  S  +F+V N++    ++  +  LT N P Q EL+I    +
Sbjct  338  SSNEPVHLAGRSIMGSYSEVSFVIFVVFNSIGFYFSLYTMIVLTXNFPLQLELQICIIAV  397

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
               Y  +  +  P   T   + V  S+ P+L+
Sbjct  398  YTTYSTAVVNIAPSYNTGLFITVFTSVLPFLV  429



>ref|XP_008388999.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=461

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 76/152 (50%), Gaps = 23/152 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W  YF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++ +        
Sbjct  279  KTNRW-XYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNNNGTG  337

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S  S  +F+V N++    ++  +  LTVN P Q EL+I    +
Sbjct  338  SSNEPVHLAGRSIMGSYSEVSFVIFVVFNSIGFYFSLYTMIVLTVNFPLQLELQICIIAV  397

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
               Y  +  +  P   T   + V  S+ P+L+
Sbjct  398  YTTYSTAVXNIAPSYNTXLFITVFTSVLPFLV  429



>emb|CAN70132.1| hypothetical protein VITISV_030400 [Vitis vinifera]
Length=394

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 22/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-----------  278
            +P N + YF F   RD+P +AR+A+LV+A L+   TYQ G++PP  +++           
Sbjct  219  QPNNLVNYFRFHRGRDSPGEARSALLVIAVLVATATYQVGLSPPGGVWQDNSGTNQSNST  278

Query  279  --NKA--------TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
              NKA        +     S  +F++ N++  S ++ MI  LT   P + EL+I    M 
Sbjct  279  ATNKAHFAGQSIFSSLGIISFGIFVLFNSIGFSVSLYMISILTXKFPMRFELQICLLAMF  338

Query  429  FGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
            F Y  +  +  P    K  LIV+ S+ P  +
Sbjct  339  FTYNTAIITISP-DNLKIFLIVLTSILPLTV  368



>ref|XP_008375178.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
 ref|XP_008360467.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=448

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 80/154 (52%), Gaps = 25/154 (16%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK---------  284
            +P+N +EYF+FK  RD+PSDAR A+LV++ L+   T+Q G++PP+ I+++          
Sbjct  267  QPKNLMEYFKFKKGRDSPSDARTALLVISVLVATATFQVGLSPPNGIWQDSSGSNNNGAG  326

Query  285  ------ATEFSTFSL---------TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                  A   +  S+           F+  N++  S ++ MI  LT N P Q EL+I   
Sbjct  327  SGSNEPAAHLAGKSIMGSNNAVAFVFFVAFNSIGFSLSLYMINVLTSNFPLQLELQICIV  386

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
             +   Y ++  S  P   TK  +IVV S+ P L+
Sbjct  387  AVYCTYNFAVTSIAP-DNTKLIIIVVTSVLPTLV  419



>emb|CBI26580.3| unnamed protein product [Vitis vinifera]
Length=392

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 22/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-----------  278
            +P N + YF F   RD+P +AR+A+LV+A L+   TYQ G++PP  +++           
Sbjct  163  QPNNLVNYFRFHRGRDSPGEARSALLVIAVLVATATYQVGLSPPGGVWQDNSGTNQSNST  222

Query  279  --NKA--------TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
              NKA        +     S  +F++ N++  S ++ MI  LT   P + EL+I    M 
Sbjct  223  ATNKAHFAGQSIFSSLGIISFGIFVLFNSIGFSVSLYMISILTSKFPMRFELQICLLAMF  282

Query  429  FGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
            F Y  +  +  P    K  LIV+ S+ P  +
Sbjct  283  FTYNTAIITISP-DNLKIFLIVLTSILPLTV  312



>ref|XP_010662157.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At3g12360 [Vitis vinifera]
Length=451

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 22/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-----------  278
            +P N + YF F   RD+P +AR+A+LV+A L+   TYQ G++PP  +++           
Sbjct  276  QPNNLVNYFRFHRGRDSPGEARSALLVIAVLVATATYQVGLSPPGGVWQDNSGTNQSNST  335

Query  279  --NKA--------TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
              NKA        +     S  +F++ N++  S ++ MI  LT   P + EL+I    M 
Sbjct  336  ATNKAHFAGQSIFSSLGIISFGIFVLFNSIGFSVSLYMISILTSKFPMRFELQICLLAMF  395

Query  429  FGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
            F Y  +  +  P    K  LIV+ S+ P  +
Sbjct  396  FTYNTAIITISP-DNLKIFLIVLTSILPLTV  425



>ref|XP_007052361.1| Uncharacterized protein TCM_005751 [Theobroma cacao]
 gb|EOX96518.1| Uncharacterized protein TCM_005751 [Theobroma cacao]
Length=210

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 83/170 (49%), Gaps = 34/170 (20%)
 Frame = +3

Query  138  ENWIEYFEFKY-----SRD-TPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS  299
            ++W  YF++K       RD   +DARNA+L+VA L+  VT+QAG+NPP  ++++     +
Sbjct  7    KDWCRYFQYKEGANEEDRDKNRADARNALLIVATLIAAVTFQAGVNPPGGVWQDNEDNQT  66

Query  300  TFSLT---------------------------VFLVANTLSLSSAMAMIEYLTVNMPYQR  398
              +                             VFL +NTL+ S+A+ +I  LT   P++ 
Sbjct  67   AVAANPPVAVRQDTKDRIPGTAIFASDSSAYYVFLTSNTLAFSAAVLLIMSLTHTFPFKF  126

Query  399  ELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
            E+R+A   M+  YG S+       G K  L ++ + AP ++R L  L  K
Sbjct  127  EVRVACVSMIITYG-SAIFAVTRDGDKFQLALIIAAAPLILRCLIQLLVK  175



>ref|XP_010536562.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Tarenaya 
hassleriana]
Length=417

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 80/163 (49%), Gaps = 26/163 (16%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPP------------------  263
            ++ +EYF FK  RD+PS+AR+A+LVVA+L+   T+QA ++PP                  
Sbjct  242  DDLVEYFSFKRCRDSPSEARSALLVVASLVATATFQASLSPPGGTWQDSYLGSGLQNKTA  301

Query  264  --DYIYKNKATEFSTF---SLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
              D  +K   +   TF   S T+F+  NT+  S ++AMIE LT   P    LR+    M 
Sbjct  302  IDDKPHKAGKSIMGTFEGVSFTLFVFFNTIGFSVSLAMIEILTRGFPLHFNLRVCMVAMF  361

Query  429  FGYGWSSCSTEPISGTKTALI---VVASLAPYLIRTLPNLFKK  548
            F    S  S  P       +I   V+++ +P+L + L    +K
Sbjct  362  FSQNASMNSIAPDHVKLYCIIITSVISAASPFLTKLLEQPVRK  404



>ref|XP_009373993.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like, 
partial [Pyrus x bretschneideri]
Length=400

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = +3

Query  150  EYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKA--------------  287
            EYF+FK  RD+PSDAR A+LV+A+L+   T+Q G+NPP+ I++N +              
Sbjct  224  EYFQFKKGRDSPSDARTALLVIASLVATATFQVGLNPPNGIWQNSSGVNNNGTRSSNEPV  283

Query  288  --------TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGW  443
                      +S  S  +F+V N++    ++  +  LT N P Q EL+I    +   Y  
Sbjct  284  HEAGKSIMGSYSEVSFVIFVVLNSIGFYFSLYTMIVLTANFPLQLELQICIIAVYTTYST  343

Query  444  SSCSTEPISGTKTALIVVASLAPYLI  521
            +  +  P   TK  + V   + P+L+
Sbjct  344  AVINIAPSYNTKLFISVFTLVLPFLV  369



>ref|XP_010654960.1| PREDICTED: uncharacterized protein LOC104880325 [Vitis vinifera]
Length=200

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 73/174 (42%), Gaps = 47/174 (27%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD-----------  266
            LP     NW  Y+ F   RD P DARN +LVVAAL+  VT+QAG+NPP            
Sbjct  7    LPEDPSTNWYAYYRFNPRRDMPGDARNTLLVVAALIAAVTFQAGLNPPSSFLPEGPATKE  66

Query  267  ---------YIYKNKATEFSTF---------------------------SLTVFLVANTL  338
                      +   + TE + F                             T+FL  NTL
Sbjct  67   GAETCSGRVILPSKENTEHTLFLSCNTTSGEQGVKEGSVSVVLASTQKVQFTLFLFCNTL  126

Query  339  SLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVA  500
            +LS+++  I  L +  P+  E+  A + MM  YG S  + EP  G     ++++
Sbjct  127  ALSASIQTITALIIGCPFSFEVLTAIYSMMATYGVSIATLEPPRGVLLECLIIS  180



>ref|XP_007220754.1| hypothetical protein PRUPE_ppa024013mg [Prunus persica]
 gb|EMJ21953.1| hypothetical protein PRUPE_ppa024013mg [Prunus persica]
Length=446

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 77/151 (51%), Gaps = 22/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKA--TEFSTF  305
            +P N +EYF+FK  RD+PSDAR A+LVVA L+   T+Q G++PP+ ++++ A  T+  T 
Sbjct  277  QPNNLMEYFKFKKGRDSPSDARTALLVVAVLVATATFQVGLSPPNGVWQDNAGLTKNGTG  336

Query  306  S-------------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
            S                     +F+  N++  S ++ MI  LT N P Q EL+I    M 
Sbjct  337  SAEPARLAGKSIMGSYNAVLFVIFVSFNSIGFSVSLHMISVLTSNFPLQLELQICVVAMY  396

Query  429  FGYGWSSCSTEPISGTKTALIVVASLAPYLI  521
              Y  +  +  P   T   + V  ++ P L+
Sbjct  397  VTYNTAMINIAP-DNTTVLITVFTAVLPTLV  426



>ref|XP_008364900.1| PREDICTED: uncharacterized protein LOC103428565 [Malus domestica]
Length=169

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 23/120 (19%)
 Frame = +3

Query  147  IEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKA-------------  287
            +EYF+FK  RD+PSDAR A+LV+A L+   T+QAG++PP  I+++               
Sbjct  1    MEYFKFKKGRDSPSDARTALLVIAVLVATTTFQAGLSPPMGIWQDSPGSNMNGTGSGSNE  60

Query  288  ----------TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGY  437
                      + +       F  +N++ LS ++ MI  LT N P Q EL I  F M   Y
Sbjct  61   PAHTAGQSIMSSYKILGFFFFYTSNSIRLSFSLYMIHVLTTNFPLQLELNICMFTMFLTY  120



>ref|XP_010276201.1| PREDICTED: uncharacterized protein LOC104611001 [Nelumbo nucifera]
Length=208

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 68/126 (54%), Gaps = 9/126 (7%)
 Frame = +3

Query  174  RDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFST---------FSLTVFLV  326
            RD   + RN +LVV+AL+  VT+QAG+NPP  ++++                 + ++FL 
Sbjct  31   RDYSHETRNVLLVVSALIAAVTFQAGVNPPGGVWQDDDGHHKAGRSIYAAHPVAFSLFLF  90

Query  327  ANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASL  506
             NTL LS+++++I YLT   P   E+ IA + M+  Y  +  +  P    K   I++A+ 
Sbjct  91   YNTLGLSASISIIAYLTYGFPLYMEVLIAIYSMICTYASAVVAITPKGSVKFRYILIAAA  150

Query  507  APYLIR  524
             PY +R
Sbjct  151  IPYALR  156



>ref|XP_006437041.1| hypothetical protein CICLE_v10031687mg [Citrus clementina]
 gb|ESR50281.1| hypothetical protein CICLE_v10031687mg [Citrus clementina]
Length=411

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 79/159 (50%), Gaps = 22/159 (14%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY-------KNKATEF  296
             +++EYF+FK  RD+P + R+A+LVVAAL+   ++Q G+NPP  ++       KN +T  
Sbjct  243  HDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPGGVWQDNYTPDKNNSTSS  302

Query  297  S--------------TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
            S                +  +F+  N+L    ++ MI  LT   P Q  L++    M F 
Sbjct  303  SKAHNAGEAIWGSMNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFT  362

Query  435  YGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKC  551
            Y  +  +T P+ G +  +IV  ++ P LI       +KC
Sbjct  363  YDTAVIATTPV-GIRIFIIVTEAIIPALIPLTARWVRKC  400



>ref|XP_007038229.1| Ankyrin repeat family protein, putative [Theobroma cacao]
 gb|EOY22730.1| Ankyrin repeat family protein, putative [Theobroma cacao]
Length=448

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 76/155 (49%), Gaps = 26/155 (17%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK---------  284
            +P+  +EYF+FK  RD+PS+AR  +L++A L+   T+Q  +NPP  I+++          
Sbjct  271  QPQELVEYFKFKKGRDSPSEARGTLLIIATLVAAATFQVALNPPGGIWQDNYFPNQNDSH  330

Query  285  -AT-------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFC  422
             AT               S  S ++F + N++ LS ++ MI+ LT   P + EL +    
Sbjct  331  SATISGKHLAGWSVLGTSSGVSFSLFAIFNSIGLSVSLYMIKVLTRKFPLEFELGMCMLA  390

Query  423  MMFGYGWSSCSTEPISGTKTALI---VVASLAPYL  518
            M F Y  +  +  P       +I   ++ S+AP L
Sbjct  391  MFFSYNTAMINISPDDVRLVVIISTVILTSIAPLL  425



>ref|XP_006295666.1| hypothetical protein CARUB_v10024782mg [Capsella rubella]
 gb|EOA28564.1| hypothetical protein CARUB_v10024782mg [Capsella rubella]
Length=420

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 79/143 (55%), Gaps = 8/143 (6%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPP------DYIYKNKATEFS  299
            + W++YF++K ++ + ++ RN +LV+A L+   TYQA ++PP      DY        + 
Sbjct  260  KQWLDYFKYKKNKVSANEVRNVLLVIAILIATTTYQAVLSPPGGVWQEDYCINGYCQSWI  319

Query  300  TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTK  479
            ++ + +FL  N++   ++M +I  LT  +P+  EL+++   +   YG++  +  P  G  
Sbjct  320  SYGIFIFL--NSIGFFTSMELISLLTKGLPFYLELQVSLTAVALAYGFAMAALSPNFGLG  377

Query  480  TALIVVASLAPYLIRTLPNLFKK  548
               +V++ + P  +  +P+L +K
Sbjct  378  LFFMVLSVVLPIAVAKIPSLIRK  400



>gb|KDO57717.1| hypothetical protein CISIN_1g046832mg, partial [Citrus sinensis]
Length=328

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFSTFSLTV  317
             +++EYF+FK  RD+P + R+A+LVVAAL+   ++Q G+NPP       A  F+     +
Sbjct  205  HDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPG----GNAVAFA-----L  255

Query  318  FLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVV  497
            F+  N+L    ++ MI  LT   P Q  L++    M F Y  +  +T P+ G +  +IV 
Sbjct  256  FMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPV-GIRIFIIVT  314

Query  498  ASLAPYLI  521
             ++ P LI
Sbjct  315  EAIIPALI  322



>ref|XP_010260927.1| PREDICTED: uncharacterized protein LOC104599880 [Nelumbo nucifera]
Length=214

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 13/128 (10%)
 Frame = +3

Query  174  RDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-----------ATEFSTFSLTVF  320
            RD   + RN +LVVAAL+  V++QAG+NPP  ++++            A     FSL  F
Sbjct  33   RDYTHETRNVLLVVAALIATVSFQAGVNPPGGVWQDDDGGHKAGRSIYADHPVAFSL--F  90

Query  321  LVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVA  500
            L ANTL LS+++ +I YLT   P   E+ IA + M+  Y  +  +  P    K   I++A
Sbjct  91   LTANTLGLSASINIIAYLTYGFPLYMEVLIAIYSMIGTYASAVVAVTPKGSVKFRYILIA  150

Query  501  SLAPYLIR  524
            +  PY +R
Sbjct  151  AAIPYALR  158



>ref|XP_008366860.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=475

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 23/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++ +        
Sbjct  279  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNKNGTG  337

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S F    F+V N++    ++  +  LT N P + EL+I    +
Sbjct  338  RSNEPVXSAGQSIMGSYSEFFFVYFVVLNSIGFYFSLYTMSVLTSNFPLRMELQICIGAV  397

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYL  518
             F Y  +     P   ++  +IV   + P L
Sbjct  398  YFAYSTAVYKIAPSIYSRLFIIVFTCVWPLL  428



>ref|XP_008388996.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=475

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 23/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++ +        
Sbjct  279  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNKNGTG  337

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S F    F+V N++    ++  +  LT N P + EL+I    +
Sbjct  338  RSNEPVXSAGQSIMGSYSEFFFVYFVVLNSIGFYFSLYTMSVLTSNFPLRMELQICIGAV  397

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYL  518
             F Y  +     P   ++  +IV   + P L
Sbjct  398  YFAYSTAVYKIAPSIYSRLFIIVFTCVWPLL  428



>ref|XP_010242324.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Nelumbo 
nucifera]
Length=457

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 74/154 (48%), Gaps = 18/154 (12%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            +  +E+F+F+  RD PSDAR A+LV+A L+   TYQA ++PP  ++++            
Sbjct  285  DRLVEFFKFQRGRDPPSDARXALLVIAILIATTTYQAVLSPPGGLWQDSTAPDGNYTMKA  344

Query  291  ---------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGW  443
                          S  +F+ +N+     ++ MI  LT   P Q EL+I+   MM  Y  
Sbjct  345  HTAGKSILGSVDLISFGLFVFSNSAGFFLSLFMINILTSGFPLQLELQISLIAMMLTYDT  404

Query  444  SSCSTEPISGTKTALIVVASLAPYLIRTLPNLFK  545
            +  +  P    KT  I+++S+ P  I  +  L +
Sbjct  405  AMGAIIPNGRMKTLFIIISSVLPTAIPCVAKLVR  438



>ref|XP_006375176.1| hypothetical protein POPTR_0014s04980g, partial [Populus trichocarpa]
 gb|ERP52973.1| hypothetical protein POPTR_0014s04980g, partial [Populus trichocarpa]
Length=209

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (48%), Gaps = 32/160 (20%)
 Frame = +3

Query  141  NWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKN-------------  281
            +W++ F++   RD+P+D RN +LV+A L+  VT+QAG+NPP  ++++             
Sbjct  19   HWLKRFQYDKERDSPNDVRNVLLVIATLIAAVTFQAGVNPPGGVWQDDNGIKPAAGANPP  78

Query  282  ------KATEFSTFSLT-------------VFLVANTLSLSSAMAMIEYLTVNMPYQREL  404
                  +  +F                   VFL++NTL+ S+++ +I  LT   P+  E+
Sbjct  79   SPGGERQEYKFEEHHAAGRAIYASQKHPYYVFLMSNTLAFSASLLVIPSLTYKFPFHFEI  138

Query  405  RIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIR  524
             +A   MM  Y  +  +  P        +++ +  P++ R
Sbjct  139  WVATASMMVTYASAIFAVTPRESVHFRYLLITAAVPFITR  178



>emb|CBI36460.3| unnamed protein product [Vitis vinifera]
Length=389

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 73/174 (42%), Gaps = 47/174 (27%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD-----------  266
            LP     NW  Y+ F   RD P DARN +LVVAAL+  VT+QAG+NPP            
Sbjct  196  LPEDPSTNWYAYYRFNPRRDMPGDARNTLLVVAALIAAVTFQAGLNPPSSFLPEGPATKE  255

Query  267  ---------YIYKNKATEFSTF---------------------------SLTVFLVANTL  338
                      +   + TE + F                             T+FL  NTL
Sbjct  256  GAETCSGRVILPSKENTEHTLFLSCNTTSGEQGVKEGSVSVVLASTQKVQFTLFLFCNTL  315

Query  339  SLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVA  500
            +LS+++  I  L +  P+  E+  A + MM  YG S  + EP  G     ++++
Sbjct  316  ALSASIQTITALIIGCPFSFEVLTAIYSMMATYGVSIATLEPPRGVLLECLIIS  369



>ref|XP_004309013.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Fragaria 
vesca subsp. vesca]
Length=564

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 19/116 (16%)
 Frame = +3

Query  135  PENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT--------  290
            P ++IEYF+FK  RD+PSDAR A+LVVA L+   T+Q G++PP  ++++           
Sbjct  280  PTDFIEYFKFKKGRDSPSDARTALLVVAVLVTTATFQVGLSPPTGLWQDTELNRNGTSGE  339

Query  291  -----------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                        ++  +  VF+  N++  S ++ MI  LT N P Q EL+I    M
Sbjct  340  PTHTAGSSILGSYNAAAFLVFVAFNSIGFSVSLYMINILTSNFPMQLELQICIVAM  395



>gb|KDO57720.1| hypothetical protein CISIN_1g042799mg [Citrus sinensis]
Length=449

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  150  EYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS----------  299
            EYF+FK  RD+P + R+++LVVAAL+   T+Q G+NPP   +++ +   S          
Sbjct  286  EYFKFKKGRDSPGETRSSLLVVAALVATTTFQFGVNPPGGAWQDNSIPTSKTHIAGESIW  345

Query  300  ----TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
                T +  +++  N+L    ++ MI  LT   P Q EL++    M F Y  +  S  P 
Sbjct  346  GSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAP-  404

Query  468  SGTKTALIVVASLAPYLI  521
             G K  +I+  S+ P  I
Sbjct  405  DGVKLFVILTISILPVAI  422



>ref|XP_007219523.1| hypothetical protein PRUPE_ppa022541mg, partial [Prunus persica]
 gb|EMJ20722.1| hypothetical protein PRUPE_ppa022541mg, partial [Prunus persica]
Length=341

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 77/164 (47%), Gaps = 39/164 (24%)
 Frame = +3

Query  27   MYVLKSLRSETNMASVEMGNMSNREGDRV----------------DMLPNGKPENWIEYF  158
            + +  S  S+  M ++  G  + R GD V                D  P  +P+N +E+F
Sbjct  176  LLIFPSEASDREMEAILRGTGAMRAGDIVHSGVPSHNHPHAPMESDTNPLQQPDNLVEFF  235

Query  159  EFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK--------------NKATEF  296
            +FK  RD+PSDAR+A+LVVA L+   TYQ   NPP  +++              N +T +
Sbjct  236  KFKKGRDSPSDARDALLVVAVLVATTTYQVAANPPGGVWQDAVLNKNGTTSNTSNASTHY  295

Query  297  STFSL---------TVFLVANTLSLSSAMAMIEYLTVNMPYQRE  401
            +   +          VF V N++  S ++ MI+ LT N P Q E
Sbjct  296  AGTDILGSYYPAYFIVFAVFNSIGFSMSLHMIKILTTNFPLQLE  339



>ref|XP_010654964.1| PREDICTED: uncharacterized protein LOC104880328 [Vitis vinifera]
Length=196

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 74/174 (43%), Gaps = 51/174 (29%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD-YIYKNKAT--  290
            LP     NW  Y+ F   RD P DARN +LVVAA    VT+QAG+NPP  ++ +  AT  
Sbjct  7    LPEDPSTNWYAYYRFNPRRDMPGDARNTLLVVAA----VTFQAGLNPPSSFLPEGPATKE  62

Query  291  EFSTFS--------------------------------------------LTVFLVANTL  338
            E  T S                                             T+FL  NTL
Sbjct  63   EVETCSGRVILPSKENTVHTLFLSCNTTSGEQGVKQGSVSVVLASTQKVQFTLFLFCNTL  122

Query  339  SLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVA  500
            +LS+++ +I  L +  P+  E+  A + MM  YG S  + EP  G     ++++
Sbjct  123  ALSASIQIITALIIGCPFSFEVLTAIYSMMATYGVSIATLEPPRGVLLECLIIS  176



>ref|XP_006375177.1| hypothetical protein POPTR_0014s04990g [Populus trichocarpa]
 gb|ERP52974.1| hypothetical protein POPTR_0014s04990g [Populus trichocarpa]
Length=321

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 76/140 (54%), Gaps = 17/140 (12%)
 Frame = +3

Query  141  NWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATE---------  293
            +W +  ++   RD+P+DARN +L +A+L+  VT++AG+NPP  ++++             
Sbjct  171  SWFKRLQYDKERDSPNDARNVLLEIASLIAAVTFEAGVNPPGGVWRDDNVNEHHAAGRAI  230

Query  294  --FSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
              F      VFL+++TL  S+++ +I  LT   P+  E+ +A   MM  Y     ++   
Sbjct  231  YAFQKPPYYVFLMSSTLEFSASLLVIPSLTYEFPFHFEIWVATASMMVTY-----ASAIF  285

Query  468  SGTKTALIVVASLAPYLIRT  527
            + T   L++ AS+ P++ R+
Sbjct  286  AVTHHYLLITASV-PFISRS  304



>ref|XP_003635081.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis 
vinifera]
Length=460

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = +3

Query  144  WIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF----STFSL  311
            W  YF+F++ RDTPS+ R A+LVVA L+   TYQ G + P ++ +  + +F    ++ +L
Sbjct  305  WRNYFKFQFDRDTPSNVREALLVVAVLIAAATYQTGQSIPTWVQQKGSDKFEMIRASHNL  364

Query  312  TVFL---VANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKT  482
             +FL   ++NT+    ++ MI  LT   P   EL +A   M   Y  S     P  G K 
Sbjct  365  VLFLFYSLSNTVGFLVSLDMILVLTSKFPMCWELVVAVHAMAINYSISIVGIAPSGGMKI  424

Query  483  A  485
            A
Sbjct  425  A  425



>emb|CBI40931.3| unnamed protein product [Vitis vinifera]
Length=372

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 7/121 (6%)
 Frame = +3

Query  144  WIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEF----STFSL  311
            W  YF+F++ RDTPS+ R A+LVVA L+   TYQ G + P ++ +  + +F    ++ +L
Sbjct  217  WRNYFKFQFDRDTPSNVREALLVVAVLIAAATYQTGQSIPTWVQQKGSDKFEMIRASHNL  276

Query  312  TVFL---VANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKT  482
             +FL   ++NT+    ++ MI  LT   P   EL +A   M   Y  S     P  G K 
Sbjct  277  VLFLFYSLSNTVGFLVSLDMILVLTSKFPMCWELVVAVHAMAINYSISIVGIAPSGGMKI  336

Query  483  A  485
            A
Sbjct  337  A  337



>ref|XP_008376967.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103440060 
[Malus domestica]
Length=572

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 74/145 (51%), Gaps = 23/145 (16%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY-------KNKAT  290
            +P N +EYF+FK  RD+PSDAR A+LVVA L+   T+QAG++PP  ++       KN   
Sbjct  387  QPNNPMEYFKFKMGRDSPSDARTALLVVAVLVATATFQAGLSPPGGVWQDSTGSNKNGTG  446

Query  291  EFST---------------FSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
              S                 S   F+V N++    ++ MI  LT+N P Q EL+I    +
Sbjct  447  SGSNEPAHSAGESVMGSYHVSFVGFMVLNSIGFFVSLDMINVLTINFPLQLELQICMVAI  506

Query  426  MFGYGWSSCSTEPISGTKTALIVVA  500
               Y ++  S  P + T +AL V A
Sbjct  507  YCTYIFAVISIAPKTMT-SALSVFA  530



>gb|KDO57716.1| hypothetical protein CISIN_1g0128361mg, partial [Citrus sinensis]
Length=452

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 77/158 (49%), Gaps = 27/158 (17%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY--------KNKA  287
            +P + +EYF+FK  RD+P +  +A+LVVA L+   T+Q G+NPP  ++        KN  
Sbjct  282  QPNDLMEYFKFKKGRDSPGETLSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGT  341

Query  288  TEFSTFS-------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
            T    +S               +F+  N++  S ++ MI  LT N P Q EL++  F M 
Sbjct  342  TSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELQLCFFAMY  401

Query  429  FGYGWSSCSTEP------ISGTKTALIVVASLAPYLIR  524
              Y  +  +  P      ++ T   +  V +LA YL+R
Sbjct  402  VTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLR  439



>ref|XP_010052784.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Eucalyptus 
grandis]
 ref|XP_010052785.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Eucalyptus 
grandis]
 ref|XP_010052786.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Eucalyptus 
grandis]
 ref|XP_010052787.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Eucalyptus 
grandis]
Length=465

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 24/124 (19%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK---------NKAT  290
            + W E F++K  RD+P D RNA+LV+AAL+   TYQA + PP  +++           AT
Sbjct  296  DEWFEEFQYKKGRDSPGDVRNALLVIAALIATATYQAVLQPPGGLWQADSGPSTNGTNAT  355

Query  291  EFSTFS---------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
               T S                 VFL+ NT    +++ MI  LT   P QRELR+A   +
Sbjct  356  TNGTASYKAGQSVLGTTNEVAFMVFLIFNTTGFFASLQMIYILTWGFPMQRELRVAMLAL  415

Query  426  MFGY  437
            +  Y
Sbjct  416  IMTY  419



>ref|XP_004309014.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Fragaria 
vesca subsp. vesca]
Length=441

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 59/101 (58%), Gaps = 9/101 (9%)
 Frame = +3

Query  135  PENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY------KNKATEF  296
            P+N +EYF+F+  RD+P DARNA+LVVA L+   TY+  +NPP  ++      KN     
Sbjct  275  PKNLVEYFKFRRGRDSPDDARNALLVVAVLVATATYETALNPPGGLWPDTNLSKNGTEPL  334

Query  297  STFSLTVFLVA---NTLSLSSAMAMIEYLTVNMPYQRELRI  410
              ++L  F +    N++  S ++ +I  LT N P + EL++
Sbjct  335  QGYNLAYFFIGAVYNSIGFSVSLYIINILTTNFPLRLELQV  375



>ref|XP_002321785.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF05912.1| ankyrin repeat family protein [Populus trichocarpa]
Length=255

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 26/128 (20%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS  299
            L NG   N IEYF+FK  RD+PS+AR+ +LV+A L+   T+Q G+NPP  ++++      
Sbjct  78   LSNGN--NLIEYFKFKKGRDSPSEARSTLLVIAVLVATATFQVGVNPPGGVWQDTNIPDH  135

Query  300  TFSLT---------------------VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAG  416
            T S +                     +F+  N++  S ++ MI  LT   P Q EL+I  
Sbjct  136  TNSTSSSNAHFGGQSIMATTNKVGFMLFVFFNSVGFSMSLYMIYVLTSEFPLQFELQI--  193

Query  417  FCMMFGYG  440
             C++  YG
Sbjct  194  -CLLAMYG  200



>gb|KCW76859.1| hypothetical protein EUGRSUZ_D01212 [Eucalyptus grandis]
Length=453

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 24/124 (19%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK---------NKAT  290
            + W E F++K  RD+P D RNA+LV+AAL+   TYQA + PP  +++           AT
Sbjct  284  DEWFEEFQYKKGRDSPGDVRNALLVIAALIATATYQAVLQPPGGLWQADSGPSTNGTNAT  343

Query  291  EFSTFS---------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
               T S                 VFL+ NT    +++ MI  LT   P QRELR+A   +
Sbjct  344  TNGTASYKAGQSVLGTTNEVAFMVFLIFNTTGFFASLQMIYILTWGFPMQRELRVAMLAL  403

Query  426  MFGY  437
            +  Y
Sbjct  404  IMTY  407



>emb|CDY38856.1| BnaA03g13230D [Brassica napus]
Length=430

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 80/163 (49%), Gaps = 24/163 (15%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++  T         
Sbjct  255  KDLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSYTPDVSQNATS  314

Query  291  ------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
                         F+  + T+F+  NT+  S +++M+  LT+  P + +L+I    M F 
Sbjct  315  QQPHIAGQSIMGTFNGIAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMMAMYFS  374

Query  435  YGWSSCSTEPISGTKTALIVVASLA---PYLIRTLPNLFKKCC  554
            +  +  S  P       +++ + LA   P L+R L       C
Sbjct  375  HNTAMTSVAPDHVKLYCVLITSILAAATPALMRLLEKPIAMLC  417



>ref|XP_009132618.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Brassica 
rapa]
Length=430

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 80/163 (49%), Gaps = 24/163 (15%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++  T         
Sbjct  255  KDLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSYTPDVSQNATS  314

Query  291  ------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
                         F+  + T+F+  NT+  S +++M+  LT+  P + +L+I    M F 
Sbjct  315  QQPHIAGQSIMGTFNGIAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMMAMYFS  374

Query  435  YGWSSCSTEPISGTKTALIVVASLA---PYLIRTLPNLFKKCC  554
            +  +  S  P       +++ + LA   P L+R L       C
Sbjct  375  HNTAMTSVAPDHVKLYCVLITSILAAATPALMRLLEKPIAMLC  417



>ref|XP_006279812.1| hypothetical protein CARUB_v10028013mg [Capsella rubella]
 gb|AFJ66229.1| hypothetical protein 34G24.15 [Capsella rubella]
 gb|EOA12710.1| hypothetical protein CARUB_v10028013mg [Capsella rubella]
Length=435

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 80/163 (49%), Gaps = 29/163 (18%)
 Frame = +3

Query  129  GKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD---------YIYKN  281
            G  +  ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP           + +N
Sbjct  251  GSHKELVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVSQN  310

Query  282  KATE-----------------FSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRI  410
            K +                  F+  + T+F+  NT+  S +++M+  LT+  P + +L+I
Sbjct  311  KTSANATIQQAHIAGQSIMGTFNGIAFTMFVFFNTIGFSVSLSMLNILTLGFPLRFQLQI  370

Query  411  AGFCMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTL  530
                M F +  +  S  P       +++ + LA   P L+R L
Sbjct  371  CMMAMYFSHNTAMTSIAPDQVKLYCILITSILAAATPSLMRLL  413



>ref|XP_008388997.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=467

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 78/157 (50%), Gaps = 23/157 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-----------  278
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I++           
Sbjct  279  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNNNGTX  337

Query  279  --NKATEFSTFSL---------TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
              N+    +  S+          VF+V N++    ++  +  LT N P + ELRI    +
Sbjct  338  SSNEPVHLAGXSIMGSYSEVSFVVFVVLNSIGFYYSIYTMSVLTSNFPLKLELRICFEAV  397

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPN  536
             + Y  +  +  P + T   + V   + P+L   L N
Sbjct  398  YYAYSTAVYNIAPSNNTSLYITVFTMVLPFLAHILSN  434



>ref|XP_010507738.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Camelina 
sativa]
Length=453

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 81/164 (49%), Gaps = 27/164 (16%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPP------DY----------  269
            + W++YF++K  R +P++ RN +LV+A L+   TYQA ++PP      DY          
Sbjct  271  KQWLDYFKYKKDRVSPNEVRNVLLVIAILIATATYQAVLSPPGGVWQEDYCIDGFCQLTD  330

Query  270  IYKNKATEF-----------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAG  416
            I +NK               S  S  +F+  N++   +++ +I  LT  +P+  EL+++ 
Sbjct  331  IKENKIKPVYYAGTTIMGSKSWISYGIFIFLNSVGFFTSIELISLLTKGLPFYLELQVSL  390

Query  417  FCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
              +   YG++  +  P  G     +V++ + P  +  +P+L +K
Sbjct  391  TAVALTYGFAMAALSPNFGLGLFFMVLSVVLPIAVARIPSLIRK  434



>ref|XP_006437043.1| hypothetical protein CICLE_v10033891mg [Citrus clementina]
 gb|ESR50283.1| hypothetical protein CICLE_v10033891mg [Citrus clementina]
Length=438

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 70/138 (51%), Gaps = 16/138 (12%)
 Frame = +3

Query  150  EYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS----------  299
            EYF+FK  RD+P + R+++LVVAAL+   T+Q G+NPP   +++ +   S          
Sbjct  276  EYFKFKKGRDSPGETRSSLLVVAALVA-TTFQFGVNPPGGAWQDNSIPTSKTHIAGESIW  334

Query  300  ----TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
                T +  +++  N+L    ++ MI  LT   P Q EL++    M F Y  +  S  P 
Sbjct  335  GSTNTIAFRLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAP-  393

Query  468  SGTKTALIVVASLAPYLI  521
             G K  +I+  S+ P  I
Sbjct  394  DGVKLFVILTISILPVAI  411



>ref|XP_006375174.1| hypothetical protein POPTR_0014s04960g, partial [Populus trichocarpa]
 gb|ERP52971.1| hypothetical protein POPTR_0014s04960g, partial [Populus trichocarpa]
Length=182

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (52%), Gaps = 10/129 (8%)
 Frame = +3

Query  168  YSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATE-----FSTFS-----LTV  317
            +  +T  D RN +LV AAL+  VT+QAGI PP  ++++   +      + +S       +
Sbjct  34   WKTETNGDIRNVMLVGAALIATVTFQAGITPPGGVWQSDDNQGHRAGHAVYSDQKVPFQI  93

Query  318  FLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVV  497
            FL+ NT++L+S++ ++  LT   PY  E+ IA   MM  Y        P       LI V
Sbjct  94   FLICNTIALTSSIFLLLCLTFGYPYFLEVLIATISMMGTYSSGIYCITPYESVSFRLIFV  153

Query  498  ASLAPYLIR  524
            A+ AP +IR
Sbjct  154  AAPAPIVIR  162



>ref|NP_199929.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
 dbj|BAA97378.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS77479.1| At5g51160 [Arabidopsis thaliana]
 dbj|BAD42930.1| putative protein [Arabidopsis thaliana]
 dbj|BAD94109.1| putative protein [Arabidopsis thaliana]
 gb|AED96045.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
Length=442

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 79/162 (49%), Gaps = 29/162 (18%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            +  ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++ +          
Sbjct  252  KELVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVSQNTTN  311

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++M+  LT+  P + +L+I   
Sbjct  312  VNTTNQQAHTAGQSIMGTFNGVAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMI  371

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTLPN  536
             M F +  +  S  P       +++ + LA   P L+R L N
Sbjct  372  AMYFSHNTTMASIAPDHVKLYCILITSILAATTPGLMRLLEN  413



>emb|CDX74683.1| BnaA05g04290D [Brassica napus]
Length=456

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 79/165 (48%), Gaps = 28/165 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-------------  278
            + W++YF+ K  + +P++ RN +LV+A L+   TYQA ++PP  I++             
Sbjct  275  KQWLDYFKHKKDKVSPNEIRNVLLVIAILIATTTYQAALSPPGGIWQEDYYCIGRYCQES  334

Query  279  ----NKATEF-----------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIA  413
                NK               S  S  +F+  N++   +++ +I  LT  +P+  EL+++
Sbjct  335  ETKGNKTKPVYYAGTTIMGSKSWISYGIFIFLNSVGFFTSIELISLLTKGLPFYLELQVS  394

Query  414  GFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
               +   YG++  +  P  G     +V++ + P+ +  +P+L  K
Sbjct  395  LTALALTYGFAMAALSPNFGLGLFFMVISVVLPFAVAKIPSLIHK  439



>emb|CDY32636.1| BnaC03g16040D [Brassica napus]
Length=434

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 80/168 (48%), Gaps = 29/168 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++  T         
Sbjct  254  KDLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSYTPASSQNTTS  313

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++M+  LT+  P + +L+I   
Sbjct  314  VKTPSQQPYIAGQSIMGTFNGIAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMM  373

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTLPNLFKKCC  554
             M F +  +  S  P       +++ + LA   P L+R L       C
Sbjct  374  AMYFSHNTAMTSVAPDHVKLYCILITSILAAATPALMRLLEKPIAMLC  421



>ref|XP_006376955.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|ERP54752.1| ankyrin repeat family protein [Populus trichocarpa]
Length=448

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 63/127 (50%), Gaps = 22/127 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK------------N  281
            +N +EYF+FK  RD+PS+AR  +LV+A L+   T+Q G+ PP  +++            N
Sbjct  275  DNLVEYFKFKKDRDSPSEARGTLLVIAVLVATATFQVGVGPPGGVWQDTSIPDQKNITSN  334

Query  282  KATEFS---------TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
                F+         T    +F+  N++  S ++ M+  LT   P Q EL+I    M   
Sbjct  335  NTAHFAGQSIMATTNTVGFMLFVFFNSVGFSMSLYMLYVLTSKFPLQFELQICLLAMYCT  394

Query  435  YGWS-SC  452
            YG + SC
Sbjct  395  YGTALSC  401



>ref|XP_009143063.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Brassica 
rapa]
Length=458

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 79/165 (48%), Gaps = 28/165 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK-------------  278
            + W++YF+ K  + +P++ RN +LV+A L+   TYQA ++PP  I++             
Sbjct  275  KQWLDYFKHKKDKVSPNEIRNVLLVIAILIATTTYQAALSPPGGIWQEDYYCIGRYCQES  334

Query  279  ----NKATEF-----------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIA  413
                NK               S  S  +F+  N++   +++ +I  LT  +P+  EL+++
Sbjct  335  ETKGNKTKPVYYAGTTIMGSKSWISYGIFIFLNSVGFFTSIELISLLTKGLPFYLELQVS  394

Query  414  GFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
               +   YG++  +  P  G     +V++ + P+ +  +P+L  K
Sbjct  395  LTALALTYGFAMAALSPNFGLGLFFMVISVVLPFAVAKIPSLIHK  439



>ref|XP_010508259.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Camelina 
sativa]
Length=484

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 80/164 (49%), Gaps = 27/164 (16%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKN--------KATE  293
            + W++YF++K  R +P + RN +LV+A L+   TYQA ++PP  +++         K T+
Sbjct  279  KQWLDYFKYKKDRVSPHEVRNVLLVIAILIATATYQAVLSPPGGVWQEDYCIDGFCKVTD  338

Query  294  F-------------------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAG  416
                                S  +  +F+  N++   +++ +I  LT  +P+  EL+++ 
Sbjct  339  LKENKTKPVYYAGTTIMGSKSWVNYGIFIFLNSVGFFTSIELISLLTKGLPFYLELQVSL  398

Query  417  FCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
              +   YG++  +  P  G     +V++ + P  +  +P+L +K
Sbjct  399  NAVALTYGFAMAALSPNFGLGLFFMVLSVVLPIAVARIPSLIRK  442



>ref|XP_011085716.1| PREDICTED: uncharacterized protein LOC105167627 [Sesamum indicum]
Length=158

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 9/128 (7%)
 Frame = +3

Query  195  RNailvvaallvQVTYQAGINPPDYIYKNKATEFSTF---------SLTVFLVANTLSLS  347
            RN +L+VAAL+  VT+QAG+NPP  ++++                 +   FL++NTL+LS
Sbjct  26   RNVLLIVAALITAVTFQAGVNPPGGVWQDSKDGHKAGRAIYSSDKGAFYTFLISNTLALS  85

Query  348  SAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRT  527
            S++ ++  LT   PY  EL +A   M   Y  S  +  P    K   ++  +  P+++R 
Sbjct  86   SSILVLMALTYRFPYHVELWVAIMAMFVTYAASVFAVAPDESVKFRYLLATAAGPFVLRF  145

Query  528  LPNLFKKC  551
            +    K+ 
Sbjct  146  VMETVKRL  153



>ref|XP_010680067.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Beta 
vulgaris subsp. vulgaris]
Length=435

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 75/152 (49%), Gaps = 13/152 (9%)
 Frame = +3

Query  126  NGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-------  284
            N + ++ IEYF F   RD+PSD R+ +LV+A L+V  TYQ G +PP  ++++        
Sbjct  263  NNRAKDLIEYFRFHDGRDSPSDVRSTLLVIAVLVVTATYQVGNSPPGDVWQDDDEGHLAG  322

Query  285  ----ATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSC  452
                AT+    S  + +  N++  + ++ MI  LT   P Q EL++  F +   +  +  
Sbjct  323  TSIMATK-DLVSYILLVTCNSIGFNVSLYMIYTLTRKFPLQTELQVCVFALYMTFNVAVT  381

Query  453  STEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
             T P S T+    V  S+ P  +     L +K
Sbjct  382  VTSPKS-TRLFTNVFTSVLPTAVPLACGLLRK  412



>ref|XP_010482448.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Camelina 
sativa]
Length=434

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 80/160 (50%), Gaps = 29/160 (18%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD---------YIYKNKAT  290
            +N ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP           +Y+N  +
Sbjct  253  KNLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVYQNTTS  312

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++++  LT+  P + +L+I   
Sbjct  313  VNGTNQQAHIAGQSIMGTFNGVAFTMFVFFNTIGFSVSLSILNILTLGFPLRFQLQICMM  372

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTL  530
             M F +  +  S  P       +++ + LA   P L+R L
Sbjct  373  AMYFSHNTAMTSIAPDQVKLYCILITSILAAATPSLMRFL  412



>gb|KFK26730.1| hypothetical protein AALP_AA8G285300 [Arabis alpina]
Length=432

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 82/168 (49%), Gaps = 29/168 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPD---------YIYKNKAT  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP           + +NK +
Sbjct  254  KDLVKYFTFKKYRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSNIPAVSQNKTS  313

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++M+  LT+  P Q +L++   
Sbjct  314  VNSTNQQAHTAGQSIMGTFNGVAFTLFVFFNTIGFSVSLSMLNILTLGFPLQFQLQVCMM  373

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTLPNLFKKCC  554
             M F +  +  S  P +     +++ + LA   P L+R L       C
Sbjct  374  AMYFSHNTAMTSIAPDNVKLYCILITSILAATTPSLMRLLEKPIGMLC  421



>gb|AFJ66184.1| hypothetical protein 11M19.23, partial [Arabidopsis halleri]
Length=411

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 30/162 (19%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            +  ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++ +          
Sbjct  221  KELVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPTVSQNTTS  280

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++M+  LT+  P + +L+I   
Sbjct  281  VNTTNQQAHIAGQSIMGTFNGVAFTLFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMI  340

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFK  545
             M F +  +  S  P    K   I++ S+   L  T P+L K
Sbjct  341  AMYFSHNTTMASIAP-DNVKIYCILITSI---LAATTPSLMK  378



>ref|XP_011003549.1| PREDICTED: alpha-latrotoxin-Lt1a-like [Populus euphratica]
Length=448

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 22/127 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKN------------  281
            +N++EYF+FK  RD+PS+AR A+LV+A L+   T+Q G+ PP  ++++            
Sbjct  275  DNFVEYFKFKKDRDSPSEARGALLVIAVLVATATFQVGVGPPGGVWQDTNIPDQKNITSS  334

Query  282  KATEFS---------TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFG  434
                F+         T    +F+  N++  S ++ M+  LT   P Q EL+I    M   
Sbjct  335  NTAHFAGQSIMATTNTVGFMLFVFFNSVGFSMSLYMLYVLTSKFPLQFELQICLLAMYCT  394

Query  435  YGWS-SC  452
            YG + SC
Sbjct  395  YGTALSC  401



>emb|CDY48256.1| BnaC04g05150D [Brassica napus]
Length=458

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 78/165 (47%), Gaps = 28/165 (17%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY--------------  275
            + W++YF  K  + +P++ RN +LV+A L+   TYQA ++PP  I+              
Sbjct  275  KQWLDYFMHKKDKVSPNEIRNVLLVIAILIATTTYQAALSPPGGIWQEDYYCIGRYCQES  334

Query  276  -----KNKATEF---------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIA  413
                 K K   +         S  S  +F+  N++   +++ +I  LT  +P+  EL+++
Sbjct  335  ETTGNKTKPVHYAGTTIMGSKSWISYGIFIFLNSVGFFTSIELISLLTKGLPFYLELQVS  394

Query  414  GFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
               +   YG++  +  P  G     +V++ + P+    +P+L +K
Sbjct  395  LTALALTYGFAMAALSPNFGLGVFFMVISVVLPFAAAKIPSLIRK  439



>gb|KDO46882.1| hypothetical protein CISIN_1g023199mg [Citrus sinensis]
Length=286

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = +3

Query  150  EYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS----------  299
            E+F+FK  RD+P + R+++LVVAAL+   T+Q  +NPP   +++ +T  S          
Sbjct  123  EFFKFKKGRDSPGETRSSLLVVAALVATTTFQFCVNPPGGTWQDNSTPSSKAHIAGESIW  182

Query  300  ----TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPI  467
                T +  +++  N+L    ++ MI  LT   P Q EL++    M F Y  +  S  P 
Sbjct  183  GSTNTIAFCLYMFFNSLGFKLSLQMINILTTKFPLQFELQLCFLAMNFTYDTAVISIAP-  241

Query  468  SGTKTALIVVASLAPYLI  521
               K  +I+  S+ P  I
Sbjct  242  DEVKLFVILTISILPLAI  259



>ref|XP_006485162.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Citrus 
sinensis]
Length=445

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 29/158 (18%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY--------KNKA  287
            +P + +EYF+FK  RD+P + R+A+LVVA L+   T+Q G+NPP  ++        KN  
Sbjct  277  QPNDLMEYFKFKNGRDSPGETRSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGT  336

Query  288  TEFSTFS-------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
            T    +S               +F+  N++  S ++ MI  LT N P Q EL    F M 
Sbjct  337  TSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLELCF--FAMY  394

Query  429  FGYGWSSCSTEP------ISGTKTALIVVASLAPYLIR  524
              Y  +  +  P      ++ T   +  V +LA YL+R
Sbjct  395  VTYTNAVITIAPDGMSLFVTLTVAIMPAVIALAAYLLR  432



>ref|XP_010442600.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Camelina 
sativa]
Length=434

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 79/160 (49%), Gaps = 29/160 (18%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++ +          
Sbjct  253  KDLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVSQNTTS  312

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++M+  LT+  P + +L+I   
Sbjct  313  VTATNQQAHIAGQSIMGTFNGVAFTMFVFFNTIGFSVSLSMLNILTLGFPLRFQLQICMM  372

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTL  530
             M F +  +  S  P       +++ + LA   P L+R L
Sbjct  373  AMYFSHNTAMTSIAPDQVKLYCILITSILAAATPSLMRLL  412



>ref|XP_010054546.1| PREDICTED: uncharacterized protein LOC104442870 [Eucalyptus grandis]
Length=314

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 68/129 (53%), Gaps = 12/129 (9%)
 Frame = +3

Query  174  RDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS---------TFSLTVFLV  326
            ++ P + RN +LVVA L+  VT+QAG+NPP  +++  + +             +  VFL 
Sbjct  26   KNKPEEVRNYLLVVATLIAAVTFQAGVNPPGGVWQENSHDHKAGRAIYASDVMAFYVFLT  85

Query  327  ANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYG---WSSCSTEPISGTKTALIVV  497
             NTL+LSS++ +I  LT   P+  E+ +A   M+  YG   ++   TE +   +   ++ 
Sbjct  86   CNTLALSSSIFLIINLTWGFPFFLEVLVATVSMLMTYGASIFAITPTETMPSVQFRYVLA  145

Query  498  ASLAPYLIR  524
             +  P ++R
Sbjct  146  IAAVPIIVR  154



>ref|XP_008388990.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=475

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 74/151 (49%), Gaps = 23/151 (15%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT-------  290
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++ +        
Sbjct  279  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDSSDVNNNGTR  337

Query  291  ---------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
                            +S  S  VF+V N++     +  +  LT N P + ELRI    +
Sbjct  338  SSNEPVHLAGKSIMGSYSEVSFVVFVVLNSIGFYXXIYTMXVLTXNFPLKLELRICFEAV  397

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYL  518
             + Y  +  +  P   T   + V   + P+L
Sbjct  398  YYAYSTAVYNXAPSBNTSLYITVFTMVLPFL  428



>ref|XP_006375175.1| hypothetical protein POPTR_0014s04970g [Populus trichocarpa]
 gb|ERP52972.1| hypothetical protein POPTR_0014s04970g [Populus trichocarpa]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 10/124 (8%)
 Frame = +3

Query  189  DARNailvvaallvQVTYQAGINPPDYIYK------NKATEF----STFSLTVFLVANTL  338
            D RN +L  AAL+  VT+QAGI+PP  +++      +KA             +FL+ NT+
Sbjct  42   DIRNVLLAGAALIATVTFQAGISPPGGVWQSDDKLGHKAGRAIYSDQRIPFQIFLLCNTI  101

Query  339  SLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYL  518
            +L+S+  ++  LT   PY  E+ IA   MM  YG +     P       LI +A+  P +
Sbjct  102  ALTSSSFLLLCLTFRYPYFLEVFIATISMMGTYGSAIYCVTPYESVSFRLIFLAAPVPMV  161

Query  519  IRTL  530
            IR L
Sbjct  162  IRVL  165



>ref|XP_008343936.1| PREDICTED: uncharacterized protein LOC103406722 [Malus domestica]
Length=169

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 75/151 (50%), Gaps = 21/151 (14%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY-------KNKAT  290
            +P +  EYF+FK  R +  D    +LVVA L+   T+QAG++PP+          KN   
Sbjct  10   QPNDPTEYFKFKKGRKSDEDPSPVLLVVAVLVATTTFQAGLSPPNGGLHYTTGSNKNGTG  69

Query  291  EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYG---WSSCSTE  461
              S   + +++  NT+  S ++ MI++LT N P   +LR   FCM+  YG    +  ST 
Sbjct  70   CGSNGLVVLYMFFNTIGFSVSLIMIDFLTRNFPLLFKLR---FCMVMMYGTYTVAVISTA  126

Query  462  PISGTKTALIVVASLAPYLIRTLPNLFKKCC  554
            P    K+ L+ + S  P  +  L    + CC
Sbjct  127  P----KSMLLCITSSTPLFVVIL----QLCC  149



>ref|XP_009759429.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Nicotiana 
sylvestris]
Length=463

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (46%), Gaps = 27/180 (15%)
 Frame = +3

Query  90   SNREGDRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDY  269
            S+RE  R    P  + +   +YF++  ++D+P  AR+ +LV+A L+   TYQA ++PP  
Sbjct  271  SSREHRRDR--PRSRSKKLQDYFKYNKTKDSPGKARDTLLVIAILIATATYQAVLSPPGG  328

Query  270  IYK--------NKATEFSTFSL-----------------TVFLVANTLSLSSAMAMIEYL  374
            +++        N  +   T SL                  + LV N++    ++  I +L
Sbjct  329  VWQDSYRPGGNNNTSSDDTMSLPHVAGQSVMGTNNPISYGLVLVFNSIGFYVSLHTINFL  388

Query  375  TVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKCC  554
            T+  P Q EL+++   +   YG    +  P  G     I+ +S+ P L+  +  L +  C
Sbjct  389  TIGFPLQLELQVSLVALTATYGIVMSAITPNRGIALFFIIFSSVFPVLLPYISMLLRNYC  448



>ref|XP_010426299.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Camelina 
sativa]
Length=434

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 29/160 (18%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++ +          
Sbjct  253  KDLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSSIPAVSQNTTS  312

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  S +++++  LT+  P + +L+I   
Sbjct  313  VNGTNQQVHIAGQSIMGTFNGVAFTMFVFFNTIGFSVSLSILNILTLGFPLRFQLQICMM  372

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTL  530
             M F +  +  S  P       +++ + LA   P L+R L
Sbjct  373  AMYFSHNTAMTSIAPDQVKLYCILITSILAAATPSLMRLL  412



>emb|CDP09407.1| unnamed protein product [Coffea canephora]
Length=457

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (46%), Gaps = 23/162 (14%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKN------------  281
            E  + YF+F   RD+P++ RN +LV+A L+   TYQA ++PP  ++++            
Sbjct  281  EKLLNYFKFDKLRDSPNEVRNTLLVLAVLIATATYQAVLSPPGGVWQDDYLPSQGTGTNA  340

Query  282  ------KATE-----FSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
                  KA E         S  +FL+ N++    +  MI  LT   P + EL ++ F ++
Sbjct  341  TSTKPHKAGEAVMGTHRKTSYGLFLIFNSIGFFMSTYMINVLTAGFPLRMELLVSLFALL  400

Query  429  FGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKKCC  554
              Y  S  +  P         +++++ P LI  +  + +  C
Sbjct  401  ATYDTSMAAISPDKDITLWFTILSAVLPVLIPIVTKIMRNHC  442



>ref|XP_006401542.1| hypothetical protein EUTSA_v10015398mg [Eutrema salsugineum]
 gb|ESQ42995.1| hypothetical protein EUTSA_v10015398mg [Eutrema salsugineum]
Length=455

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 23/123 (19%)
 Frame = +3

Query  75   EMGNMSNREGD---------RVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaall  227
            EMGN  ++E D         RV   PN K E  +E  +          ARN + +VA L+
Sbjct  240  EMGNFDSQEVDDLKLQKEIVRVKSSPNKKFEMQLEALQ---------SARNTLTIVAVLI  290

Query  228  vQVTYQAGINPPDYIYKN-----KATEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPY  392
              VT+  GINPP  +Y+      K+T   T +  +F ++N+++L ++++M+  L   +PY
Sbjct  291  ASVTFTCGINPPGGVYQETSSIGKSTAARTLAYMIFTISNSIALFTSVSMVVLLVSIIPY  350

Query  393  QRE  401
            ++E
Sbjct  351  KQE  353



>ref|XP_008370254.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Malus 
domestica]
Length=408

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFSTFSL  311
            K   W EYF+FK  RD+PSDARNA+LVVA+L+   T+Q G+NPP+ I+++     S  + 
Sbjct  281  KTNRW-EYFQFKKGRDSPSDARNALLVVASLVATATFQVGLNPPNGIWQDS----SDVNX  335

Query  312  TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALI  491
                 +N     +  +++     N P + ELRI    + + Y  +  +  P   T   + 
Sbjct  336  NGTXXSNEPVXXAGXSIM----ANFPLKLELRICFEAVYYAYSTAVYNNAPSDNTSLYIT  391

Query  492  VVASLAPY  515
            V   + P+
Sbjct  392  VFTMVLPF  399



>gb|KCW76855.1| hypothetical protein EUGRSUZ_D01209 [Eucalyptus grandis]
Length=455

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 65/131 (50%), Gaps = 24/131 (18%)
 Frame = +3

Query  144  WIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK---------------  278
            W+E F++   RD+P D RNA+L+VAAL+   TYQA + PP  +++               
Sbjct  297  WLENFKYNKERDSPGDVRNALLIVAALITIATYQAVLQPPGGVWQADSGSSSSSTSAINN  356

Query  279  ----NKATEF-----STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMF  431
                +KA +      S  S  +F++ N++   +++ MI  LT   P Q EL +A F ++ 
Sbjct  357  GAKSHKAGQAVLGTKSPVSYVLFIIFNSVGFFASVRMIAILTSGFPMQMELHVALFALIT  416

Query  432  GYGWSSCSTEP  464
             Y  +  S  P
Sbjct  417  TYDTAMSSLTP  427



>ref|XP_010054542.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Eucalyptus 
grandis]
Length=452

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 65/131 (50%), Gaps = 24/131 (18%)
 Frame = +3

Query  144  WIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYK---------------  278
            W+E F++   RD+P D RNA+L+VAAL+   TYQA + PP  +++               
Sbjct  294  WLENFKYNKERDSPGDVRNALLIVAALITIATYQAVLQPPGGVWQADSGSSSSSTSAINN  353

Query  279  ----NKATEF-----STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMF  431
                +KA +      S  S  +F++ N++   +++ MI  LT   P Q EL +A F ++ 
Sbjct  354  GAKSHKAGQAVLGTKSPVSYVLFIIFNSVGFFASVRMIAILTSGFPMQMELHVALFALIT  413

Query  432  GYGWSSCSTEP  464
             Y  +  S  P
Sbjct  414  TYDTAMSSLTP  424



>gb|KCW76854.1| hypothetical protein EUGRSUZ_D01208, partial [Eucalyptus grandis]
Length=169

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 24/118 (20%)
 Frame = +3

Query  147  IEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKN---------------  281
            +EYF++K  RD+PSD RNA+LVVAAL+   TYQA + PP   +++               
Sbjct  51   LEYFKYKKQRDSPSDVRNALLVVAALITIATYQAMLQPPGGFWQDNSGSSSSSTGATSRG  110

Query  282  ----KATE--FSTFSL---TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMM  428
                KA++    T SL    +F+++N+    ++  MI  L +  P Q EL++A F ++
Sbjct  111  IESHKASQPVLGTKSLPSYILFIISNSAGFFASARMITVLRLGFPMQMELQVALFALI  168



>ref|XP_006402007.1| hypothetical protein EUTSA_v10015548mg [Eutrema salsugineum]
 gb|ESQ43460.1| hypothetical protein EUTSA_v10015548mg [Eutrema salsugineum]
Length=440

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 78/160 (49%), Gaps = 29/160 (18%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKAT---------  290
            ++ ++YF FK  RD+PS+AR+A+LVVA+L+   T+QA + PP   +++            
Sbjct  251  KDLVKYFTFKKHRDSPSEARSALLVVASLVATATFQASLTPPGGTWQDSHIPAVSQNTTN  310

Query  291  -----------------EFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGF  419
                              F+  + T+F+  NT+  + +++M+  LT+  P + +L++   
Sbjct  311  VNTTYQQAHIAGQSIMGTFNGVAFTLFVFFNTIGFAVSLSMLNILTLGFPLRFQLQVCMM  370

Query  420  CMMFGYGWSSCSTEPISGTKTALIVVASLA---PYLIRTL  530
             M F +  +  S  P       +++ + LA   P L+R L
Sbjct  371  AMYFSHNTAMTSIAPDHVKLYCILITSILAATTPGLMRLL  410



>ref|XP_010089784.1| hypothetical protein L484_008034 [Morus notabilis]
 gb|EXB38376.1| hypothetical protein L484_008034 [Morus notabilis]
Length=140

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 3/99 (3%)
 Frame = +3

Query  255  NPPDYIYKNKATEFSTFSL---TVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCM  425
            NPPD         F +F      VFL++NTL+LSSA+ +I  LT   P+  E+  A   M
Sbjct  3    NPPDQETTTGWKWFKSFQYNKEKVFLISNTLALSSAILVIISLTYRFPFHFEIWDATVSM  62

Query  426  MFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLF  542
            +  YG S  +  P    +   ++ A+  P+ +R L  +F
Sbjct  63   IITYGSSVLAVTPRESVRFHYVLSAAAMPFALRLLWEIF  101



>ref|XP_011093263.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Sesamum 
indicum]
Length=460

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 82/186 (44%), Gaps = 36/186 (19%)
 Frame = +3

Query  60   NMASVEMGNMSNREGDRVDMLPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVT  239
            N + + + N S +E  R       K     +YF++   +D+P+  RN +LV+A L+   T
Sbjct  258  NSSQIPLQNQSAQEQQRNSRKSASK--KLQDYFKYDKIKDSPTKVRNTLLVIAVLIATAT  315

Query  240  YQAGINPPDYIYK-----------------------------NKATEFSTFSLTVFLVAN  332
            YQA ++PP  +++                             NKA  +      +FL+ N
Sbjct  316  YQAVLSPPGGVWQDDFWPDTKNNVSSARRPPRHMAGQAVMGTNKAVAYG-----LFLLFN  370

Query  333  TLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLAP  512
            +L    A+ M+ +LT+ +P Q ELR+A F +   Y     +  P        IV++ + P
Sbjct  371  SLGFFMALHMMNFLTIGLPLQFELRVALFALTATYDTCMVAITPNGWILVLFIVLSIVMP  430

Query  513  YLIRTL  530
            +++  L
Sbjct  431  FIMPVL  436



>ref|XP_007024264.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOY26886.1| Ankyrin repeat family protein [Theobroma cacao]
Length=306

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 66/117 (56%), Gaps = 8/117 (7%)
 Frame = +3

Query  150  EYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY-----KNKATEFSTFSLT  314
            ++ +++  R+   +ARN I++VA L+  VT+ AGINPP  +Y     K K+T   T +  
Sbjct  88   QHKQYEMHREAALNARNTIILVAILIATVTFAAGINPPGGVYQEGPLKGKSTVGRTKAFK  147

Query  315  VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCS---TEPISGT  476
            VF+++N ++L +++ ++  L   +P+QR+  +    +     W S S   T  ISGT
Sbjct  148  VFMISNYIALFTSLGIVVALVSIIPFQRKQLMRLILITHKLLWVSLSFTTTAFISGT  204



>ref|XP_011032506.1| PREDICTED: uncharacterized protein LOC105131287 [Populus euphratica]
Length=176

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 10/125 (8%)
 Frame = +3

Query  180  TPSDARNailvvaallvQVTYQAGINPPDYIYKNKATE-----FSTFS-----LTVFLVA  329
            T  D RN +LV AAL+  VT+QAGI PP  ++++   +      + +S       +FL+ 
Sbjct  33   TTDDFRNVMLVGAALIATVTFQAGITPPGGVWQSNDNQGHRAGHAVYSAQKVPFQIFLLF  92

Query  330  NTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYGWSSCSTEPISGTKTALIVVASLA  509
            NT++L+S++ ++  LT   PY  E+ IA   MM  Y        P       LI VA+ A
Sbjct  93   NTIALTSSIFLLLCLTFGYPYFLEVLIATISMMGTYSSGIYCITPYESVSFRLIFVAAPA  152

Query  510  PYLIR  524
            P ++R
Sbjct  153  PLVMR  157



>ref|XP_006375172.1| hypothetical protein POPTR_0014s04940g, partial [Populus trichocarpa]
 gb|ERP52969.1| hypothetical protein POPTR_0014s04940g, partial [Populus trichocarpa]
Length=177

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 72/136 (53%), Gaps = 11/136 (8%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNK-----ATEF  296
            +  +W + F++   RD+P DAR   +VVA +   +T+QAG++ P   ++ +     A  +
Sbjct  30   RSASWFKRFQYDEVRDSPRDAR---VVVALIAAVLTFQAGVDSPGGAWQERHHGGRAINY  86

Query  297  STFSLT--VFLVANTLSLSSAMAMIEYLTVN-MPYQRELRIAGFCMMFGYGWSSCSTEPI  467
            ++      VFLV+NTL+LS+ + ++  LT +  P+  E+ +A   MM  Y  +  +  P 
Sbjct  87   ASQKRASYVFLVSNTLALSTCILVVTSLTYSWFPFHLEIWVATASMMIAYASAVFAAIPH  146

Query  468  SGTKTALIVVASLAPY  515
                   ++VA+ + +
Sbjct  147  ESVHFRYLLVAAFSAF  162



>ref|XP_006437040.1| hypothetical protein CICLE_v10033865mg, partial [Citrus clementina]
 gb|ESR50280.1| hypothetical protein CICLE_v10033865mg, partial [Citrus clementina]
Length=430

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 21/112 (19%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY--------KNKA  287
            +P + +EYF+FK  RD+P + R+A+LVVA L+   T+Q G+NPP  ++        KN  
Sbjct  278  QPNDLMEYFKFKNGRDSPGETRSALLVVAVLVATTTFQFGVNPPGGVWQEYYKPDRKNGT  337

Query  288  TEFSTFS-------------LTVFLVANTLSLSSAMAMIEYLTVNMPYQREL  404
            T    +S               +F+  N++  S ++ MI  LT N P Q EL
Sbjct  338  TSGKAYSAGQSILGSTDPVGFGIFIFFNSVGFSLSIEMIRILTTNFPLQLEL  389



>gb|EYU42336.1| hypothetical protein MIMGU_mgv11b017551mg, partial [Erythranthe 
guttata]
Length=577

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 66/137 (48%), Gaps = 26/137 (19%)
 Frame = +3

Query  123  PNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS-  299
            P    +   EYF++   +++PSDARN +LV+A L+   TYQA ++PP  ++++   +FS 
Sbjct  270  PKSASKKLQEYFKYDKIKESPSDARNTLLVIAVLIATATYQAVLSPPGGVWQD---DFSP  326

Query  300  ----------------------TFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIA  413
                                    S  +FL+ N++    ++ M+ +LT  +P Q ELR+A
Sbjct  327  DNNVVKTPPRHTAGKSVMGTQTAISFGLFLIFNSVGFFMSLHMMNFLTNGLPMQFELRVA  386

Query  414  GFCMMFGYGWSSCSTEP  464
             F +   Y     +  P
Sbjct  387  LFALFATYDVCMVAIAP  403



>ref|XP_010242097.1| PREDICTED: uncharacterized protein LOC104586527 [Nelumbo nucifera]
Length=148

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 14/128 (11%)
 Frame = +3

Query  177  DTPSDARNailvvaallvQVTYQAGINPPDYIYK--NKATE-------FSTFSLTVFLVA  329
            D   ++R+A+LVVA L+  VT+QAG+NPP  +++   K  E       +      +FL  
Sbjct  13   DLLRESRDAMLVVATLIATVTFQAGVNPPGGVWQESTKTHEAGKSIMGYDKNGYRLFLFG  72

Query  330  NTLSLSSAMAMIEYLTVNMPYQRELR----IAGFCMMFGYGWSSCSTEPISGTKTALIVV  497
            NTL  S A  +I YL  N P  R L+    IA F + F YG S  +  P +    +L ++
Sbjct  73   NTLGFSIACNIIIYLIPNTPL-RNLKVMVYIAIFSLTFTYGVSVAAITPETSVNLSLFLI  131

Query  498  ASLAPYLI  521
                PYLI
Sbjct  132  FIGVPYLI  139



>ref|XP_002515991.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF46411.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=648

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +3

Query  165  KYSRDTPSDARNailvvaallvQVTYQAGINPPDYIY-----KNKATEFSTFSLTVFLVA  329
            K  ++   +AR+ I++VA L+  VT+ AGINPP  +Y     K K+T   T +  VF V 
Sbjct  466  KMQQEALQNARSTIILVATLIATVTFTAGINPPGGVYQDGPMKGKSTAVKTIAFKVFAVT  525

Query  330  NTLSLSSAMAMIEYLTVNMPYQRELRI  410
            NT +L +++A++  L   +P++RE++I
Sbjct  526  NTSALFTSLAVVLILVRIIPFRREVQI  552



>ref|XP_006397654.1| hypothetical protein EUTSA_v10001761mg [Eutrema salsugineum]
 gb|ESQ39107.1| hypothetical protein EUTSA_v10001761mg [Eutrema salsugineum]
Length=442

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 72/164 (44%), Gaps = 37/164 (23%)
 Frame = +3

Query  138  ENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPP------DY----------  269
            + W++YF+ K +R +PS+ R             TYQA ++PP      DY          
Sbjct  271  KQWLDYFKNKKNRVSPSEIRTT----------ATYQAALSPPGGVWQEDYCINGYCQITD  320

Query  270  IYKNKATEF-----------STFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAG  416
            I  NK               S  S  +F+  N++   +++ +I  LT  +P+  EL+++ 
Sbjct  321  IKGNKTKPVYIAGTTIMGSKSWISYGIFIFLNSIGFFTSLELISLLTKGLPFYLELQVSL  380

Query  417  FCMMFGYGWSSCSTEPISGTKTALIVVASLAPYLIRTLPNLFKK  548
              +   YG++  +  P  G     +V++ + P  +  +P+L +K
Sbjct  381  TALALTYGFAMSALSPNFGLGLFFMVISVVLPIAVAKIPSLIRK  424



>ref|XP_009363736.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Pyrus 
x bretschneideri]
Length=421

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 77/152 (51%), Gaps = 22/152 (14%)
 Frame = +3

Query  132  KPENWIEYFEFKYSRDTPSDA-RNailvvaallvQVTYQAGINPPDYIY-------KNKA  287
            +P++ ++YF+FK  R +  D     +LVVA L+   T+QAGI+PP+          KN  
Sbjct  267  QPKDPMQYFKFKKGRKSDDDPYATVLLVVAVLVATTTFQAGISPPNGGLHYTTGSNKNGI  326

Query  288  TEFSTFSLTVFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAGFCMMFGYG---WSSCST  458
               S   + V++  NT+  S ++ MI++LT N P   +LR   FCM+  YG    +  ST
Sbjct  327  DCGSNGLVVVYMFFNTIGFSVSLFMIDFLTRNFPLLFQLR---FCMVMMYGTYTVAVIST  383

Query  459  EPISGTKTALIVVASLAPYLIRTLPNLFKKCC  554
             P    K+ L+ + S  P  +  L    + CC
Sbjct  384  AP----KSMLLCITSSTPLFVVIL----QLCC  407



>ref|XP_011040333.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At3g12360 [Populus euphratica]
Length=447

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 34/150 (23%)
 Frame = +3

Query  120  LPNGKPENWIEYFEFKYSRDTPSDARNailvvaallvQVTYQAGINPPDYIYKNKATEFS  299
            L NG   N IEYF+FK   D+PS+AR+ +LV+A L+   T+Q G+NP   ++++      
Sbjct  270  LSNGN--NLIEYFKFKKGTDSPSEARSTLLVIAVLVATATFQVGVNPAGGVWQDTNIPEH  327

Query  300  TFSLT---------------------VFLVANTLSLSSAMAMIEYLTVNMPYQRELRIAG  416
            T S T                     +F+  N++  S ++ MI  LT   P Q EL+I  
Sbjct  328  TNSTTSSNAHFGGQSIMATTIPVGFMLFVFFNSVGFSMSLYMIYVLTSEFPLQFELQI--  385

Query  417  FCMMFGYGWSSCSTEPISGTKTALIVVASL  506
             C++  Y    C+     GT    IV +SL
Sbjct  386  -CLLAIY----CT----XGTALPRIVPSSL  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1512131764632