BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25055_g1_i2 len=2568 path=[1:0-135 137:136-143 145:144-191
193:192-204 206:205-552 554:553-555 557:556-611 613:612-671
673:672-869 871:870-942 944:943-988 990:989-1053 1055:1054-1085
1087:1086-1204 1206:1205-1240 1242:1241-1481 1483:1482-1521
1523:1522-1545 1547:1546-1574 1576:1575-1632 1634:1633-1684
1686:1685-1690 1692:1691-1724 1726:1725-1816 1818:1817-1842
1844:1843-1959 1961:1960-1995 1997:1996-2087 2089:2088-2377
2379:2378-2413 2415:2414-2567]

Length=2568
                                                                      Score     E

ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           813   0.0     
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                811   0.0     
emb|CDP20511.1|  unnamed protein product                                807   0.0     
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                805   0.0     
ref|XP_007024651.1|  Subtilase family protein                           796   0.0     
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     792   0.0     
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           792   0.0     
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                792   0.0     Vitis vinifera
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                791   0.0     
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                784   0.0     
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             779   0.0     
ref|XP_006369129.1|  subtilase family protein                           778   0.0     
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                777   0.0     
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                775   0.0     
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             773   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           770   0.0     
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                769   0.0     
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                769   0.0     
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                767   0.0     
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                766   0.0     
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                765   0.0     
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                765   0.0     
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             761   0.0     
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                761   0.0     
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                759   0.0     
emb|CAN75239.1|  hypothetical protein VITISV_014205                     756   0.0     Vitis vinifera
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                757   0.0     
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             754   0.0     
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           750   0.0     
ref|XP_010111996.1|  Subtilisin-like protease                           749   0.0     
gb|KDP40686.1|  hypothetical protein JCGZ_24685                         744   0.0     
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                739   0.0     
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    737   0.0     
ref|NP_566473.2|  Subtilase family protein                              732   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             731   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY33251.1|  BnaC01g37240D                                          729   0.0     
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                728   0.0     
ref|XP_002885009.1|  subtilase family protein                           728   0.0     
emb|CDY39093.1|  BnaA01g29630D                                          728   0.0     
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    723   0.0     
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           722   0.0     
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                720   0.0     
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    718   0.0     
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           717   0.0     
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    717   0.0     
gb|EPS74243.1|  subtilase family protein                                713   0.0     
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                713   0.0     
gb|ADW11233.1|  subtilisin-like protease 2                              713   0.0     
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                712   0.0     
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                711   0.0     
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    711   0.0     
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                709   0.0     
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                706   0.0     
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             706   0.0     
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                703   0.0     
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                691   0.0     
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    689   0.0     
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             698   0.0     
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          675   0.0     
ref|XP_010088794.1|  Subtilisin-like protease                           672   0.0     
emb|CDY52259.1|  BnaC05g52030D                                          662   0.0     
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                659   0.0     
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           658   0.0     
ref|XP_010088796.1|  Subtilisin-like protease                           657   0.0     
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           653   0.0     
gb|AFW73751.1|  putative subtilase family protein                       651   0.0     
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                648   0.0     
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                647   0.0     
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                647   0.0     
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           646   0.0     
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                644   0.0     
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                643   0.0     
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                643   0.0     
emb|CDP15538.1|  unnamed protein product                                643   0.0     
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980          642   0.0     Sorghum bicolor [broomcorn]
ref|XP_010111995.1|  Subtilisin-like protease                           639   0.0     
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                640   0.0     
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                639   0.0     
emb|CDY67452.1|  BnaCnng55020D                                          637   0.0     
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                637   0.0     
ref|NP_569048.1|  subtilisin-like protease                              635   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105479.1|  Subtilisin-like protease                           635   0.0     
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                635   0.0     
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             634   0.0     
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           635   0.0     
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             634   0.0     
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                634   0.0     
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         633   0.0     
emb|CDP02570.1|  unnamed protein product                                634   0.0     
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      634   0.0     Ricinus communis
ref|NP_001048301.1|  Os02g0779200                                       634   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                632   0.0     
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         632   0.0     
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like           632   0.0     
gb|AAM10321.1|  AT5g67360/K8K14_8                                       631   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                631   0.0     
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                630   0.0     
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     630   0.0     
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    629   0.0     
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like           630   0.0     
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     629   0.0     
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                628   0.0     
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                628   0.0     
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             628   0.0     
gb|ABR17987.1|  unknown                                                 628   0.0     Picea sitchensis
ref|XP_007047459.1|  Subtilase family protein                           627   0.0     
emb|CDY29697.1|  BnaA04g17300D                                          627   0.0     
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           626   0.0     
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             626   0.0     
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           627   0.0     
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           626   0.0     
gb|KHN12975.1|  Subtilisin-like protease                                625   0.0     
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                626   0.0     
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   620   0.0     
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                626   0.0     
emb|CDY63302.1|  BnaCnng41810D                                          625   0.0     
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                625   0.0     
gb|KHN21060.1|  Subtilisin-like protease                                623   0.0     
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                625   0.0     
emb|CAA59963.1|  subtilisin-like protease                               623   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                623   0.0     
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     623   0.0     
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             624   0.0     
emb|CDY00497.1|  BnaA10g07760D                                          624   0.0     
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             623   0.0     
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                624   0.0     
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                623   0.0     
emb|CDY12840.1|  BnaC07g15930D                                          622   0.0     
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             622   0.0     Musa acuminata [banana]
gb|ABR18065.1|  unknown                                                 622   0.0     Picea sitchensis
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             622   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                622   0.0     
ref|XP_010087293.1|  Subtilisin-like protease                           620   0.0     
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                621   0.0     
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                620   0.0     
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           621   0.0     
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                622   0.0     
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                620   0.0     
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease                621   0.0     
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           620   0.0     
dbj|BAJ93208.1|  predicted protein                                      620   0.0     
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          619   0.0     
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             620   0.0     
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             619   0.0     
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             620   0.0     
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           619   0.0     
dbj|BAJ87876.1|  predicted protein                                      620   0.0     
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             619   0.0     
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g             620   0.0     
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    619   0.0     
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   619   0.0     
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                619   0.0     
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                618   0.0     
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           618   0.0     
gb|AGN03879.1|  senescence-associated subtilisin protease               619   0.0     
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    618   0.0     
dbj|BAJ86110.1|  predicted protein                                      618   0.0     
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                618   0.0     
ref|XP_010090170.1|  Subtilisin-like protease                           617   0.0     
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          617   0.0     
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                617   0.0     Vitis vinifera
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           616   0.0     
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                616   0.0     
dbj|BAJ96698.1|  predicted protein                                      616   0.0     
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                616   0.0     Vitis vinifera
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                616   0.0     
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           616   0.0     
emb|CDX99895.1|  BnaC09g28100D                                          616   0.0     
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             617   0.0     
ref|XP_010105478.1|  Subtilisin-like protease                           615   0.0     
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                615   0.0     
tpg|DAA50265.1|  TPA: putative subtilase family protein                 615   0.0     
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                615   0.0     
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                614   0.0     
dbj|BAJ88205.1|  predicted protein                                      615   0.0     
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                613   0.0     
emb|CDY57437.1|  BnaAnng14520D                                          613   0.0     
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           613   0.0     
ref|NP_001050634.1|  Os03g0605300                                       613   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                614   0.0     
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           613   0.0     
gb|ACN40199.1|  unknown                                                 613   0.0     Picea sitchensis
gb|KHN45156.1|  Subtilisin-like protease                                611   0.0     
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             613   0.0     
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                612   0.0     
ref|NP_001234282.1|  SBT1 protein precursor                             611   0.0     
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                611   0.0     Vitis vinifera
ref|NP_001234288.1|  SBT2 protein precursor                             611   0.0     
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          612   0.0     
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like           611   0.0     
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                611   0.0     
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                611   0.0     
dbj|BAJ87780.1|  predicted protein                                      611   0.0     
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                610   0.0     
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    610   0.0     
dbj|BAJ97136.1|  predicted protein                                      610   0.0     
ref|NP_568765.1|  subtilase 1.3                                         610   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                610   0.0     
gb|KEH35793.1|  subtilisin-like serine protease                         608   0.0     
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like           609   0.0     
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             608   0.0     
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             608   0.0     
emb|CDY22001.1|  BnaC09g01070D                                          607   0.0     
ref|XP_002533857.1|  Cucumisin precursor, putative                      607   0.0     Ricinus communis
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                608   0.0     
emb|CDY18651.1|  BnaA09g07440D                                          607   0.0     
ref|NP_001151549.1|  subtilisin-like protease precursor                 607   0.0     Zea mays [maize]
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...    607   0.0     Medicago truncatula
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                607   0.0     
ref|XP_007012625.1|  Subtilase family protein                           607   0.0     
emb|CDY18654.1|  BnaA09g07410D                                          606   0.0     
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                607   0.0     
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           606   0.0     
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      606   0.0     Ricinus communis
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease                606   0.0     
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     605   0.0     
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    605   0.0     
gb|EPS59495.1|  hypothetical protein M569_15309                         604   0.0     
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like           606   0.0     
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             604   0.0     
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             604   0.0     
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           604   0.0     
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           604   0.0     
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           604   0.0     
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                604   0.0     
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           603   0.0     
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   604   0.0     
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             604   0.0     
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     604   0.0     
ref|XP_006381615.1|  subtilase family protein                           603   0.0     
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                603   0.0     
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like           603   0.0     
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                603   0.0     
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     603   0.0     
ref|XP_003608462.1|  Subtilisin-like protease                           603   0.0     
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             603   0.0     
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             602   0.0     
ref|XP_009590448.1|  PREDICTED: subtilisin-like protease                604   0.0     
ref|XP_002864127.1|  subtilase family protein                           602   0.0     
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                603   0.0     
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           603   0.0     
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    602   0.0     
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     602   0.0     
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g             600   0.0     
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     602   0.0     
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                602   0.0     
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     602   0.0     Zea mays [maize]
ref|NP_001051353.1|  Os03g0761500                                       602   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           601   0.0     
gb|AIX97848.1|  SBT1.5                                                  602   0.0     
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           602   0.0     
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             602   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010089708.1|  Subtilisin-like protease                           602   0.0     
gb|ACF79126.1|  unknown                                                 601   0.0     Zea mays [maize]
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     601   0.0     
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease                601   0.0     
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                601   0.0     
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           601   0.0     
gb|KHG16003.1|  Subtilisin-like protease                                601   0.0     
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                601   0.0     
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                601   0.0     
gb|ADD09584.1|  proteinase inhibitor                                    601   0.0     Trifolium repens [creeping white clover]
ref|NP_565330.1|  Subtilase-like protein                                600   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                601   0.0     
emb|CDO96926.1|  unnamed protein product                                601   0.0     
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                601   0.0     
gb|AES59354.2|  subtilisin-like serine protease                         599   0.0     
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           600   0.0     
ref|XP_003627424.1|  Subtilisin-like serine protease                    600   0.0     
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             600   0.0     
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          600   0.0     
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                600   0.0     
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                600   0.0     
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  600   0.0     
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                600   0.0     
gb|ACN27710.1|  unknown                                                 597   0.0     
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          599   0.0     
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             599   0.0     
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             599   0.0     
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    599   0.0     
gb|EPS61757.1|  hypothetical protein M569_13035                         598   0.0     
gb|EPS65791.1|  hypothetical protein M569_08985                         598   0.0     
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                598   0.0     
gb|EMT11726.1|  Subtilisin-like protease                                599   0.0     
gb|AFW73750.1|  putative subtilase family protein                       599   0.0     
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like           598   0.0     
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    598   0.0     
ref|XP_003589103.1|  Subtilisin-like protease                           601   0.0     
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_001757585.1|  predicted protein                                  597   0.0     
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                597   0.0     
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease-like           597   0.0     
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                598   0.0     
tpg|DAA51518.1|  TPA: putative subtilase family protein                 597   0.0     
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          597   0.0     
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           598   0.0     
ref|XP_002885806.1|  predicted protein                                  597   0.0     
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...    597   0.0     
ref|XP_003597117.1|  Subtilisin-like protease                           597   0.0     
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like           597   0.0     
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor     597   0.0     
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                596   0.0     
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                596   0.0     
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     601   0.0     
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             596   0.0     
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         596   0.0     
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             597   0.0     
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           596   0.0     
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like           596   0.0     
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                596   0.0     
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             595   0.0     
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           595   0.0     
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_002886065.1|  predicted protein                                  595   0.0     
gb|ACN28204.1|  unknown                                                 595   0.0     
ref|NP_001151463.1|  LOC100285096 precursor                             595   0.0     
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             595   0.0     
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           595   0.0     
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             594   0.0     
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                597   0.0     
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                594   0.0     
emb|CDY63219.1|  BnaAnng18730D                                          593   0.0     
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           593   0.0     
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                594   0.0     
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                593   0.0     
gb|EAZ24824.1|  hypothetical protein OsJ_08603                          592   0.0     
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|NP_567972.1|  subtilisin-like serine protease 2                     593   0.0     
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            594   0.0     
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             593   0.0     
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      592   0.0     
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|NP_001152427.1|  LOC100286067 precursor                             592   0.0     
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                592   0.0     
gb|EAY87753.1|  hypothetical protein OsI_09169                          592   0.0     
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             592   0.0     
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           592   0.0     
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980          592   0.0     
ref|XP_008788427.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           592   0.0     
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    592   0.0     
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                592   0.0     
gb|EPS74284.1|  hypothetical protein M569_00464                         591   0.0     
ref|NP_001048303.1|  Os02g0780200                                       592   0.0     
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                591   0.0     
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                592   0.0     
dbj|BAJ91400.1|  predicted protein                                      591   0.0     
dbj|BAJ99493.1|  predicted protein                                      591   0.0     
ref|XP_006369092.1|  subtilase family protein                           591   0.0     
ref|XP_003595292.1|  Subtilisin-like protease                           591   0.0     
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease                591   0.0     
emb|CDY40653.1|  BnaA03g53100D                                          590   0.0     
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like           591   0.0     
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                591   0.0     
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                590   0.0     
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                590   0.0     
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                590   0.0     
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         590   0.0     
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           591   0.0     
ref|XP_009389184.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      590   0.0     
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             590   0.0     
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           590   0.0     
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                590   0.0     
emb|CAN75240.1|  hypothetical protein VITISV_014207                     583   0.0     
emb|CDX72509.1|  BnaC07g45310D                                          589   0.0     
ref|XP_002320086.2|  subtilase family protein                           590   0.0     
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             589   0.0     
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                590   0.0     
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    589   0.0     
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             589   0.0     
emb|CDX82491.1|  BnaA03g33300D                                          589   0.0     
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           589   0.0     
gb|KHN13888.1|  Subtilisin-like protease                                588   0.0     
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                589   0.0     
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           589   0.0     
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           589   0.0     
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                589   0.0     
ref|XP_010109072.1|  Subtilisin-like protease                           589   0.0     
ref|XP_010090327.1|  Subtilisin-like protease                           589   0.0     
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             589   0.0     
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           588   0.0     
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                589   0.0     
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    588   0.0     
ref|XP_003609994.1|  Subtilisin-like protease                           587   0.0     
gb|AES92191.2|  subtilisin-like serine protease                         587   0.0     
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             587   0.0     
ref|XP_008363295.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    588   0.0     
gb|EPS65938.1|  hypothetical protein M569_08836                         587   0.0     
gb|KEH30495.1|  subtilisin-like serine protease                         588   0.0     
dbj|BAJ93872.1|  predicted protein                                      588   0.0     
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           588   0.0     
gb|KHG02130.1|  Subtilisin-like protease                                588   0.0     
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     588   0.0     
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             587   0.0     
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                588   0.0     
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     587   0.0     
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                588   0.0     
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             587   0.0     
gb|KHN27220.1|  Subtilisin-like protease                                586   0.0     
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg             587   0.0     
gb|KHN15704.1|  Subtilisin-like protease                                586   0.0     
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease                587   0.0     
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease                587   0.0     
emb|CAH66960.1|  OSIGBa0147H17.8                                        586   0.0     
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           586   0.0     
ref|NP_001053614.1|  Os04g0573300                                       586   0.0     
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    586   0.0     
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                586   0.0     
gb|AES62637.2|  subtilisin-like serine protease                         586   0.0     
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                585   0.0     
ref|XP_008220304.1|  PREDICTED: subtilisin-like protease                586   0.0     
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                585   0.0     
gb|AFS34694.1|  subtilisin-like serine protease                         586   0.0     
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like           585   0.0     
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                585   0.0     
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                585   0.0     
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       586   0.0     
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           585   0.0     
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like           585   0.0     
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg             585   0.0     
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                583   0.0     
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease                584   0.0     
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                584   0.0     
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             584   0.0     
ref|XP_004954114.1|  PREDICTED: subtilisin-like protease-like           585   0.0     
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           584   0.0     
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease                584   0.0     
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    584   0.0     
gb|KDP28200.1|  hypothetical protein JCGZ_13971                         583   0.0     
ref|XP_007038510.1|  Subtilase 1.3                                      584   0.0     
ref|XP_003592386.1|  Subtilisin-like protease                           586   0.0     
gb|ACN39811.1|  unknown                                                 581   0.0     
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                583   0.0     
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           583   0.0     
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           583   0.0     
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    583   0.0     
ref|XP_003605881.1|  Subtilisin-like protease                           583   0.0     
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                582   0.0     
emb|CDX97560.1|  BnaA05g25190D                                          583   0.0     
ref|XP_010028715.1|  PREDICTED: subtilisin-like protease                583   0.0     
gb|KHN10472.1|  Subtilisin-like protease                                580   0.0     
emb|CDP05276.1|  unnamed protein product                                583   0.0     
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     585   0.0     
ref|XP_006342910.1|  PREDICTED: subtilisin-like protease-like           582   0.0     
dbj|BAH20348.1|  AT3G14067                                              575   0.0     
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          581   0.0     
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease                581   0.0     
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    581   0.0     
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                582   0.0     
ref|XP_010105482.1|  Subtilisin-like protease                           581   0.0     
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             581   0.0     
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                582   0.0     
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                581   0.0     
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                581   0.0     
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    580   0.0     
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g             580   0.0     
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    580   0.0     
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease                581   0.0     
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           580   0.0     
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                580   0.0     
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                580   0.0     
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             580   0.0     
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           579   0.0     
emb|CDX98438.1|  BnaC05g39370D                                          580   0.0     
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                580   0.0     
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             579   0.0     
ref|XP_004231532.1|  PREDICTED: subtilisin-like protease                580   0.0     



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/755 (58%), Positives = 538/755 (71%), Gaps = 30/755 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FI+ + KS+KP +FSTHH WYSSI+ ++SP S+H   S++LYTYE  A GFSARLT  
Sbjct  31    ETFIIHVAKSDKPHVFSTHHHWYSSIVRSISPPSHHR--SKILYTYERAAVGFSARLTAG  88

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA +L  VPGVISV+PD++  L TT +P FL L + S  L P SDY  D+I+GVLD+GIW
Sbjct  89    QADQLRRVPGVISVIPDQVRYLHTTHTPTFLKL-ADSFGLWPDSDYADDVIVGVLDTGIW  147

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL+P+P  W+ KC  GP FP +SCNRKIIGAR +Y+GYEA  G P+    E
Sbjct  148   PERPSFSDEGLSPVPAGWKGKCVTGPGFPRSSCNRKIIGARMFYKGYEASHG-PMDESKE  206

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C ++D
Sbjct  207   AKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGEARGMAIKARIAAYKICWKDGCFDSD  266

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAVADGVHV+SLS+ +    G+A  Y  D IAIGAFGA + GV+VSC+AGN GP
Sbjct  267   ILAAMDQAVADGVHVISLSVGAN---GYAPHYLHDSIAIGAFGASEHGVLVSCSAGNSGP  323

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
              PYTAVN+APWILTVGASTIDREFPA V LG+ R F G SLYSG   +  + PVVY G  
Sbjct  324   GPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFGGVSLYSGNPLTDSKFPVVYSGDC  383

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S YC+PG+LD  KV G+IV C++G +   V+KG AV  AGGVGMI+ NL   G +L  +
Sbjct  384   GSKYCYPGKLDHKKVAGKIVLCDRGGNAR-VEKGSAVKLAGGVGMILANLAESGEELVAD  442

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  +P  +V    G+ IR+YV + + PTA I F+GTVIGNSP+APRVAAFS RGPN LTP
Sbjct  443   SHLLPATMVGQKAGDKIREYVTSDTSPTATIVFRGTVIGNSPAAPRVAAFSSRGPNHLTP  502

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILA WTGS             EFN+ISGTSM+CPHVSGLAA+L++ +
Sbjct  503   EILKPDVIAPGVNILAGWTGSTGPTDLAIDPRRVEFNIISGTSMSCPHVSGLAALLRRAH  562

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
               W+PAAIKSALMTTAY +DNSG+    DL T + +TP  +GSGHVDP  A+DPGLVYD 
Sbjct  563   SKWTPAAIKSALMTTAYNLDNSGK-IFTDLATGEESTPFVHGSGHVDPNRALDPGLVYDI  621

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI-  2053
               +DYV+FLCTIGYD   IA+F+R+S  V+C  R+L  PG LNYPSFSV F ++   V+ 
Sbjct  622   ETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLNYPSFSVDFTSDSNGVVK  681

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS----  2221
             YKR VKNV    N  Y+V V  PS V V+VSP +LVF++  ++LSYE++F S R      
Sbjct  682   YKRVVKNVGGDSNAVYEVKVNAPSAVEVSVSPAKLVFSEENNSLSYEISFTSKRSEDIMV  741

Query  2222  ---ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                  +FGS+ WSDG H V SPIAV W  +S   +
Sbjct  742   KGIQSAFGSIEWSDGIHSVRSPIAVRWRYQSAVSM  776



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/757 (57%), Positives = 543/757 (72%), Gaps = 36/757 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FI+ + KS+KP++F+THH WYSSII ++S        S++LYTY   A GFSARLT +
Sbjct  31    ETFIIHVSKSDKPRVFATHHHWYSSIIRSVS-----QHPSKILYTYSRAAVGFSARLTAA  85

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA +L  +PGVISVLPD +  L TT +P FLGL + S  L P+SDY  D+IIGVLD+GIW
Sbjct  86    QADQLRRIPGVISVLPDEVRHLHTTHTPTFLGL-ADSFGLWPNSDYADDVIIGVLDTGIW  144

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL+P+P+SW+ KC  GP+FP TSCN+KIIGA+ +Y+GYEA  G P+    E
Sbjct  145   PERPSFSDEGLSPVPSSWKGKCATGPDFPETSCNKKIIGAQMFYKGYEASHG-PMDESKE  203

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C N+D
Sbjct  204   SKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGEARGMAIKARIAAYKICWKNGCFNSD  263

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAV DGVHV+SLS+ +    G+A  Y  D IAIGAFGA + GV+VSC+AGN GP
Sbjct  264   ILAAMDQAVNDGVHVISLSVGAN---GYAPHYLLDSIAIGAFGASEHGVLVSCSAGNSGP  320

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
               YTAVN+APWILTVGASTIDREFPA V LG++R F G SLYSG   +  ++PVVY G  
Sbjct  321   GAYTAVNIAPWILTVGASTIDREFPADVILGDNRIFGGVSLYSGDPLTDAKLPVVYSGDC  380

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S YC+PG+LD  KV G+IV C++G +   V+KG AV QAGGVGMI+ NL + G +L  +
Sbjct  381   GSKYCYPGKLDHKKVAGKIVLCDRGGNAR-VEKGSAVKQAGGVGMILLNLADSGEELVAD  439

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  +P  +V    G+ IR YV++   PTA I F+GTVIG SP+APRVAAFS RGPN LTP
Sbjct  440   SHLLPATMVGQKAGDKIRHYVKSDPSPTATIVFRGTVIGKSPAAPRVAAFSSRGPNHLTP  499

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILA WTGS+            EFN+ISGTSM+CPH SGLAA+LK+ +
Sbjct  500   EILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEFNIISGTSMSCPHASGLAALLKRAH  559

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P W+PAA+KSALMTTAY +DNSG+    DL T Q +TP  +GSGHVDP  A+DPGLVYD 
Sbjct  560   PKWTPAAVKSALMTTAYNLDNSGK-VFTDLATGQESTPFVHGSGHVDPNRALDPGLVYDI  618

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI-  2053
               +DYV+FLC+IGYD   +A+F+R+S  V+C  +NL  PG LNYPSFSV+F      V+ 
Sbjct  619   ETSDYVNFLCSIGYDGDDVAVFVRDSSRVNCSEQNLATPGDLNYPSFSVVFTGESNGVVK  678

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD--  2227
             YKR +KNV K  +  Y+V V  PS+V V+VSP +LVF++   +LSYE++F+S + S D  
Sbjct  679   YKRVMKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKKSLSYEISFKS-KSSGDLE  737

Query  2228  -------SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                    +FGS+ WSDG H V SPIAV W   S + +
Sbjct  738   MVKGIESAFGSIEWSDGIHNVRSPIAVRWRHYSAASI  774



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/746 (57%), Positives = 532/746 (71%), Gaps = 24/746 (3%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV + K++KP +F THH WYSSI+ +LSPLS H   ++L+YTY+H  HGFSARLT S
Sbjct  29    ETYIVHVAKAQKPSVFPTHHHWYSSILRSLSPLSAHHPPTKLIYTYDHAVHGFSARLTSS  88

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA+EL     V+SV+PD + +L TTR+P FLGL      + P+SDY  DII+ VLD+GIW
Sbjct  89    QAAELRRRRCVLSVVPDSVRQLHTTRTPHFLGL-DDFFGIWPNSDYAEDIIVAVLDTGIW  147

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL+P+P+SW+  CE GP+FP TSCN+KIIGARAYY+GYEA +G  +   GE
Sbjct  148   PERPSFSDEGLSPVPSSWKGVCETGPDFPPTSCNKKIIGARAYYKGYEANLGMSLQEAGE  207

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS V NA++  +ARGEARG+A  AR+A YK+CW   C ++D
Sbjct  208   SKSPRDSEGHGTHTASTAAGSVVKNASLYEYARGEARGMAIKARVAAYKICWSAGCFDSD  267

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQA+ DGVHV+SLS+ +    G+A  YD D IAIGAFGA + G++ SC+AGN GP
Sbjct  268   ILAAMDQAIDDGVHVISLSVGAN---GYAPQYDHDSIAIGAFGAAKYGIVTSCSAGNSGP  324

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
              PYTAVN+APWILTVGASTIDREFPA V LG+   + G SLY+G      Q+P+VY G  
Sbjct  325   GPYTAVNIAPWILTVGASTIDREFPADVVLGDGSIYGGVSLYAGEPLGDTQLPLVYAGDC  384

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S YC+ G+LD+SKV+G+IV C++G   + + KG AV  AGG GMI+ NL + G +L  +
Sbjct  385   GSSYCYEGRLDSSKVKGKIVICDRGGGNARMAKGTAVKLAGGGGMILANLADSGEELIAD  444

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  IP   V    G+ I+ Y+R+   PTA I F+GTVIG+SPSAPRVAAFS RGPN LTP
Sbjct  445   SHLIPATNVGQKAGDKIKSYLRSEPSPTATIVFRGTVIGSSPSAPRVAAFSSRGPNHLTP  504

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILA WTG +            EFN+ SGTSM+CPHVSGLAA+L+K +
Sbjct  505   EILKPDVIAPGVNILAGWTGLVGPSQLDIDPRRVEFNIASGTSMSCPHVSGLAALLRKAH  564

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P W+PAAIKSALMTTAY VDN G  ++ DL T + + P  +GSGHVDP  A++PGLVYD 
Sbjct  565   PKWTPAAIKSALMTTAYNVDNIGE-SIKDLATGEESNPFVHGSGHVDPNRALNPGLVYDL  623

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPL-VDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI  2053
             G +DYV FLC +GY   +IA+F+R+ P+ VDC  + +G PG LNYPSFSV+F      V 
Sbjct  624   GTSDYVAFLCAVGYSPGRIAVFVRDGPVPVDCGAQGMGTPGDLNYPSFSVVFSPGNSVVK  683

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-----LRQ  2218
             Y R VKNV       Y+V V  P +V VTVSP++LVF+   DTLSYEV+F +     +  
Sbjct  684   YTRVVKNVGSNAEAVYEVKVNAPPSVEVTVSPSQLVFSQGNDTLSYEVSFTTASGILVGA  743

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSWE  2296
                +FGSL WSDG HLV SPIAV W 
Sbjct  744   LKPAFGSLEWSDGEHLVRSPIAVVWR  769



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/757 (57%), Positives = 542/757 (72%), Gaps = 36/757 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FI+ + KS+KP++F+THH WYSSII ++S        S++LYTY+  A GFSA LT +
Sbjct  31    ETFIIHVSKSDKPRVFTTHHHWYSSIIRSVS-----QHPSKILYTYKRAAVGFSAHLTAA  85

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA +L  +PGVISVLPD +  L TT +P FLGL + S  L P+SDY  D+I+GVLD+GIW
Sbjct  86    QADQLRRIPGVISVLPDEVRHLHTTHTPTFLGL-ADSFGLWPNSDYADDVIVGVLDTGIW  144

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL+P+P+SW+ KC  GP+FP TSCN+KIIGA+ +Y+GYEA+ G P+    E
Sbjct  145   PERPSFSDEGLSPVPSSWKGKCVTGPDFPETSCNKKIIGAQMFYKGYEAKHG-PMDESKE  203

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C N+D
Sbjct  204   SKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGEARGMAIKARIAAYKICWKNGCFNSD  263

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAV DGVHV+SLS+ +    G+A  Y  D IAIGAFGA + GV+VSC+AGN GP
Sbjct  264   ILAAMDQAVDDGVHVISLSVGAN---GYAPHYLYDSIAIGAFGASEHGVLVSCSAGNSGP  320

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
               YTAVN+APW+LTVGASTIDREFPA V LG++R F G SLYSG   +  ++PVVY G  
Sbjct  321   GAYTAVNIAPWMLTVGASTIDREFPADVILGDNRIFGGVSLYSGNPLADAKLPVVYSGDC  380

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S YC+PG+LD  KV G+IV C++G +   V+KG AV QAGGVGMI+ NL + G +L  +
Sbjct  381   GSKYCYPGKLDPKKVAGKIVLCDRGGNAR-VEKGSAVKQAGGVGMILANLADSGEELVAD  439

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  +P  +V    G+ IR YV++   PTA I F+GTVIG SP+APRVAAFS RGPN LTP
Sbjct  440   SHLLPATMVGQKAGDKIRHYVKSDPAPTATIVFRGTVIGKSPAAPRVAAFSSRGPNHLTP  499

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILA WTGS+            EFN+ISGTSM+CPHVSGLAA+L++ +
Sbjct  500   EILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEFNIISGTSMSCPHVSGLAALLRRAH  559

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P W+PAA+KSALMTTAY +DNSG+    DL T Q +TP  +GSGHVDP  A+DPGLVYD 
Sbjct  560   PKWTPAAVKSALMTTAYNLDNSGK-VFTDLATGQESTPFVHGSGHVDPNRALDPGLVYDI  618

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI-  2053
               +DYV+FLC+IGYD   +A+F R+S  V+C  R+L  PG LNYPSFSV+F      V+ 
Sbjct  619   ETSDYVNFLCSIGYDGTDVAVFARDSSRVNCSERSLATPGDLNYPSFSVVFTGETNGVVK  678

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD--  2227
             YKR VKNV K  +  Y+V V  PS+V V+VSP +LVF++   +LSYE++ +  + S D  
Sbjct  679   YKRVVKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKQSLSYEISLKG-KSSGDLE  737

Query  2228  -------SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                    +FGS+ WSDG H V SPIAV W   S + +
Sbjct  738   MVKGIESAFGSIEWSDGIHNVRSPIAVRWRHYSAASI  774



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/747 (57%), Positives = 534/747 (71%), Gaps = 27/747 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FI+ + KS KP LFS+HH WYSSIIH+L P S H   ++LLYTYE   +GFSARL
Sbjct  22    DRPENFIIHVSKSHKPSLFSSHHHWYSSIIHSLPP-SPHP--TKLLYTYERAINGFSARL  78

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T +QA +L  +PG++SV+PD++ ++ TTR+PQFLGL  G   L  +S YG  +IIGVLD+
Sbjct  79    TATQAEKLRELPGILSVIPDQVRQIHTTRTPQFLGLSDGV-GLWQNSYYGDGVIIGVLDT  137

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPER SF D GL+P+P+SW+  CE GP+FPA++C+RKIIGARA+Y+GYE+ +  P+  
Sbjct  138   GIWPERPSFKDSGLSPVPDSWKGICETGPDFPASACSRKIIGARAFYKGYESYLEGPMDE  197

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAGS V+NA++   A GEARG+AT ARIA YK+CW   C 
Sbjct  198   TKESKSPRDTEGHGTHTASTAAGSVVSNASLFEFAYGEARGMATKARIAAYKICWSLGCF  257

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++D+L+ MDQA+ADGV+V+SLS+ +    G+A  YD D IAIGAFGA Q G++VSC+AGN
Sbjct  258   DSDLLAAMDQAIADGVNVISLSVGAT---GYAPQYDHDSIAIGAFGAAQHGIVVSCSAGN  314

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PYTAVN+APWILTVGASTIDREFPA   LG+ R F G SLYSG     I++P+VY 
Sbjct  315   SGPGPYTAVNIAPWILTVGASTIDREFPADAILGDGRIFGGVSLYSGDPLVDIKLPLVYA  374

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G + + YC+ G L  SKV+G+IVFC++G +   V+KG AV  AGG+GMI+ N    G +L
Sbjct  375   GDSGNRYCYMGSLSPSKVQGKIVFCDRGGNAR-VEKGFAVKLAGGLGMILANTAESGEEL  433

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  IP   V    G  IRQY++ + FPTA I F GTVIG SP AP+VAAFS RGPN 
Sbjct  434   IADAHLIPATTVGEKAGNEIRQYIKISQFPTATIVFHGTVIGPSPPAPKVAAFSSRGPNH  493

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTG +             FN+ISGTSM+CPHVSGLAA+L 
Sbjct  494   LTPEILKPDVIAPGVNILAGWTGFIGPSQLNIDTRRVNFNIISGTSMSCPHVSGLAALLI  553

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP+WSPAAIKSALMTTAY++DNSG  T+ DL T   ++P  YG+GHVDP  A+ PGLV
Sbjct  554   KAYPNWSPAAIKSALMTTAYSLDNSGN-TIKDLATGVESSPFVYGAGHVDPNIALMPGLV  612

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD    DYV FLC+IGYDS++IA+F+R     D     L  PG+LNYPSFSV+F +N   
Sbjct  613   YDIDDGDYVAFLCSIGYDSKRIAIFVREPTGPDVCEGKLATPGNLNYPSFSVVFDSNDHV  672

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-----L  2212
             V YKRTVKNV    +  Y+  V  P  V ++VSP++L F+    TLSYE+TF S      
Sbjct  673   VKYKRTVKNVGPSVDAVYEAKVNAPPGVEISVSPSKLEFSAENQTLSYEITFASDGLALF  732

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               + ++FGS+ WSDG HLV SPIAV W
Sbjct  733   AVALEAFGSIEWSDGVHLVRSPIAVRW  759



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/751 (57%), Positives = 526/751 (70%), Gaps = 28/751 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FI+    S KP LFS+HH WYSS++H+L P  +H   S++LYTY   A GFSARLT  
Sbjct  39    QTFIIHASSSHKPSLFSSHHHWYSSLLHSLPP--SHP-PSQILYTYRAAAAGFSARLTAP  95

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA  L   PGV+SV+PDR+  L TTR+P+FLGL   S  L P+SDY  DIIIGVLD+GIW
Sbjct  96    QAEALRRAPGVLSVVPDRIRHLHTTRTPRFLGLTE-SFGLWPNSDYADDIIIGVLDTGIW  154

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL P+P +WR  CEVG +FPA++CNRKIIGARA+Y+GYEA + +PI    E
Sbjct  155   PERRSFSDSGLGPVPGAWRGTCEVGRDFPASACNRKIIGARAFYKGYEAYLERPIDETKE  214

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH +S A GS V+NA+   +A GEARG+AT ARIA YK+CW   C ++D
Sbjct  215   SKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVGEARGMATKARIAAYKICWSLGCFDSD  274

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAV+DGVH++SLS+ +    G+A  YD D IAIGAFGAV+ GV+VSC+AGN GP
Sbjct  275   ILAAMDQAVSDGVHIISLSVGAN---GYAPQYDHDSIAIGAFGAVKHGVLVSCSAGNSGP  331

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
              P+TAVN+APWILTVGASTIDREFPA V LG+ R F G SLYSG      ++P+VY G  
Sbjct  332   GPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFKGVSLYSGEPLGDAKLPLVYAGDC  391

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S YC+   LD++KV G+IV C++G +  +  KG AV  AGGVGMI+ N    G +L  +
Sbjct  392   GSRYCYDDSLDSTKVAGKIVVCDRGGNARVA-KGSAVKLAGGVGMILANTEESGEELIAD  450

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  IP  +V    G+ IR+Y  +  FPTA I+F GTVIG SP AP+VAAFS RGPN LT 
Sbjct  451   SHLIPANMVGETAGDKIREYASSDQFPTAAIKFIGTVIGPSPPAPKVAAFSSRGPNHLTA  510

Query  1550  EILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILAAWTG              EFN+ISGTSM+CPH SGLAA+L+K Y
Sbjct  511   EILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVEFNIISGTSMSCPHASGLAALLRKAY  570

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P WSPAAIKSALMTTAY +DN GR  + DL +   ++P  +G+GHVDP  A++PGLVYD 
Sbjct  571   PDWSPAAIKSALMTTAYNLDNGGR-NIKDLASGDESSPFVHGAGHVDPNRALNPGLVYDI  629

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVD--CRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
              V+DYV FLC IGY+ R+IA+FLR  P+    C NR +  PG LNYPSFSV+  +N   V
Sbjct  630   DVDDYVGFLCAIGYEPRRIAVFLRE-PMSSTVCANR-MATPGELNYPSFSVVLTSNGDVV  687

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--LRQSA  2224
              Y+R VKNV    +  Y+V V  P NV V+VSP++L F+     LSYE+TF S  L  S 
Sbjct  688   KYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSST  747

Query  2225  DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
               FGS+ W+DGTH V SPIAV W    V  +
Sbjct  748   PKFGSIEWTDGTHRVRSPIAVKWHQELVESI  778



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/745 (56%), Positives = 531/745 (71%), Gaps = 30/745 (4%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             PK+FIV +  S KP +F+THH WYSSI+ ++S       S  +LY+Y+  A GFSARLT 
Sbjct  28    PKTFIVHVSISHKPLIFTTHHHWYSSILRSVS-----QHSPNILYSYDRAARGFSARLTS  82

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              QA +L+ VPGV+SV+PDR+ +L TT +P FLGL   S  + P+SDY  ++I+GVLD+GI
Sbjct  83    GQADQLSRVPGVVSVIPDRVRQLHTTHTPTFLGL-EDSFGIWPNSDYADNVIVGVLDTGI  141

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPER SFSD+GL+P+P+ W+ KCE GP+FPATSCNRKIIGAR +Y+GYEA+ G P+    
Sbjct  142   WPERPSFSDKGLSPVPSGWKGKCESGPDFPATSCNRKIIGARLFYKGYEADRGSPMDESK  201

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C ++
Sbjct  202   ESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGEARGMAVKARIAAYKICWKTGCFDS  261

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MDQAVADGVHV+SLS+ +    G++  YD D IAIGAFGA + GV+VSC+AGN G
Sbjct  262   DILAAMDQAVADGVHVISLSVGAD---GYSPEYDVDSIAIGAFGATEHGVVVSCSAGNSG  318

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P   TAVN+APWILTV ASTIDREFPA V LG+ R F G SLY+G      ++ +VY   
Sbjct  319   PGASTAVNVAPWILTVAASTIDREFPADVILGDGRIFGGVSLYTGDPLGNAKLQLVYSAD  378

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
               S  C+PG+LD SKV G+IV C++G +   V+KG AV QAGG GM++ NL + G +L  
Sbjct  379   CGSQLCYPGKLDPSKVAGKIVLCDRGGNAR-VEKGSAVKQAGGAGMVLANLADSGEELVA  437

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             +A  +P  +V    G  IR Y+++   PTA I FKGTVIG SPSAPR+AAFS RGPN++T
Sbjct  438   DAHLLPATMVGQKAGNKIRDYIKSVPSPTATITFKGTVIGKSPSAPRIAAFSGRGPNYVT  497

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
             PEILKPDV APGVNILA WTG++            EFN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  498   PEILKPDVTAPGVNILAGWTGAVGPTDLEIDKRRVEFNIISGTSMSCPHVSGLAALLRKA  557

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             YP W+ AAIKSALMTTAY VDNSG+ T+ DL T Q ++P   GSGHVDP  A+ PGLVYD
Sbjct  558   YPKWTTAAIKSALMTTAYNVDNSGK-TITDLATGQESSPFVRGSGHVDPNRALHPGLVYD  616

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI  2053
                +DYV FLC IGY   +I+ F +++  V+C   +L +PG LNYPSFSV+F +    V 
Sbjct  617   IESSDYVGFLCAIGYGPSRISPFTKDTSSVNCSEHSLASPGDLNYPSFSVVFMSE-NVVK  675

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-----LRQ  2218
             YKR VKNV +  NV Y+V V  PS+V V V+P++L F++  ++LSYE++F S     ++ 
Sbjct  676   YKRVVKNVGRNANVVYKVKVNAPSSVEVKVTPSKLSFSEEKNSLSYEISFSSVGSERVKG  735

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSW  2293
                +FGS+ WSDG H V SPIAV W
Sbjct  736   LESAFGSIEWSDGIHSVRSPIAVRW  760



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/757 (55%), Positives = 532/757 (70%), Gaps = 29/757 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +E ++F+V + KS KP  ++THH WYSSI+ +L+   +  + S++LY+YE  A+GFSARL
Sbjct  24    DESQTFVVHVSKSHKPSAYATHHHWYSSIVRSLA---SSGQPSKILYSYERAANGFSARL  80

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T +QASEL  VPGV+SVLPDR  ++ TTR+P FLGL + +  L P+SDY  D+IIGVLD+
Sbjct  81    TAAQASELRRVPGVLSVLPDRAHQIHTTRTPHFLGL-ADNYGLWPNSDYADDVIIGVLDT  139

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  SFSD GL+P+PNSW   C+ GP+FPA++CNRKIIGARA+++GYE  +G+P+  
Sbjct  140   GIWPEIRSFSDSGLSPVPNSWNGVCDTGPDFPASACNRKIIGARAFFKGYEGALGRPMDE  199

Query  647   --EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAGS V +A++   A+GEARG+A  ARIA YK+CW   C 
Sbjct  200   SVESKSPRDTEGHGTHTASTAAGSVVQDASLFEFAKGEARGMAVKARIAAYKICWSLGCF  259

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQAVADGV ++SLS+ +    G A  YD D IAIGAFGA+  GV+VSC+AGN
Sbjct  260   DSDILAAMDQAVADGVDIISLSVGAT---GLAPRYDHDSIAIGAFGAMDHGVLVSCSAGN  316

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GPDP TAVN+APWILTVGASTIDREFPA V LG+ R F G S+YSG       +P+VY 
Sbjct  317   SGPDPLTAVNIAPWILTVGASTIDREFPADVVLGDGRIFGGVSIYSGDPLKDTNLPLVYA  376

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   S +CF G+L+ S+V G+IV C++G +   V+KG AV  A G GMI+ N  + G +L
Sbjct  377   GDCGSRFCFTGKLNPSQVSGKIVICDRGGNAR-VEKGTAVKMALGAGMILANTGDSGEEL  435

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P  +V    G+ I++YV++ +FPTA I F+GTVIG SP AP+VAAFS RGPN 
Sbjct  436   IADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIVFRGTVIGTSPPAPKVAAFSSRGPNH  495

Query  1541  LTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTGS             EFN+ISGTSM+CPHVSGLAA+L+
Sbjct  496   LTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPRRVEFNIISGTSMSCPHVSGLAALLR  555

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP W+PAAIKSALMTTAY +DNSG   + DL T   ++P  +G+GHVDP  A+ PGLV
Sbjct  556   KAYPKWTPAAIKSALMTTAYNLDNSGN-NIADLATGNQSSPFIHGAGHVDPNRALYPGLV  614

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-----  2032
             YD   NDY+ FLC IGYD+ +IA+F+R    VDC    L  PG LNYP+FSV+F      
Sbjct  615   YDIDANDYISFLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDP  674

Query  2033  -NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS  2209
              +    +  KR VKNV    N  Y+V V  P  + V VSP +LVF+    T SYEV+F S
Sbjct  675   VHQGNEIKLKRVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTS  734

Query  2210  LRQSADS-FGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             +     S FGS+ WSDGTH+V SP+AV +   +VS +
Sbjct  735   VESYIGSRFGSIEWSDGTHIVRSPVAVRFHQDAVSSI  771



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/751 (57%), Positives = 526/751 (70%), Gaps = 28/751 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FI+    S KP LFS+HH WYSS++H+L P  +H   S++LYTY   A GFSARLT  
Sbjct  90    QTFIIHASSSHKPSLFSSHHHWYSSLLHSLPP--SHP-PSQILYTYRAAAAGFSARLTAP  146

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA  L   PGV+SV+PDR+  L TTR+P+FLGL   S  L P+SDY  DIIIGVLD+GIW
Sbjct  147   QAEALRRAPGVLSVVPDRIRHLHTTRTPRFLGLTE-SFGLWPNSDYADDIIIGVLDTGIW  205

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL P+P +WR  CEVG +FPA++CNRKIIGARA+Y+GYEA + +PI    E
Sbjct  206   PERRSFSDSGLGPVPGAWRGTCEVGRDFPASACNRKIIGARAFYKGYEAYLERPIDETKE  265

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH +S A GS V+NA+   +A GEARG+AT ARIA YK+CW   C ++D
Sbjct  266   SKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVGEARGMATKARIAAYKICWSLGCFDSD  325

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAV+DGVH++SLS+ +    G+A  YD D IAIGAFGAV+ GV+VSC+AGN GP
Sbjct  326   ILAAMDQAVSDGVHIISLSVGAN---GYAPQYDHDSIAIGAFGAVKHGVLVSCSAGNSGP  382

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
              P+TAVN+APWILTVGASTIDREFPA V LG+ R F G SLYSG      ++P+VY G  
Sbjct  383   GPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFKGVSLYSGEPLGDAKLPLVYAGDC  442

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S YC+   LD++KV G+IV C++G +  +  KG AV  AGGVGMI+ N    G +L  +
Sbjct  443   GSRYCYDDSLDSTKVAGKIVVCDRGGNARVA-KGSAVKLAGGVGMILANTEESGEELIAD  501

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  IP  +V    G+ IR+Y  +  FPTA I+F GTVIG SP AP+VAAFS RGPN LT 
Sbjct  502   SHLIPANMVGETAGDKIREYASSDQFPTAAIKFIGTVIGPSPPAPKVAAFSSRGPNHLTA  561

Query  1550  EILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILAAWTG              EFN+ISGTSM+CPH SGLAA+L+K Y
Sbjct  562   EILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVEFNIISGTSMSCPHASGLAALLRKAY  621

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P WSPAAIKSALMTTAY +DN GR  + DL +   ++P  +G+GHVDP  A++PGLVYD 
Sbjct  622   PDWSPAAIKSALMTTAYNLDNGGR-NIKDLASGDESSPFVHGAGHVDPNRALNPGLVYDI  680

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVD--CRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
              V+DYV FLC IGY+ R+IA+FLR  P+    C NR +  PG LNYPSFSV+  +N   V
Sbjct  681   DVDDYVGFLCAIGYEPRRIAVFLRE-PMSSTVCANR-MATPGELNYPSFSVVLTSNGDVV  738

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--LRQSA  2224
              Y+R VKNV    +  Y+V V  P NV V+VSP++L F+     LSYE+TF S  L  S 
Sbjct  739   KYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSST  798

Query  2225  DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
               FGS+ W+DGTH V SPIAV W    V  +
Sbjct  799   PKFGSIEWTDGTHRVRSPIAVKWHQELVESI  829



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 534/759 (70%), Gaps = 31/759 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ ++FI+ + KS KP +FSTHH WYSSI+ ++S   +    S++LYTYE  A GFSARL
Sbjct  27    DDHETFIIHVAKSHKPHVFSTHHHWYSSIVRSVS--PSSHHPSKILYTYERAAVGFSARL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  QA +L  VPGVISV+PD++    TT +P FL L + S  L P SDY  D+I+GVLD+
Sbjct  85    TAGQADQLRRVPGVISVIPDQVRYPHTTHTPTFLKL-ADSFGLWPDSDYADDVIVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPER SFSD GL+P+P  W+ KC  GP FP +SCNRKIIGAR +Y+GYEA  G P+  
Sbjct  144   GIWPERPSFSDEGLSPVPAGWKGKCVTGPGFPRSSCNRKIIGARMFYKGYEASQG-PMDE  202

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C 
Sbjct  203   SKEAKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGEARGMAIKARIAAYKICWKTGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQAV DGVHV+SLS+ +    G+A  Y  D IAIGAFGA + GV+VSC+AGN
Sbjct  263   DSDILAAMDQAVDDGVHVISLSVGAN---GYAPHYLHDSIAIGAFGASEHGVLVSCSAGN  319

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PYTAVN+APWILTVGASTIDREFPA V LG+ R F G SLY+G   +  ++PVVY 
Sbjct  320   SGPGPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFGGVSLYAGNPLNDSKLPVVYS  379

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   S YC+PG+LD  KV G+IV C++G +   V+KG AV  AGGVGMI+ NL + G +L
Sbjct  380   GDCGSKYCYPGKLDHKKVAGKIVLCDRGGNAR-VEKGSAVKLAGGVGMILANLADSGEEL  438

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P  +V    G+ IR+YV +   PTA I FKGTVIGNSP+APRVAAFS RGPN 
Sbjct  439   VADSHLLPATMVGQKAGDEIREYVISDPSPTATIVFKGTVIGNSPAAPRVAAFSSRGPNH  498

Query  1541  LTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDV APGVNILA WTG+             EFN+ISGTSM+CPHVSGLAA+L+
Sbjct  499   LTPEILKPDVTAPGVNILAGWTGANGPTDLEIDPRRVEFNIISGTSMSCPHVSGLAALLR  558

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             + +  W+PAAIKSALMTTAY +DNSG+    DL T + +TP  +GSGHVDP  A++PGLV
Sbjct  559   RAHSKWTPAAIKSALMTTAYNLDNSGK-IFTDLATGEESTPFVHGSGHVDPNRALNPGLV  617

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD   +DYV+FLCTIGYD   IA+F+R+S  V+C  R+L  PG LNYPSF+V F ++   
Sbjct  618   YDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLNYPSFAVDFTSDSNG  677

Query  2048  VI-YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA  2224
             V+ YKR VKNV    N  Y+V V  P  V V+VSP +LVF++  ++LSYE++F S R   
Sbjct  678   VVKYKRVVKNVGGNPNAVYEVKVNAPLGVEVSVSPAKLVFSEENNSLSYEISFTSKRSED  737

Query  2225  D--------SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             +        +FGS+ WSDG H V SPIAV W  +S   +
Sbjct  738   NIMVKGTPSAFGSIEWSDGIHSVRSPIAVRWRYQSAVSM  776



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/753 (55%), Positives = 529/753 (70%), Gaps = 24/753 (3%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             P++FI+++ +S KP LFS+H DWYSSII +L P  +H  SS+LLYTY    +GFSA LTP
Sbjct  30    PQTFIIYVSRSHKPALFSSHDDWYSSIIQSLPPSPDHPHSSKLLYTYSKAINGFSAHLTP  89

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              QA  L   PG++SV+PDR   L TTR+P FLGL S S  + P+S Y  D+IIGVLD+GI
Sbjct  90    LQAEILRQHPGILSVIPDRPRHLHTTRTPHFLGL-SDSFGIWPNSKYADDVIIGVLDTGI  148

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPER SFSD  L+ +P  ++  CE   +FPA++CN+KIIGARA+YRGYE+ + +PI    
Sbjct  149   WPERHSFSDSTLSDVPRRFKGICETSKDFPASACNKKIIGARAFYRGYESYMERPIDETE  208

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD  GHGTH AS AAGS V+NA++  +ARGEARG+A  ARIAVYK+CW   C ++
Sbjct  209   ESKSPRDTEGHGTHTASTAAGSLVSNASLFDYARGEARGMAVKARIAVYKICWSPGCFDS  268

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MDQA+ADGV V+SLS+ +    G+A  YD+D IAIG+FGA Q GV+VSC+AGN G
Sbjct  269   DILAAMDQAIADGVDVISLSVGAS---GYAPQYDQDSIAIGSFGAAQHGVVVSCSAGNSG  325

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P P+TA N+APWILTVGASTIDREFPA   LG+ RSF G SLY+G      ++ +VYGG 
Sbjct  326   PGPFTATNIAPWILTVGASTIDREFPADAILGDGRSFGGVSLYAGESLPDFKLRLVYGGD  385

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
                 +C+ G+L+ SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N    G +L  
Sbjct  386   CGDRFCYMGRLEPSKVQGKIVVCDRGGNAR-VEKGAAVKLAGGLGMILANTDESGEELIA  444

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             ++  IP  +V    G+ IR+Y++ + +PTA I F+GTVI  SP AP+VAAFS RGPN LT
Sbjct  445   DSHLIPATMVGAIAGDKIREYIKLSQYPTATIVFRGTVISPSPPAPKVAAFSSRGPNSLT  504

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
              EILKPDVIAPGVNILAAWTGS             +FN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  505   AEILKPDVIAPGVNILAAWTGSTGPTDLEIDCRRVDFNIISGTSMSCPHVSGLAALLRKA  564

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             YP WSPA IKSALMTTAY +DNSG   + DL + + +TP  +G+GHVDP  A++PGLVYD
Sbjct  565   YPDWSPAVIKSALMTTAYNLDNSGE-NIKDLASGEESTPFIHGAGHVDPNRALNPGLVYD  623

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI  2053
               V++YV FLC+IGYD ++I++F+R     D   R L  PG+LNYPSFSV+F +N   V 
Sbjct  624   IDVSEYVAFLCSIGYDVKRISVFVREPASSDICTRALATPGNLNYPSFSVVFNSNNDVVK  683

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-----LRQ  2218
             YKR VKNV    +  Y+V V  P NV V V P++L F+     L+YE+TF S     L  
Sbjct  684   YKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGV  743

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             S    GS+ WSDG HLV SPIAV W   SVS +
Sbjct  744   SPQQSGSIEWSDGVHLVRSPIAVRWIQGSVSSM  776



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/748 (54%), Positives = 528/748 (71%), Gaps = 27/748 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FI+ + KS KP LFS+HHDWY+SII +L P     + +++LY Y H  HGFS  L
Sbjct  26    DHPQTFIIHVSKSHKPSLFSSHHDWYTSIIQSLPP---SPQPAKILYNYNHAIHGFSVHL  82

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP+Q ++L  VPG++SV+PD++ +L TT +P FLGL S SS L  +S YG  +IIGVLD+
Sbjct  83    TPTQLAKLRLVPGILSVIPDQIRQLHTTHTPTFLGL-SESSRLWQNSGYGDGVIIGVLDT  141

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  S SD GL+ +P +W+  CE GP+FPA+SCN+K+IGARA+++GY    G+PI  
Sbjct  142   GIWPEHKSLSDSGLSDVPANWKGICETGPDFPASSCNKKLIGARAFHKGYITHKGRPIDE  201

Query  647   EPKSA--RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               +SA  RD  GHGTH A+ AAGS   NA++  +A GEARG+A+ ARIA YK+CW   C 
Sbjct  202   SKESASPRDTEGHGTHTATTAAGSLAHNASLFQYATGEARGMASKARIAAYKICWSSGCY  261

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA+ DGVHV+SLS+ +    G A  YD D IAIGAF A Q G++VSC+AGN
Sbjct  262   DSDILAAMDQAIYDGVHVISLSVGAT---GHAPQYDHDSIAIGAFSASQHGIVVSCSAGN  318

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PYTAVN+APWILTVGASTIDREFPA V LGN   F+G SLYSG      ++P+VY 
Sbjct  319   AGPGPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFSGVSLYSGDPLVDHKLPLVYA  378

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   S YC+ G +  SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N  + G +L
Sbjct  379   GDVGSRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAVKLAGGLGMILANTADSGEEL  437

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P   V       IRQY+++   PTA I F+GT+IG SP+AP+VAAFS RGPN+
Sbjct  438   IADSHLLPATEVGEIAANKIRQYIKSDQSPTATILFRGTIIGTSPAAPKVAAFSSRGPNY  497

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG+AA+L+
Sbjct  498   LTPEILKPDVIAPGVNILAGWTGFVGPTDLELDPRRVEFNIISGTSMSCPHVSGIAALLR  557

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP WSPAAIKSAL+TTAYT+DNSG+  + DL + + +TP  +G+GHVDP  A+DPGLV
Sbjct  558   KAYPDWSPAAIKSALVTTAYTLDNSGK-NIKDLASGEESTPFIHGAGHVDPNSALDPGLV  616

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD   +DY+ FLC IGYDS +IA+F+R  P  D  +  +G+PG+LNYPS SV+F++    
Sbjct  617   YDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKVGSPGNLNYPSISVVFQSTSDV  676

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS--  2221
             V YKR VKNV    +  Y+V V +P+NV + VSP++LVF+    TLSYE+TF S+     
Sbjct  677   VTYKRVVKNVGGSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITFSSVSLDWP  736

Query  2222  ---ADSFGSLRWSDGTHLVTSPIAVSWE  2296
                  +FGS+ WSDG H V  PIAV W 
Sbjct  737   TIIPSTFGSIEWSDGIHGVRGPIAVKWR  764



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/755 (56%), Positives = 534/755 (71%), Gaps = 31/755 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ ++FI+ + KS KP  FSTHH WYSSII +L P   H+R +++LYTY+    GFSARL
Sbjct  25    DDQETFIIHVSKSHKPLAFSTHHHWYSSIIQSLPP---HNRPAKILYTYDRAVRGFSARL  81

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             + +QA+ L+ VPGVISV+PD +    TTR+P+FLGL + S  L P++DY  D+I+GVLD+
Sbjct  82    SAAQAAALSRVPGVISVIPDAVRHPHTTRTPKFLGL-ADSFGLWPNADYADDVIVGVLDT  140

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPER SFSD GL+P+P+ W+  C   P+FPAT CN+KIIGA+ +Y GYEA  GK +  
Sbjct  141   GIWPERPSFSDEGLSPVPSHWKGSCVDAPDFPATLCNKKIIGAKTFYLGYEASRGKTMEE  200

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAGS V NA++ G+A+GEARG+A  ARIAVYK+CW   C 
Sbjct  201   SNESKSPRDTEGHGTHTASTAAGSRVVNASLFGYAKGEARGMAVKARIAVYKICWAFGCY  260

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ M+ A+ DGV V+SLS+ +    G+A  YD D IAIGAFGA + G++VSC+AGN
Sbjct  261   DSDILAAMEHAIEDGVDVISLSVGAN---GYAPQYDFDSIAIGAFGAAEHGIVVSCSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GPD YTAVN+APWILTVGAST+DREFPA V LG+ R+F G SLY G       +P+VYG
Sbjct  318   SGPDSYTAVNIAPWILTVGASTLDREFPADVILGDGRTFGGVSLYHGDSLGEKLLPLVYG  377

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                 S YC+ GQLD +KV G+IV C++G +   V+KG AV  AGG G+I+ NL + G +L
Sbjct  378   ADCGSRYCYTGQLDPAKVAGKIVICDRGGNAR-VEKGNAVHVAGGAGLIMANLADSGEEL  436

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  IP  +V    G+ IR Y R+   PTA I F+GTVI  SP APRVA+FS RGP++
Sbjct  437   LADAHFIPATMVGQTAGDKIRAYARSDPNPTATIAFRGTVISTSPPAPRVASFSSRGPSY  496

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
              T EILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSGLAA+L+
Sbjct  497   RTAEILKPDVIAPGVNILAGWTGYIGPTDLESDTRKVEFNIISGTSMSCPHVSGLAALLR  556

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K +P WSPAAIKSALMTTAY +DNSG G + DL T   + P  +GSGHVDP  AVDPGLV
Sbjct  557   KAHPKWSPAAIKSALMTTAYNLDNSG-GNITDLATGSESNPFVHGSGHVDPNRAVDPGLV  615

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD  + DYV FLCTIGYDSR+I++F + +  VDC       PG+LNYPSFSV+F  +   
Sbjct  616   YDLEITDYVAFLCTIGYDSRRISVFTKQASSVDCDALGFKTPGNLNYPSFSVVFSGSESV  675

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS------  2209
             V YKRTVKNV K  N  Y+V V TP  V V+VSP++LVF+++ D LSYEVTF+S      
Sbjct  676   VKYKRTVKNVGKEANAVYEVKVNTPLGVEVSVSPSKLVFSEKEDKLSYEVTFKSSANAVG  735

Query  2210  --LRQSADSFGSLRWSD-GTHLVTSPIAVSWEGRS  2305
               +  S  SFGS+ WSD G+HLV SPIAV W   S
Sbjct  736   FEITGSKSSFGSIEWSDGGSHLVRSPIAVLWRRNS  770



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/754 (54%), Positives = 536/754 (71%), Gaps = 27/754 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FI+ + +S KP LFS+HHDWY+SIIH+L P S H   ++LLY Y H  HGFSA+L
Sbjct  28    DHPRTFIIHVSRSHKPSLFSSHHDWYTSIIHSLPP-SPHP--AKLLYNYNHATHGFSAQL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T +Q   L  VPG++SV+PD++ ++ TT +P FLGL S S  L  +S YG  +IIGVLD+
Sbjct  85    TTTQVEMLRRVPGILSVIPDQIRQIHTTHTPAFLGL-SESFGLWENSGYGDGVIIGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  S SD GL+ +P +W+  CE GP+FPA+SCN+K+IGARA+ +GY +  G+ I  
Sbjct  144   GIWPEHRSLSDSGLSDVPANWKGICETGPDFPASSCNKKLIGARAFNKGYISHRGRHIDD  203

Query  647   EPKSA--RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               +SA  RD  GHGTH ++ AAGS+V NA++  +A GEARG+A+ ARIA YK+CW   C 
Sbjct  204   SKESASPRDTEGHGTHTSTTAAGSSVHNASLFEYASGEARGMASKARIAAYKICWSSGCY  263

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA+ DGVHV+SLS+ +    G A  YD D IAIGAF A Q G++VSC+AGN
Sbjct  264   DSDILAAMDQAIYDGVHVISLSVGAT---GHAPQYDHDSIAIGAFSASQHGIVVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GPDPYTAVN+APWILTVGASTIDREFPA V LGN   F+G SLYSG      ++P+VY 
Sbjct  321   SGPDPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFSGVSLYSGDPLVGFKLPLVYA  380

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   + YC+ G +  SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N  + G +L
Sbjct  381   GDVGNRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAVKLAGGLGMILANTADSGEEL  439

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P   V       IR+YV+ + +PTA I F+GT+IG SP+AP+VAAFS RGPN+
Sbjct  440   IADSHLLPATEVGEIAANKIREYVKLSQYPTATINFRGTIIGTSPAAPKVAAFSSRGPNY  499

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG+ A+L+
Sbjct  500   LTPEILKPDVIAPGVNILAGWTGFVGPTDLEIDPRRVEFNIISGTSMSCPHVSGIVALLR  559

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP WSPAAIKSAL+TTA+ +DNSG+  + DL + + +TP  +G+GHVDP  A+DPGLV
Sbjct  560   KAYPDWSPAAIKSALVTTAHNLDNSGK-NIKDLASSEESTPFIHGAGHVDPNSALDPGLV  618

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD   +DY+ FLC IGYDS++IA+F+R  P  D  +  +G+PG+LNYPSFSV+F++N   
Sbjct  619   YDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKVGSPGNLNYPSFSVVFQSNSDV  678

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQ---  2218
             V Y+RTVK+V    +  Y+V V  P+NV + VSP+RLVF     T+SYE+TF S+     
Sbjct  679   VTYRRTVKSVGNSPDAVYEVEVNAPANVDIKVSPSRLVFNAENKTVSYEITFSSVSSGWS  738

Query  2219  --SADSFGSLRWSDGTHLVTSPIAVSWEGRSVSE  2314
               ++ +FGS+ WS+G H V SPIAV W   S  E
Sbjct  739   SINSATFGSIEWSNGIHRVRSPIAVKWRQGSSRE  772



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/754 (54%), Positives = 536/754 (71%), Gaps = 27/754 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FI+ + +S KP LFS+HHDWY+SIIH+L P S H   ++LLY Y H   GFSA+L
Sbjct  28    DHPQTFIIHVSRSHKPSLFSSHHDWYTSIIHSLPP-SPHP--AKLLYNYNHAIRGFSAQL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T +Q  +L  VPG++SV+PD++ +L TT +P FLGL S SS L  +S YG  +IIGVLD+
Sbjct  85    TTTQVEKLRRVPGILSVIPDQIRQLHTTHTPAFLGL-SESSGLWENSGYGDGVIIGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  S SD GL+ +P +W+  CE GP+FPA+SCN+K+IGARA+ +GY +  G+ I  
Sbjct  144   GIWPEHRSLSDSGLSDVPANWKGICETGPDFPASSCNKKLIGARAFNKGYISHKGRHIDE  203

Query  647   EPKSA--RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               +SA  RD  GHGTH ++ AAGS+V NA++  +A GEARG+A+ ARIA YK+CW   C 
Sbjct  204   SKESASPRDTEGHGTHTSTTAAGSSVHNASLFEYASGEARGMASKARIAAYKICWSSGCY  263

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA+ DGVHV+SLS+ +    G A  YD D IAIGAF A Q G++VSC+AGN
Sbjct  264   DSDILAAMDQAIYDGVHVISLSVGAT---GHAPQYDHDSIAIGAFSASQHGIVVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GPDPYTAVN+APWILTVGASTIDREFPA V LGN   F G SLYSG      ++P+VY 
Sbjct  321   SGPDPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFGGVSLYSGDPLVDFKLPLVYA  380

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   + YC+ G +  SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N  + G +L
Sbjct  381   GDVGNRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAVKLAGGLGMILANTADSGEEL  439

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P   V     + IR+YV+ + +PTA I F+GT+IG SPSAP+VAAFS RGPN+
Sbjct  440   IADSHLLPATEVGEIAADKIREYVKLSQYPTATINFRGTIIGTSPSAPKVAAFSSRGPNY  499

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG+ A+L+
Sbjct  500   LTPEILKPDVIAPGVNILAGWTGFVGPTDLEIDPRRVEFNIISGTSMSCPHVSGIVALLR  559

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP WSPAAIKS+L+TTA+ +DNSG+  + DL + + +TP  +G+GHVDP  A++PGLV
Sbjct  560   KAYPDWSPAAIKSSLVTTAHNLDNSGK-NIKDLASSEESTPFIHGAGHVDPNSALNPGLV  618

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD   +DY+ FLC IGYDS++IA+F+R  P  D  +   G+PG+LNYPSFSV+F++N   
Sbjct  619   YDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKEGSPGNLNYPSFSVVFQSNSDE  678

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQ---  2218
             V Y+RTVKNV    +  Y+V V  P+NV + VSP++LVF     T+SY++TF S+     
Sbjct  679   VTYRRTVKNVGNSLDAVYEVEVNAPANVDIKVSPSKLVFNAENKTVSYDITFSSVSSGWS  738

Query  2219  --SADSFGSLRWSDGTHLVTSPIAVSWEGRSVSE  2314
               ++ +FGS+ WS+G H V SPIAV W   S  E
Sbjct  739   SINSATFGSIEWSNGIHRVRSPIAVKWRQGSSRE  772



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/753 (55%), Positives = 526/753 (70%), Gaps = 24/753 (3%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             P++FI+++ +S KP LFS+H DWYSSII +L P  +H  SS+LLYTY    +GFSA LTP
Sbjct  30    PQTFIIYVSRSHKPALFSSHDDWYSSIIQSLPPSPDHPHSSKLLYTYSKAINGFSAHLTP  89

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              Q   L   PG++SV+PDR   L TTR+P FLGL S S  + P+S Y  D+IIGVLD+GI
Sbjct  90    LQTEILRQYPGILSVIPDRPRHLHTTRTPHFLGL-SDSFGIWPNSKYADDVIIGVLDTGI  148

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPER SFSD  L+ +P  ++  CE   +FPA++CN+KIIGARA+YRGYE+ + +PI    
Sbjct  149   WPERHSFSDSTLSDVPRRFKGICETSKDFPASACNKKIIGARAFYRGYESYMERPIDETD  208

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD  GHGTH AS AAGS V+NA++  +ARGEARG+A  ARIAVYK+CW   C ++
Sbjct  209   ESKSPRDTEGHGTHTASTAAGSLVSNASLFDYARGEARGMAVKARIAVYKICWSPGCFDS  268

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MDQA+ADGV V+SLS+ +    G+A  YD+D IAIG+FGA Q GV+VSC+AGN G
Sbjct  269   DILAAMDQAIADGVDVISLSVGAS---GYAPQYDQDSIAIGSFGAAQHGVVVSCSAGNSG  325

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P P+TA N+APWILTVGASTIDREFPA   LG+ R F G SLY+G      ++ +VYGG 
Sbjct  326   PGPFTATNIAPWILTVGASTIDREFPADAILGDGRIFGGVSLYAGESLPDFKLHLVYGGD  385

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
                 +C+ G+L+ SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N    G +L  
Sbjct  386   CGDRFCYMGRLEPSKVQGKIVVCDRGGNAR-VEKGAAVKLAGGLGMILANTDESGEELIA  444

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             ++  IP  +V    G+ IR+Y++ + +PTA I F+GTVI  SP AP+VAAFS RGPN LT
Sbjct  445   DSHLIPATMVGAIAGDKIREYIKLSQYPTATIVFRGTVISPSPPAPKVAAFSSRGPNSLT  504

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
              EILKPDVIAPGVNILAAWTGS             +FN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  505   AEILKPDVIAPGVNILAAWTGSTGPTDLEIDPRRVDFNIISGTSMSCPHVSGLAALLRKA  564

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             YP WSPAAIKSALMTTAY +DNSG   + DL + + +TP  +G+GHVDP  A++PGLVYD
Sbjct  565   YPDWSPAAIKSALMTTAYNLDNSGE-NIKDLASGEESTPFIHGAGHVDPNRALNPGLVYD  623

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI  2053
               V++YV FLC+IGYD ++I++F+R     D   R L  PG+LNYPSFSV+F +N   V 
Sbjct  624   IDVSEYVAFLCSIGYDVKRISVFVREPVSSDICTRALATPGNLNYPSFSVVFNSNNDVVK  683

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF-----QSLRQ  2218
             YKR VKNV    +  Y+V V  P NV + V P++L F+     L+YE+TF       L  
Sbjct  684   YKRVVKNVGSSVDAVYEVKVNAPPNVAINVWPSKLAFSAEKKALAYEITFSIVGLDGLGV  743

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             S    GS+ WSDG HLV SPIAV     SVS +
Sbjct  744   SPQQSGSIEWSDGVHLVRSPIAVRGIQGSVSSM  776



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/761 (54%), Positives = 532/761 (70%), Gaps = 37/761 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FIV + KS++P   ++HH WYSSI+ +L        S+ +LY Y+H   GFSA LT S
Sbjct  33    QTFIVHVSKSQRPPYLTSHH-WYSSILRSLP---QSPPSTRILYVYDHAITGFSAHLTQS  88

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q +EL  +PGV+S+LPDR  +L TTR+P FLGL + +  L P+SDY  D+IIGVLD+GIW
Sbjct  89    QVAELQRIPGVLSILPDRPHQLHTTRTPHFLGL-ADTFGLWPNSDYADDVIIGVLDTGIW  147

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SF D  L+ IP+ W+  CE GP+FPA+SCN KIIGARA+YRGYEA +G+P+    E
Sbjct  148   PERRSFYDSDLSEIPSGWKGTCETGPDFPASSCNGKIIGARAFYRGYEAALGRPMNDTVE  207

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAG+AV  A     A GEARG+AT ARIA YKVCW   C ++D
Sbjct  208   SKSPRDTEGHGTHTASTAAGAAVREAGFYKFAVGEARGMATRARIAAYKVCWKLGCFDSD  267

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MD A+ADGVH++SLS+ +    G+A PY  D IAIGAFGA+QKGV+VSC+AGN GP
Sbjct  268   ILAAMDHAIADGVHIISLSVGAT---GYAPPYYHDSIAIGAFGAIQKGVLVSCSAGNSGP  324

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVVYGG  1183
             +PYTAVN+APWI+TVGASTIDREFPA V LG+ R F G SLYSG  +  S   +P+VY  
Sbjct  325   EPYTAVNIAPWIITVGASTIDREFPADVVLGDGRVFNGVSLYSGDPLGDSGHLLPLVYAA  384

Query  1184  SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
                S  C+PG+LD +KV G+IV C++G +   V+KG A+  +GG GMI+ N    G +L 
Sbjct  385   DCGSRLCYPGKLDPTKVAGKIVVCDRGGNAR-VEKGSAIKISGGAGMIMANTAESGEELI  443

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              ++  +P  +V    G+ IR Y+R+   PTA I F+GTVIG SPSAP+VA+FS RGPN+ 
Sbjct  444   ADSHLLPATMVGQTSGDKIRDYIRSDPSPTATIVFRGTVIGASPSAPKVASFSSRGPNYQ  503

Query  1544  TPEILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLAAMLKK  1690
             T EILKPDVIAPGVNILA WTG              EFN+ISGTSMACPHVSGLAA+L+K
Sbjct  504   TAEILKPDVIAPGVNILAGWTGYNGPTDLDIDPRRVEFNIISGTSMACPHVSGLAALLRK  563

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              YP W+PAA+KSALMTTAY +DN G+  + DL T + +TP  +G+GHVDP  A+DPGLVY
Sbjct  564   AYPKWTPAALKSALMTTAYNLDNGGK-NISDLATGKESTPFVHGAGHVDPNRALDPGLVY  622

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRN-SPLVDCRNRNLGNPGSLNYPSFSVLFKNN--L  2041
             D  VNDYV+FLC+IGYD + IALF+R+ +  V+C  ++L +PG LNYPSFSV+FK N   
Sbjct  623   DISVNDYVEFLCSIGYDEKMIALFIRDGNTSVNCSAQSLPSPGDLNYPSFSVVFKLNGGK  682

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL---  2212
               V Y+R V NV    +  Y+  V  P +V ++VSP++LVF+   +  SYE+TF+S+   
Sbjct  683   DVVKYRRVVTNVGDSVDAVYEAKVWGPDSVEISVSPSKLVFSGEEERQSYEITFKSVVPP  742

Query  2213  ------RQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                     SA  FG + WSDG+H V SPIA  W+ + VS +
Sbjct  743   NETEERTASASKFGWIEWSDGSHRVRSPIAFWWQPKLVSSI  783



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/747 (56%), Positives = 533/747 (71%), Gaps = 30/747 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FIV + KS KP +F+THH WYSSI+ ++S  S+   S+++LY+Y++ + GFSARLT  
Sbjct  33    ETFIVHVSKSHKPHIFTTHHHWYSSILRSVS--SSSQYSAKILYSYDYASQGFSARLTSG  90

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA  +  VPGV+SV+ DR  +L TT +P FLGL + S  L P+SDY  D+I+GVLD+GIW
Sbjct  91    QADRIRRVPGVVSVILDRARQLHTTHTPTFLGL-ADSFGLWPNSDYADDVIVGVLDTGIW  149

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SF+D GL+ +P+ W+ KCE GP+FPATSCNRKIIGAR +Y+GYEA+ G PI    E
Sbjct  150   PERPSFTDDGLSAVPSGWKGKCETGPDFPATSCNRKIIGARLFYKGYEADRGSPIDESKE  209

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C ++D
Sbjct  210   SKSPRDTEGHGTHTASTAAGSVVANASFFQYAKGEARGMAVKARIAAYKICWKTGCFDSD  269

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAVADGVHV+SLS+ +    G+A  YD D IAIGAFGA + GV+VSC+AGN GP
Sbjct  270   ILAAMDQAVADGVHVISLSVGAD---GYAPEYDVDSIAIGAFGASEHGVVVSCSAGNSGP  326

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                TAVN+APWILTV ASTIDREFPA V LG+ R F G SLYSG      ++P+VY G  
Sbjct  327   GASTAVNVAPWILTVAASTIDREFPADVILGDGRIFGGVSLYSGDPLGDSKLPLVYSGDC  386

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S  C+PG+LD SKV G+IV C++G +   V+KG AV  AGG GM++ NL + G +L  +
Sbjct  387   GSQLCYPGKLDPSKVAGKIVLCDRGGNAR-VEKGSAVKLAGGAGMVLANLADSGEELVAD  445

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  +P  +V    G+ IR YV++ S PTA I FKGTVIG  PSAPR+AAFS RGPN++TP
Sbjct  446   SHLLPATMVGQKAGDKIRDYVKSDSSPTATIVFKGTVIGKPPSAPRIAAFSGRGPNYVTP  505

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDV APGVNILA WTGS+            EFN+ISGTSM+CPHVSGLAA+L+K Y
Sbjct  506   EILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVEFNIISGTSMSCPHVSGLAALLRKAY  565

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P W+ AAIKSALMTTAY +DNSG+ T  DL T Q ++P  +GSGHVDP  A+DPGLVYD 
Sbjct  566   PKWTTAAIKSALMTTAYNIDNSGK-TFTDLATGQESSPFVHGSGHVDPNRALDPGLVYDI  624

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIY  2056
                DYVDFLC IGYD ++I+ F++++  V+C  ++L +PG LNYPS   +  ++   V Y
Sbjct  625   ATRDYVDFLCAIGYDPKRISPFVKDTSSVNCSEKSLVSPGDLNYPS-FSVVFSSESVVKY  683

Query  2057  KRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--------L  2212
             KR VKNV +  N AY+V +  P++V V V+P +L F++   +LSYE++F S        +
Sbjct  684   KRVVKNVGRNTNAAYEVKINAPASVEVKVTPTKLSFSEENKSLSYEISFSSNGSVGLERV  743

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +    +FGS+ WSDG H V SPIAV W
Sbjct  744   KGLESAFGSIEWSDGIHSVRSPIAVHW  770



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/747 (55%), Positives = 534/747 (71%), Gaps = 30/747 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FIV + KS KP +F+THH+WYSSI+ ++S  S+   S+++LY+Y++ A GFSAR+T  
Sbjct  30    ETFIVHVSKSHKPHIFTTHHNWYSSILRSVS--SSSQHSAKILYSYDYAARGFSARITSG  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA  L  VPGV+SV+PDR  +L TT +P FLGL + S  L P+SDY  D+I+GVLD+GIW
Sbjct  88    QADRLRRVPGVVSVIPDRARQLHTTHTPTFLGL-ADSFGLWPNSDYADDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PER SFSD GL+ +P+ W+ KCE G +FPATSCNRKIIGAR +Y+GYEA+ G PI    E
Sbjct  147   PERPSFSDDGLSAVPSGWKGKCETGQDFPATSCNRKIIGARLFYKGYEADRGSPIDESKE  206

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS VANA+   +A+GEARG+A  ARIA YK+CW   C ++D
Sbjct  207   SKSPRDTEGHGTHTASTAAGSVVANASFFQYAKGEARGMAVKARIAAYKICWKTGCFDSD  266

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAVADGVHV+SLS+ +    G+A  YD D IAIGAFGA + GV+VSC+AGN GP
Sbjct  267   ILAAMDQAVADGVHVISLSVGAD---GYAPEYDVDSIAIGAFGASEHGVVVSCSAGNSGP  323

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                TAVN+APWILTV ASTIDREFPA V LG+ R F G SLYSG   +  ++P+VY G  
Sbjct  324   GASTAVNVAPWILTVAASTIDREFPANVILGDGRIFGGVSLYSGDPLNDTKLPLVYSGDC  383

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S  C+PG+LD SKV G+IV C++G +   V+KG AV  AGG GM++ NL + G +L  +
Sbjct  384   GSQLCYPGKLDPSKVAGKIVLCDRGGNAR-VEKGSAVKLAGGAGMVLANLADSGEELVAD  442

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  +P  +V    G+ IR YV++ S P A I FKGTVIG SP+APR+AAFS RGPN++TP
Sbjct  443   SHLLPATMVGQKAGDKIRDYVKSDSSPKATIVFKGTVIGKSPTAPRIAAFSGRGPNYVTP  502

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDV APGVNILA WTGS+            EFN+ISGTSM+CPHVSGLAA+L+K Y
Sbjct  503   EILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVEFNIISGTSMSCPHVSGLAALLRKAY  562

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P W+ AAIKSALMTTAY VDNSG+ T  DL T Q ++P  +GSGHVDP  A+DPGLVYD 
Sbjct  563   PKWTTAAIKSALMTTAYNVDNSGK-TFTDLATGQESSPFVHGSGHVDPNRALDPGLVYDI  621

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIY  2056
              + DYV+FLC IGYD ++I+ F++ +  V+C  ++  +PG LNYPS   +  ++   V Y
Sbjct  622   EMKDYVNFLCAIGYDPKRISPFVKETSSVNCSEKSFVSPGDLNYPS-FSVVFSSESVVKY  680

Query  2057  KRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--------QSL  2212
             KR VKNV +  N  Y+V +  P++V V V+P +L F++   +LSYE++F        +++
Sbjct  681   KRVVKNVGRNTNAVYEVKISVPASVEVKVTPTKLSFSEENKSLSYEISFSSNGSVGLETV  740

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +    +FGS+ WSDG H V SPIAV W
Sbjct  741   KGLESAFGSIEWSDGIHSVRSPIAVYW  767



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/748 (53%), Positives = 522/748 (70%), Gaps = 27/748 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FI+ + KS KP LF ++HDWY+SII +L P    +R   +LY Y H  HGFS  L
Sbjct  28    DHPQTFIIHVSKSHKPSLFCSYHDWYTSIIQSLPPSPQPAR---ILYNYNHAIHGFSVHL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP+Q ++L  VPG++SV+PD++ +L TT +  FLGL  GS  L  +S YG  +IIGVLD+
Sbjct  85    TPTQLAKLRLVPGILSVIPDQICQLHTTHTSTFLGLSEGS-RLWQNSGYGDGVIIGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  S SD GL+ +P +W+  CE GP+FPA+SCN+K+IGARA+Y+GY    G+PI  
Sbjct  144   GIWPEHKSLSDSGLSDVPANWKGICETGPDFPASSCNKKLIGARAFYKGYITHKGRPIDE  203

Query  647   EPKSA--RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               +SA  RD  GHGTH A+ AAGS   NA++  +A GEARG+A+ ARIA YK+CW   C 
Sbjct  204   SKESASPRDTEGHGTHTATTAAGSLAHNASLFQYATGEARGMASKARIAAYKICWSSGCY  263

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA+ DGVHV+SLS+ +    G A  YD D IAIGAF A Q G++VSC+AGN
Sbjct  264   DSDILAAMDQAIYDGVHVISLSVGAT---GHAPQYDHDSIAIGAFSASQHGIVVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PYTAVN+APWILTVGASTIDREFPA V LGN    +G SLYSG      ++P+VY 
Sbjct  321   AGPGPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVLSGVSLYSGDPLVDYKLPLVYA  380

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   S YC+ G +  SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N  + G +L
Sbjct  381   GDVGSRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAVKLAGGLGMILANTADSGEEL  439

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P   V       IRQY+++   PTA I F+GT+IG+SP+AP+VAAFS RGPN+
Sbjct  440   IADSHLLPATEVGEIAANKIRQYIKSDQSPTATILFRGTIIGSSPAAPKVAAFSSRGPNY  499

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG+ A+L+
Sbjct  500   LTPEILKPDVIAPGVNILAGWTGFVGPTDLELDPRRVEFNIISGTSMSCPHVSGIVALLR  559

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP WSPAAIKSAL+TTAYT+DNSG+  + DL + + +TP  +G+GHVDP  A+DPGLV
Sbjct  560   KAYPDWSPAAIKSALVTTAYTLDNSGK-NIKDLASAEESTPFIHGAGHVDPNSALDPGLV  618

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD   +DY+ FLC IGYDS +IA+F+R  P  D  +  + +PG+LNYPSFSV+F++    
Sbjct  619   YDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKVSSPGNLNYPSFSVVFQSTSDV  678

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS--  2221
             V  KR VKNV    +  Y+V V +P+NV + VSP++LVF+    TLSYE+TF S+     
Sbjct  679   VTCKRVVKNVGSSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITFSSVGLDWP  738

Query  2222  ---ADSFGSLRWSDGTHLVTSPIAVSWE  2296
                  ++GS+ WSDG H V  PIAV W 
Sbjct  739   TIIPSTYGSIEWSDGIHGVRGPIAVKWR  766



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/754 (55%), Positives = 521/754 (69%), Gaps = 33/754 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             ++FIV ++KSEKP  FSTHH WYSSII +L P   H R +E+LYTY+    GFSARL+ +
Sbjct  29    ETFIVHVIKSEKPLTFSTHHHWYSSIIKSLPP---HHRPAEILYTYDRAVRGFSARLSAA  85

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA  L  VP V+SV+PD +  L TT +P+FLGL + S  L P+SDY  D+I+GVLD+GIW
Sbjct  86    QADALRRVPAVVSVIPDAVRYLHTTHTPKFLGL-ADSFGLWPNSDYADDVIVGVLDTGIW  144

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PERSSFSD GL+ +P+ W+  C    +FPAT CN+K+IG +A+Y GYEA  G  +    E
Sbjct  145   PERSSFSDEGLSAVPSHWKGSCVDAADFPATLCNKKLIGTKAFYLGYEASRGTTMEESNE  204

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD  GHGTH AS AAGS VANA++ G+A GEARG+A  ARIAVYK+CW   C ++D
Sbjct  205   SKSPRDTEGHGTHTASTAAGSIVANASLLGYAEGEARGMAIKARIAVYKICWTFGCYDSD  264

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+  +QAV DGV V+SLS+ +    G A  YD D IAIGAF A + G++VSC+AGN GP
Sbjct  265   ILAAFEQAVIDGVDVISLSVGAN---GHAPQYDYDSIAIGAFAAAEHGIVVSCSAGNSGP  321

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
             DPYTAVN+APWILTVGAST+DR+FPAVVTLG++ ++TG SLY+G       +P+VY    
Sbjct  322   DPYTAVNIAPWILTVGASTLDRDFPAVVTLGDNTTYTGVSLYAGEPLGDKLLPLVYAADC  381

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              + YC+ G LD+SKV G+IV C++G +    +KG AV QAGG GMI+ NL +   +L  +
Sbjct  382   GNRYCYSGSLDSSKVAGKIVICDRGGNAR-AEKGNAVHQAGGAGMILANLADSAEELLAD  440

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             A  IP  +V    G  IR YV++   PTA I FKGTVI  SP APRVA+FS RGPN+ T 
Sbjct  441   AHFIPATMVGEIAGNKIRAYVKSDPNPTATITFKGTVISTSPPAPRVASFSSRGPNYRTA  500

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
             EILKPDVIAPGVNILA WTG +             FN+ISGTSM+CPHVSGLAA+L+K +
Sbjct  501   EILKPDVIAPGVNILAGWTGYVGPTDLESDSRRVAFNIISGTSMSCPHVSGLAALLRKAH  560

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P WSPAAIKSALMT+AY +DN+G   + DL T   +TP  +G+GHVDP  AVDPGLVYD 
Sbjct  561   PKWSPAAIKSALMTSAYNLDNTG-ANITDLATGAESTPFVHGAGHVDPNRAVDPGLVYDL  619

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIY  2056
                DY+ FLCTIGYDSR+I++F +++  VDC       PG+LNYPSFSV+F      V Y
Sbjct  620   DTTDYIAFLCTIGYDSRRISVFTKDASSVDCDKLGFKTPGNLNYPSFSVVFYGEESVVKY  679

Query  2057  KRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS---------  2209
              RTV NV    +  Y+V V  P  V V+VSP++LVF++  D LSYEVTF+S         
Sbjct  680   NRTVTNVGSEVDAVYEVRVGAPPGVEVSVSPSKLVFSETEDKLSYEVTFKSSSSASSGLE  739

Query  2210  -LRQSADSFGSLRWSD-GTHLVTSPIAVSWEGRS  2305
              +  +  SFGS+ WSD G+HLV SPIA  W   S
Sbjct  740   IVGSAKSSFGSIEWSDGGSHLVRSPIAAVWRTSS  773



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/746 (55%), Positives = 530/746 (71%), Gaps = 28/746 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTL-SPLSNHSRSSELLYTYEHVAHGFSAR  283
             + PK+FIV + KS+KP LFS+H  WY+SII +L SP       ++LLYTY+   HGFSA 
Sbjct  29    DRPKTFIVHVSKSDKPALFSSHRSWYTSIIQSLPSP-----HPTKLLYTYDRAVHGFSAA  83

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LT SQA++L + P V+SV PD+  +L TT +P FLGL   S  L P+SDY  D+I+GVLD
Sbjct  84    LTSSQATQLLSHPAVLSVTPDQPRQLHTTHTPSFLGLAE-SFGLWPNSDYADDVIVGVLD  142

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +GIWPER SFSD GL P+P+ W+  C   P+FP++SCNRKIIGARAY+ GYEA IG+ + 
Sbjct  143   TGIWPERPSFSDSGLGPVPSRWKGTCVSAPDFPSSSCNRKIIGARAYFDGYEAYIGRLMD  202

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD  GHGTH AS AAGS VANA++  +ARGEARG+AT ARIAVYK+CW   C
Sbjct  203   ESNESKSPRDTEGHGTHTASTAAGSPVANASLFSYARGEARGMATKARIAVYKICWSFGC  262

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ MDQA+ADGV ++SLS+ +    G +  YD D IAIG+FGA Q GV+VS +AG
Sbjct  263   FDSDILAAMDQAIADGVDIISLSVGAS---GRSPAYDRDSIAIGSFGAAQHGVLVSASAG  319

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP+P+TA N+APWILTVGAST+DREFPA V LG++R F G SLYSG      Q+P++Y
Sbjct  320   NSGPNPFTATNIAPWILTVGASTVDREFPADVILGDNRVFGGVSLYSGEPLVDHQLPLIY  379

Query  1178  GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             GG A S YC+ G L  SKV+G+IV C++G +   V KG AV  AGG+G I+ N  + G +
Sbjct  380   GGDAGSRYCYAGALKPSKVQGKIVVCDRGGNAR-VGKGSAVKLAGGLGFILANTADSGEE  438

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  IP   V     + IR+Y+R + +PTA I F+GTV+G SP+AP+VAAFS RGPN
Sbjct  439   LLADAHLIPATEVGEIAADQIREYIRLSQYPTATIVFRGTVVGTSPAAPKVAAFSSRGPN  498

Query  1538  FLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSGLAAML  1684
              LTPEILKPDVIAPGVNILA WTG+            TEFN+ISGTSM+CPHVSG+AA+L
Sbjct  499   SLTPEILKPDVIAPGVNILAGWTGASAPTDLDIDPRRTEFNIISGTSMSCPHVSGIAALL  558

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +K YP+WS AAIKSAL+TTAYT+D+SG+  + DL T + +TP  +G+GHVDP  A++PGL
Sbjct  559   RKAYPNWSIAAIKSALITTAYTLDDSGK-KIRDLATGKESTPFVHGAGHVDPNRALNPGL  617

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNL  2041
             +YD  VNDYV FLC+IGY  R+IA+FL      D C   +L +PG LNYPS SV+  ++ 
Sbjct  618   IYDLNVNDYVAFLCSIGYSPRQIAVFLGKPTGSDICTKNSLASPGDLNYPSLSVILSSDQ  677

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--LR  2215
               V YKR   NV    +  Y+V V  P+ V ++VSP++L F++   +LSYEVTF+     
Sbjct  678   SLVKYKRVATNVGGNVDAVYKVNVTAPAGVEISVSPSKLEFSEENQSLSYEVTFRRGVGY  737

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW  2293
                + +GS+ W+DG+HLV SP+AV W
Sbjct  738   DGGERYGSIEWTDGSHLVRSPVAVRW  763



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/755 (55%), Positives = 526/755 (70%), Gaps = 29/755 (4%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             P+++IV + +S+KP LFSTHH+WY+SI+H+L P    S  + LLYTY   A GFS R+TP
Sbjct  33    PRTYIVHVAQSQKPTLFSTHHNWYTSILHSLPP---SSHPATLLYTYSAAAAGFSVRITP  89

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
             SQ S L   P V++V PD++    TT +P+FLGL   S  L P+SDY  D+I+GVLD+GI
Sbjct  90    SQLSHLRRHPAVLAVEPDQVRHPHTTHTPRFLGLAE-SFGLWPNSDYADDVIVGVLDTGI  148

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPE  SFSD  L+P+P++W+  CEV  +FPA+SCNRKIIGA+A+Y+GYEA +  PI    
Sbjct  149   WPELRSFSDDNLSPVPSTWKGSCEVSRDFPASSCNRKIIGAKAFYKGYEAYLDGPIDESA  208

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD  GHGTH +S AAG  V+NA++  +A+GEARG+AT ARIA YK+CW   C ++
Sbjct  209   ESKSPRDTEGHGTHTSSTAAGGVVSNASLFHYAQGEARGMATKARIAAYKICWKYGCFDS  268

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MD+AVADGVHV+SLS+ S    G+A  Y  D IA+GAFGA +  V+VSC+AGN G
Sbjct  269   DILAAMDEAVADGVHVISLSVGSS---GYAPQYFRDSIALGAFGAARHNVLVSCSAGNSG  325

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P P+TAVN+APWILTVGASTIDREFPA V LG+ R F G SLY G      Q+ +VY   
Sbjct  326   PGPFTAVNIAPWILTVGASTIDREFPADVILGDGRVFGGVSLYYGESLPDFQLRLVYAKD  385

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
               + YC+ G L+ASKV+G+IV C++G +   V+KG AV  AGG+GMI+ N    G +L  
Sbjct  386   CGNRYCYLGSLEASKVQGKIVVCDRGGNAR-VEKGSAVKLAGGLGMIMANTAESGEELLA  444

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             +A  +   +V    G+ I++Y+R + +PTA IEFKGTVIG SPSAP+VA+FS RGPN LT
Sbjct  445   DAHLLAATMVGQIAGDEIKKYIRLSQYPTATIEFKGTVIGGSPSAPQVASFSSRGPNHLT  504

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
              EILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPH SG+AA+L+K 
Sbjct  505   SEILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNIISGTSMSCPHASGIAALLRKA  564

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             YP WSPAAIKSALMTTAY VDNSG G + DL T + + P  +G+GHVDP  A++PGLVYD
Sbjct  565   YPEWSPAAIKSALMTTAYNVDNSG-GNIKDLGTGKESNPFTHGAGHVDPNRALNPGLVYD  623

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-C-----RNRNLGNPGSLNYPSFSVLFKN  2035
             + +NDY+ FLC+IGYD+ +IA+F R     + C     R   L +PG LNYPSFSV    
Sbjct  624   SDINDYLAFLCSIGYDANQIAVFTREPAAANPCEGKVGRTGRLASPGDLNYPSFSVELGR  683

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR  2215
                 V YKR V NV  V +  Y V V  P  V VTV+PN LVF+    T ++EV F  + 
Sbjct  684   GSDLVKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVAPNTLVFSGENKTQAFEVAFSRVT  743

Query  2216  -QSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
               ++DSFGS+ W+DG+H+V SPIAV W G S S L
Sbjct  744   PATSDSFGSIEWTDGSHVVRSPIAVRWSGDSSSSL  778



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/755 (54%), Positives = 529/755 (70%), Gaps = 29/755 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTL-SPLSNHSRSSELLYTYEHVAHGFSAR  283
             + PK+FIV + KS+KP LFS+H  WY+SII  L SP       ++LLYTY+   HGFSA 
Sbjct  67    DRPKTFIVHVSKSQKPSLFSSHRSWYTSIIQNLPSP-----HPTKLLYTYDRSVHGFSAT  121

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LT SQA++L + P V+SV PD+  +L TT +P FLGL + S  L P+SDY  D++IGVLD
Sbjct  122   LTSSQATQLLSHPSVLSVTPDQPRQLHTTHTPNFLGL-ADSFGLWPNSDYADDVVIGVLD  180

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +GIWPER SFSD G+ PIP  W+  C    +FP+++CNRKIIGARAY+ GYE+ IG+ + 
Sbjct  181   TGIWPERPSFSDSGIGPIPTRWKGTCVTTADFPSSACNRKIIGARAYFNGYESHIGRLMD  240

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD  GHGTH AS AAG+ VANA+   +A+GEARG+AT ARIAVYK+CW   C
Sbjct  241   ETAEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQGEARGMATKARIAVYKICWSSGC  300

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ MDQA+ADGV ++SLS+ +    G A PYD D IAIGAFGA Q GV+VS +AG
Sbjct  301   FDSDILAAMDQAIADGVDIISLSVGAG---GRAPPYDRDSIAIGAFGAAQHGVLVSASAG  357

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP+P+TA N+APWILTVGASTIDREFPA V LG++R  +G SLYSG      ++P+V+
Sbjct  358   NSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVISGVSLYSGEPLVDYKLPLVH  417

Query  1178  GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             GG   S YC+ G L  SKV+G+IV C++G +  +  KG AV  AGG+GMI+ N    G +
Sbjct  418   GGDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVA-KGGAVKLAGGLGMILANTEESGEE  476

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +   IP   V       IR+Y+R + +PTA I F+GTVIG+SPS+PRVAAFS RGPN
Sbjct  477   LLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRGTVIGSSPSSPRVAAFSSRGPN  536

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAML  1684
              LTPEILKPDVIAPGVNILA WTG+             EFN+ISGTSM+CPHVSG+AA+L
Sbjct  537   SLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVEFNIISGTSMSCPHVSGIAALL  596

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +K YP+WS AAIKSAL+TTAYT+DN+G+  + DL T + +TP  +G+GHVDP  A++PGL
Sbjct  597   RKAYPNWSIAAIKSALITTAYTLDNAGK-KINDLGTGEESTPFVHGAGHVDPNRALNPGL  655

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNL  2041
             VYD  VNDYV FLC+IGY  R+IA+F+      D C   +L +PG LNYPSFSV+  ++ 
Sbjct  656   VYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDICTRNSLASPGDLNYPSFSVVLSSDQ  715

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--LR  2215
               V YKR   NV    +  Y+VTV  P+ V ++V P +LVF+    T SYEVTF+     
Sbjct  716   GLVKYKRIATNVGADADAVYEVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTFKRGVGY  775

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2317
              S + +GS+ W+DG HLV SP+AV W   RS++ +
Sbjct  776   DSGERYGSIEWTDGRHLVRSPVAVRWSSARSLASM  810



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/756 (55%), Positives = 526/756 (70%), Gaps = 33/756 (4%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + ++FIV + KS KP  F++HH WY+SI+ +L+  +  SR   +LY+YEH A GFSARLT
Sbjct  46    DSQNFIVHVSKSHKPTAFASHHQWYASIVQSLTSSTQPSR---ILYSYEHAATGFSARLT  102

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               QASEL  +PGV+SV P+++ E+ TT +P FLGL +  S L P+SDY  D+IIGVLD+G
Sbjct  103   AGQASELRRIPGVLSVWPEQVHEVHTTHTPHFLGL-ANDSGLWPNSDYADDVIIGVLDTG  161

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             IWPE  SF+D  L+P+P SW+  CE GP+FPA  CNRKIIGAR ++RGYE+ +G+ I   
Sbjct  162   IWPELRSFNDSELSPVPESWKGVCETGPDFPA--CNRKIIGARTFHRGYESALGRQIDES  219

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD  GHGTH AS AAGS V NA++  +A GEARG+AT ARIAVYK+CW   C +
Sbjct  220   EESKSPRDTEGHGTHTASTAAGSVVQNASMFEYANGEARGMATKARIAVYKICWNQGCLD  279

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ MDQA+ADGVHV+SLS+ +K   G A  YD D IAIGAFGA++ GVIVSC+ GN 
Sbjct  280   SDILAAMDQAIADGVHVISLSVGAK---GLAPKYDRDSIAIGAFGAMEHGVIVSCSVGNS  336

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP P+TAVN+APWILTVGASTIDREFPA V LGN R F G SLY+G   +   +P+V   
Sbjct  337   GPKPFTAVNIAPWILTVGASTIDREFPADVVLGNGRIFRGVSLYTGDPLNATHLPLVLAD  396

Query  1184  SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
                S  C  G+L+ S V G+IV C++G     V+KG AV  AGG GMI+ N    G +L 
Sbjct  397   ECGSRLCVAGKLNPSLVSGKIVVCDRGGGKR-VEKGRAVKLAGGAGMILANTKTTGEELV  455

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              ++  IP  +V    G+ I++Y  + S PTA I F+GTV+GNS  AP+VA+FS RGPN L
Sbjct  456   ADSHLIPATMVGKTAGDEIKRYADSKSSPTATIAFRGTVMGNSLLAPKVASFSSRGPNRL  515

Query  1544  TPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSGLAAMLKK  1690
             TPEILKPDVIAPGVNILA WTGS             EFN+ISGTSMACPHVSGLAA+L+K
Sbjct  516   TPEILKPDVIAPGVNILAGWTGSNSPTGLDMDERRVEFNIISGTSMACPHVSGLAALLRK  575

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              +P WSPAAIKSALMTTAY  DNSG   + DL T   +TP  +GSGHV+P  A+DPGLVY
Sbjct  576   AHPDWSPAAIKSALMTTAYNSDNSG-SQITDLATGNKSTPLIHGSGHVNPIGALDPGLVY  634

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL---  2041
             D G +DYV FLC++GY S  I +F+R+   V+C ++ +  PG LNYPSFSV+F  +    
Sbjct  635   DIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSVVFNADSAVI  692

Query  2042  ---QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
                + V +KR V+NV   +N  Y V V  P +V++ VSP++LVFT++    SYEVTF S+
Sbjct  693   KRGRVVKHKRVVRNVGSSKNAVYSVKVNPPPSVKINVSPSKLVFTEKNQVASYEVTFTSV  752

Query  2213  RQS-ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
               S    FGS+ W+DG+H V SP+AV W    V+ +
Sbjct  753   GASLMTEFGSIEWTDGSHRVRSPVAVRWHNDLVASM  788



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/756 (54%), Positives = 527/756 (70%), Gaps = 33/756 (4%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E ++FIV + KS KP  F++HH WY+SI+ +L+  +  SR   +LY+YEH A GFSARLT
Sbjct  26    ESQNFIVHVSKSHKPTAFASHHQWYASIVQSLTSSTQPSR---ILYSYEHAATGFSARLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               QASEL  +PGV+SV P+++ E+ TT +P FLGL +  S L P+SDY  D+IIGVLD+G
Sbjct  83    AGQASELRRIPGVLSVWPEQVHEVHTTHTPHFLGL-ANDSGLWPNSDYADDVIIGVLDTG  141

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             IWPE  SF+D  L+P+P SW+  CE GP+FPA  CNRKIIGAR ++RGYE+ +G+ I   
Sbjct  142   IWPELRSFNDSELSPVPESWKGVCETGPDFPA--CNRKIIGARTFHRGYESALGRQIDES  199

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD  GHGTH AS AAGS V NA++  +A GEARG+AT ARIAVYK+CW   C +
Sbjct  200   EESKSPRDTEGHGTHTASTAAGSVVQNASMFEYANGEARGMATKARIAVYKICWNQGCLD  259

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ MDQA+ADGVHV+SLS+ +K   G A  YD D IAIGAFGA++ GVIVSC+ GN 
Sbjct  260   SDILAAMDQAIADGVHVISLSVGAK---GLAPKYDRDSIAIGAFGAMEHGVIVSCSVGNS  316

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP P+TAVN+APWILTVGASTIDREFPA V LGN R F G SLY+G   +   +P+V   
Sbjct  317   GPKPFTAVNIAPWILTVGASTIDREFPADVVLGNGRIFRGVSLYTGDPLNAPHLPLVLAD  376

Query  1184  SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
                S  C  G+L+ S V G+IV C++G     V+KG AV  AGG GMI+ N    G +L 
Sbjct  377   ECGSRLCVAGKLNPSLVSGKIVVCDRGGGKR-VEKGRAVKLAGGAGMILANTKTTGEELV  435

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              ++  IP  +V    G+ I++Y  + S PTA I F+GTV+GNS  AP+VA+FS RGPN L
Sbjct  436   ADSHLIPATMVGKTAGDEIKRYADSKSSPTATIAFRGTVMGNSLLAPKVASFSSRGPNRL  495

Query  1544  TPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSGLAAMLKK  1690
             TPEILKPDVIAPGVNILA WTGS             EFN+ISGTSMACPHVSGLAA+L+K
Sbjct  496   TPEILKPDVIAPGVNILAGWTGSNSPTGLDMDERRVEFNIISGTSMACPHVSGLAALLRK  555

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              +P WSPAAIKSALMTTAY  DNSG   + DL +   +TP  +GSGHV+P  A+DPGLVY
Sbjct  556   AHPDWSPAAIKSALMTTAYNSDNSG-SQITDLASGNKSTPLIHGSGHVNPIGALDPGLVY  614

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQ--  2044
             D G +DYV FLC++GY S  I +F+R+   V+C ++ +  PG LNYPSFSV+F  +    
Sbjct  615   DIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSVVFNADSAVI  672

Query  2045  ----TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
                  V +KR V+NV   ++  Y V V +P +V++ VSP++LVFT++    SYEVTF S+
Sbjct  673   KRGGVVKHKRVVRNVGSSKDAVYSVKVNSPPSVKINVSPSKLVFTEKNQVASYEVTFTSV  732

Query  2213  RQSADS-FGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
               S  + FGS+ W+DG+H V SP+AV W    V+ +
Sbjct  733   GASLMTVFGSIEWTDGSHRVRSPVAVRWHNDLVASM  768



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/755 (54%), Positives = 518/755 (69%), Gaps = 37/755 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +   ++IV + KS KP   S+   WYSSI+H+LS  +       LLY+Y H + GF+A L
Sbjct  53    QSKSTYIVHVSKSHKPTTLSSPKSWYSSILHSLSTTTT---PPNLLYSYSHSSTGFAAHL  109

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             + +QA++L   P V+SV+PDR  ++ TT +P FLGL  GS  L P+S Y +D+I+GVLD+
Sbjct  110   SQAQAAQLRRHPAVLSVIPDRAHQIHTTHTPNFLGLHDGS-GLWPNSHYASDVIVGVLDT  168

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPE  SFSD G + +P +W+  CEVGP+FPA SCNRKI+GARA+Y+GYEA  G P+  
Sbjct  169   GIWPELLSFSDDGYDHVPPTWKGSCEVGPDFPAGSCNRKIVGARAFYKGYEAAKG-PMNE  227

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAGS V +A +  +ARGEARG+AT ARIA YK+CW   C 
Sbjct  228   TKESKSPRDTEGHGTHTASTAAGSVVPDAGLFDYARGEARGMATKARIAAYKICWSTGCY  287

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA+ DGVHV+SLS+ S    G A  +D+D IAIGA  AVQ GV+VSC+AGN
Sbjct  288   DSDILAAMDQAIEDGVHVISLSVGSS---GLAPQFDKDGIAIGALHAVQSGVLVSCSAGN  344

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLY--SGVQPSRIQVPVV  1174
              GPD +TA N+APWILTVGASTIDREFPA V LG+ R+F G SLY   G+  S + + +V
Sbjct  345   SGPDAFTATNIAPWILTVGASTIDREFPADVVLGDGRTFKGVSLYYGDGLNDS-VYLELV  403

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
              G    S  C  G LD SK  G++V C++GD T+ V KG AV QAGGVGMI+ N    G 
Sbjct  404   RGADCGSRLCKAGDLDTSKAAGKMVICDRGD-TARVAKGDAVKQAGGVGMILANTAESGE  462

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  ++  IP  +V    G+ IR YV     PTA I FKGTVIG SPSAPRVAAFS RGP
Sbjct  463   ELIADSHLIPATMVGQIAGDQIRDYVSAVPNPTATIRFKGTVIGPSPSAPRVAAFSSRGP  522

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAM  1681
             N LTPEILKPDVIAPGVNILA WTGS             +FN+ISGTSM+CPHVSGLAA+
Sbjct  523   NHLTPEILKPDVIAPGVNILAGWTGSAAPTDLEIDPRRVQFNIISGTSMSCPHVSGLAAL  582

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             L+  YPSWSPAA+KSALMTTAY +DNSG+  + DL T + ++P  +GSGHVDP  A++PG
Sbjct  583   LRNAYPSWSPAAVKSALMTTAYYLDNSGK-NITDLATGKQSSPFVHGSGHVDPNKALNPG  641

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             LVYD   NDY+  LC +GY+S +IA+FL+    +DC  +NL   G+LNYPSFSV+F++  
Sbjct  642   LVYDINANDYISLLCAMGYNSTRIAIFLKEPTTIDCAAKNLSTAGNLNYPSFSVVFESGK  701

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS  2221
               V Y R VKNV    +  Y+V+V  P NV V+VSP +L F+    TLSYE++F S+ ++
Sbjct  702   NVVKYTRVVKNVGSSADAVYEVSVNAPLNVDVSVSPRKLEFSADKQTLSYEISFTSISET  761

Query  2222  -----------ADSFGSLRWSDGTHLVTSPIAVSW  2293
                          SFGS+ WSDG+H V SPIAV W
Sbjct  762   YLTGKVKPILGTSSFGSIEWSDGSHRVRSPIAVRW  796



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/755 (54%), Positives = 528/755 (70%), Gaps = 29/755 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTL-SPLSNHSRSSELLYTYEHVAHGFSAR  283
             + PK+FIV + KS+KP LFS+H  WY+SII  L SP       ++LLYTY+   HGFSA 
Sbjct  29    DRPKTFIVHVSKSQKPSLFSSHRSWYTSIIQNLPSP-----HPTKLLYTYDRSVHGFSAT  83

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LT SQA++L + P V+SV PD+  +L TT +P FLGL + S  L P+SDY  D++IGVLD
Sbjct  84    LTSSQATQLLSHPSVLSVTPDQPRQLHTTHTPNFLGL-ADSFGLWPNSDYADDVVIGVLD  142

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +GIWPER SFSD G+ P+P  W+  C    +FP+++CNRKIIGARAY+ GYE+ IG+ + 
Sbjct  143   TGIWPERPSFSDSGIGPVPTRWKGTCVTTADFPSSACNRKIIGARAYFNGYESHIGRLMD  202

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD  GHGTH AS AAG+ VANA+   +A+G+ARG+AT ARIAVYK+CW   C
Sbjct  203   ETTEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQGDARGMATKARIAVYKICWSFGC  262

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ MDQA+ADGV ++SLS+ +    G A PYD D IAIGAFGA Q GV+VS +AG
Sbjct  263   FDSDILAAMDQAIADGVDIISLSVGAS---GNAPPYDRDSIAIGAFGAAQHGVLVSASAG  319

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP+P+TA N+APWILTVGASTIDREFPA V LG++R  +G SLYSG      ++P+VY
Sbjct  320   NSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVISGVSLYSGEPLVDYKLPLVY  379

Query  1178  GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             GG   S YC+ G L  SKV+G+IV C++G +  +  KG AV  AGG+GMI+ N    G +
Sbjct  380   GGDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVA-KGGAVKLAGGLGMILANTEESGEE  438

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +   IP   V       IR+Y+R + +PTA I F+GTVIG+SPS+P+VAAFS RGPN
Sbjct  439   LLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRGTVIGSSPSSPQVAAFSSRGPN  498

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAML  1684
              LTPEILKPDVIAPGVNILA WTG+             EFN+ISGTSM+CPHVSG+AA+L
Sbjct  499   SLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVEFNIISGTSMSCPHVSGIAALL  558

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +K +P+WS AAIKSAL+TTAYT+DN+G+  + DL T + +TP  +G+GHVDP  A++PGL
Sbjct  559   RKAFPNWSIAAIKSALITTAYTLDNAGK-KIKDLGTGEESTPFVHGAGHVDPNRALNPGL  617

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNL  2041
             +YD  VNDYV FLC+IGY  R+IA+F+      D C   +L +PG LNYPSFSV+  ++ 
Sbjct  618   IYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDMCTRNSLASPGDLNYPSFSVVLSSDQ  677

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--LR  2215
               + YKR   NV    +  Y+VTV  P+ V ++V P +LVF+    T SYEVTF+     
Sbjct  678   GLIKYKRIATNVGGDADAVYEVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTFKRGVGY  737

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2317
                + +GS+ W+DG HLV SP+AV W   RS++ +
Sbjct  738   DGGERYGSIEWTDGRHLVRSPVAVRWSSARSLASM  772



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=773

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/747 (54%), Positives = 518/747 (69%), Gaps = 29/747 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FIV + K  KP LFS+   WY+SI+ +L P S H   ++LLYTY    HGFSA L
Sbjct  29    DSPRTFIVHVSKYSKPALFSSQRRWYTSILRSLPP-SPHP--TKLLYTYSRAVHGFSATL  85

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG--PSSDYGADIIIGVL  460
             + SQA  L + P V+SV+PD   +L TTR+  FLGL   + N G  P+SDY  D+IIGVL
Sbjct  86    SASQAHALQSHPAVLSVVPDMPRQLHTTRTYDFLGL---ADNFGIWPNSDYADDVIIGVL  142

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+GIWPER SFSD GL P+P +W+ KC +  +FPA+SCNRKIIGARAY+ GYE+ +GKP+
Sbjct  143   DTGIWPERPSFSDSGLGPVPKTWKGKCVITGDFPASSCNRKIIGARAYFNGYESHLGKPM  202

Query  641   --VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E +S RD  GHGTH AS A GS V+NA+   +A GEARG+A+ ARIA YK+CW   
Sbjct  203   DESNESRSPRDTEGHGTHTASTAGGSRVSNASFYEYASGEARGMASKARIAAYKICWTFG  262

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DIL+ MDQA+ADGVH++SLS+ +    G A PYD D IAIGAFGA Q GV+VS +A
Sbjct  263   CFDSDILAAMDQAIADGVHIISLSVGAS---GGAPPYDRDSIAIGAFGAAQHGVLVSASA  319

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVV  1174
             GN GP  +TA N+APWILTVGAST+DREFPA V LG+ R F G SLYSG      ++P+V
Sbjct  320   GNSGPGKFTATNIAPWILTVGASTLDREFPADVVLGDGRVFNGVSLYSGEGLMDYKLPLV  379

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             YGG   S  C+ G L  SKV+G+IV C++G +  +  KG AV  AGG+GMI+ N    G 
Sbjct  380   YGGDCGSRLCYSGALQPSKVQGKIVVCDRGGNARVA-KGSAVKLAGGIGMIMANTEESGE  438

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  ++  IP  +V     + IR Y++T    TA I+F+GTVIG SP +P+VA+FS RGP
Sbjct  439   ELLADSHLIPATMVGQMAADQIRSYIKTGHNATATIKFRGTVIGTSPPSPKVASFSSRGP  498

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAM  1681
             N LTPEILKPDVIAPGVNILA WTG+ +           EFN+ISGTSM+CPHVSG+AA+
Sbjct  499   NSLTPEILKPDVIAPGVNILAGWTGASSPTDLDIDPRRVEFNIISGTSMSCPHVSGIAAL  558

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             L+K YP WSPAAIKSAL+TTAYT+DNSG   + DL     +TP  +G+GHVDP  A++PG
Sbjct  559   LRKAYPKWSPAAIKSALVTTAYTLDNSGN-KIKDLANGGESTPFVHGAGHVDPNRALNPG  617

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNN  2038
             LVYD  VNDYV F+C+IGY  R+IA+F+R     D C   +L +PG LNYPSF+V+FK  
Sbjct  618   LVYDIDVNDYVAFMCSIGYGPRQIAVFMRELAGDDICARNSLASPGDLNYPSFAVVFKPG  677

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS--L  2212
              + V YKR V NV  V +  Y+V V  P+ V ++V P++LVF++   T SYEVTF     
Sbjct  678   RELVKYKRVVTNVGSVVDAVYEVNVDAPAGVEISVEPSKLVFSEVNQTQSYEVTFAKGIG  737

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               + + +GS+ WSDG H V SP+AV W
Sbjct  738   YVNGERYGSIEWSDGRHHVRSPVAVRW  764



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/758 (54%), Positives = 525/758 (69%), Gaps = 31/758 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FIV + KS KP  F++HH WY+SII +L P S H   S+LLYTY    +GFSA L
Sbjct  79    DAPRTFIVHVSKSHKPSFFTSHHHWYTSIIRSL-PSSPHP--SKLLYTYGKSINGFSATL  135

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T SQAS+L  + GV+SV+PD+  +L TTR+ QFLGL + +  L P+SDY  D++IGVLD+
Sbjct  136   TASQASKLRGIRGVVSVVPDQPRQLHTTRTYQFLGL-TDNFGLWPNSDYAEDVVIGVLDT  194

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPER SFS  GL+ +P+ W+  CE   +FPA++CN KIIGAR++Y+GY A +GKPI  
Sbjct  195   GIWPERPSFSGAGLSRVPSGWKGICETAKDFPASACNGKIIGARSFYKGYLAALGKPIDE  254

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E  S RD  GHGTH +S AAG+ V+NA+   +A GEARG+AT ARIA YK+CW   C 
Sbjct  255   SKESLSPRDTEGHGTHTSSTAAGAVVSNASFLHYAPGEARGMATKARIAAYKICWSLGCY  314

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA++DGVH++SLS+ S      A PY  D IAIG+FGA Q GV+VSC+AGN
Sbjct  315   DSDILAAMDQAISDGVHIISLSVGSS----HASPYFLDSIAIGSFGAAQHGVLVSCSAGN  370

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GPD YTA N+APWILTVGASTIDREFPA V LG+ R F G SLY+G      ++P+VY 
Sbjct  371   SGPDAYTATNIAPWILTVGASTIDREFPADVILGDDRIFNGVSLYAGDSLGASKLPLVYA  430

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
               A   YC  G+L   KV G IV C++G +   V+KG AV  AGG GM++ NL + G +L
Sbjct  431   REAGDRYCHEGKLIPKKVEGTIVVCDRGGNAR-VEKGSAVKHAGGFGMVLANLEDSGEEL  489

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P  +V   +G+ I++Y+++   PTA I F+GTVIG+SP+AP+VAAFS RGPN 
Sbjct  490   LADSHLLPATMVGQINGDKIKEYIKSTENPTATIVFRGTVIGSSPAAPKVAAFSSRGPNI  549

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             L PEILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG+AA+L+
Sbjct  550   LNPEILKPDVIAPGVNILAGWTGFIGPTDLEIDPRRVEFNIISGTSMSCPHVSGIAALLR  609

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YPSWSPAAIKSAL+TTAY VDNSG  TL DL T + + P  +G+GHVDP  A++PGLV
Sbjct  610   KAYPSWSPAAIKSALITTAYDVDNSGE-TLRDLATGEESNPFVHGAGHVDPNRALNPGLV  668

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRN------LGNPGSLNYPSFSVLF  2029
             YDAGVNDYV FLC+IGYDS  I++F+R     D   +       L + G LNYPSFSV+F
Sbjct  669   YDAGVNDYVAFLCSIGYDSALISIFVREPTSSDICAKTFDKIGALISSGDLNYPSFSVVF  728

Query  2030  KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS  2209
              +N Q V YKR V NV    +  Y+V+V  P+ V + VSP+RLVF       ++EVTF +
Sbjct  729   DSNRQVVKYKRVVTNVGSETDAVYEVSVSEPAGVDIKVSPSRLVFRADNQKQTFEVTFTT  788

Query  2210  LRQSADS--FGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                   S  FGS+ W+DGTH V SP+A  W   S + +
Sbjct  789   SVDYIKSSRFGSVVWTDGTHRVRSPVAFKWRTGSAASM  826



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/756 (54%), Positives = 533/756 (71%), Gaps = 28/756 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P++FIV ++KS KP LFS+HHDWY+SII +L   S  S+   +LYTY+   +GFSA L
Sbjct  27    DRPQTFIVHVLKSHKPVLFSSHHDWYTSIIRSLPSSSPSSK---ILYTYDRAINGFSAHL  83

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  QA EL    GV+SV+PD++ +L TTR+P FLGL +GS  L  +  YG D+IIGVLD+
Sbjct  84    TAGQADELRQYLGVLSVIPDQIRQLHTTRTPHFLGLTNGS-GLWLNGAYGEDVIIGVLDT  142

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  SFSD GL P+P +W+  CE+  +FPA+SCNRK+IGARA+Y+G+ +  GKPI  
Sbjct  143   GIWPEHPSFSDSGLTPVPANWKGICEISADFPASSCNRKLIGARAFYKGFVSYHGKPIDE  202

Query  647   EPKSA--RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
                SA  RD  GHGTH AS A GS V NA+    ARGEARG+A+ ARIA YK+CW   C 
Sbjct  203   SRDSASPRDTEGHGTHTASTAGGSFVQNASFYQFARGEARGMASKARIAAYKICWSIGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MDQA+ADGVHV+SLS+ +    G+A  YD D IA+GAFGA Q G++VSC+AGN
Sbjct  263   DSDILAAMDQAIADGVHVISLSVGAT---GYAPQYDHDSIAVGAFGATQNGIVVSCSAGN  319

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GPDP+TAVN+APWILTVGASTIDREFPA V LGN  +F G SLYSG      ++P++Y 
Sbjct  320   SGPDPFTAVNIAPWILTVGASTIDREFPADVVLGNGMTFGGVSLYSGEPLVDYKLPLIYA  379

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   + YC  G +  SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N  + G +L
Sbjct  380   GDCGNRYCLIGGISPSKVQGKIVVCDRGVNAR-VEKGAAVKLAGGLGMILANTADSGEEL  438

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P  +V    G  I+QY++   +PTA I F+GTVIGNSP AP+VAAFS RGPN 
Sbjct  439   IADSHLLPATMVGEIAGNQIKQYIKFGQYPTATIVFEGTVIGNSPPAPKVAAFSSRGPNH  498

Query  1541  LTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAMLK  1687
             LTPEILKPDVIAPGVNILA WTG+ +           +FN+ISGTSM+CPHVSG+AA+L+
Sbjct  499   LTPEILKPDVIAPGVNILAGWTGAASPTDLDIDPRRVQFNIISGTSMSCPHVSGIAALLR  558

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K Y  WSPAAIKSAL+TTAY++DNSG   ++DL + + +T   +G+GHVDP  A+DPGLV
Sbjct  559   KAYTDWSPAAIKSALITTAYSLDNSGE-NILDLASGKESTAFVHGAGHVDPNSALDPGLV  617

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD    D++ FLCTIGYDS++I++F+     ++  ++ L +PG+LNYPSFSV+F ++   
Sbjct  618   YDLETRDFILFLCTIGYDSKRISVFIGEPASLNVCDQKLSSPGNLNYPSFSVVFDSSSDV  677

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-----L  2212
             V YKR VKNV    N  Y+  V  P+NV + +S ++L F+    +LSYE+TF S      
Sbjct  678   VTYKRVVKNVGSSVNAVYEAKVNAPANVDIKLSTSKLEFSAENKSLSYEITFSSASLGLS  737

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2317
                + SFGS+ WSDGTH V SPIAV W EG S + +
Sbjct  738   SFGSQSFGSIEWSDGTHRVRSPIAVKWLEGSSKASI  773



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/756 (53%), Positives = 531/756 (70%), Gaps = 32/756 (4%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             +FIV + +S+KP LFS+HH W+SSI+ +L P     R + L+Y+Y    +GFSA L+PSQ
Sbjct  35    TFIVHVSRSQKPSLFSSHHHWHSSILRSLPP---SPRPATLIYSYSRAVNGFSAVLSPSQ  91

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
              + L  +P VISV+PDR+ ++ TT +P+FLG  SG+ +L  +SD G D+I+GVLD+GIWP
Sbjct  92    VAFLRLIPAVISVIPDRIHQIHTTHTPRFLGF-SGNFSLWSNSDDGEDVIVGVLDTGIWP  150

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SFSD GL P+P+SW+  CE+GP+FPA++C+RK+IGARA+Y+GYE+ +   +    E 
Sbjct  151   EHPSFSDSGLGPVPSSWKGACEIGPDFPASACSRKLIGARAFYKGYESHLNGSMDDSKES  210

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD  GHGTH AS AAGS VANA++  +ARGEARG+A+ ARIA YK+CW   C ++DI
Sbjct  211   KSPRDTEGHGTHTASTAAGSVVANASLYQYARGEARGMASKARIAAYKICWSSGCYDSDI  270

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ MDQAV+DGV V+SLS+ +    G A  Y ED IAIGAFGA Q GV+VSC+AGN GP 
Sbjct  271   LAAMDQAVSDGVQVISLSVGAN---GLAPAYHEDSIAIGAFGAAQHGVVVSCSAGNSGPG  327

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQP-SRIQVPVVYGGSA  1189
             PYTAVN+APWILTVGASTIDREFPA   +G+ R F GTSLY+G    S  Q+P+VY G  
Sbjct  328   PYTAVNIAPWILTVGASTIDREFPADAVIGDGRVFYGTSLYAGEDSLSDSQIPLVYSGDC  387

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S  C+PG+L++S V+G+IV C++G +   V+KG AV QAGG+GMI+ N    G +L  +
Sbjct  388   GSRLCYPGKLNSSLVKGKIVLCDRGGNAR-VEKGSAVKQAGGLGMILANTDESGEELTAD  446

Query  1370  ADRIPTAVVTVADGEIIRQYVRTAS-FPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             +  IP  +V  A G  IR Y++ +S  PTA I F+GTVIG SPSAPRVAAFS RGPN LT
Sbjct  447   SHLIPATMVGSAAGNQIRDYIKISSESPTATIRFEGTVIGPSPSAPRVAAFSSRGPNHLT  506

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
             P+ILKPDVIAPGVNILA WTGS+             FN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  507   PQILKPDVIAPGVNILAGWTGSVGPTDLDIDPRRVTFNIISGTSMSCPHVSGLAALLRKA  566

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             +P+WSPA IKSAL+TTAY VDNSG  ++ DL T + + P  +G+GHVDP  A+DPGLVYD
Sbjct  567   HPNWSPAMIKSALVTTAYNVDNSGE-SIKDLATGKSSNPFIHGAGHVDPNKALDPGLVYD  625

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
               + +YV FLC +GYD   I++F+ +  L + C    L  PG LNYPS   +  ++ + V
Sbjct  626   IDMKEYVAFLCAVGYDWPAISVFIHDPKLFNACETSKLRTPGDLNYPSLVAVLGSSGEVV  685

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL------  2212
              Y+R VKNV    +  Y V + +P+NV + VSP+RL F+     L YEVTF+S+      
Sbjct  686   KYRRVVKNVGSKADAVYNVGINSPTNVEIEVSPSRLEFSKEKRELEYEVTFRSVVLGGRV  745

Query  2213  -RQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
               +  + FGS+ W+DG H+V SP+A+ W   SV  +
Sbjct  746   GAEPREEFGSIEWTDGDHVVRSPVAIRWSQGSVQPI  781



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/754 (54%), Positives = 530/754 (70%), Gaps = 29/754 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E  +++IV + KSEKP LFS+HH W+SSI+ +LSP S H   ++LLY YE  A+GFSAR+
Sbjct  29    ETQETYIVHVSKSEKPSLFSSHHHWHSSILESLSP-SPHP--TKLLYNYERAANGFSARI  85

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSD--YGADIIIGVL  460
             T +QA EL  VPG+ISV+PDR+ +L TTR+P FLGL   + NLG  +D  Y  D+IIGVL
Sbjct  86    TTAQAEELRRVPGIISVIPDRIRQLHTTRTPHFLGL---ADNLGLWADTNYADDVIIGVL  142

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+GIWPER SFSD GL P+P  W+  C+ G    A +CNRKIIGARA++ GYE+ +   +
Sbjct  143   DTGIWPERPSFSDEGLAPVPARWKGTCDTGEGSSALACNRKIIGARAFFXGYESNLRGSL  202

Query  641   VGEP--KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
              G    KSARD +GHGTH AS AAGS V NA+   +ARGEARG+A+ ARIA YK+CW   
Sbjct  203   KGSSDFKSARDTDGHGTHTASTAAGSFVKNASFFQYARGEARGMASRARIAAYKICWEFG  262

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DIL+ MDQA++DGV V+SLS+ S    G A  Y  D IAIGAFGA+Q G++VSC+A
Sbjct  263   CYDSDILAAMDQAISDGVDVISLSVGSS---GRAPAYYRDSIAIGAFGAMQHGIVVSCSA  319

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVV  1174
             GN GP PYTAVN+APWI+TVGASTIDREF A V LG++R F+G SLYSG      ++P+V
Sbjct  320   GNSGPGPYTAVNIAPWIVTVGASTIDREFLADVILGDNRVFSGVSLYSGDPLGDSKLPLV  379

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             YGG   S YC+ G LD+SKV GRIV C++G +  +  KG AV  AGG+GM++ N    G 
Sbjct  380   YGGDCGSRYCYSGSLDSSKVAGRIVVCDRGGNARVA-KGGAVKSAGGLGMVLANTEENGE  438

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  ++  IP  +V    G  +R Y+ T   PTA I F+GTVIG+SP AP+VA+FS RGP
Sbjct  439   ELLADSHLIPGTMVGEIAGNKLRDYIHTDPNPTATIVFRGTVIGDSPPAPKVASFSSRGP  498

Query  1535  NFLTPEILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLAAM  1681
             N+ T EILKPDVIAPGVNILA W+G              EFN+ISGTSM+CPHVSG+AA+
Sbjct  499   NYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVEFNIISGTSMSCPHVSGVAAL  558

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             L+K +P+WSPAAIKSAL+TT+Y++D+SG   + DL T + + P  +G+GH+DP  A++PG
Sbjct  559   LRKAFPTWSPAAIKSALITTSYSLDSSGS-PIKDLATSEESNPFVHGAGHIDPNQALNPG  617

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             L+YD    DYV FLC+IGYDS++IA+F++ S         L NPG+LNYPSFSV+F +  
Sbjct  618   LIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYSQLCEHKLSNPGNLNYPSFSVVFDDG-  676

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR--  2215
             + V Y RTV NV     V Y V V+ P  V ++V PN+L F     TLSYE+TF  +   
Sbjct  677   EVVKYTRTVTNVGDETEVVYGVKVEAPQGVEISVVPNKLEFNKEKTTLSYEITFTKINGF  736

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             + + SFGS++WSDG H V SPIAVS++  S++ +
Sbjct  737   KESASFGSIQWSDGIHNVRSPIAVSFKTGSIASM  770



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/756 (52%), Positives = 516/756 (68%), Gaps = 31/756 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV + +S KP LFS+H++W+ S++ +L    +  + + LLY+Y    HGFSARL+P 
Sbjct  31    ESYIVHVQRSHKPSLFSSHNNWHVSLLRSLP---SSPQPATLLYSYSRAVHGFSARLSPI  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q + L   P VISV+PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  88    QTAALRRHPSVISVIPDQAREIHTTHTPAFLGF-SQNSGLWSNSNYGEDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE---IGKPIVG  646
             PE  SFSD GL PIP++W+ +CE+GP+FPA+SCNRK+IGARA+YRGY  +     K    
Sbjct  147   PEHPSFSDSGLGPIPSTWKGECEIGPDFPASSCNRKLIGARAFYRGYLTQRNGTKKHAAK  206

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E +S RD  GHGTH AS AAGS VANA++  +ARG A G+A+ ARIA YK+CW G C ++
Sbjct  207   ESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGTATGMASKARIAAYKICWTGGCYDS  266

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MDQAVADGVHV+SLS+ +    G A  Y  D IAIGAFGA + G++VSC+AGN G
Sbjct  267   DILAAMDQAVADGVHVISLSVGAS---GSAPEYHTDSIAIGAFGATRHGIVVSCSAGNSG  323

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P+P TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+ +VY G 
Sbjct  324   PNPETATNIAPWILTVGASTVDREFAANAITGDGKVFTGTSLYAGESLPDSQLSLVYSGD  383

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
               S  C+PG+L++S V G+IV C++G +   V+KG AV  AGG GMI+ N    G +L  
Sbjct  384   CGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKLAGGAGMILANTAESGEELTA  442

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             ++  +P  +V    G+ IR Y++T+  PTA+I F GT+IG SP +PRVAAFS RGPN LT
Sbjct  443   DSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTLIGPSPPSPRVAAFSSRGPNHLT  502

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
             P ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  503   PVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLRKA  562

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             +P WSPAAIKSAL+TTAY V+NSG   + DL T + +    +G+GHVDP  A++PGLVYD
Sbjct  563   HPDWSPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYD  621

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
               V +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFSV+F +  + V
Sbjct  622   IEVKEYVAFLCAVGYEFPGILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVV  681

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS---  2221
              YKR VKNV    +  Y+V V++P+NV + VSP++L F+     L YEVTF+S+      
Sbjct  682   KYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGV  741

Query  2222  ----ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                    FGS+ W+DG H+V SP+AV W   SV   
Sbjct  742   GSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  777



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/756 (52%), Positives = 516/756 (68%), Gaps = 31/756 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV + +S KP LFS+H++W+ S++ +L    +  + + LLY+Y    HGFSARL+P 
Sbjct  31    ESYIVHVQRSHKPSLFSSHNNWHVSLLRSLP---SSPQPATLLYSYSRAVHGFSARLSPI  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q + L   P VISV+PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  88    QTAALRRHPSVISVIPDQAREIHTTHTPAFLGF-SQNSGLWSNSNYGEDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE---IGKPIVG  646
             PE  SFSD GL PIP++W+ +CE+GP+FPA+SCNRK+IGARA+YRGY  +     K    
Sbjct  147   PEHPSFSDSGLGPIPSTWKGECEIGPDFPASSCNRKLIGARAFYRGYLTQRNGTKKHAAM  206

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E +S RD  GHGTH AS AAGS VANA++  +ARG A G+A+ ARIA YK+CW G C ++
Sbjct  207   ESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGTATGMASKARIAAYKICWTGGCYDS  266

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MDQAVADGVHV+SLS+ +    G A  Y  D IAIGAFGA + G++VSC+AGN G
Sbjct  267   DILAAMDQAVADGVHVISLSVGAS---GSAPEYHTDSIAIGAFGATRHGIVVSCSAGNSG  323

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P+P TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+ +VY G 
Sbjct  324   PNPETATNIAPWILTVGASTVDREFAANAITGDGKVFTGTSLYAGESLPDSQLSLVYSGD  383

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
               S  C+PG+L++S V G+IV C++G +   V+KG AV  AGG GMI+ N    G +L  
Sbjct  384   CGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKLAGGAGMILANTAESGEELTA  442

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             ++  +P  +V    G+ IR Y++T+  PTA+I F GT+IG SP +PRVAAFS RGPN LT
Sbjct  443   DSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTLIGPSPPSPRVAAFSSRGPNHLT  502

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
             P ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  503   PVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLRKA  562

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             +P WSPAAIKSAL+TTAY V+NSG   + DL T + +    +G+GHVDP  A++PGLVYD
Sbjct  563   HPDWSPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYD  621

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
               V +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFSV+F +  + V
Sbjct  622   IEVKEYVAFLCAVGYEFPGILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVV  681

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS---  2221
              YKR VKNV    +  Y+V V++P+NV + VSP++L F+     L YEVTF+S+      
Sbjct  682   KYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGV  741

Query  2222  ----ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                    FGS+ W+DG H+V SP+AV W   SV   
Sbjct  742   GSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  777



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/754 (52%), Positives = 511/754 (68%), Gaps = 29/754 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV +  S KP LFS+H  W++S++ +L    +  + + LLY+Y    HGFSARL+PS
Sbjct  31    ESYIVHVQGSHKPSLFSSHSHWHNSLLRSLP---SSPQPATLLYSYSRAVHGFSARLSPS  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q S L   P VISV+PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  88    QTSALRRHPSVISVIPDQAREIHTTHTPAFLGF-SDNSGLWSNSNYGEDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI-GKPIVGEP  652
             PE  SFSD GL+P+P++W+  CE+GP+FPA+SCNRK+IGARA+Y+GY     G     E 
Sbjct  147   PEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGARAFYKGYLTHRNGSKHAEES  206

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD  GHGTH AS AAGS V NA++  +A+G ARG+A+ ARIA YK+CW G C ++DI
Sbjct  207   KSPRDTAGHGTHTASTAAGSVVVNASLYQYAQGVARGMASKARIAAYKICWTGGCYDSDI  266

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ MDQAVADGVHV+SLS+ +    GFA  Y +D IAIGAFGA++ G++VSC+AGN GP 
Sbjct  267   LAAMDQAVADGVHVISLSVGAN---GFAPEYHKDSIAIGAFGAMRHGIVVSCSAGNSGPG  323

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
             P TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+ +VY G   
Sbjct  324   PQTATNIAPWILTVGASTVDREFTANAITGDGKVFTGTSLYAGEPLPDSQISLVYSGDCG  383

Query  1193  SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNA  1372
             S  C+PG+L++S V G+IV C++G +   V+KG AV  AGG GMI+ N    G +L  ++
Sbjct  384   SRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIAGGAGMILANTAESGEELTADS  442

Query  1373  DRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPE  1552
               +P  +V    G+ IR Y++ +  PTA I F GT+IG SP +PRVAAFS RGPN +TP 
Sbjct  443   HLVPATMVGAKAGDQIRDYIKNSDSPTATISFLGTLIGPSPPSPRVAAFSSRGPNHITPV  502

Query  1553  ILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYP  1699
             ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K +P
Sbjct  503   ILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFNIISGTSMSCPHVSGLAALLRKAHP  562

Query  1700  SWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAG  1879
              WSPAAIKSAL+TTAY  +NSG   + DL T + +    +G+GHVDP  A++PGLVYD  
Sbjct  563   DWSPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIHGAGHVDPNKALNPGLVYDVD  621

Query  1880  VNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTVIY  2056
               DYV FLC +GY+   I +FL++  L D C    L   G LNYPSFSV+F +N   V Y
Sbjct  622   AKDYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSNDGVVKY  681

Query  2057  KRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS-----  2221
             +R VKNV    +  Y+V V+ P+NV + VSP++L F+     + YEVTF+S+        
Sbjct  682   RRVVKNVGSNVDAVYEVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGS  741

Query  2222  --ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                  FGS+ W+DG H+V SP+AV W   SV   
Sbjct  742   VPGHEFGSIEWTDGEHVVKSPVAVQWSQGSVQSF  775



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/754 (51%), Positives = 513/754 (68%), Gaps = 29/754 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV +  S KP LFS+H  W++S++ +L    +  + + LLY+Y    +GFSARL+PS
Sbjct  31    ESYIVHVQGSHKPSLFSSHSHWHNSLLRSLP---SSPQPATLLYSYSRAVNGFSARLSPS  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q S L   P VIS++PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  88    QTSALRRHPSVISLIPDQAREIHTTHTPAFLGF-SDNSGLWSNSNYGEDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI-GKPIVGEP  652
             PE  SFSD GL+P+P++W+  CE+GP+FPA+SCNRK+IGARA+Y+GY     G     E 
Sbjct  147   PEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGARAFYKGYLTHRNGSKHAEES  206

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD  GHGTH AS AAGS V NA++  +ARG ARG+A+ ARIA YK+CW G C ++DI
Sbjct  207   KSPRDTAGHGTHTASTAAGSVVVNASLYQYARGVARGVASKARIAAYKICWTGGCYDSDI  266

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ MDQAVADGVHV+SLS+ +    GFA  Y +D IAIGAFGA++ G++VSC+AGN GP 
Sbjct  267   LAAMDQAVADGVHVISLSVGAN---GFAPEYHKDSIAIGAFGAMRHGIVVSCSAGNSGPG  323

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
             P TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+P+VY G   
Sbjct  324   PQTATNIAPWILTVGASTVDREFTANAITGDGKVFTGTSLYAGEPLPDSQIPLVYSGDCG  383

Query  1193  SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNA  1372
             S  C+PG+L++S V G+IV C++G +   V+KG AV   GG GMI+ N    G +L  ++
Sbjct  384   SRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIGGGAGMILANTAESGEELTADS  442

Query  1373  DRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPE  1552
               +P  +V    G+ IR Y++ ++ PTA I F GT+IG SP +PRVAAFS RGPN +TP 
Sbjct  443   HLVPATMVGAKAGDQIRDYIKNSNSPTATISFLGTLIGPSPPSPRVAAFSSRGPNHITPV  502

Query  1553  ILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYP  1699
             ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K +P
Sbjct  503   ILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFNIISGTSMSCPHVSGLAALLRKAHP  562

Query  1700  SWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAG  1879
              WSPAAIKSAL+TTAY  +NSG   + DL T + +    +G+GHVDP  A++PGLVYD  
Sbjct  563   DWSPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIHGAGHVDPNKALNPGLVYDLD  621

Query  1880  VNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTVIY  2056
               +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFSV+F +++  V Y
Sbjct  622   AKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSSVDVVKY  681

Query  2057  KRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS-----  2221
             +R VKNV    +  YQV V+ P+NV + VSP++L F+     + YEVTF+S+        
Sbjct  682   RRVVKNVGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGS  741

Query  2222  --ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                  FGS+ W+DG H+V SP+AV W   SV   
Sbjct  742   VPGHEFGSIEWTDGEHVVKSPVAVQWSQGSVQSF  775



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/756 (52%), Positives = 513/756 (68%), Gaps = 31/756 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV +  S KP LFS+H+ W+ S++ +L    +  + + LLY+Y    HGFSARL+P 
Sbjct  31    ESYIVHVQSSHKPSLFSSHNHWHVSLLRSLP---SSPQPATLLYSYSRAVHGFSARLSPI  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q + L   P VISV+PD+  E+ TT +P FLG  S +S L  +SDYG D+I+GVLD+GIW
Sbjct  88    QTAALRRHPSVISVIPDQAREIHTTHTPDFLGF-SQNSGLWGNSDYGEDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE---IGKPIVG  646
             PE  SFSD GL P+P++W+ +CE+GP+FPA+SCNRK+IGARAYY+GY  +     K    
Sbjct  147   PEHPSFSDSGLGPVPSTWKGECEIGPDFPASSCNRKLIGARAYYKGYLTQRNGTKKHAAK  206

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E +S RD  GHGTH AS AAGS VANA++  +A G ARG+A+ ARIA YK+CW   C ++
Sbjct  207   ESRSPRDTEGHGTHTASTAAGSVVANASLFQYAPGTARGMASKARIAAYKICWSSGCYDS  266

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MDQAVADGVHV+SLS+ +    G+A  Y  D IAIGAFGA + G++VSC+AGN G
Sbjct  267   DILAAMDQAVADGVHVISLSVGAS---GYAPEYHTDSIAIGAFGATRHGIVVSCSAGNSG  323

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P P TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+ +VY G 
Sbjct  324   PGPETATNIAPWILTVGASTVDREFSANAITGDGKVFTGTSLYAGESLPDSQLSLVYSGD  383

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
               S  C+PG+L++S V G+IV C++G +   V+KG AV  AGG GMI+ N    G +L  
Sbjct  384   CGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIAGGAGMILANTAESGEELTA  442

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             ++  +P  +V    G+ IR Y++T+  PTA+I F GT+IG SP +PRVAAFS RGPN LT
Sbjct  443   DSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTLIGPSPPSPRVAAFSSRGPNHLT  502

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
             P ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K 
Sbjct  503   PVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLRKA  562

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             +P WSPAAIKSAL+TTAY V+NSG   + DL T + +    +G+GHVDP  A++PGLVYD
Sbjct  563   HPDWSPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYD  621

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
               V +YV FLC +GY+   I +FL++  L + C    L   G LNYPSFSV+F +  + V
Sbjct  622   IEVKEYVAFLCAVGYEFPGILVFLQDPTLFNACETSKLRTAGDLNYPSFSVVFGSTGEVV  681

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS---  2221
              YKR VKNV    +  Y+V V++P+NV + VSP++L F+     L YEVTF+S+      
Sbjct  682   KYKRAVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSELEYEVTFKSVVLGGGV  741

Query  2222  ----ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                    FGS+ W+DG H+V SP+AV W   SV   
Sbjct  742   GSVPGHEFGSIEWADGEHVVKSPVAVQWGQGSVQSF  777



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/754 (51%), Positives = 513/754 (68%), Gaps = 29/754 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV +  S KP LFS+H  W++S++ +L    +  + + LLY+Y    +GFSARL+PS
Sbjct  31    ESYIVHVQGSHKPSLFSSHSHWHNSLLRSLP---SSPQPATLLYSYSRAVNGFSARLSPS  87

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q S L   P VIS++PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  88    QTSALRRHPSVISLIPDQAREIHTTHTPAFLGF-SDNSGLWSNSNYGEDVIVGVLDTGIW  146

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI-GKPIVGEP  652
             PE  SFSD GL+P+P++W+  CE+GP+FPA+SCNRK+IGARA+Y+GY     G     E 
Sbjct  147   PEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGARAFYKGYLTHRNGSKHAEES  206

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD  GHGTH AS AAGS V NA++  +ARG ARG+A+ ARIA YK+CW G C ++DI
Sbjct  207   KSPRDTAGHGTHTASTAAGSVVVNASLYQYARGVARGMASKARIAAYKICWTGGCYDSDI  266

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ MDQAVADGVHV+SLS+ +    GFA  Y +D IAIGAFGA++ G++VSC+AGN GP 
Sbjct  267   LAAMDQAVADGVHVISLSVGAN---GFAPEYHKDSIAIGAFGAMRHGIVVSCSAGNSGPG  323

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
             P TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+P+VY G   
Sbjct  324   PQTATNIAPWILTVGASTVDREFTANAITGDGKVFTGTSLYAGEPLPDSQIPLVYSGDCG  383

Query  1193  SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNA  1372
             S  C+PG+L++S V G+IV C++G +   V+KG AV   GG GMI+ N    G +L  ++
Sbjct  384   SRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIGGGAGMILANTAESGEELTADS  442

Query  1373  DRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPE  1552
               +P  +V    G+ IR Y++ ++ PTA I F GT+IG SP +PRVAAFS RGPN +TP 
Sbjct  443   HLVPATMVGAKAGDQIRDYIKNSNSPTATISFLGTLIGPSPPSPRVAAFSSRGPNHITPV  502

Query  1553  ILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYP  1699
             ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K +P
Sbjct  503   ILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFNIISGTSMSCPHVSGLAALLRKAHP  562

Query  1700  SWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAG  1879
              WSPAAIKSAL+TTAY  +NSG   + DL T + +    +G+GHVDP  A++PGL+YD  
Sbjct  563   DWSPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIHGAGHVDPNKALNPGLIYDLD  621

Query  1880  VNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTVIY  2056
               +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFSV+F +++  V Y
Sbjct  622   AKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSSVDVVKY  681

Query  2057  KRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS-----  2221
             +R VKNV    +  YQV V+ P+NV + VSP++L F+     + YEVTF+S+        
Sbjct  682   RRVVKNVGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGS  741

Query  2222  --ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                  FGS+ W+DG H+V SP+AV W   SV   
Sbjct  742   VPGHEFGSIEWTDGEHVVKSPVAVQWSQGSVQSF  775



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/739 (54%), Positives = 519/739 (70%), Gaps = 27/739 (4%)
 Frame = +2

Query  131   FMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQASEL  310
             F++   KP L++T+H+ Y+SI++TL P S H+ S  +LYTY    HGFSA LTPSQA+ L
Sbjct  31    FIIHVSKPSLYTTNHNHYTSILNTLPP-SQHTPS--ILYTYTSAIHGFSAHLTPSQAAHL  87

Query  311   ANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPE--R  484
                P V+S+ PD++  L TT +P FLGL   +S L P+S + +D+IIGVLD+GIWPE   
Sbjct  88    TTHPDVLSIQPDQIRHLHTTHTPDFLGLAE-TSGLWPNSHFASDVIIGVLDTGIWPELKS  146

Query  485   SSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEPKS  658
              S      +P+P+SW+  CEV  +FP++SCN KIIGA+A+Y+GYE+ + +PI    E KS
Sbjct  147   FSDPSLSSSPLPSSWKGTCEVSHDFPSSSCNGKIIGAKAFYKGYESYLQRPIDETVESKS  206

Query  659   ARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILS  838
              RD  GHG+H AS AAGS V+NA++   A+GEA+G+AT ARIA YK+CW   C ++DIL+
Sbjct  207   PRDTEGHGSHTASTAAGSIVSNASLFSFAQGEAKGMATKARIAAYKICWSLGCFDSDILA  266

Query  839   GMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPY  1018
              MD+AV+DGVHV+SLS+ +    G+A  Y  D IAIGAFGA Q GV+VSC+AGN GP  Y
Sbjct  267   AMDEAVSDGVHVISLSVGAS---GYAPQYYHDSIAIGAFGASQHGVVVSCSAGNSGPGSY  323

Query  1019  TAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANSF  1198
             T+ N+APWILTVGASTIDREFPA V LG+ R F G SLY G      ++P+VYG    S 
Sbjct  324   TSTNIAPWILTVGASTIDREFPADVILGDGRVFGGVSLYDGDDLPDYKLPLVYGADCGSR  383

Query  1199  YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADR  1378
             YCF G LD+SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N    G +L  +A  
Sbjct  384   YCFIGSLDSSKVQGKIVVCDRGVNAR-VEKGSAVKLAGGLGMIMANTEGSGEELLADAHL  442

Query  1379  IPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEIL  1558
             +   +V     + IR+Y+R++ +PTA IEFKGTVIG SP+AP+VA+FS RGPN++T EIL
Sbjct  443   VAATMVGQIAADKIREYIRSSQYPTATIEFKGTVIGGSPAAPQVASFSSRGPNYVTSEIL  502

Query  1559  KPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYPSW  1705
             KPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG+AA+L+K YP+W
Sbjct  503   KPDVIAPGVNILAGWTGKVGPTDLDFDTRRVEFNIISGTSMSCPHVSGIAALLRKAYPNW  562

Query  1706  SPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVN  1885
             SPAAIKSALMTTAY VDNSG   + DL T + + P  +G+GHVDP  A++PGLVYD   N
Sbjct  563   SPAAIKSALMTTAYDVDNSGE-KIKDLGTGKESNPFVHGAGHVDPNRALNPGLVYDLNSN  621

Query  1886  DYVDFLCTIGYDSRKIALFLRNSPLVD-CRNR-NLGNPGSLNYPSFSVLFKNNLQTVIYK  2059
             DY+ FLC+IGYD++KI +F R     D C  R  L +PG+LNYPSFSV+F  N   V YK
Sbjct  622   DYLSFLCSIGYDAKKIQIFTREPTSFDVCEKREKLVSPGNLNYPSFSVVFGVNNGLVKYK  681

Query  2060  RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL-RQSADSFG  2236
             R V NV    +  Y V V +P  V V+VSP++LVF+    T ++E+TF  +    + SFG
Sbjct  682   RVVTNVGGYVDAVYTVKVNSPFGVDVSVSPSKLVFSGENKTQAFEITFARVGYGGSQSFG  741

Query  2237  SLRWSDGTHLVTSPIAVSW  2293
             S+ WSDG+H+V SPIAV W
Sbjct  742   SIEWSDGSHIVRSPIAVRW  760



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/749 (52%), Positives = 519/749 (69%), Gaps = 31/749 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P+++I+ + +S+KP LF++H  WYSSI+ +L P S H   + LLYTY   A GFS RL
Sbjct  26    DAPQTYIIHVAQSQKPSLFTSHTTWYSSILRSLPP-SPHP--ATLLYTYSSAASGFSVRL  82

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TPSQAS L   P V+++  D++    TT +P+FLGL + S  L P+SDY  D+I+GVLD+
Sbjct  83    TPSQASHLRRHPSVLALHSDQIRHPHTTHTPRFLGL-ADSFGLWPNSDYADDVIVGVLDT  141

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPE  SFSD  L+PIP+SW+  C+  P+FP++ CN KIIGA+A+Y+GYE+ + +PI  
Sbjct  142   GIWPELKSFSDHNLSPIPSSWKGSCQPSPDFPSSLCNNKIIGAKAFYKGYESYLERPIDE  201

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAG+ V+NA++  +ARGEARG+AT ARIA YK+CW   C 
Sbjct  202   SQESKSPRDTEGHGTHTASTAAGAVVSNASLFHYARGEARGMATKARIAAYKICWKLGCF  261

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+AV+DGVHV+SLS+ S    G+A  Y  D IA+GAFGA +  V+VSC+AGN
Sbjct  262   DSDILAAMDEAVSDGVHVISLSVGSS---GYAPQYYRDSIAVGAFGAAKHNVLVSCSAGN  318

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P TAVN+APWILTVGAST+DREFPA V LG+ R F G SLY G      ++P+VY 
Sbjct  319   SGPGPSTAVNIAPWILTVGASTVDREFPADVILGDGRVFGGVSLYYGESLPDFKLPLVYA  378

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                 S YC+ G L++SKV+G+IV C++G +   V+KG AV   GG+GMI+ N    G +L
Sbjct  379   KDCGSRYCYIGSLESSKVQGKIVVCDRGGNAR-VEKGSAVKLTGGLGMIMANTEANGEEL  437

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +   +V    G+ I++Y++ + +PTA IEF+GTVIG SPSAP+VA+FS RGPN 
Sbjct  438   LADAHLLAATMVGQTAGDKIKEYIKLSQYPTATIEFRGTVIGGSPSAPQVASFSSRGPNH  497

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LT +ILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPH SG+AA+L+
Sbjct  498   LTSQILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNIISGTSMSCPHASGIAALLR  557

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K YP WSPAAIKSALMTTAY VDNSG G + DL + + + P  +G+GHVDP  A++PGLV
Sbjct  558   KAYPEWSPAAIKSALMTTAYNVDNSG-GNIKDLGSGKESNPFIHGAGHVDPNRALNPGLV  616

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDC-------RNRNLGNPGSLNYPSFSVL  2026
             YD   NDY+ FLC++GYD+ +IA+F R  P V+        R   L +PG LNYPSF+V 
Sbjct  617   YDLDSNDYLAFLCSVGYDANQIAVFTRE-PAVESVCEGKVGRTGKLASPGDLNYPSFAVK  675

Query  2027  FKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
                    V Y+R V NV    +V Y V V  P  V V VSP+ LVF+    T ++EVTF 
Sbjct  676   LGGEGDLVKYRRVVTNVGSEVDVVYTVKVNAPPGVGVGVSPSTLVFSGENKTQAFEVTFS  735

Query  2207  SLR-QSADSFGSLRWSDGTHLVTSPIAVS  2290
               +   ++SFGS+ W+DG+H+V SPIAV+
Sbjct  736   RAKLDGSESFGSIEWTDGSHVVRSPIAVT  764



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/756 (51%), Positives = 512/756 (68%), Gaps = 31/756 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV +  S KP LFS+H  W++S++ +L    +  + + LLY+Y     GFSARL+P+
Sbjct  30    ESYIVHVQSSHKPSLFSSHDHWHNSLLRSLP---SSPQPATLLYSYSRAVQGFSARLSPT  86

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q + L     VISV+PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  87    QTAALRRHTSVISVIPDQAREIHTTHTPSFLGF-SDNSGLWSNSNYGEDVIVGVLDTGIW  145

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PE  SFSD GL+P+P++W+  CE+GP+FPA+SCNRK+IGARA+Y+GY       +    E
Sbjct  146   PEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGARAFYKGYLTHRNGTVKAAKE  205

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              +S RD  GHGTH AS AAGS VANA++  +ARG ARG+A+ ARIA YK+CW G C ++D
Sbjct  206   SRSPRDTEGHGTHTASTAAGSVVANASLYQYARGVARGMASKARIAAYKICWTGGCYDSD  265

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ MDQAVADGVHV+SLS+ +    G+A  Y  D IAIGAFGA + G++VSC+AGN GP
Sbjct  266   ILAAMDQAVADGVHVISLSVGAN---GYAPEYHMDSIAIGAFGATRHGIVVSCSAGNSGP  322

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
              P TA N+APWILTVGASTIDREF A    GN + FTGTSLY+G      Q+ +VY G  
Sbjct  323   GPQTATNIAPWILTVGASTIDREFSANAITGNGKVFTGTSLYAGEPLPDSQLSLVYSGDC  382

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
              S  C+PG+L+AS V G+IV C++G +   V+KG AV  AGG GMI+ N    G +L  +
Sbjct  383   GSRLCYPGKLNASLVEGKIVLCDRGGNAR-VEKGSAVKIAGGAGMILANTAESGEELTAD  441

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             +  +P  +V    G+ IR+Y++ +  PTA I F GT+IG SP +PRVAAFS RGPN +TP
Sbjct  442   SHLVPATMVGAKAGDQIREYIQKSDSPTATISFLGTLIGPSPPSPRVAAFSSRGPNHITP  501

Query  1550  EILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIY  1696
              ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K +
Sbjct  502   VILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLRKAH  561

Query  1697  PSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDA  1876
             P WSPAAIKSAL+TTAY  +NSG   + DL T + +    +G+GHVDP  A++PGLVYD 
Sbjct  562   PDWSPAAIKSALVTTAYDTENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDI  620

Query  1877  GVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTVI  2053
              V DYV FLC +GY+   I +FL++  L + C    L   G LNYPSFSV+F +++  V 
Sbjct  621   DVKDYVAFLCAVGYEFPGILVFLQDPTLYNACETSKLRTAGDLNYPSFSVVFGSSVDVVK  680

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS----  2221
             Y+R VKNV       Y+V V++P+NV + VSP RL F+     L YEVTF+S+       
Sbjct  681   YRRVVKNVGTNVEAVYEVGVKSPANVEIDVSPRRLAFSKGESELEYEVTFRSVVLGGGVG  740

Query  2222  ---ADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2317
                   FGS+ W+DG H+V SP+AV W +G SV   
Sbjct  741   SVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSSVQSF  776



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/759 (51%), Positives = 510/759 (67%), Gaps = 36/759 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTL--SPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +S+IV + +S KP LFS+H  W++S++ +L  SP     + + LLY+Y    HGFSA+L+
Sbjct  28    ESYIVHVQRSHKPSLFSSHKHWHNSLLRSLPSSP-----KPATLLYSYSRAVHGFSAQLS  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P Q + L   P VISV+PD+  E+ TT +P FLG  S +S L  +SDYG D+I+GVLD+G
Sbjct  83    PIQTAVLLRNPAVISVIPDQAREIHTTHTPAFLGF-SDNSGLWSNSDYGEDVIVGVLDTG  141

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGY----EAEIGKP  637
             IWPE  SFSD GL PIP++W+ +CE+GP+FPA SCNRK+IGARA+YRGY    +      
Sbjct  142   IWPEHPSFSDSGLGPIPSTWKGECEIGPDFPAESCNRKLIGARAFYRGYLTSKKNASSTH  201

Query  638   IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E +S RD  GHGTH AS AAGS VANA++  +A+G ARG+A+ ARIA YK+CW G C
Sbjct  202   TAKESRSPRDTEGHGTHTASTAAGSVVANASLFHYAQGIARGMASKARIAAYKICWTGGC  261

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DI++ MDQA+ADGVHV+SLS+ S    GFA  Y  D IAIGAFGA + G++VSC+AG
Sbjct  262   YDSDIMAAMDQAIADGVHVISLSVGSS---GFASEYHMDSIAIGAFGATRHGIVVSCSAG  318

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP   TA N+APWILTVGAST+DREF A    G+ + FTGTSLY+G      Q+ +VY
Sbjct  319   NSGPGSETATNIAPWILTVGASTVDREFSANAITGDGKVFTGTSLYAGEPLPNSQISLVY  378

Query  1178  GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
              G   S  C+ G+L++S V G+IV C++G +   V+KG AV  AGG GMI+ N    G +
Sbjct  379   SGDCGSRLCYSGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKLAGGAGMILANTAESGEE  437

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  ++  +P  +V    G+ IR Y++++  PTA I F GT+IG SP +PRVAAFS RGPN
Sbjct  438   LTADSHLVPATMVGAKAGDQIRDYIKSSESPTATISFLGTLIGPSPPSPRVAAFSSRGPN  497

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TP ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L
Sbjct  498   HVTPIILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALL  557

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +K +  WSPAAIKSAL+TTAY ++NSG   + DL T + +    +G+GHVDP  A++PGL
Sbjct  558   RKAHLDWSPAAIKSALVTTAYDIENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGL  616

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNL  2041
             VYD  V +YV FLC +GY    I +FL++  L D C    L   G LNYPSFSV+F + +
Sbjct  617   VYDIDVKEYVAFLCAVGYSFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVIFGSTV  676

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS  2221
               V YKR VKNV    +  YQV V++P NV + VSP++L F+     L YEVTF+S+   
Sbjct  677   DVVKYKRVVKNVGSNVDAVYQVGVKSPVNVEIDVSPSKLEFSKEKSELEYEVTFKSVVLG  736

Query  2222  -------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                       FGS++W+DG H+V SP+AV W   SV   
Sbjct  737   GGVGSVPGQEFGSIQWTDGEHVVKSPVAVQWRQSSVQSF  775



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/755 (53%), Positives = 519/755 (69%), Gaps = 30/755 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E  +++IV + KSEKP LFS+HH         L  LS+    ++LLY YE  A+GFSAR+
Sbjct  29    ENQETYIVHVSKSEKPSLFSSHH---HWHSSILESLSSSPHPTKLLYNYERAANGFSARI  85

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSD--YGADIIIGVL  460
             T  QA EL  VPG+ISV+PD++ +L TTR+P FLGL   + NLG  +D  Y  D+IIGVL
Sbjct  86    TTVQAEELRRVPGIISVIPDQIRQLHTTRTPHFLGL---ADNLGLWADTNYADDVIIGVL  142

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI--GK  634
             D+GIWPER SFSD GL+P+P  W+  C+ G    A +CNRKIIGARAY+ GYE+ +    
Sbjct  143   DTGIWPERPSFSDEGLSPVPARWKGTCDTGEGVSAFACNRKIIGARAYFYGYESNLRGSL  202

Query  635   PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
              +  + KSARD  GHGTH AS AAGS V NA+   +ARGEARG+A+ ARIA YK+CW   
Sbjct  203   KVSSDFKSARDTEGHGTHTASTAAGSFVNNASFFQYARGEARGMASRARIAAYKICWEFG  262

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DIL+ MDQA++DGV V+SLS+ S    G A  Y  D IAIGAFGA+Q GV+VSC+A
Sbjct  263   CYDSDILAAMDQAISDGVDVISLSVGSS---GRAPAYYRDSIAIGAFGAMQHGVVVSCSA  319

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVV  1174
             GN GP PYTAVN+APWILTVGASTIDREF A V LG+ R F+G SLYSG      ++ +V
Sbjct  320   GNSGPGPYTAVNIAPWILTVGASTIDREFLADVILGDGRVFSGVSLYSGDPLGDSKLQLV  379

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             YGG   S YC+ G LD+SKV G+IV C++G +  +  KG AV  AGG+GM++ N    G 
Sbjct  380   YGGDCGSRYCYSGSLDSSKVAGKIVVCDRGGNARVA-KGGAVKSAGGLGMVLANTEENGE  438

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  ++  IP  +V    G  +R Y+ T   PTA I F+GTVIG+SP APRVAAFS RGP
Sbjct  439   ELLADSHLIPGTMVGAIAGNKLRDYIHTDPNPTATIVFRGTVIGDSPPAPRVAAFSSRGP  498

Query  1535  NFLTPEILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLAAM  1681
             N+ T EILKPDVIAPGVNILA W+G              EFN+ISGTSM+CPHVSG+AA+
Sbjct  499   NYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVEFNIISGTSMSCPHVSGVAAL  558

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             L+K +P+WSPAAIKSAL+TT+Y++D+SG+  + DL T + + P  +G+GH++P  A++PG
Sbjct  559   LRKAFPTWSPAAIKSALITTSYSLDSSGK-PIKDLSTSEESNPFVHGAGHINPNQALNPG  617

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             L+YD    DYV FLC+IGYDS++IA+F++ S         L NPG+LNYPSFSV+F    
Sbjct  618   LIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYFQLCEHKLTNPGNLNYPSFSVVFDEE-  676

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR--  2215
             + V Y RTV NV     V Y+V V+ P  V ++V PN+L F     T SYE+TF  +   
Sbjct  677   EVVKYTRTVTNVGDETEVVYEVKVEAPQGVVISVVPNKLEFNKEKTTQSYEITFTKINGF  736

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSWE-GRSVSEL  2317
             + + SFGS++W DG H V SPIAVS++ G S++ +
Sbjct  737   KESASFGSIQWGDGIHSVRSPIAVSFKTGGSIASM  771



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/751 (53%), Positives = 517/751 (69%), Gaps = 33/751 (4%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHD-WYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             P+++I+ + K  K  +FST+    +SSI+++L P  N    + +LYTY    HGFSA L 
Sbjct  35    PQTYIIHVAKQPKNSIFSTNQKTHFSSILNSLPPSPN---PATILYTYTSAIHGFSAHLA  91

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             PSQA+ L + P ++S+  D++  L TT +P FLGL   SS L P+S + +++I+GVLD+G
Sbjct  92    PSQAAHLQSHPDILSIQTDQIRYLHTTHTPVFLGLTE-SSGLWPNSHFASEVIVGVLDTG  150

Query  470   IWPERSSFS---DRGLNPIPNSWRNKCEVGPNFPATSCNR--KIIGARAYYRGYEAEIGK  634
             IWPE  SFS   D       NSW+ KCE+  +FP++SCN   KIIGA+A+Y+GYEA + +
Sbjct  151   IWPELRSFSTSDDSNSLKSLNSWKGKCEISKDFPSSSCNSNSKIIGAKAFYKGYEAYLQR  210

Query  635   PI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             PI    E KS RD  GHGTH AS AAGS V NA++ G ARGEA+G+AT ARIA YK+CW 
Sbjct  211   PIDETVESKSPRDTEGHGTHTASTAAGSVVGNASLFGFARGEAKGMATKARIAAYKICWK  270

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C ++DIL+ MD+AVADGVHV+SLS+ S    G+A  Y  D IAIGAFGA Q GV+VSC
Sbjct  271   LGCFDSDILAAMDEAVADGVHVISLSVGSN---GYAPHYYRDSIAIGAFGAAQHGVVVSC  327

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP PYT+VN+APWILTVGASTIDREFPA V LG+ R F G SLY G      ++P
Sbjct  328   SAGNSGPGPYTSVNIAPWILTVGASTIDREFPADVVLGDGRVFGGVSLYYGDSLPDNKLP  387

Query  1169  VVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             ++YG    S YC+ G LD+SKV+G+IV C++G +   V+KG AV +AGG+GMI+ N    
Sbjct  388   LIYGADCGSRYCYLGSLDSSKVQGKIVVCDRGGNAR-VEKGSAVKKAGGLGMIMANTEEN  446

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIG--NSPSAPRVAAFS  1522
             G +L  +A  +   +V     E IR+Y++++  PTA I+FKGTVIG   SPSAP+VA+FS
Sbjct  447   GEELLADAHLVAATMVGENAAEKIREYIKSSENPTATIKFKGTVIGGEGSPSAPQVASFS  506

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN+ T EILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSG
Sbjct  507   SRGPNYRTAEILKPDVIAPGVNILAGWTGKVGPTDLEIDPRRVEFNIISGTSMSCPHVSG  566

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             +AA+L+K YP WSPAAIKSALMTTAY VDNSG G + DL T + + P  +G+GHVDP  A
Sbjct  567   IAALLRKAYPEWSPAAIKSALMTTAYNVDNSG-GKIKDLGTGKESNPFVHGAGHVDPNKA  625

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRN-RNLGNPGSLNYPSFSV  2023
             ++PGLVYD  +NDY+ FLC+IGYD+++I +F R     + C N R   +PG LNYPSFSV
Sbjct  626   LNPGLVYDLNINDYLAFLCSIGYDAKEIQIFTREPTSYNVCENERKFTSPGDLNYPSFSV  685

Query  2024  LFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
             +F  N   V YKR + NV    +  Y V V  P  V V+VSP++LVF+    T ++EVTF
Sbjct  686   VFGANNGLVKYKRVLTNVGDSVDAVYTVKVNAPFGVDVSVSPSKLVFSSENKTQAFEVTF  745

Query  2204  QSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               +    + SFGSL WSDG+H+V SPIA  W
Sbjct  746   TRIGYGGSQSFGSLEWSDGSHIVRSPIAARW  776



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/751 (52%), Positives = 505/751 (67%), Gaps = 30/751 (4%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E +++IV + KS KP++FS+HH WYSS++ +L P       ++LLY+Y+    GFSA L+
Sbjct  2     ERRTYIVHVSKSHKPRVFSSHHHWYSSVVESL-PRRRGEGPAKLLYSYDRAVRGFSAHLS  60

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               QA  L  VPGVIS++PD    L TTR+PQFLGL + S  L P+SDY  D+I+GVLD+G
Sbjct  61    GDQADALRRVPGVISLVPDERRVLHTTRTPQFLGL-ADSFGLWPNSDYADDVIVGVLDTG  119

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             IWPER SFSD GL P+P  W+  C    +FP + CNRKIIG +AY+ GYEA  GK +   
Sbjct  120   IWPERPSFSDEGLPPVPERWKGGCIEAADFPKSLCNRKIIGTKAYFLGYEATRGKTMEES  179

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E  S RD  GHGTH AS AAGS V+NA++ G+A GEARG+A+ ARIAVYK+CW   C +
Sbjct  180   NESNSPRDTEGHGTHTASTAAGSVVSNASLFGYAPGEARGMASRARIAVYKICWSFGCYD  239

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+  +QAV DGV V+SLS+ S    G A PY  D IAIGAF AV+ G++VSC+AGN 
Sbjct  240   SDILAAFEQAVVDGVDVISLSVGSS---GHAPPYYLDSIAIGAFAAVENGIVVSCSAGNS  296

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  Y+AVN+APWILTVGAST+DREFPA V LG+  ++ G SLY+G      Q  +VY  
Sbjct  297   GPSSYSAVNIAPWILTVGASTLDREFPADVILGDGTTYGGVSLYAGESLGGQQYSLVYAA  356

Query  1184  SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
              A + YC+ G+L  + V G+IV C++G +  +  KG +V  AGGVG+I+ NL + G +L 
Sbjct  357   DAGNRYCYSGRLSPALVAGKIVICDRGGNARVA-KGNSVHLAGGVGVILANLADSGEELL  415

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              +A  IP  +V    G+ IR Y R+   PTA I F+GTVIG SP APRVA+FS RGPN+ 
Sbjct  416   ADAHFIPATMVGQTAGDKIRSYARSDPNPTATIAFRGTVIGTSPPAPRVASFSSRGPNYR  475

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             T EILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPHVSGLAA+LKK
Sbjct  476   TAEILKPDVIAPGVNILAGWTGEVGPTDLDSDTRKVEFNIISGTSMSCPHVSGLAALLKK  535

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              +P W+PAAIKSAL+TTAY VD++G   + DL T   +    +G+GHVDP  A+DPGLVY
Sbjct  536   AHPDWTPAAIKSALVTTAYVVDDNG-APISDLATGGKSNSFVHGAGHVDPNRALDPGLVY  594

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
             D   +DYV FLCTIGYD+ +I++F   +   DC    LG PG+LNYPSFS +F      V
Sbjct  595   DIQTSDYVAFLCTIGYDANRISVFTDAAYSTDCSAVGLGTPGNLNYPSFSAVFSGRGAVV  654

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD-  2227
              YKRTVKNV    +  Y+V V+ P    VTV+P++L F+     LS+EV   S+  + D 
Sbjct  655   KYKRTVKNVGLNADAVYEVEVKAPIGASVTVTPSKLTFSQNATELSFEVELSSVAGAVDL  714

Query  2228  --------SFGSLRWSD-GTHLVTSPIAVSW  2293
                     +FGS+ WSD G+H V SP+AV W
Sbjct  715   ESSGSSLAAFGSIEWSDGGSHRVRSPVAVLW  745



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/750 (53%), Positives = 503/750 (67%), Gaps = 27/750 (4%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV +  S KP    +H  WY+  + +L P    +R   LLY Y   A GF+ARLTP+Q
Sbjct  34    TYIVHLSPSRKPASSPSHAHWYARTLRSL-PGRQPAR---LLYAYSRAASGFAARLTPAQ  89

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A+ +  +P V++VLPDRL    TT SP FL L S S+ L P S + +D++IGVLD+GI+P
Sbjct  90    AAAIRRLPSVLAVLPDRLCHPHTTHSPVFLRL-STSTGLWPFSSFASDVVIGVLDTGIYP  148

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
              R+SF+D  L P P++WR  CE G  F A+SCNRK+IGAR +Y+GYEA +G PI    E 
Sbjct  149   SRASFADDSLPPPPSTWRGYCESGNGFNASSCNRKLIGARFFYQGYEAAMGHPIDETKES  208

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS  D  GHGTH AS AAG+ V++A    +ARGEARG+AT ARIA YK+CW G C ++DI
Sbjct  209   KSPLDTEGHGTHTASTAAGAVVSDAGFYQYARGEARGMATKARIAAYKICWAGGCYDSDI  268

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ MD A+ADGV V+SLS+ +    G+A  +  D IAIGAFGA + GV+VSC+AGN GP 
Sbjct  269   LAAMDAAIADGVDVISLSVGAG---GYAPSFYRDSIAIGAFGAARHGVVVSCSAGNSGPG  325

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
               TAVN+APWILTVGASTIDREFPA V LG+  ++ G SLY+G   +   +P+VY G + 
Sbjct  326   QRTAVNIAPWILTVGASTIDREFPADVVLGDGNTYGGASLYAGDPINSTYLPLVYAGDSG  385

Query  1193  SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNA  1372
             S  C PG LDA+ V G+IV CE+G +   V+KG AV  AGG GMI+ N    G +L  ++
Sbjct  386   SRLCIPGFLDAAVVAGKIVLCERGTNAR-VEKGSAVKLAGGAGMILANDAASGGELVADS  444

Query  1373  DRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPE  1552
               IP  +V+   G  I  Y+++   PTA I F+GT IG SP+AP+VAAFS RGPNF   E
Sbjct  445   HLIPATMVSHTSGSKITDYIKSQPSPTATIVFRGTAIGASPAAPKVAAFSSRGPNFRVAE  504

Query  1553  ILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLAAMLKKIYP  1699
             ILKPDVIAPGVNILA WTG              EFN+ISGTSMACPHVSG+AA+L++ YP
Sbjct  505   ILKPDVIAPGVNILAGWTGMNGPTDLDIDPRRVEFNIISGTSMACPHVSGIAALLRRAYP  564

Query  1700  SWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAG  1879
              WSPAAIKSALMTTAY  D+SG  T+ DL T   +TP   G+GHVDP  A+DPGLVYD+ 
Sbjct  565   DWSPAAIKSALMTTAYNSDDSGE-TIKDLATEAESTPFVRGAGHVDPNRALDPGLVYDSN  623

Query  1880  VNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIYK  2059
             V+DY+ FLC + Y   +IA+F RN   V+C    L +PG LNYP+FSV+F +N   V YK
Sbjct  624   VDDYLAFLCAMEYSPAQIAVFTRNEISVNCSTAALDSPGDLNYPAFSVIFSSNSDVVTYK  683

Query  2060  RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA----D  2227
             R V+NV      AY+  V +P  V VTV+P+ LVF     +LSYE+TF SL   A     
Sbjct  684   RVVRNVGTSAAAAYEARVSSPPGVDVTVTPSTLVFDAVNVSLSYEITFTSLASQAVAGSY  743

Query  2228  SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             ++GS+ WSDG H V SPIAV+W+   VS +
Sbjct  744   AYGSISWSDGDHDVRSPIAVTWDLSLVSSI  773



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/761 (53%), Positives = 521/761 (68%), Gaps = 36/761 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P+++IV + +S+KP+ F THH+WY+SI+H   P S+H   + LLYT    A GFS R+
Sbjct  62    DAPRTYIVHVAQSQKPR-FLTHHNWYTSILHL--PPSSHP--ATLLYT-TRAAAGFSVRI  115

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSP--QFLGLISGSSNLGPSSDYGADIIIGVL  460
             TPSQ S L   P V++V P+         +   +FLGL   S  L P+SDY  D+I+GVL
Sbjct  116   TPSQLSHLRRHPAVLAVEPEPGPPHPPPPTHTPRFLGLAE-SFGLWPNSDYADDVIVGVL  174

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+GIWPE  SFSD  L+P+P++W+  CEV  +FPA+SCNRKIIGA+A+Y+GYEA +  PI
Sbjct  175   DTGIWPELRSFSDDNLSPVPSTWKGSCEVSRDFPASSCNRKIIGAKAFYKGYEAYLDGPI  234

Query  641   --VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E KS RD  GHGTH +S AAG  V+NA++  +A+GEARG+AT ARIA YK+CW   
Sbjct  235   DESAESKSPRDTEGHGTHTSSTAAGGVVSNASLFHYAQGEARGMATKARIAAYKICWKYG  294

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DIL+ MD+AVADGVHV+SLS+ S    G+A  Y  D IA+GAFGA +  V+VSC+A
Sbjct  295   CFDSDILAAMDEAVADGVHVISLSVGSS---GYAPQYFRDSIALGAFGAARHNVLVSCSA  351

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVV  1174
             GN GP P+TAVN+APWILTVGASTIDREFPA V LG+ R F G SLY G      Q+ +V
Sbjct  352   GNSGPGPFTAVNIAPWILTVGASTIDREFPADVILGDGRVFGGVSLYYGESLPDFQLRLV  411

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAV--SQAGGVGMIVPNLPNE  1348
             Y     + YC+ G L+ASKV+G+IV C++G +   V+KG AV  + AGG+G+I+ N    
Sbjct  412   YAKDCGNRYCYLGSLEASKVQGKIVVCDRGGNAR-VEKGSAVKLAGAGGLGVIMANTAES  470

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +   +V    G+ I++Y+R + +PTA IEFKGTVIG SPSAP+VA+FS R
Sbjct  471   GEELLADAHLLAATMVGQIAGDEIKKYIRLSQYPTATIEFKGTVIGGSPSAPQVASFSSR  530

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LT EILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPH SG+A
Sbjct  531   GPNHLTSEILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNIISGTSMSCPHASGIA  590

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+L+K YP WSPAAIKSALMTTAY VDNSG G + DL T + + P  +G+GHVDP  A++
Sbjct  591   ALLRKAYPEWSPAAIKSALMTTAYNVDNSG-GNIKDLGTGKESNPFTHGAGHVDPNRALN  649

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-C-----RNRNLGNPGSLNYPSF  2017
             PGLVYD+ +NDY+ FLC+IGYD+ +IA+F R     + C     R   L +PG LNYPSF
Sbjct  650   PGLVYDSDINDYLAFLCSIGYDANQIAVFTREPAAANPCEGKVGRTGRLASPGDLNYPSF  709

Query  2018  SVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             SV        V YKR V NV  V +  Y V V  P  V VTV+PN LVF+    T ++EV
Sbjct  710   SVELGRGSDLVKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVAPNTLVFSGENKTQAFEV  769

Query  2198  TFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
              F  +   ++DSFGS+ W+DG+H+V SPIAV W G S S L
Sbjct  770   AFSRVTPATSDSFGSIEWTDGSHVVRSPIAVRWSGDSSSSL  810



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/755 (52%), Positives = 517/755 (68%), Gaps = 40/755 (5%)
 Frame = +2

Query  122   FIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQA  301
             +IV +  S KP LFS+H+ W+ S++ +L PLS   + + LLY+Y   AHGFSARL+P Q 
Sbjct  35    YIVHVQSSHKPSLFSSHNHWHVSLLRSL-PLS--PQPATLLYSYTRAAHGFSARLSPLQT  91

Query  302   SELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPE  481
             + L   P VIS++PD+  E+ TT +P FLG  S ++ L  +SD G D+IIGVLD+GIWPE
Sbjct  92    AALRRHPSVISIIPDQAREIHTTHTPDFLGF-SQNTGLWSNSDDGEDVIIGVLDTGIWPE  150

Query  482   RSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI--GKPI--VGE  649
               SFSD GL P+P++W+ +CE GP+FPA+SCNRK+IGARAYYRGY A    G  +    +
Sbjct  151   HPSFSDSGLGPVPSTWKGECETGPDFPASSCNRKLIGARAYYRGYYAGQVNGTKLHAAKD  210

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              +S RD  GHGTH AS AAGS VANA++  +A+G ARG+A+ ARIA YK+CW   C ++D
Sbjct  211   SRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGMASKARIAAYKICWSVGCYDSD  270

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+GMDQAVADGVHV+SLS+ S    G+A  + +D IAIGAFGA + GV+VSC+AGN GP
Sbjct  271   ILAGMDQAVADGVHVISLSVGSS---GYAREFSKDSIAIGAFGATRHGVVVSCSAGNSGP  327

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG-------VQPSRIQVP  1168
              P TA N+APW+LTVGAST+DREF A V  G+ + FTGTSLY+G       +     Q+ 
Sbjct  328   GPETATNIAPWMLTVGASTVDREFSANVVTGDGKVFTGTSLYAGESLPDSPMSLPESQIS  387

Query  1169  VVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             +VY G   S  C  G+L++S V+G+IV C++G  ++ V+KG AV  AGG GMI+ N  + 
Sbjct  388   LVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGG-SARVEKGRAVKLAGGAGMILANTASS  446

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  +P  +V    G+ IR Y++T   PTA I F GT+IG +P +PRVAAFS R
Sbjct  447   GEELTADSHLVPATMVGAKAGDQIRDYIKTTDSPTATINFLGTLIGPTPPSPRVAAFSSR  506

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTP ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLA
Sbjct  507   GPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLA  566

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+L+K +P WSPAA+KSAL+TTAY V+NSG   L DL T +P+    +G+GHVDP  A++
Sbjct  567   ALLRKAHPDWSPAAVKSALVTTAYDVENSGE-PLEDLATGKPSNSFIHGAGHVDPNKALN  625

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFK  2032
             PGLVYD  V +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+V+F 
Sbjct  626   PGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFG  685

Query  2033  NNLQTVI-YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS  2209
             +    V+ YKR VKNV    +  Y+V V++P+NV + VSP++L F+     L YEVTF+S
Sbjct  686   STTGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLEFSKEKSELEYEVTFKS  745

Query  2210  LRQS-------ADSFGSLRWSDGTHLVTSPIAVSW  2293
             +          +  FGS+ W+DG H+V SP+AV W
Sbjct  746   VVLGGGVGSVPSQEFGSIEWTDGDHVVKSPVAVQW  780



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/754 (52%), Positives = 516/754 (68%), Gaps = 39/754 (5%)
 Frame = +2

Query  122   FIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQA  301
             +IV +  S KP LFS+H+ W+ S++ +L    +  + + LLY+Y   AHGFSARL+P Q 
Sbjct  33    YIVHVQSSHKPSLFSSHNHWHVSLLRSLP---SSPQPATLLYSYSRAAHGFSARLSPLQT  89

Query  302   SELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPE  481
               L   P VIS++PD+  E+ TT +P FLG  S +S L  +SD G D+IIGVLD+GIWPE
Sbjct  90    EALRRHPSVISIIPDQAREIHTTHTPDFLGF-SQNSGLWSNSDDGEDVIIGVLDTGIWPE  148

Query  482   RSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI--GKPI--VGE  649
               SFSD GL P+P++W+ +CE GP+FPA+SCNRK+IGAR YYRGY A    G  +    +
Sbjct  149   HPSFSDSGLGPVPSAWKGECETGPDFPASSCNRKLIGARGYYRGYFAGQVNGTKLHAAKD  208

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              +S RD  GHGTH AS AAGS VANA++  +A+G ARG+A+ ARIA YK+CW   C ++D
Sbjct  209   SRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGMASKARIAAYKICWSVGCYDSD  268

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+GMDQAVADGVHV+SLS+ S    G+A  + +D IAIGAFGA + GV+VSC+AGN GP
Sbjct  269   ILAGMDQAVADGVHVISLSVGSS---GYARDFSKDSIAIGAFGATRHGVVVSCSAGNSGP  325

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVP-----  1168
              P TA N+APW+LTVGAST+DREF A V  G+ + FTGTSLY+G  +  S++ +P     
Sbjct  326   GPETATNIAPWMLTVGASTVDREFSANVVTGDGKVFTGTSLYAGESLPDSQMSLPDSQIS  385

Query  1169  VVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             +VY G   S  C  G+L++S V+G+IV C++G  ++ V+KG AV  AGG GMI+ N  + 
Sbjct  386   LVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGG-SARVEKGRAVKLAGGAGMILANTASS  444

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  +P  +V    G+ IR Y++T+  PTA I F GT+IG SP +PRVAAFS R
Sbjct  445   GEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTATINFLGTLIGPSPPSPRVAAFSSR  504

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTP ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLA
Sbjct  505   GPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLA  564

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+L++ +P+WSPAA+KSAL+TTAY V+NSG   L DL T +P+    +G+GHVDP  A++
Sbjct  565   ALLRRAHPNWSPAAVKSALVTTAYDVENSGE-PLEDLATGKPSNSFIHGAGHVDPNKALN  623

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFK  2032
             PGLVYD  V +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+V+F 
Sbjct  624   PGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFG  683

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
             +    V YKR VKNV    +  Y+V V++P+NV + VSP++L F      L YEVTF+S+
Sbjct  684   STGDVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLEFNKEKSELEYEVTFKSV  743

Query  2213  RQS-------ADSFGSLRWSDGTHLVTSPIAVSW  2293
                       +  FGS+ W+DG H+V SP+AV W
Sbjct  744   VLGGGVGSVPSQEFGSIEWTDGDHVVKSPVAVQW  777



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/753 (52%), Positives = 520/753 (69%), Gaps = 34/753 (5%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             P+++I+ + +S+KP LF++H  WYSSI+ +L P    S  +  LYTY   A GFS RL+P
Sbjct  69    PRTYIIHVAQSQKPSLFTSHKTWYSSILRSLPP---SSPPATPLYTYSSAAAGFSVRLSP  125

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
             SQAS L   P V+++LPD++    TT +P+FLGL + S  L P+SDY  D+I+GVLD+GI
Sbjct  126   SQASLLRRHPSVLALLPDQIRHPHTTHTPRFLGL-ADSFGLWPNSDYADDVIVGVLDTGI  184

Query  473   WPERSSFSDRGLNPIPNS--WRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             WPE  SFSD  L+PI +S  W+  C+  P+FP++ CN KIIGA+A+Y+GYE+ + +PI  
Sbjct  185   WPELKSFSDENLSPISSSSSWKGSCQSSPDFPSSLCNNKIIGAKAFYKGYESYLERPIDE  244

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAG+ V+NA++  +A+GEARG+AT ARIA YK+CW   C 
Sbjct  245   SQESKSPRDTEGHGTHTASTAAGAVVSNASLFHYAQGEARGMATKARIAAYKICWKLGCF  304

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+AV+DGVHV+SLS+ +    G+A  Y  D IA+GAFGA +  V+VSC+AGN
Sbjct  305   DSDILAAMDEAVSDGVHVISLSVGAS---GYAPQYYRDSIAVGAFGAARHNVLVSCSAGN  361

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P TAVN+APWILTVGAST+DREFPA V LG+ R F G SLY G +    ++P+VY 
Sbjct  362   SGPGPSTAVNIAPWILTVGASTVDREFPADVILGDGRVFGGVSLYYGEKLPDFKLPLVYA  421

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                 S YC+ G L++SKV+G+IV C++G +   V+KG AV  AGG+GMI+ N    G +L
Sbjct  422   KDCGSRYCYMGSLESSKVQGKIVVCDRGGNAR-VEKGSAVKLAGGLGMIMANTEANGEEL  480

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNS-PSAPRVAAFSCRGPN  1537
               +A  +   +V  A G+ I++Y++ + +PTA IEF+GTVIG S PSAP+VA+FS RGPN
Sbjct  481   LADAHLLAATMVGQAAGDKIKEYIKLSQYPTATIEFRGTVIGGSEPSAPQVASFSSRGPN  540

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              LT +ILKPDVIAPGVNILA WTG +            EFN+ISGTSM+CPH SG+AA+L
Sbjct  541   HLTSQILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNIISGTSMSCPHASGIAALL  600

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +K YP WSPAAIKSALMTTAY VDNSG G++ DL + + + P  +G+GHVDP  A++PGL
Sbjct  601   RKAYPEWSPAAIKSALMTTAYNVDNSG-GSIKDLGSGKESNPFIHGAGHVDPNRAINPGL  659

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDC-------RNRNLGNPGSLNYPSFSV  2023
             VYD    DYV FLC++GYD+ +IA+F R  P  +        R   L +PG LNYPSF+V
Sbjct  660   VYDLDTGDYVAFLCSVGYDANQIAVFTRE-PAAESVCEGKVGRTGKLASPGDLNYPSFAV  718

Query  2024  LFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                     V  KR V NV    +  Y V V  P  V V VSP+ +VF+    T ++EVTF
Sbjct  719   KLGGEGDLVKNKRVVTNVGSEVDAVYTVKVNPPPGVGVGVSPSTIVFSAENKTQAFEVTF  778

Query  2204  QSLR-QSADSFGSLRWSDGTHLVTSPIAVSWEG  2299
               ++   ++SFGS+ W+DG+H+V SPIAV+W G
Sbjct  779   SRVKLDGSESFGSIEWTDGSHVVRSPIAVTWSG  811



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/754 (51%), Positives = 514/754 (68%), Gaps = 39/754 (5%)
 Frame = +2

Query  122   FIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQA  301
             +IV +  S KP LFS+H+ W+ S++ +L    +  +   LLY+Y   AHGFSARL+P Q 
Sbjct  34    YIVHVQSSHKPSLFSSHNHWHVSLLRSLP---SSPQPPTLLYSYSRAAHGFSARLSPLQT  90

Query  302   SELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPE  481
               L   P VIS++PD+  E+ TT +P FLG  S +S L  +SD G D+IIGVLD+GIWPE
Sbjct  91    EALRRHPSVISIIPDQAREIHTTHTPDFLGF-SQNSGLWSNSDDGEDVIIGVLDTGIWPE  149

Query  482   RSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI--GKPI--VGE  649
               SFSD GL P+P++W+ +CE GP+FPA+SCNRK+IGARAYYRGY A    G  +    +
Sbjct  150   HPSFSDSGLGPVPSAWKGECETGPDFPASSCNRKLIGARAYYRGYFAGQVNGTKLHAAKD  209

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              +S RD  GHGTH AS AAGS VANA++  +A+G ARG+A+ ARIA YK+CW   C ++D
Sbjct  210   SRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGMASKARIAAYKICWSVGCYDSD  269

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+GMDQAVADGVHV+SLS+ S    G+A  + +D IAIG+FGA + G++VSC+AGN GP
Sbjct  270   ILAGMDQAVADGVHVISLSVGSS---GYARDFSKDSIAIGSFGATRHGIVVSCSAGNSGP  326

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG-------VQPSRIQVP  1168
              P TA N+APW+LTVGAST+DREF A V  G+ + +TGTSLY+G       +     Q+ 
Sbjct  327   GPETATNIAPWMLTVGASTVDREFSANVITGDGKVYTGTSLYAGESLPDSQMSLPESQIS  386

Query  1169  VVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             +VY G   S  C  G+L++S V+G+IV C++G  ++ V+KG AV  AGG GMI+ N  + 
Sbjct  387   LVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGG-SARVEKGRAVKLAGGAGMILANTASS  445

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  +P  +V    G+ IR Y++T+  PTA I F GT+IG SP +PRVAAFS R
Sbjct  446   GEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTATINFLGTMIGPSPPSPRVAAFSSR  505

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTP ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLA
Sbjct  506   GPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLA  565

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+L++ +P WSPAA+KSAL+TTAY V+NSG   L DL T +P+    +G+GHVDP  A++
Sbjct  566   ALLRRAHPDWSPAAVKSALVTTAYDVENSGE-PLEDLATGKPSNSFIHGAGHVDPNKALN  624

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFK  2032
             PGLVYD  V +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+V+F 
Sbjct  625   PGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFG  684

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
             ++ + V YKR VKNV    +  Y+V V++P+NV + VSP++L F      L YEVTF+S+
Sbjct  685   SSGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLEFNKEKSELEYEVTFKSV  744

Query  2213  RQS-------ADSFGSLRWSDGTHLVTSPIAVSW  2293
                       +  FGS+ W+DG H+V SP+AV W
Sbjct  745   VLGGGVGSVPSQEFGSIEWTDGDHVVKSPVAVQW  778



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/752 (51%), Positives = 513/752 (68%), Gaps = 33/752 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPL--SNHSRSSELLYTYEHVAHGFSA  280
             +   +FIV ++ S     FS H  W++SI+ TLS L  +N  ++  L+Y+Y H A GF+A
Sbjct  23    QSKSNFIVNVLHSHNTANFSAH-KWHTSILQTLSSLGYNNTLKTPMLIYSYTHSATGFAA  81

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVL  460
              L+ +Q +EL +   V+S++PD++ ++QTTR+ QFLGL  GS  L P SD G+DIIIGV+
Sbjct  82    SLSAAQVAELRSHRSVLSIIPDQVHQVQTTRTTQFLGLSEGS-GLWPQSDQGSDIIIGVI  140

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVG-PNFPATSCNRKIIGARAYYRGYEAEIGKP  637
             D+GIWP   SFSD G  P+P +W+  C VG P+FPA SCN+K+IGARA+Y GYEA  G+ 
Sbjct  141   DTGIWPGHRSFSDVGYGPVPTTWKGSCPVGDPDFPAGSCNKKLIGARAFYAGYEANYGRL  200

Query  638   IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS +D NGHGTH AS AAGS V NA +  +A+G ARG+AT ARIA YKVCW   C
Sbjct  201   PGKERKSPKDYNGHGTHCASTAAGSKVVNAALFNYAKGTARGVATKARIAAYKVCWGRRC  260

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALP--YDEDLIAIGAFGAVQKGVIVSCA  991
               +DIL+GMDQA+ DGVHV+S SL+       +LP  YD  L+AIGA  A Q GV+VS +
Sbjct  261   HASDILAGMDQAIKDGVHVISASLS-------SLPDEYDVSLMAIGAAHAAQNGVLVSSS  313

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ-VP  1168
             AGN GP   T   +APW+L  GASTIDR+F A V L + R+F+G +LY G      Q +P
Sbjct  314   AGNNGPSHSTITKVAPWMLITGASTIDRQFQADVILADGRTFSGVTLYPGDPSKEGQFLP  373

Query  1169  VVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             +V G  + S  C  G L  +K++G+IV CE G+  S V+   +V +A G GMI+ N    
Sbjct  374   LVTGEISGSKNCQRGHLKKTKIQGKIVVCEYGN-ISGVEMSYSVQEASGAGMILINHARL  432

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPT----ARIEFKGTVIGN-SPSAPRVA  1513
             G +L   A  IP  +V+ + G+ I++Y  T+S PT    A+I+F+GTV G+ +PS+PRVA
Sbjct  433   GAELTSEAYFIPAIMVSYSAGDAIKKYASTSSTPTIKPSAKIKFRGTVTGSATPSSPRVA  492

Query  1514  AFSCRGPNFLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPH  1660
             AFS RGPNFLT EILKPDVIAPGV+ILAAW+G+             EFN+ISGTSMACPH
Sbjct  493   AFSSRGPNFLTSEILKPDVIAPGVDILAAWSGAGGLTHLDFDTRCVEFNIISGTSMACPH  552

Query  1661  VSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDP  1840
             VSGLAAMLKK +P+W+PAAI SA+ TTAY +D++G+  +I+  T  P+TP  +GSGH+DP
Sbjct  553   VSGLAAMLKKAHPTWTPAAIMSAIKTTAYNIDSTGK-EIIEASTLLPSTPFVHGSGHIDP  611

Query  1841  THAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFS  2020
               AVDPGLVYD  ++DY+ FLCTIGYD+++I +  +   +VDC ++ L +PG+LNYPSFS
Sbjct  612   NKAVDPGLVYDLQISDYIAFLCTIGYDTKRIHVLFKEPAVVDCASQILSSPGNLNYPSFS  671

Query  2021  VLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
             V+F+ +   V Y R VKNV   +N  Y+V V+ P NV ++V+P  L FT  + TLSY++T
Sbjct  672   VVFRGDTNKVKYTRVVKNVGSSKNAVYKVNVKVPLNVHISVAPTTLAFTSTVQTLSYDIT  731

Query  2201  FQSLRQSADSFGSLRWSDGTHLVTSPIAVSWE  2296
             F S      SFGS+ W+DG+H V SPIAV WE
Sbjct  732   FTSTSIGPPSFGSIEWTDGSHHVRSPIAVQWE  763



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/750 (51%), Positives = 507/750 (68%), Gaps = 35/750 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTL--SPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +S+IV +  S KP LFS+H+ W+ S++ +L  SP     + + LLY+Y  V HGFSARL+
Sbjct  37    ESYIVHVQSSHKPSLFSSHNHWHVSLLRSLPSSP-----QPATLLYSYSRVLHGFSARLS  91

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
                 + L   P VISV PD+  ++ TT +P FLG  S ++ L  +SD G D+I+GVLD+G
Sbjct  92    SLHTAALRRHPSVISVTPDQARQIHTTHTPAFLGF-SQNTGLWSNSDDGEDVIVGVLDTG  150

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV--  643
             IWPE  SFSD  L P+P++W+ +CE GP+FPA+SCNRKIIGARAYY+GY        +  
Sbjct  151   IWPEHPSFSDSDLGPVPSTWKGECETGPDFPASSCNRKIIGARAYYKGYLTRRNGTKLHA  210

Query  644   -GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD  GHGTH AS AAGS VANA++  +A+G ARG+A+ ARIA YK+CW   C 
Sbjct  211   AKESRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGMASKARIAAYKICWSSGCY  270

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ ++QAVADGVHV+SLS+ +    G A  Y  D IAIGAFGA + G++VSC+AGN
Sbjct  271   DSDILAALEQAVADGVHVISLSVGAS---GSAPEYHRDSIAIGAFGATRHGIVVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P TA N+APWILTVGAST+DREF A V  G+ + FTGTSLY+G      Q+ +VY 
Sbjct  328   SGPGPETATNIAPWILTVGASTVDREFSANVITGDGKVFTGTSLYAGESLPDSQISLVYS  387

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             G   S  C  G+L++S V G+IV C++G  ++ V+KG AV  AGG GMI+ N  + G +L
Sbjct  388   GDCGSRLCSVGELNSSLVEGKIVLCDRG-GSARVEKGRAVKLAGGAGMILANTASSGEEL  446

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P  +V    G+ IR Y++T++ PTA I F GT+IG SP +PRVAAFS RGPN 
Sbjct  447   TADSHLVPATMVGAKAGDQIRDYIKTSNSPTATISFLGTLIGPSPPSPRVAAFSSRGPNH  506

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTP ILKPD+IAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+
Sbjct  507   LTPVILKPDMIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLR  566

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
             K +P WSPAAIKSAL+TTAY V+NSG   + DL T + + P  +G+GHVDP  A++PGLV
Sbjct  567   KAHPDWSPAAIKSALVTTAYDVENSGE-AIEDLATGKSSNPFIHGAGHVDPNKALNPGLV  625

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQ  2044
             YD  V +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFSV+F +  +
Sbjct  626   YDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSTGE  685

Query  2045  TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL----  2212
                Y+R VKNV    +  Y+V V++P+NV + VSP++LVF+     L YEVTF+S+    
Sbjct  686   VAKYRRVVKNVGSNVDAVYEVGVKSPANVEIEVSPSKLVFSKEKRELEYEVTFKSVVLGG  745

Query  2213  ---RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                      FGS+ W+DG H+V SP+A  W
Sbjct  746   GVGSMPGQEFGSIEWTDGDHVVKSPVAFQW  775



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/756 (52%), Positives = 502/756 (66%), Gaps = 32/756 (4%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS-----ELLYTYEHVAHGFSAR  283
             ++IV +  + KP    T   WY     TL  L  H R +      LLY Y   A GF+AR
Sbjct  35    TYIVHVSPAHKPASSPTLRQWYWC---TLRSLPRHLRRAPAPAPRLLYAYSRAAAGFAAR  91

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             L+P+QA+ + ++P V+SVLPDR  +   T SP FL L S SS L PSS + +D ++ VLD
Sbjct  92    LSPAQAAAVRSLPHVLSVLPDRARQPHITHSPTFLRL-SPSSGLWPSSSFASDAVVAVLD  150

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPAT-SCNRKIIGARAYYRGYEAEIGKPI  640
             +GI+P R+SF D  L+  P+SWR  C+ GP F ++ +CNRK+IGAR +Y+GYEA +G PI
Sbjct  151   TGIFPSRASFFDSSLSAPPSSWRGSCDSGPGFNSSQACNRKLIGARFFYKGYEAAMGHPI  210

Query  641   --VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E KS  D  GHGTH AS AAG+AV +A    +ARGEARG+AT ARIA YK+CW   
Sbjct  211   DESRESKSPLDTEGHGTHTASTAAGAAVDDAGFYQYARGEARGMATKARIAAYKICWASG  270

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DIL+ MD A+ DG  V+SLS+ +    GFA  +D D IAIGAFGA + GVIVSC+A
Sbjct  271   CFDSDILAAMDAAIDDGADVISLSVGAN---GFAPSFDRDSIAIGAFGAARHGVIVSCSA  327

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVV  1174
             GN GP PYTAVN+APWILTVGASTIDREFPA V LG+  ++ G SLY+G   +   +P+V
Sbjct  328   GNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYGGVSLYAGELSNSTDLPLV  387

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
               G   S  C  G LD++KV G+IV C++G +   V+KG AV  AGG GMI+ N    G 
Sbjct  388   DAGDCGSRLCITGYLDSAKVAGKIVLCDRGANAR-VEKGSAVKLAGGAGMILANTAENGE  446

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  ++  IP  +V  + G+ IR Y+++ S PTA I FKGTVI +SP AP+VAAFS RGP
Sbjct  447   ELIADSHLIPATMVGESAGDKIRGYIKSQSSPTATIVFKGTVISSSPPAPKVAAFSSRGP  506

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAM  1681
             N+  PEILKPDVIAPGVNILAAWTG+ +           EFN+ISGTSM+CPHVSG+AA+
Sbjct  507   NYRAPEILKPDVIAPGVNILAAWTGASSPTDLDIDPRRVEFNIISGTSMSCPHVSGIAAL  566

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             L K YP WSPAAIKSALMTTA  +DNSG   + DL T + +TP   G+GHVDP  A+DPG
Sbjct  567   LHKTYPDWSPAAIKSALMTTASNLDNSGE-LIKDLATGKESTPFVRGAGHVDPNKALDPG  625

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             LVYD+ V DY+ FLC IGY  ++IALF R+   V+C    L +PG LNYP+FS +F +  
Sbjct  626   LVYDSQVEDYLAFLCAIGYSPQQIALFTRDEIAVNCSALTLASPGDLNYPAFSAVFSSAS  685

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS  2221
               V Y R V+NV    + AY+  V  P  V VTV+P++LVF     +LSY++T  S+  +
Sbjct  686   DVVTYSRVVRNVGGPDDAAYEAEVSCPPGVNVTVTPSKLVFDAVEQSLSYKITLASMADA  745

Query  2222  A----DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             A     SFG + WSDG H+V SPIAVSW    VS +
Sbjct  746   AVAGSRSFGWISWSDGAHIVRSPIAVSWRESLVSSI  781



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/747 (51%), Positives = 510/747 (68%), Gaps = 25/747 (3%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPL--SNHSRSSELLYTYEHVAHGFSA  280
             +   +FIV ++ S     FS H  W+SSI+ TLS L  +N     +L+Y+Y H A GF+A
Sbjct  23    QSKSNFIVHVLNSHNTANFSAH-KWHSSILQTLSSLGYNNTLNIPKLIYSYTHSATGFAA  81

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVL  460
              L+ +QA+EL + P V+S++PD++ ++QTTR+ QFL L  GS  L P SD G++IIIGV+
Sbjct  82    SLSAAQAAELRSHPAVLSIIPDQVHQVQTTRTTQFLDLSEGS-GLWPQSDQGSEIIIGVI  140

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVG-PNFPATSCNRKIIGARAYYRGYEAEIGKP  637
             D+GIWP   SFSD G  P+P +W+  C VG P+FPA SCN+K+IGA A+Y GYEA  G+ 
Sbjct  141   DTGIWPGHRSFSDVGYGPVPTTWKGSCPVGDPDFPAGSCNKKLIGAYAFYAGYEANYGRL  200

Query  638   IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS +D NGHGTH ASIAAGS V NA +  +A+G ARG+AT ARIA YK CW   C
Sbjct  201   PRKERKSPKDYNGHGTHCASIAAGSKVVNAALFNYAKGTARGVATKARIAAYKACWGSEC  260

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ MD+A+ DGVH++S S+ S      A+ YD   IAIG+  A Q GV+VS AAG
Sbjct  261   QDSDILAAMDKAIKDGVHIISASIGSFP----AVQYDFSAIAIGSAHAAQSGVLVSSAAG  316

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ-VPVV  1174
             N GP   T  N+APW+L VGAS+IDR+F A VTL + R+F+G +LY G   +  Q +P+V
Sbjct  317   NDGPGRGTVSNVAPWMLVVGASSIDRQFEADVTLADGRTFSGVTLYPGDPSADAQFLPIV  376

Query  1175  YGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
              G ++ S  C  GQL  +KV+G+IV CE G   +  +   +V +AGG GMI+ N  N G 
Sbjct  377   TGENSGSKNCKRGQLQKTKVKGKIVVCEYGK-IADTEMSYSVQEAGGAGMILINDANWGA  435

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPT-ARIEFKGTVIGN-SPSAPRVAAFSCR  1528
             +L   A  IP  +V+ + G+ I++Y  T +  T A+I+F+GTV G+ +PS+PRVAAFS R
Sbjct  436   ELRSQAYFIPAVMVSYSAGDAIKKYASTPTIKTSAKIKFRGTVTGSATPSSPRVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +  EILKPDVIAPGVNILAAW+G+             EFN+ISGTSMACPHVSGLA
Sbjct  496   GPNIVNTEILKPDVIAPGVNILAAWSGAAGPTGLDFDTRRVEFNIISGTSMACPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             AMLKK +P+W+PAAI SA+MTTAY +D++G+  +ID+ T  P+TP   GSGH+DP  AVD
Sbjct  556   AMLKKAHPTWTPAAIMSAIMTTAYNIDSTGK-EIIDVSTLLPSTPFVRGSGHIDPNKAVD  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD  V+DY+ FLCT GY    I +  +   ++DC ++ L +PG+LNYPSFSV+F+ 
Sbjct  615   PGLVYDLQVSDYIAFLCTAGYTKNMIRVIFKAPAVIDCASQKLSSPGNLNYPSFSVVFRG  674

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR  2215
                 V Y R VKNV   +N  Y+V V+ P NV+++V+P+ L FT  + TLSY++TF S  
Sbjct  675   ATNKVKYTRVVKNVGSSKNAVYKVNVKAPLNVQISVAPSTLTFTSTVQTLSYDITFTSTS  734

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSWE  2296
             + A SFGS+ WSDG H V SPIA+ W+
Sbjct  735   RGASSFGSIEWSDGNHHVRSPIAIQWK  761



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/752 (51%), Positives = 503/752 (67%), Gaps = 25/752 (3%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS-ELLYTYEHVAHGFSARLTPS  295
             ++IV +  + KP    T   WY   + +L P   H   +  LLY Y     GF+ARL+P+
Sbjct  33    TYIVHVSPAHKPASSPTLRHWYRCTLRSLPPPPPHPAPAPRLLYFYSRATTGFAARLSPA  92

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA+ L ++P ++SVLPDR  +  TTRSP FL L S  S L PSS + +D +I VLD+GI+
Sbjct  93    QAAALRSLPYILSVLPDRARQPHTTRSPTFLRL-SPYSGLWPSSSFASDAVIAVLDTGIF  151

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPAT-SCNRKIIGARAYYRGYEAEIGKPI--VG  646
             P R SF D  L+P P+SWR  C+ G  F ++ +CNRK+IGAR +Y+GYE+ +G PI    
Sbjct  152   PSRPSFLDSSLSPPPSSWRGSCDSGSGFNSSQACNRKLIGARFFYKGYESAMGHPIDESR  211

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS  D  GHGTH AS AAG+AV +A    +ARGEARG+AT ARIA YK+CW   C ++
Sbjct  212   ESKSPLDTEGHGTHTASTAAGAAVEDAGFYQYARGEARGMATKARIAAYKICWAAGCFDS  271

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MD A+ DG  V+SLS+ +    GFA  +  D IAIGAFGA + GV VSC+AGN G
Sbjct  272   DILAAMDAAIDDGADVISLSVGAT---GFAPSFYRDSIAIGAFGAARHGVTVSCSAGNSG  328

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P PYTAVN+APWILTVGASTIDREFPA V LG+  ++ G SLY+G   +   +P+VY G 
Sbjct  329   PGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYGGVSLYAGELLNSTDLPLVYAGD  388

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
               S  C  G LD++KV G+IV C++G +   V+KG AV  AGG GMI+ N    G +L  
Sbjct  389   CGSRLCISGYLDSAKVAGKIVLCDRGANAR-VEKGSAVKLAGGAGMILANTAENGEELIA  447

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             ++  IP  +V  + G+ IR Y+++ S PTA + F+GTVI +SP AP+VAAFS RGPN+  
Sbjct  448   DSHLIPATMVGESAGDKIRDYIKSQSSPTATVVFRGTVISSSPPAPKVAAFSSRGPNYRA  507

Query  1547  PEILKPDVIAPGVNILAAWTG--SLTE---------FNMISGTSMACPHVSGLAAMLKKI  1693
             PEILKPDVIAPGVNILAAWTG  S T+         FN+ISGTSM+CPHVSG+AA+L K 
Sbjct  508   PEILKPDVIAPGVNILAAWTGISSPTDLDIDPRRVLFNIISGTSMSCPHVSGIAALLHKT  567

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             YP WSPAAIKSALMTTAY +DNSG   + DL T + +TP   G+GHVDP  A+DPGL+YD
Sbjct  568   YPDWSPAAIKSALMTTAYNLDNSGE-IIKDLSTGEESTPFVRGAGHVDPNKALDPGLIYD  626

Query  1874  AGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVI  2053
             + V DY+ FLC IGY +++IALF R+   V+C    L +PG LNYP+FSV+F +    V 
Sbjct  627   SQVEDYLAFLCAIGYSTQQIALFTRDETTVNCSAMTLASPGDLNYPAFSVVFSSTSDIVT  686

Query  2054  YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA---  2224
             + R V+NV    +  Y+  +  P  V VTV+P++LVF     +LSYE+TF S+  +A   
Sbjct  687   FSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPSKLVFDAVDQSLSYEITFASIADAAVAG  746

Query  2225  -DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
              + FG + WSDGTH V SPIAVSW    V+ +
Sbjct  747   SNGFGGISWSDGTHSVRSPIAVSWRQSFVASM  778



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/738 (51%), Positives = 498/738 (67%), Gaps = 31/738 (4%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E   S+IV +  S KP LFS+H+ W++S++ +L    +  + + LLY+Y    HGFSARL
Sbjct  631   EGIASYIVHVQSSHKPSLFSSHNHWHNSLLRSLP---SSPQPATLLYSYSRAVHGFSARL  687

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             +P Q + L   P VISV+PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+
Sbjct  688   SPIQTAALRRNPAVISVIPDQAREIHTTHTPTFLGF-SDNSGLWSNSNYGEDVIVGVLDT  746

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV-  643
             GIWPE  SFSD GL+P+P++W+ +CE GP+FPA+SCNRK+IGARA+Y+GY          
Sbjct  747   GIWPEHPSFSDSGLDPVPSTWKGECETGPDFPASSCNRKLIGARAFYKGYLTHRNGSTTH  806

Query  644   --GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E +S RD  GHGTH AS AAGS VANA+   +A G ARG+A+ ARIA YK+CW G C
Sbjct  807   TAKESRSPRDTEGHGTHTASTAAGSVVANASFYQYASGLARGMASKARIAAYKICWTGGC  866

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ MDQAV+DGVHV+SLS+ +    G+A  Y +D IAIGAFGA + G++VSC+AG
Sbjct  867   YDSDILAAMDQAVSDGVHVISLSVGAN---GYAPEYHKDSIAIGAFGATRHGIVVSCSAG  923

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP P TA N+APWILTVGASTIDREF A    G+ + FTGTSLY+G      Q+ +VY
Sbjct  924   NSGPGPQTATNIAPWILTVGASTIDREFTANAITGDGKVFTGTSLYAGESLPDSQISLVY  983

Query  1178  GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
              G   S  C+PG+L++S V G+IV C++G +   V+KG AV  AGG GMI+ N    G +
Sbjct  984   SGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIAGGAGMILANTAESGEE  1042

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  ++  +P  +V    G+ IR Y++ +  PTA I F GT+IG SP +PRVAAFS RGPN
Sbjct  1043  LTADSHLVPATMVGAKAGDQIRDYIKNSDSPTATISFLGTLIGPSPPSPRVAAFSSRGPN  1102

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TP ILKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L
Sbjct  1103  HITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALL  1162

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +K +P WSPAAIKSAL+TTAY  +NSG   + DL T + +    +G+GHVDP  A++PGL
Sbjct  1163  RKAHPDWSPAAIKSALVTTAYVTENSGE-PIEDLATGKTSNSFIHGAGHVDPNKALNPGL  1221

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNL  2041
             VYD  V DYV FLC +GY+   I +FL++  L + C    L   G LNYPSFSV+F + +
Sbjct  1222  VYDIDVKDYVAFLCAVGYEFPGILVFLQDPALYNACETSKLRTAGDLNYPSFSVVFGSTV  1281

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL---  2212
               + Y+R VKNV    +  Y++ V++P+NV + VSP++L F+     L +EVTF+S+   
Sbjct  1282  DVLKYRRVVKNVGSNVDAVYEIGVKSPANVEIEVSPSKLAFSKEKSELEFEVTFKSVVLG  1341

Query  2213  ----RQSADSFGSLRWSD  2254
                       FGS+ W+D
Sbjct  1342  GGDGSMPGHEFGSIEWTD  1359



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/758 (51%), Positives = 491/758 (65%), Gaps = 37/758 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE----LLYTYEHVAHGFS  277
             +  +FIV + K+ KP +F+THH WY +I+ +L       R+ E    LLY+Y+ VAHGFS
Sbjct  23    QHHTFIVHVSKAHKPAIFTTHHHWYKAILRSLR------RAGEPKPTLLYSYDRVAHGFS  76

Query  278   ARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGV  457
             AR+ PSQA  L N P ++SV P+R   L TTR+P+FLGL S    L P+SDY  D+IIGV
Sbjct  77    ARILPSQADILRNFPEILSVRPERTYSLHTTRTPEFLGL-SKDQGLWPNSDYAKDVIIGV  135

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPN--FPATSCNRKIIGARAYYRGYEAEIG  631
             LD+GIWPER SFSD GL  +P  W+  C+ G         CNRKIIGAR + +GYEA  G
Sbjct  136   LDTGIWPERPSFSDNGLTTVPERWKGVCDSGAGKILSGEFCNRKIIGARWFAKGYEAVNG  195

Query  632   K-PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             K     E  S  D  GHGTH AS AAG+ V+ A+  G+A GEARG+ATNARIAVYK+CW 
Sbjct  196   KINETEESPSPLDTEGHGTHTASTAAGALVSGADFYGYAAGEARGMATNARIAVYKICWK  255

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C ++DIL+ MDQAV DGV V+SLS+ S      A  +D+D IAIGAFGA + GV+VSC
Sbjct  256   TGCYDSDILAAMDQAVGDGVDVISLSVGSSH---LAPEFDDDSIAIGAFGAARHGVVVSC  312

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP P+TA N+APWILTVGASTIDR+FPA V LG+     G SLY+G + S     
Sbjct  313   SAGNSGPGPHTATNIAPWILTVGASTIDRDFPADVILGDGTILAGVSLYTGNR-SPENFS  371

Query  1169  VVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             VV    +    C  G+L  +KV G+ V CE+G  T+ V KG++V  +GG  M++ N    
Sbjct  372   VVLAADSGDRLCRKGRLIPAKVAGKTVVCERG-ITARVAKGLSVKDSGGAAMVLTNTEES  430

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGN-SPSAPRVAAFSC  1525
             G +L  +A  +P  +V   +G+ IR+YVR+A+ P+A I F+GTV G  + +AP VAAFS 
Sbjct  431   GEELVADAHLLPATMVGQINGDKIRKYVRSANNPSAGILFRGTVTGKYATAAPMVAAFSS  490

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGL  1672
             RGPN+ +PEI+KPDVIAPGVNILA WTG+              FN+ISGTSM+CPHVSGL
Sbjct  491   RGPNYRSPEIVKPDVIAPGVNILAGWTGATGPTGLETDGRRWNFNVISGTSMSCPHVSGL  550

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK  +P WSPAA+KSALMTTAY  DN+G  T+ DL   + +TP   GSGHVDP  A+
Sbjct  551   AALLKNAFPHWSPAAVKSALMTTAYDSDNNGS-TIKDLADGKESTPFVRGSGHVDPNRAL  609

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             DPGLVYD    DYV +LC +GYDS +IA+F      VDCR       G LNYPSFS++F 
Sbjct  610   DPGLVYDIKPEDYVAYLCALGYDSVRIAVFTGGKS-VDCRVVGFAKSGDLNYPSFSMVFG  668

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
                    + RTV NV   R+ AY  ++  P +VR+ V P +LVF  +  +LSY VTF+ +
Sbjct  669   PGKTVAKFSRTVTNVGDARS-AYAASINGPDSVRIRVDPEKLVFCAQNQSLSYSVTFEYV  727

Query  2213  RQSA---DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                +     FG L WSDG H V SPIA SWEG   S  
Sbjct  728   EGYSPLDTCFGLLTWSDGRHDVKSPIAFSWEGALASSF  765



>ref|XP_010088794.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36977.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/757 (52%), Positives = 501/757 (66%), Gaps = 40/757 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P +FIV M K  KP LF++   WY+SII +L P+S H   S LLYTYE VA+GF+  L
Sbjct  34    DHPMTFIVHMTKQHKPLLFTSQFHWYNSIIKSL-PISRHP--SMLLYTYERVANGFAVSL  90

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TPSQA++L ++PGV+SV+PD   EL  T + +FLGL S  S L PSS+YG DIIIGV D+
Sbjct  91    TPSQAAKLEDIPGVLSVMPDEAQELHITHTYRFLGL-SPDSGLWPSSNYGEDIIIGVFDT  149

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRG-YEAEIGKPIV  643
             GIWPE  SFSD GL+P+P+SW+  CE   +FPA+SCNRKIIGAR++  G Y + +    +
Sbjct  150   GIWPEHRSFSDAGLSPVPSSWKGTCETWNDFPASSCNRKIIGARSFLAGHYMSNLAGSTL  209

Query  644   GEP---KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL-G  811
                    S RD  GHGTH  S AAGS V+NA+  G+A+GEA GIAT ARIAVYKVC    
Sbjct  210   NLSAITNSPRDTYGHGTHTTSTAAGSVVSNASFYGYAKGEAIGIATKARIAVYKVCATKK  269

Query  812   TCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C  ADIL+GMDQAVADGV +      S S +G   PY  D IAI  FGA+Q G++VS +
Sbjct  270   VCRVADILAGMDQAVADGVDI-----ISMSLSGGTKPYYRDNIAIATFGAMQHGILVSVS  324

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG-VQPSRIQVP  1168
              GN GP   T  +L PW+LTVGAS++DREF A V LG++R+F G SLY G   P   Q  
Sbjct  325   GGNQGPTRSTVNHLPPWVLTVGASSVDREFRADVVLGDNRTFLGASLYPGPFFPFTDQYE  384

Query  1169  VVYGGSANSFYCFPGQLDAS-KVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
             +VYGG   + +C  GQ +   ++ G+I+ CEQG DTS  D   AV+   G G I+ N   
Sbjct  385   LVYGGDFGNVFCKVGQFNKQDQLAGKIIVCEQG-DTSSSDMAYAVANVTGRGAIILNNRK  443

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNS-PSAPRVAAFS  1522
              G +L     R P   V++ DG  I++Y++++  PTA I F+GTV G++ P AP+VA FS
Sbjct  444   YGEELRAEQHRWPATRVSMTDGNEIKRYLQSSENPTANILFRGTVNGSTFPPAPKVATFS  503

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL----------TEFNMISGTSMACPHVSGL  1672
              RGPN LTP+ILKPDVIAPG+NILAAWT +            EFN+ISGTSMACPHVSG+
Sbjct  504   SRGPNPLTPQILKPDVIAPGLNILAAWTNATGPRGGNDPRRVEFNVISGTSMACPHVSGI  563

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             +A+LKK YPSWSPAAIKSALMTTAY +DNSG+  L DL T + +TP A+GSGHVDP+ A+
Sbjct  564   SALLKKAYPSWSPAAIKSALMTTAYNLDNSGQ-RLKDLATGKTSTPFAHGSGHVDPSRAL  622

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRN--SPLVDCRNR--NLG---NPGSLNYP  2011
             DPGL+YD  V DYV FLC+IGY S+ I++F     SP + C      LG    PG LN P
Sbjct  623   DPGLIYDMSVTDYVGFLCSIGYSSKLISIFFTQTVSPKI-CEETYAALGARVTPGDLNLP  681

Query  2012  SFSVLFKNN-LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
             SFSV+FKN+ ++TV Y+RTV NV    +  Y  T   P+ V++TVSP +LVF     T +
Sbjct  682   SFSVVFKNDQVETVKYRRTVTNVGTNVDAVYSATGVQPAGVKITVSPKKLVFDANNLTQT  741

Query  2189  YEVTFQSL--RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             YE+TF           FG ++WSDG H V S IA SW
Sbjct  742   YEITFSPTGGHGKLARFGWIQWSDGIHSVRSTIAFSW  778



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/753 (49%), Positives = 489/753 (65%), Gaps = 65/753 (9%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV +  S KP LFS+H  W++S++ +L    +  + + LLY+Y     GFSARL+P+
Sbjct  30    ESYIVHVQSSHKPSLFSSHDHWHNSLLRSLP---SSPQPATLLYSYSRAVQGFSARLSPT  86

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             Q ++L   P VISV+PD+  E+ TT +P FLG  S +S L  +S+YG D+I+GVLD+GIW
Sbjct  87    QTADLRRHPSVISVIPDQAREIHTTHTPAFLGF-SDNSGLWSNSNYGEDVIVGVLDTGIW  145

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGEPK  655
             PE  SFSD GL+P+P++W+  CE GP+FPA+SCNRK+IGARA+Y+GY             
Sbjct  146   PEHPSFSDSGLDPVPSTWKGACETGPDFPASSCNRKLIGARAFYKGYL------------  193

Query  656   SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADIL  835
                  + HGTH AS AAGS VANA++  +ARG ARG+A+ ARIA                
Sbjct  194   ----THRHGTHTASTAAGSVVANASLYQYARGVARGMASKARIA----------------  233

Query  836   SGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDP  1015
                  AVADGVHV+SLS+ +    G+A  Y  D IAIGAFGA + G++VSC+AGN GP P
Sbjct  234   -----AVADGVHVISLSVGAN---GYAPEYHMDSIAIGAFGATRHGIVVSCSAGNSGPGP  285

Query  1016  YTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANS  1195
              TA N+APWILTVGAST DREF A    G+ + FTGTSLY+G      Q+ +VY G   S
Sbjct  286   QTATNIAPWILTVGASTTDREFSANAITGDGKVFTGTSLYAGEPLPDSQLSLVYSGDCGS  345

Query  1196  FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNAD  1375
               C+PG+L+AS V G+IV C++G +   V+KG AV  AGG GMI+ N+   G +L  ++ 
Sbjct  346   RLCYPGKLNASLVEGKIVLCDRGGNAR-VEKGSAVKIAGGAGMILANIAESGEELTADSH  404

Query  1376  RIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEI  1555
              +P  +V    G+ IR+Y++ +  PTA I F GT IG SP +PRVAAFS RGPN +TP I
Sbjct  405   LVPATMVGANAGDQIREYIQKSVSPTATISFLGTSIGPSPPSPRVAAFSSRGPNHITPVI  464

Query  1556  LKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYPS  1702
             LKPDVIAPGVNILA WTG +            +FN+ISGTSM+CPHVSGLAA+L+K +P 
Sbjct  465   LKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLRKAHPD  524

Query  1703  WSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGV  1882
             WSPAAIKSAL+TTAY  +NSG   + DL T +P+    +G+GHVDP  A++PGLVYD  V
Sbjct  525   WSPAAIKSALVTTAYDTENSGE-PIEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIDV  583

Query  1883  NDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQTVIYK  2059
              DYV FLC +GY+   I +FL++  L + C    L   G LNYPSFSV+F + +  V Y+
Sbjct  584   KDYVAFLCAVGYEFPGILVFLQDPTLYNACETSKLKTSGDLNYPSFSVVFGSTVDVVKYR  643

Query  2060  RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQS------  2221
             R VKNV    +  Y+V V++P+NV + VSP +L F+     L YEVTF+S+         
Sbjct  644   RVVKNVGTNVDAVYEVGVKSPANVEIDVSPRKLAFSKGEGELEYEVTFRSVVLGGGVGSV  703

Query  2222  -ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
                 FGS+ W+DG H+V SP+AV W   SV   
Sbjct  704   PGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  736



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/751 (49%), Positives = 499/751 (66%), Gaps = 43/751 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E K++I+ M KS+ P +F  H  WY + + ++S       S+E++Y Y++V HGF+ARLT
Sbjct  23    EKKTYIIHMAKSQMPAIFDDHTHWYDASLKSVS------ESAEMIYVYKNVVHGFAARLT  76

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               QA  L   PG++SVLP+ + +L TTR+P FLGL   S N+ P SD  +D+I+GVLD+G
Sbjct  77    ARQAESLETQPGILSVLPELIYQLHTTRTPLFLGL-DRSVNIFPESDAMSDVIVGVLDTG  135

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPER SF D G  P+P+SW+ +CE   NF +  CNRK++GAR + RGYE  +G PI   
Sbjct  136   VWPERKSFDDTGFGPVPDSWKGECESSNNFSSAMCNRKLVGARYFSRGYETTLG-PIDES  194

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH AS AAGS V  A++ G+A G ARG+A  AR+A+YKVCWLG C N
Sbjct  195   KESKSPRDDDGHGTHTASTAAGSVVQGASLFGYASGTARGMAYRARVAMYKVCWLGGCFN  254

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+GMD+A+ D V VLSLSL      G    Y +D IAIGAF A++KG++VSC+AGN 
Sbjct  255   SDILAGMDKAIDDKVDVLSLSLG-----GSTPDYYKDSIAIGAFAAMEKGILVSCSAGNA  309

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP+ ++  N APWI TVGA TIDR+FPA V+LGN ++F+G SLY+G       +P+VY G
Sbjct  310   GPNQFSLANQAPWITTVGAGTIDRDFPAYVSLGNGKNFSGVSLYAGDSLLNKMLPLVYAG  369

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C  G L   KV+G+IV C++G  ++ V KG  V +AGG GM++ N    G
Sbjct  370   NASNVTSGNLCMMGTLIPEKVKGKIVLCDRG-ISARVQKGFVVKEAGGAGMVLANTAANG  428

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P A V    G++I++Y+ +   PTA I F GT +   PS P VAAFS RG
Sbjct  429   EELVADAHLLPAAAVGQKAGDVIKKYLFSDPNPTAEILFGGTKVDIEPS-PVVAAFSSRG  487

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPEILKPD+IAPGVNILA WTG++            EFN+ISGTSM+CPHVSGLAA
Sbjct  488   PNSITPEILKPDIIAPGVNILAGWTGAVGPTGMAEDDRRVEFNIISGTSMSCPHVSGLAA  547

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K ++P WSPAAI+SALMT+AYTV  +G G L+D+ T +P+TP  +G+GHVDP  AV+P
Sbjct  548   LIKGVHPEWSPAAIRSALMTSAYTVYKNG-GALVDVATGKPSTPFDHGAGHVDPVSAVNP  606

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF---  2029
             GLVYD   +DY++F+C + Y   +I    R +    C +    +   LNYPSF+V F   
Sbjct  607   GLVYDINADDYLNFMCALKYTPSQINSLARRN--FTCDSSKTYSVTDLNYPSFAVSFVAG  664

Query  2030  KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTP-SNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
              +   T+ Y RT+ NV       Y+VTV +P S+V++ V P  L FT   +  SY V+F 
Sbjct  665   SDGSNTIKYSRTLTNVGPAGT--YKVTVSSPNSSVKIIVEPETLSFTQINEKKSYTVSFT  722

Query  2207  SLRQSA--DSFGSLRWSDGTHLVTSPIAVSW  2293
             +  +S+  D FG + WSDG H+V+SP+A+SW
Sbjct  723   APSKSSATDVFGRIEWSDGKHVVSSPVAISW  753



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/751 (49%), Positives = 496/751 (66%), Gaps = 42/751 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             EE K++I+ M KS+ P  F  H  WY + + ++S       S+E++Y Y++V HGF+ARL
Sbjct  35    EEKKTYIIHMAKSQMPVTFDDHTHWYDASLKSVS------ESAEMIYVYKNVVHGFAARL  88

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG++SVLP+ + +L TTR+P FLGL   S N+ P SD  +D+I+GVLD+
Sbjct  89    TAQEAESLETQPGILSVLPEVIYQLHTTRTPLFLGL-DKSVNIFPESDSMSDVIVGVLDT  147

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPER SF D G  P+P+SW+ +CE   NF +  CNRK++GAR + RGYE  +G PI  
Sbjct  148   GVWPERKSFDDTGFGPVPDSWKGQCESSTNFSSAMCNRKLVGARYFSRGYETTLG-PIDE  206

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH AS AAGS V  A++ G+A G ARG+A +AR+AVYKVCWLG C 
Sbjct  207   SKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYASGTARGMAYHARVAVYKVCWLGGCF  266

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             N+DIL+GMD+A+ D V VLSLSL      G    Y +D IAIGAF A++KG++VSC+AGN
Sbjct  267   NSDILAGMDKAIDDKVDVLSLSLG-----GSTPDYYKDSIAIGAFAAMEKGILVSCSAGN  321

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP+ ++  N APWI TVGA TIDR+FPA V+LGN ++F+G SLY+G       +P+VY 
Sbjct  322   AGPNQFSLSNQAPWITTVGAGTIDRDFPAYVSLGNGKNFSGVSLYAGDSLLNKMLPLVYA  381

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A++      C  G L   KV+G+IV C++G +   V KG  V  AGG GM++ N    
Sbjct  382   GNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGINAR-VQKGFVVKAAGGAGMVLANTAAN  440

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P A V +  G+ +++Y+ +   PTA I   GT +G  PS P VAAFS R
Sbjct  441   GEELVADAHLLPAAAVGLIAGDAVKKYLFSDPNPTAEILIGGTKVGIQPS-PVVAAFSSR  499

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG++            EFN+ISGTSM+CPHVSGLA
Sbjct  500   GPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMAEDDRRVEFNIISGTSMSCPHVSGLA  559

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K ++P WSPAAI+SALMTTAYTV  +G G L+D+ T +P+TP  +G+GHVDP  AV+
Sbjct  560   ALVKGVHPEWSPAAIRSALMTTAYTVYKNG-GALLDVATGKPSTPFDHGAGHVDPVSAVN  618

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD   +DY++F+C + Y   +I    R +    C +    +   LNYPSF+V F  
Sbjct  619   PGLVYDINADDYLNFMCALKYTPSQINSLARRN--FTCDSSKKYSVTDLNYPSFAVSFPA  676

Query  2036  NL--QTVIYKRTVKNVAKVRNVAYQVTVQTP-SNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             +    T+ Y RT+ NV       Y+VTV +P S+V++ V P  + FT   +  SY V+F 
Sbjct  677   DTGSNTIKYSRTLTNVGPAGT--YKVTVSSPNSSVKIIVEPETVSFTQINEKKSYTVSFT  734

Query  2207  --SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               S   S D FG + WSDG H+V+SP+A+SW
Sbjct  735   APSKSSSTDVFGRIEWSDGKHVVSSPVAISW  765



>ref|XP_010088796.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36979.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/757 (51%), Positives = 494/757 (65%), Gaps = 40/757 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P +FIV M K  KP LF++   WY+SII +L P S H   S LLYTYE VA+GF+  L
Sbjct  34    DHPMTFIVHMAKQHKPLLFTSQFHWYNSIIKSL-PHSRHP--SRLLYTYERVANGFAVSL  90

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TPSQA+EL N+PGV+SV+PD   EL  T + +FLGL S  S L PSS+YG DIIIG+LD+
Sbjct  91    TPSQAAELENIPGVLSVMPDEAQELHITHTYRFLGL-SSDSGLWPSSNYGEDIIIGILDT  149

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE--IGKP-  637
             GIWPE  SFSD GL+P+P+SW+  CE   +FPATSCNRKIIGAR++  G+     +G   
Sbjct  150   GIWPEHRSFSDAGLSPVPSSWKGTCETWNDFPATSCNRKIIGARSFLAGHYMSNLVGSTL  209

Query  638   -IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL-G  811
              +     S RD +GHGTH  S AAGS V+NA+    A+G+A GIAT AR+AVYKVC    
Sbjct  210   NLSAITNSPRDTDGHGTHTTSTAAGSVVSNASFYKFAKGKAIGIATKARVAVYKVCATRK  269

Query  812   TCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C  ADIL+GMDQAVADGV +      S S +G   PY +D IAI  FGA++ G++VS +
Sbjct  270   VCRVADILAGMDQAVADGVDI-----ISMSISGGTKPYHQDNIAIATFGAMKNGILVSAS  324

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ-PSRIQVP  1168
              GN GP   T  +L PW+LTVGAS++DREF A V LG  R + GTSLY G + P   +  
Sbjct  325   GGNKGPTRSTVNHLPPWVLTVGASSVDREFVASVILGTGRPYAGTSLYPGPRFPFLSRYE  384

Query  1169  VVYGGSANSFYCFPGQLDAS-KVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
             +V+GG   + +C  G+ +   ++  +I+ CEQ  DTS  D   AV+   G G I+ N   
Sbjct  385   LVHGGDFGNPFCKVGEFNKQDQLVDKIIVCEQDWDTSSRDSAYAVANVSGRGAIIVNNRK  444

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVI-GNSP-SAPRVAAF  1519
              G +L     R P   V ++DG  I +Y+R+ + PTA I F GT I G  P +AP VA+F
Sbjct  445   HGEELLAEPHRWPATRVAMSDGYKIMKYLRSEN-PTATINFYGTWIAGEYPITAPEVASF  503

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL----------TEFNMISGTSMACPHVSG  1669
             S RGPN LTP+ILKPDVIAPG+NILAAW+ ++           EFN+ISGTSMAC HVSG
Sbjct  504   SSRGPNPLTPQILKPDVIAPGLNILAAWSNAIGPWGDDDPRRVEFNIISGTSMACAHVSG  563

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             ++A+LKK+YP+WSPAAIKSALMTTAY +DN G+  L DL  ++ +TP A+GSGHVDP+ A
Sbjct  564   ISALLKKVYPTWSPAAIKSALMTTAYDLDNDGQ-RLRDLAGKR-STPFAHGSGHVDPSRA  621

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLR---NSPLVDCRNRNLG---NPGSLNYP  2011
             +DPGL+YD  V DYV FLC+IGYDS  I+ F     +S + +     LG    PG LN P
Sbjct  622   LDPGLIYDMNVTDYVGFLCSIGYDSTLISKFFTETISSNICEETYAALGGRVTPGDLNVP  681

Query  2012  SFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
             SFS +F+N ++TV Y+RTV NV    +  Y  T   P   ++T+SPNRLVF     T +Y
Sbjct  682   SFSAVFENGVETVKYRRTVTNVGTNVDAVYSATAVAPEGTKITISPNRLVFDANNPTQTY  741

Query  2192  EVTFQSL---RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             E+TF S    R    +FG ++WSDG H V S IA SW
Sbjct  742   EITFSSTGGNRDKLATFGWIQWSDGIHSVRSTIACSW  778



>ref|XP_004954115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/706 (51%), Positives = 475/706 (67%), Gaps = 27/706 (4%)
 Frame = +2

Query  239   LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  418
             +LY+Y+H A G +ARLTP QA+  A   GV++V PD+  +L TT +P FL L   +  L 
Sbjct  75    VLYSYQHAATGIAARLTPEQAAHAAAGEGVLAVYPDQARQLHTTHTPAFLHLTEAAGLLP  134

Query  419   PSSDYGADIIIGVLDSGIWP-ERSSFSD-RGLNPIPNSWRNKCEVGPNFPATS-CNRKII  589
              ++   +  ++GVLD+G++P  R SF+   GL P P S+   C    +F A++ CN K+I
Sbjct  135   AATRGASSAVVGVLDTGLYPIGRGSFAAPAGLGPAPASFSGGCVSTGSFNASAYCNSKLI  194

Query  590   GARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARG  763
             GA+ +Y+GYEA +G PI    E KS  D  GHGTH AS AAGS VA A    +A+G+A G
Sbjct  195   GAKVFYQGYEAALGHPIDETKESKSPLDTEGHGTHTASTAAGSPVAGAGFFDYAKGQAVG  254

Query  764   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIA  943
             +   ARIA YK+CW   C ++DIL+ MD+AVADGV V+SLS+ +    G+A  + +D IA
Sbjct  255   MDAGARIAAYKICWKSGCYDSDILAAMDEAVADGVDVISLSVGAG---GYAPSFFQDSIA  311

Query  944   IGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTG  1123
             IGAF AV KG++VSC+AGN GP  YTA N+APWILTVGASTIDREFPA V LG+ R F G
Sbjct  312   IGAFHAVSKGIVVSCSAGNSGPGEYTATNIAPWILTVGASTIDREFPADVVLGDGRVFGG  371

Query  1124  TSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVS  1303
              SLY+G   +  Q+P+V+ G   S  C  G+LD  KV G+IV CE+G  T+ V+KG AV 
Sbjct  372   VSLYAGDPLNSTQLPLVFAGDCGSRLCLLGELDPKKVAGKIVLCERG-KTARVEKGAAVK  430

Query  1304  QAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVI  1483
              AGG GMI+ N    G +L  ++  +P  +V    G+ I+ YV+T   PTA I F+GTVI
Sbjct  431   LAGGAGMILANTEASGEELVADSHLVPATMVGQKFGDKIKYYVQTDPSPTATIVFRGTVI  490

Query  1484  GNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNM  1630
             G SPSAPRVA+FS RGPN+   EILKPDVIAPGVNILAAWTG+ +           EFN+
Sbjct  491   GKSPSAPRVASFSSRGPNYRAREILKPDVIAPGVNILAAWTGAASPTDLDIDSRRVEFNI  550

Query  1631  ISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTP  1810
             ISGTSM+CPHVSGLAA+L++ +P WSPAAIKSALMTTAY +DNSG  T+ DL T   +TP
Sbjct  551   ISGTSMSCPHVSGLAALLRQAHPDWSPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTP  609

Query  1811  HAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGN  1990
                G+GHVDP  A+DPGLVYDAG +DYV FLCT+GY    I++F ++S + DC +R    
Sbjct  610   FVRGAGHVDPNSALDPGLVYDAGTDDYVAFLCTLGYPPSLISIFTKDSSVADC-SRKFAR  668

Query  1991  PGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTD  2170
              G LNYP+F+ +F +   +V Y R V+NV    +  Y+  + +PS V VTVSP++LVF D
Sbjct  669   SGDLNYPAFAAVFSSYKDSVTYHRVVRNVGSNSSAVYESKIVSPSGVDVTVSPSKLVFDD  728

Query  2171  RIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +  +L+YE+T        +  +  SFGS+ WSDG H VTSPIAV+W
Sbjct  729   KNRSLAYEITIAVSGNPVIVDAKYSFGSISWSDGVHNVTSPIAVTW  774



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/708 (52%), Positives = 477/708 (67%), Gaps = 30/708 (4%)
 Frame = +2

Query  239   LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  418
             +LY+Y+H A G +ARLTP QA+  A   GV++V PD+  +L TT +P FL L   ++ L 
Sbjct  74    VLYSYQHAATGIAARLTPQQAAHAAAGEGVLAVYPDQARQLHTTHTPAFLRLTE-AAGLL  132

Query  419   PSSDYGAD--IIIGVLDSGIWP-ERSSFSDR-GLNPIPNSWRNKCEVGPNFPATS-CNRK  583
             P++  GA    ++GVLD+G++P  RSSF+   GL P P S+   C    +F A++ CN K
Sbjct  133   PAATGGASSSAVVGVLDTGLYPIGRSSFAAADGLGPAPASFSGGCVSAGSFNASAYCNSK  192

Query  584   IIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEA  757
             +IGA+ +Y+GYEA +G PI    E KS  D  GHGTH AS AAGS VA A    +A G+A
Sbjct  193   LIGAKFFYQGYEAALGHPIDETKESKSPLDTEGHGTHTASTAAGSPVAGAGFFDYAEGQA  252

Query  758   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDL  937
              G+   ARIA YK+CW   C ++DIL+ MD+AVADGV V+SLS+ +    G+A  +  D 
Sbjct  253   VGMDPGARIAAYKICWTSGCYDSDILAAMDEAVADGVDVISLSVGAN---GYAPSFFTDS  309

Query  938   IAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSF  1117
             IAIGAF AV KG++VSC+AGN GP  YTAVN+APWILTVGASTIDREFPA V LG+ R F
Sbjct  310   IAIGAFHAVSKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDREFPADVVLGDGRVF  369

Query  1118  TGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVA  1297
              G SLY+G      Q+P+V+ G   S  C  G+LD+ KV G++V C +G++   V+KG A
Sbjct  370   GGVSLYAGDPLDSTQLPLVFAGDCGSPLCLMGELDSKKVAGKMVLCLRGNNAR-VEKGAA  428

Query  1298  VSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGT  1477
             V  AGGVGMI+ N    G +L  ++  +P  +V    G+ IR YV+T   PTA I F+GT
Sbjct  429   VKLAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTDPSPTATIVFRGT  488

Query  1478  VIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EF  1624
             VIG S SAPRVAAFS RGPN+  PEILKPDVIAPGVNILAAWTG+ +           EF
Sbjct  489   VIGKSRSAPRVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASPTDLDIDSRRVEF  548

Query  1625  NMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPT  1804
             N+ISGTSM+CPHVSGLAA+L++ +P WSPAAIKSALMTTAY +DNSG  T+ DL T   +
Sbjct  549   NIISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALMTTAYNLDNSGE-TIKDLATGVES  607

Query  1805  TPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNL  1984
             TP   G+GHVDP  A+DPGLVYDAG +DYV FLCT+GY    I++F +++ + DC  +  
Sbjct  608   TPFVRGAGHVDPNAALDPGLVYDAGSDDYVAFLCTLGYSPSLISIFTQDASVADCSTK-F  666

Query  1985  GNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVF  2164
               PG LNYP+F+ +F +   +V Y+R V+NV    +  YQ T+ +P  V VTV+P++L F
Sbjct  667   ARPGDLNYPAFAAVFSSYQDSVTYRRVVRNVGSNSSAVYQPTIASPYGVDVTVTPSKLAF  726

Query  2165  TDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               +  +L YE+T        +  S+ SFGS+ WSDG H VTSPIAV+W
Sbjct  727   DGKQQSLGYEITIAVSGNPVIVDSSYSFGSITWSDGAHDVTSPIAVTW  774



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/760 (49%), Positives = 488/760 (64%), Gaps = 51/760 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
             EE K++I+ M KS+ P  F+  H  WY S + ++S       S+E+LY Y +V HGFSAR
Sbjct  33    EEKKTYIIHMAKSQMPATFNDDHAHWYDSSLKSVS------DSAEMLYVYNNVVHGFSAR  86

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LTP +A  L   PG++SVLP+   +L TTR+P FLGL  G+ +  P SD  +D+IIGVLD
Sbjct  87    LTPQEAESLETQPGILSVLPELKYQLHTTRTPTFLGLDKGA-DFFPESDAMSDVIIGVLD  145

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +G+WPE  SF D GL P+P SW+ +CE G NF +++CNRK+IGAR + RGYE  +G PI 
Sbjct  146   TGVWPESKSFDDTGLGPVPASWKGQCESGTNFSSSNCNRKLIGARYFSRGYETTLG-PID  204

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KSARD +GHGTH ++ A GS V  A++ G+A G ARG+AT AR+AVYKVCW+G C
Sbjct  205   ESRESKSARDDDGHGTHTSTTAGGSVVQGASLFGYAPGTARGMATRARVAVYKVCWVGGC  264

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ MD+A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AG
Sbjct  265   FSSDILAAMDKAIDDNVNVLSLSLG-----GGISDYYRDSVAIGAFAAMEKGILVSCSAG  319

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP PY+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G   S   +P V+
Sbjct  320   NAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGNSLSNKMLPFVF  379

Query  1178  GGSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              G+A    N   C  G L   KV+G+IV C++G +   V KG  V  AGG GM++ N   
Sbjct  380   AGNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGINAR-VQKGSVVKAAGGAGMVLTNTAA  438

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  +A  +P   V    G+ IR Y+ + S P A I F+GT +G  PS P VAAFS 
Sbjct  439   NGEELVADAHLLPATAVGQKTGDAIRDYLTSDSNPMATILFEGTKVGIEPS-PVVAAFSS  497

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGS-----LTE------FNMISGTSMACPHVSGL  1672
             RGPN +TPEILKPD+IAPGVNILA WTG+     L E      FN+ISGTSM+CPHVSGL
Sbjct  498   RGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGLEEDDRRVGFNIISGTSMSCPHVSGL  557

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK  +P WSPAAI+SALMTTAYT   +G G + D+ T +P+T   +G+GHVDP  A+
Sbjct  558   AALLKGAHPEWSPAAIRSALMTTAYTAYKNG-GAIQDVSTGKPSTLFDHGAGHVDPVSAL  616

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF-  2029
             +PGLVYD   +DY+DFLC + Y   +I    R +    C      +   LNYPSF+V F 
Sbjct  617   NPGLVYDITADDYLDFLCALNYTPSQINSLARRN--FTCNESKKYSVTDLNYPSFAVSFP  674

Query  2030  --------KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDT  2182
                          ++ Y RT+ NV       Y+VTV +PSN V++ V P  L F+   + 
Sbjct  675   AESAARTGSAGSSSIKYSRTLTNVGPAGT--YKVTVTSPSNSVKIMVEPETLSFSQMNEK  732

Query  2183  LSYEVTFQSLRQSADS---FGSLRWSDGTHLVTSPIAVSW  2293
              SY VTF +   S+ +   FG + WSD  H+V SP+A+SW
Sbjct  733   KSYTVTFTAPSMSSSTTNVFGRIEWSDEKHVVGSPVAISW  772



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/759 (49%), Positives = 490/759 (65%), Gaps = 51/759 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + K++I+ M KS+ P  F+  H  WY S + ++S       S+E+LY Y +V HGFSARL
Sbjct  34    KKKTYIIHMAKSQMPATFNDDHTHWYDSSLRSVS------DSAEMLYVYNNVIHGFSARL  87

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +A  L   PG++SVLP+   +L TTR+P FLGL   S++  P SD  +D+IIGVLD+
Sbjct  88    TPQEAESLETQPGILSVLPELKYQLHTTRTPTFLGL-DKSADFFPESDAMSDVIIGVLDT  146

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL PIP SW+ +CE G NF +++CNRK+IGAR + RGYE  +G PI  
Sbjct  147   GVWPESKSFDDSGLGPIPASWKGQCESGTNFSSSNCNRKLIGARYFSRGYETTLG-PIDE  205

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH ++ A GS V  A++ G+A G ARG+AT AR+AVYKVCW+G C 
Sbjct  206   SKESKSPRDDDGHGTHTSTTAGGSVVQGASLFGYAPGTARGMATRARVAVYKVCWVGGCF  265

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN
Sbjct  266   SSDILAAMDKAIDDNVNVLSLSLG-----GGISDYYRDSVAIGAFAAMEKGILVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PY+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY 
Sbjct  321   AGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGNSLPNKMLPFVYA  380

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGM++ N    
Sbjct  381   GNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGINAR-VQKGSVVKAAGGVGMVLTNTAAN  439

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ IR Y+ + S PTA I F+GT +G  PS P VAAFS R
Sbjct  440   GEELVADAHLLPATAVGQKTGDAIRDYLTSDSNPTATILFEGTKVGIEPS-PVVAAFSSR  498

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGS-----LTE------FNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG+     L E      FN+ISGTSM+CPHVSGLA
Sbjct  499   GPNSITPEILKPDIIAPGVNILAGWTGAVGPTGLEEDDRRVGFNIISGTSMSCPHVSGLA  558

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAYT   +G G + D+ T +P+TP  +G+GHVDP  A++
Sbjct  559   ALLKGAHPEWSPAAIRSALMTTAYTAYKNG-GAIQDVSTGKPSTPLDHGAGHVDPVSALN  617

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF--  2029
             PGLVYD   +DY++FLC + Y   +I+   R +    C      +   LNYPSF+V F  
Sbjct  618   PGLVYDITTDDYLNFLCALNYTPSQISSLARRN--FTCNESKKYSVTDLNYPSFAVSFPA  675

Query  2030  -------KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTP-SNVRVTVSPNRLVFTDRIDTL  2185
                         ++ Y R + NV       Y+VTV +P S+V++TV P  L F+   +  
Sbjct  676   ESAARTGSAGSSSIKYSRMLTNVGPAGT--YKVTVTSPTSSVKITVEPETLSFSQMNEKK  733

Query  2186  SYEVTFQSLRQSADS---FGSLRWSDGTHLVTSPIAVSW  2293
             SY VTF +   S+ +   FG + WSDG H+V SP+A+SW
Sbjct  734   SYTVTFTAPSMSSSTTNVFGRIEWSDGKHVVGSPLAISW  772



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/756 (49%), Positives = 494/756 (65%), Gaps = 47/756 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV + KS+ P+ F  H  WY S + ++S       S+E+LY Y +V HGFSARLT
Sbjct  31    KKSTYIVHVAKSQMPESFEDHKHWYDSSLKSVS------DSAEMLYVYNNVVHGFSARLT  84

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L    G++SVLP+   EL TTR+P FLGL   S++  P S+  +D+++GVLD+G
Sbjct  85    IQEAESLERQSGILSVLPELRYELHTTRTPSFLGL-DRSADFFPESNAMSDVVVGVLDTG  143

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVG  646
             +WPE  SF D GL PIP+SW+ +CE G NF +++CNRK+IGAR + +GYE  +G   +  
Sbjct  144   VWPESKSFDDTGLGPIPDSWKGECESGTNFSSSNCNRKLIGARYFSKGYETTLGPVDVSK  203

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KSARD +GHGTH A+ AAGS V  A++ G+A G ARG+AT AR+AVYKVCW+G C ++
Sbjct  204   ESKSARDDDGHGTHTATTAAGSVVQGASLFGYASGTARGMATRARVAVYKVCWIGGCFSS  263

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MD+A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN G
Sbjct  264   DILAAMDKAIDDNVNVLSLSLG-----GGNSDYYRDSVAIGAFAAMEKGILVSCSAGNAG  318

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P PY+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY G+
Sbjct  319   PSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGDLSLSKMLPFVYAGN  378

Query  1187  A----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             A    N   C  G L   KV+G+IV C++G +   V KG  V +AGGVGM++ N    G 
Sbjct  379   ASNTTNGNLCMTGTLIPEKVKGKIVLCDRGINPR-VQKGSVVKEAGGVGMVLANTAANGD  437

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  +P   V    GE I++Y+ +   PTA I F+GT +G  PS P VAAFS RGP
Sbjct  438   ELVADAHLLPATTVGQTTGEAIKKYLTSDPNPTATILFEGTKVGIKPS-PVVAAFSSRGP  496

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGS-----LTE------FNMISGTSMACPHVSGLAAM  1681
             N +T EILKPD+IAPGVNILA WTG+     L E      FN+ISGTSM+CPHVSGLAA+
Sbjct  497   NSITQEILKPDIIAPGVNILAGWTGAVGPTGLAEDTRRVGFNIISGTSMSCPHVSGLAAL  556

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             LK  +P WSPAAI+SALMTTAYTV  +G G L D+ T +P+TP  +G+GHVDP  A++PG
Sbjct  557   LKGAHPDWSPAAIRSALMTTAYTVYKNG-GALQDVSTGKPSTPFDHGAGHVDPVAALNPG  615

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             LVYD   +DY++FLC + Y S +I    R +   +C      +   LNYPSF+V+F   +
Sbjct  616   LVYDLRADDYLNFLCALNYTSIQINSIARRN--YNCETSKKYSVTDLNYPSFAVVFPEQM  673

Query  2042  QT--------VIYKRTVKNVAKVRNVAYQV-TVQTPSN-VRVTVSPNRLVFTDRIDTLSY  2191
                       V Y RT+ NV       Y+V TV +PSN V+V+V P  LVFT   +  SY
Sbjct  674   TAGSGSSSSSVKYTRTLTNVGPAGT--YKVSTVFSPSNSVKVSVEPETLVFTRANEQKSY  731

Query  2192  EVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              VTF   S+  + + +G + WSDG H+V SP+A+SW
Sbjct  732   TVTFTAPSMPSTTNVYGRIEWSDGKHVVGSPVAISW  767



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/752 (48%), Positives = 484/752 (64%), Gaps = 46/752 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             +FI+ M KS+ P+ F  H  WY S + ++S       S+E+LY Y +  HGF+ARLTP +
Sbjct  37    NFIIHMAKSQMPEGFEDHTHWYDSSLRSVS------ASAEMLYVYNNAVHGFAARLTPEE  90

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L N PG++SVLP+   EL TTR+P FLGL   S++  P S+   D+I+GVLD+G+WP
Sbjct  91    AESLQNQPGILSVLPEMKYELHTTRTPLFLGL-DVSADYFPESNAMGDVIVGVLDTGVWP  149

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVGEPK  655
             E  SF D G  PIP SW+ +CE G NF + +CNRK+IGAR + +GYE+ +G   +  E K
Sbjct  150   ESKSFDDNGFGPIPASWKGECESGTNFTSKNCNRKLIGARYFAKGYESTLGPIDVSKESK  209

Query  656   SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADIL  835
             S RD +GHGTH ++ AAGS V  A++ G+A G ARG+AT+AR+AVYKVCW+G C ++DIL
Sbjct  210   SPRDDDGHGTHTSTTAAGSVVQGASLLGYASGNARGMATHARVAVYKVCWVGGCFSSDIL  269

Query  836   SGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDP  1015
             +G+D+A+ D V+VLSLSL      G    Y  D IAIGAF A++KG++VSC+AGN GP P
Sbjct  270   AGLDKAIDDNVNVLSLSLG-----GGNSDYYRDSIAIGAFAAMEKGILVSCSAGNAGPSP  324

Query  1016  YTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA--  1189
             Y+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY G+A  
Sbjct  325   YSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGDSSLSKMLPFVYAGNASN  384

Query  1190  --NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
               N   C  G L   +V+G+IV C++G +   V KG  V  AGG GM++ N    G +L 
Sbjct  385   MTNGNLCMTGTLIPEEVKGKIVLCDRGINPR-VQKGSVVKAAGGAGMVLANTAANGDELI  443

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              +A  IP   V    GE I++Y+ +   PTA I F+GT +G  PS P VAAFS RGPN +
Sbjct  444   ADAHLIPATSVGQTTGEAIKKYLTSDPNPTATILFEGTKVGIKPS-PVVAAFSSRGPNSI  502

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             T EILKPD+IAPGVNILA WTG+             EFN+ISGTSM+CPHVSGLAA+LK 
Sbjct  503   TQEILKPDIIAPGVNILAGWTGAAGPTGLAEDDRRVEFNIISGTSMSCPHVSGLAALLKG  562

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              +P WSPAAI+SALMTTAYTV   G G L D+ T +P+TP  +G+GHVDP  A++PGLVY
Sbjct  563   AHPDWSPAAIRSALMTTAYTVYKKG-GALQDVVTGKPSTPFDHGAGHVDPVAALNPGLVY  621

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT-  2047
             D   +DY++FLC + Y S +I    R      C      +   LNYPSF+V+F   +   
Sbjct  622   DLKADDYLNFLCALNYTSIQINSVARRP--FSCETSKKFSVADLNYPSFAVVFPEQMTAS  679

Query  2048  -------VIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTF  2203
                    + + RT+ NV       Y+V V +PSN V+V V P  L FT   +  SY VTF
Sbjct  680   SGSGSSSIKHTRTLTNVGPAGT--YKVNVISPSNSVKVVVEPEILAFTRMNEQKSYTVTF  737

Query  2204  Q--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                S+  + + +  + WSDG H+V+SP+A+SW
Sbjct  738   TAPSMPSTENVYARIEWSDGKHIVSSPVAISW  769



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/751 (49%), Positives = 489/751 (65%), Gaps = 44/751 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             EE K++I+ M KS+ P  F  H  WY + + ++S       S+E++Y Y +V HGF+ARL
Sbjct  34    EEKKTYIIHMAKSQMPATFDDHTHWYDASLKSVS------ESAEMIYVYNNVIHGFAARL  87

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG++SVL + + +L TTR+P FLGL     ++   SD  +++IIG+LDS
Sbjct  88    TAQEAESLKTQPGILSVLSEVIYQLHTTRTPLFLGL-DNRPDVFNDSDAMSNVIIGILDS  146

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPER SF D GL P+P SW+ +CE G NF +  CNRK+IGAR +  GYEA +G PI  
Sbjct  147   GIWPERRSFDDTGLGPVPESWKGECESGINFSSAMCNRKLIGARYFSSGYEATLG-PIDE  205

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD  GHGTH AS AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C 
Sbjct  206   SKESKSPRDNEGHGTHTASTAAGSVVQGASLFGYASGTARGMAYRARVAVYKVCWLGKCF  265

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
               DIL+GMD+A+ D V+VLSLSL      G    +  D +AIGAF A++KG++VSC+AGN
Sbjct  266   GPDILAGMDKAIDDNVNVLSLSLG-----GEHFDFYSDDVAIGAFAAMEKGIMVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP+ ++  N APWI TVGA T+DR+FPA V+LGN ++F+G SLY+G       +P+VY 
Sbjct  321   AGPNQFSLANQAPWITTVGAGTVDRDFPAYVSLGNGKNFSGVSLYAGDPLPSGMLPLVYA  380

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV+G+IV C+ G +    +KG  V  AGG GMI  N    
Sbjct  381   GNASNATNGNLCIMGTLIPEKVKGKIVLCDGGVNVR-AEKGYVVKSAGGAGMIFAN--TN  437

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G  L  +A  +P A V   DG+ I++Y+ +   PTA I F GT++G  P AP +AAFS R
Sbjct  438   GLGLLADAHLLPAAAVGQLDGDEIKKYITSDPNPTATILFGGTMVGVQP-APILAAFSSR  496

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA W+G++            EFN+ISGTSM+CPHVSGLA
Sbjct  497   GPNSITPEILKPDIIAPGVNILAGWSGAVGPTGLPEDDRRVEFNIISGTSMSCPHVSGLA  556

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK ++P WSPAAI+SALMTTAYT   +G G L+D+ T +P+TP  +G+GHVDP  AV+
Sbjct  557   ALLKGVHPEWSPAAIRSALMTTAYTTYRNG-GALLDVATGKPSTPFGHGAGHVDPVSAVN  615

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD   +DY++FLC + Y   +I +  R +    C +  + +   LNYPSFSV F  
Sbjct  616   PGLVYDINADDYLNFLCALKYSPSQINIIARRN--FTCDSSKIYSVTDLNYPSFSVAFPA  673

Query  2036  NL--QTVIYKRTVKNVAKVRNVAYQVTVQTP-SNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             +    T+ Y RT+ NV    +  Y+V V  P S+V + V P  + FT   + +SY V+F 
Sbjct  674   DTGSNTIRYSRTLTNVGP--SGTYKVAVTLPDSSVEIIVEPETVSFTQINEKISYSVSFT  731

Query  2207  SLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
             +  +  S + FG + WSDGTHLVTSP+A+SW
Sbjct  732   APSKPPSTNVFGKIEWSDGTHLVTSPVAISW  762



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/749 (49%), Positives = 488/749 (65%), Gaps = 41/749 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E K++IV M K + P+ F  H  WY S + ++S       S+E+LYTY +V HGFS RLT
Sbjct  23    EKKTYIVHMAKFQMPESFEEHTHWYDSSLKSVS------DSAEMLYTYNNVIHGFSTRLT  76

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PG++ VLP+   EL TTR+P+FLGL   +  L P SD  +++++GVLD+G
Sbjct  77    DEEAKLLEGRPGILLVLPEVRYELHTTRTPEFLGL-DKNDGLFPQSDSASEVVVGVLDTG  135

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D+GL PIP+ W+ +CEVG NF A++CNRK+IGAR + RGYEA +G PI   
Sbjct  136   VWPESLSFDDKGLGPIPSGWKGECEVGKNFNASNCNRKLIGARFFSRGYEATLG-PIDET  194

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH ++ AAGS V  A++ G+A G ARG+AT+AR+AVYKVCW+G C +
Sbjct  195   KESRSPRDDDGHGTHTSTTAAGSVVDGASLFGYAAGAARGMATHARVAVYKVCWIGGCFS  254

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             ADIL+ MD+AV DGV+VLS+SL      G    Y  D +AIGAF A+++G++VSC+AGN 
Sbjct  255   ADILAAMDKAVDDGVNVLSMSLG-----GGMSDYFRDSVAIGAFTAMERGILVSCSAGNA  309

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  Y+  N+APWI TVGA T+DR+FPA VTLGN ++F+G SLY G      Q+  VY G
Sbjct  310   GPSSYSLSNVAPWITTVGAGTLDRDFPAYVTLGNGKNFSGVSLYGGKPLPDSQLTFVYAG  369

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A +      C  G L   KV G+IV C++G +   V KG  V QAGG GMI+ N    G
Sbjct  370   NATNVTSGNLCMIGTLIPEKVAGKIVLCDRGVNAR-VQKGSVVKQAGGAGMILANTAANG  428

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    G++I+ Y+ +   PTA I F GT +G  PS P VAAFS RG
Sbjct  429   EELVADAHLLPATAVGQKTGDMIKNYLFSDPNPTATIIFGGTKLGIQPS-PVVAAFSSRG  487

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPEILKPD+IAPGVNILA W+G++             FN+ISGTSM+CPHVSGLAA
Sbjct  488   PNSITPEILKPDLIAPGVNILAGWSGAVGPTGLAVDSRRVGFNIISGTSMSCPHVSGLAA  547

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAIKSALMTT+YT   S    + D+ T +P+TP  +G+GHVDP  A+DP
Sbjct  548   LLKAAHPEWSPAAIKSALMTTSYTTYKSSE-KIQDVATGKPSTPFDHGAGHVDPVAALDP  606

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKI-ALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF-K  2032
             GLVYD  V+DY+DFLC + Y S +I +L  RN    + +  ++ +   LNYPSF+V F +
Sbjct  607   GLVYDITVDDYLDFLCALKYTSLQIGSLAKRNFTCDESKKYSVTD---LNYPSFAVSFTQ  663

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--  2206
                 TV Y RT+ NV         V+ QT + V++ V P+ L F+   +  ++ VTF   
Sbjct  664   GGTTTVKYTRTLTNVGTPGTYKVSVSSQTET-VKILVEPDTLSFSQPNEKKTFTVTFSGG  722

Query  2207  SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             SL     SF  L WSDG H+V SPIA SW
Sbjct  723   SLPSGTTSFARLEWSDGKHIVGSPIAFSW  751



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/755 (49%), Positives = 486/755 (64%), Gaps = 42/755 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+ +++IV M KS +P  F+ H  WY + + ++S       S+E+LY+Y+ VAHGFSARL
Sbjct  30    EKRQTYIVHMAKSRRPSTFAEHGHWYDASLRSVS------SSAEILYSYDTVAHGFSARL  83

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T ++A  L ++ GV+SVLP+   EL TTR+P+FLGL   S +L P ++ G+D+++GVLD+
Sbjct  84    TTAEAQALESLDGVLSVLPEVRYELHTTRTPEFLGL-DKSDDLVPQANTGSDVVVGVLDT  142

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPER SF D G  P+P  W+  CE G +F AT CNRK+IGAR + +GYEA +G PI  
Sbjct  143   GVWPERKSFDDAGFGPVPAGWKGACEEGKDFKATDCNRKLIGARFFSKGYEASMG-PIDE  201

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH ++ AAGSAV +A++ G A G ARG+AT AR+A YKVCW+G C 
Sbjct  202   TRELRSPRDSDGHGTHTSTTAAGSAVTDASLLGFAAGTARGMATRARVAAYKVCWVGGCF  261

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ +D+AV DG HVLSLSL      G    Y  D +AIGAF A++KGV+VSC+AGN
Sbjct  262   SSDILAAIDRAVDDGCHVLSLSLG-----GGMSDYYRDSVAIGAFNAMEKGVLVSCSAGN  316

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APWI TVGA T+DR+FPA V LGN ++++G SLYSG       +P+VY 
Sbjct  317   SGPSASSLSNVAPWITTVGAGTLDRDFPAYVVLGNGKNYSGVSLYSGKPLPSSPLPIVYA  376

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A++      C PG L   KV G+IV CE+G  +  V KG  V  AGG GMI+ N    
Sbjct  377   GNASNATGGNLCMPGTLMPEKVAGKIVLCERGI-SPRVQKGYVVRDAGGAGMILANTDAN  435

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I++Y+ +   PTA I F GT +G  PS P VAAFS R
Sbjct  436   GEELVADAHLLPANGVGEKAGDAIKRYLLSEMSPTATIVFGGTKVGVRPS-PVVAAFSSR  494

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG++            EF++ISGTSM+CPHVSGLA
Sbjct  495   GPNVVTPEILKPDLIAPGVNILAGWTGAVGPTGLSVDSRRVEFSIISGTSMSCPHVSGLA  554

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY     G G ++D+ T +  TP  YG+GHVDP   +D
Sbjct  555   ALLKGAHPDWSPAAIRSALMTTAYADYPGGNGGVLDVATGKAATPFDYGAGHVDPRRGMD  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD   +DY+DFLC + Y S +IA   + +     R R     G LNYPSF+V F+ 
Sbjct  615   PGLVYDLTADDYIDFLCALNYTSLQIAAVAKRTNYTCDRKRTYAVSG-LNYPSFAVAFET  673

Query  2036  NLQTVIYKRTVKNVAKVRNVA----YQVTVQTP---SNVRVTVSPNRLVFTDRIDTLSYE  2194
                  +   TVK+   + +V     Y+ TV T      V+V V P  L FT   +  SY 
Sbjct  674   ASGDRVGVATVKHTRTMTSVGGPGTYKATVATAVTGGEVKVAVEPAELSFTKVGEKQSYT  733

Query  2195  VTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             V+F   SL   +  FG L WSDG H+V SPIA +W
Sbjct  734   VSFSAPSLPSGSSGFGRLEWSDGKHVVASPIAFTW  768



>emb|CDP15538.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/759 (50%), Positives = 483/759 (64%), Gaps = 69/759 (9%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV++ +S KP   ++HHDW+SSI   L  +      ++LLY+YEH  HGF+ARL PS
Sbjct  33    KTYIVYVSESAKPPFNTSHHDWHSSI---LRNVYYDLPKTKLLYSYEHAIHGFAARLIPS  89

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA EL + PG++SV+PD + +LQTTRS QFLGL + SS + P+++YG DIIIG+LD+GI 
Sbjct  90    QAEELRHQPGILSVIPDSISQLQTTRSLQFLGL-ADSSGIWPNTNYGEDIIIGILDTGIR  148

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             P+  SFSD GL+P+P+SWR  CE   +FP+ SCNRK+IGAR+YY GYE  + + +  +GE
Sbjct  149   PDHPSFSDAGLSPVPSSWRGGCETAVDFPSGSCNRKLIGARSYYGGYEESMRRSLEEMGE  208

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS  D +GHGTH AS AAGS V +A    +A GEA+G+A  ARIA YKVCW G C ++D
Sbjct  209   FKSPTDYDGHGTHTASTAAGSVVRSAGFYEYATGEAKGVAIKARIAAYKVCWRGGCFDSD  268

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ ++QA++DGVHVLSLSL        A PYDED IAI AF A ++G++ S +AGN GP
Sbjct  269   ILAAVNQAISDGVHVLSLSLGRSP----ARPYDEDPIAIAAFHAAERGILTSASAGNSGP  324

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                T  N+APWIL+VGASTIDREF A V LG+ R+  G SLY G       +P+      
Sbjct  325   SYGTVTNVAPWILSVGASTIDREFQADVVLGDGRTLLGVSLYHGNPLVNALLPL------  378

Query  1190  NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPN  1369
                               IV C+ G DT  V KG AV  AGGVGMI+ N      +L   
Sbjct  379   ------------------IVVCDVGGDTKGVAKGYAVHLAGGVGMILANTEERMEELMLE  420

Query  1370  ADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTP  1549
             A  IP   V + +G II+ Y+R+   PTA I F+GTV G +  APRV  FS RGPN +T 
Sbjct  421   AHLIPATKVGITNGNIIKSYIRSQFAPTATIIFRGTVAGFTIWAPRVGVFSSRGPNVITQ  480

Query  1550  EILKPDVIAPGVNILAAWT---------GSL----TEFNMISGTSMACPHVSGLAAMLKK  1690
             EILKPDVIAPGV ILAAW+         G++     +FN+ISGTSMACPHVSG+AA+L+K
Sbjct  481   EILKPDVIAPGVYILAAWSKFANPSGFDGNIDKRRVDFNIISGTSMACPHVSGIAALLRK  540

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
               P WSPAAIKSA+MTTA  VDN+GR  ++D  T   +TP A+GSGHVDP  A++PGLVY
Sbjct  541   ARPYWSPAAIKSAIMTTANNVDNNGR-NIVDRATDVASTPFAHGSGHVDPNKALNPGLVY  599

Query  1871  DAG------------VNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
             D G            + DYV FLC+IGY   +IA+F+ N P   CR      PG LNYPS
Sbjct  600   DMGTRAAIKRYQLKLLGDYVQFLCSIGYTPARIAVFVSNPP-ESCRPGI--TPGDLNYPS  656

Query  2015  FSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
             FSV+F      V + R V+NV       Y V    P  V V V+P +L F    DTL+Y+
Sbjct  657   FSVVFSRQRTVVTHTRRVRNVESTAAAVYTVRWNAPKFVEVKVTPYKLAFDQYSDTLTYQ  716

Query  2195  VTF-----QSLRQSADSFGSLRWSDG-THLVTSPIAVSW  2293
             VTF     +++  +  +FG L W DG  H+V SPIAV W
Sbjct  717   VTFTSAAIETIGDTTSAFGYLEWIDGQQHIVRSPIAVLW  755



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/706 (51%), Positives = 476/706 (67%), Gaps = 27/706 (4%)
 Frame = +2

Query  239   LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  418
             +LY+Y+H A G +ARLTP QA+  A   GV++V PD++ +L TT +P FLGL   +  L 
Sbjct  79    VLYSYQHAATGIAARLTPEQAAHAAAGEGVLAVYPDKVRQLHTTHTPSFLGLTETAGLLP  138

Query  419   PSSDYGADIIIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPNFPATS-CNRKII  589
              ++   +  ++GVLD+G++P  R SF+   GL P P S+   C    +F A++ CN K+I
Sbjct  139   AAAGGASSAVVGVLDTGLYPIGRGSFAATAGLGPPPASFSGGCVSAASFNASAYCNSKLI  198

Query  590   GARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARG  763
             GA+ +Y+GYEA +G PI    E KS  D  GHGTH AS AAGS V  A    +A+G+A G
Sbjct  199   GAKFFYQGYEAGLGHPIDETKESKSPLDTEGHGTHTASTAAGSPVPGAGFFDYAKGQAVG  258

Query  764   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIA  943
             +   ARIAVYK+CW   C ++DIL+ MD+AVADGV V+SLS+ +    G+A  +  D IA
Sbjct  259   MDPGARIAVYKICWASGCYDSDILAAMDEAVADGVDVISLSVGAN---GYAPRFYTDSIA  315

Query  944   IGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTG  1123
             IGAF AV+KG++VSC+AGN GP  YTAVN+APWILTVGASTIDREFPA V LG+ R F G
Sbjct  316   IGAFHAVRKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDREFPADVVLGDGRVFGG  375

Query  1124  TSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVS  1303
              SLY+G      Q+P+V+ G   S  C  G+LD  KV G+IV C +G++   V+KG AV 
Sbjct  376   VSLYAGDPLDSTQLPLVFAGDCGSRLCLIGELDPKKVAGKIVLCLRGNNAR-VEKGAAVK  434

Query  1304  QAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVI  1483
              AGGVGMI+ N    G +L  ++  +P  +V    G+ IR YV+T   PTA I F+GTVI
Sbjct  435   LAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTDPSPTATIMFRGTVI  494

Query  1484  GNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNM  1630
             G SPSAP+VAAFS RGPN+  PEILKPDVIAPGVNILAAWTG+ +           EFN+
Sbjct  495   GKSPSAPQVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASPTDLDIDTRRVEFNI  554

Query  1631  ISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTP  1810
             ISGTSM+CPHVSGLAA+L++ +P WSPAAIKSALMTTAY +DNSG  T+ DL T   +TP
Sbjct  555   ISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTP  613

Query  1811  HAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGN  1990
                G+GHVDP  A+DPGLVYDAG++DYV FLCT+GY    I++F ++  + +C +R    
Sbjct  614   FVRGAGHVDPNAALDPGLVYDAGIDDYVAFLCTLGYSPSLISIFTQDGSVANC-SRKFAR  672

Query  1991  PGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTD  2170
              G LNYP+F+ +F +   +V Y R V+NV    +  Y+  + +PS V VTVSP++LVF  
Sbjct  673   SGDLNYPAFAAVFSSYQDSVTYHRVVRNVGSNSSAVYEPKIVSPSGVDVTVSPSKLVFDG  732

Query  2171  RIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +  +L YE+T        +   + SFGS+ WSDG H VTSPIAV+W
Sbjct  733   KQQSLGYEITIAVSGNPVIVDVSYSFGSITWSDGAHDVTSPIAVTW  778



>ref|XP_010111995.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32306.1| Subtilisin-like protease [Morus notabilis]
Length=733

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/695 (51%), Positives = 473/695 (68%), Gaps = 32/695 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             + P +FIV M KS++P +F     WY+SII +L P S H   S++LY YE VA+GF+A L
Sbjct  34    DRPMTFIVHMAKSQRPSVFPPPRQWYTSIIESLPP-SRHP--SKILYAYEKVANGFAASL  90

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
               SQA +L N+ G++SV+PD   +LQ T + +FLGL +    + P S+YG D+IIGVLD+
Sbjct  91    NLSQAEKLKNIHGILSVMPDESHQLQITHTYKFLGLPT-RPGIWPYSNYGEDVIIGVLDT  149

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE----IGK  634
             GIWP+  SFSD+GL+P+P +W+ KCE   +F A+ CNRK+IGARA+  GY        G 
Sbjct  150   GIWPQHRSFSDKGLSPVPKTWKGKCETWDDFLASFCNRKLIGARAFLAGYHMSNLGGSGL  209

Query  635   PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E  S RD +GHGTHVAS AAG+  +NA+  G+A+G A G+A  ARIAVYKVC   T
Sbjct  210   NQSAETNSPRDTDGHGTHVASTAAGAVASNASFFGYAKGVAIGVAPKARIAVYKVCLTST  269

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C  +D+L+GMDQAV+DGVH++S+S++     G   PY +D++AI +FGA++ GV++S AA
Sbjct  270   CKQSDMLAGMDQAVSDGVHIISMSIS-----GGTDPYYKDIMAIASFGAMRHGVLLSLAA  324

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ-PSRIQVPV  1171
             GN GPDP+T  +L PW+LTVGAS++DREF A V LG+ R+F G+SLY G   P   Q  +
Sbjct  325   GNDGPDPFTVNHLPPWVLTVGASSVDREFSADVALGDGRTFLGSSLYYGPHFPFYKQYKL  384

Query  1172  VYGGSANSFYCFPGQL-DASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             VY G   + +C PG   + +++ G+IV C+ G +TS +DKG AV    G G I+ N    
Sbjct  385   VYAGDFGNKFCSPGDFTNQNQLAGKIVVCDYGGETSSLDKGFAVKDVNGRGTIIANNAQV  444

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L       PT  V + DG  I++Y++++  PTA I F GTVIG SP APRVAAFS R
Sbjct  445   GEELSAEPHVTPTTQVGIKDGRKIKRYIKSSRNPTANILFHGTVIGTSPPAPRVAAFSNR  504

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL----------TEFNMISGTSMACPHVSGLAA  1678
             GPN LTP+ILKPDVIAPG+NILAAWT  +           EFN+ISGTSMA PHVSG+AA
Sbjct  505   GPNPLTPQILKPDVIAPGLNILAAWTQVVGPSGEGDTRQVEFNIISGTSMAAPHVSGIAA  564

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +L+  YP WSPAAIKSALMTTAY +DNSG+ ++ DL T + +TP  +GSGHVDP  A++P
Sbjct  565   LLRNAYPDWSPAAIKSALMTTAYDLDNSGQ-SIKDLATGKKSTPFVHGSGHVDPNRALNP  623

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRN---SPLVDCRNRNLG---NPGSLNYPSFS  2020
             GL+YD GV+DYV FLC+IGYDS +I++F R    S + +    +LG    PG LN PSFS
Sbjct  624   GLIYDMGVSDYVGFLCSIGYDSEQISVFFRKLVRSDICEKTYDHLGARVTPGDLNLPSFS  683

Query  2021  VLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPS  2125
             V+F N  +TV Y+RTV NV    +  Y V+ + P+
Sbjct  684   VVFDNEGETVKYRRTVTNVGSNVDAVYVVSGEAPA  718



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/752 (48%), Positives = 480/752 (64%), Gaps = 46/752 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             +FIV M KS+ P+ F  H  WY S + ++S       S+E+LY Y +  HGF+ARLT  +
Sbjct  38    NFIVHMAKSQMPESFEDHTHWYDSSLRSVS------GSAEMLYVYNNAVHGFAARLTAEE  91

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L N PG++SVLP+   EL TTR+P FLGL   S++  P S+   D+I+GVLD+G+WP
Sbjct  92    AESLQNQPGILSVLPEMKYELHTTRTPSFLGL-DVSADYFPESNAMGDVIVGVLDTGVWP  150

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVGEPK  655
             E  SF D G  PIP SW+ +CE G NF + +CNRK+IGAR + +GYE+ +G   +  E K
Sbjct  151   ESKSFDDTGFGPIPASWKGECESGTNFTSKNCNRKLIGARYFAKGYESTLGPIDVSKESK  210

Query  656   SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADIL  835
             S RD +GHGTH ++ A GS V  A++ G+A G ARG+AT+AR+AVYKVCW+G C ++DIL
Sbjct  211   SPRDDDGHGTHTSTTATGSVVQGASLLGYASGNARGMATHARVAVYKVCWVGGCFSSDIL  270

Query  836   SGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDP  1015
             + +D+A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN GP P
Sbjct  271   AALDKAIDDNVNVLSLSLG-----GGNSDYYRDSVAIGAFAAMEKGILVSCSAGNAGPSP  325

Query  1016  YTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA--  1189
             Y+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY G+A  
Sbjct  326   YSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGASSLSKMLPFVYAGNASN  385

Query  1190  --NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
               N   C  G L   +V+G+IV C++G +   V KG  V  AGG GM++ N    G +L 
Sbjct  386   MTNGNLCMSGTLIPEEVKGKIVLCDRGINPR-VQKGSVVKAAGGAGMVLANTAANGDELI  444

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              +A  IP   V    GE I+ Y+ +   PTA I F+GT +G  PS P VAAFS RGPN +
Sbjct  445   ADAHLIPATSVGQTTGEAIKNYLTSNPNPTATILFEGTKVGIKPS-PVVAAFSSRGPNSI  503

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             T EILKPD+IAPGVNILA WTG+             EFN+ISGTSM+CPHVSGLAA+LK 
Sbjct  504   TQEILKPDIIAPGVNILAGWTGAAGPTGLAEDDRRVEFNIISGTSMSCPHVSGLAALLKG  563

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              +P WSPAAI+SALMTTAYTV   G G L D+ T +P+TP  +G+GHVDP  A++PGLVY
Sbjct  564   AHPDWSPAAIRSALMTTAYTVYKKG-GALQDVVTGKPSTPFDHGAGHVDPVAALNPGLVY  622

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT-  2047
             D   +DY++FLC + Y S +I    R  P     N+       LNYPSF+V+F   +   
Sbjct  623   DLKADDYLNFLCALNYTSIQINSVARR-PFSCATNKKF-RVADLNYPSFAVVFPEQMTAS  680

Query  2048  -------VIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTF  2203
                    + + RT+ NV       Y+V V  PSN V+V V P  L FT   +  SY VTF
Sbjct  681   SGSGSSSIKHTRTLTNVGPAGT--YKVNVIKPSNSVKVVVEPETLAFTRMNEQKSYTVTF  738

Query  2204  Q--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                S+  + + +  + WSDG H+V+SP+A+SW
Sbjct  739   TAPSMPSTENVYARIEWSDGKHVVSSPVAISW  770



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/752 (49%), Positives = 490/752 (65%), Gaps = 48/752 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY+S + ++S       S+ELLYTY +  HGFS RLT
Sbjct  29    QQATYIVHMAKSQMPSSFDLHSLWYASSLKSVS------ESAELLYTYNNAIHGFSTRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L   PGVISVLP++  EL TTR+P FLGL   + +L P ++  +D+++GV+D+G
Sbjct  83    PQEADSLMTQPGVISVLPEQQYELHTTRTPLFLGLDVHNGDLFPETEASSDVVVGVIDTG  142

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPER SFSD+G  PIP++W+ KCEVG NF A+ CNRK+IGAR + RGYEAE G PI   
Sbjct  143   VWPERKSFSDKGYGPIPSTWKGKCEVGTNFTASLCNRKLIGARFFARGYEAEKG-PIDES  201

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V  AN  G A G ARG+A  AR+AVYKVCW G C +
Sbjct  202   KESRSPRDDDGHGTHTSSTAAGSVVEGANFLGFANGTARGMAPGARLAVYKVCWKGGCFD  261

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +D+L+ +D+A+ D V+VLS+S+         L Y  + IAIGAF A+++G++VSC+AGN 
Sbjct  262   SDVLAAIDKAIDDNVNVLSISMDD-----LTLDYYRNDIAIGAFAAMERGILVSCSAGNS  316

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP      N+APWI TVGA TIDR+FPA+V LGN  +++G SL  G     + +P VY G
Sbjct  317   GPRSSDISNVAPWITTVGAGTIDRDFPALVILGNGNNYSGVSLIKGDALPEL-LPFVYAG  375

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N  +C  G L   KV+G+IV C++G +   V+KG  V   GG+GMI+ N    G
Sbjct  376   NASNATNGNFCVSGTLIPEKVKGKIVMCDRGVNFR-VEKGEVVKAVGGLGMILANTAENG  434

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    GEIIR YV T   PTA I  +GTV+   PS P VAAFS RG
Sbjct  435   EELVADAHLLPATAVGEKAGEIIRHYVITHPNPTASILTQGTVVNVQPS-PVVAAFSLRG  493

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN  TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA
Sbjct  494   PNPTTPNILKPDLIAPGVNILAAWTGAKGPTELASDTRRVEFNIISGTSMSCPHVSGLAA  553

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY+    G+  LID+ T +P+TP  +G+GHV PT AV+P
Sbjct  554   LLKSVHPEWSPAAIRSALMTTAYSTYKDGK-PLIDIATGKPSTPFDHGAGHVSPTMAVNP  612

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKN  2035
             GL+YD    DY+DFLC + Y S +I    R +   D  +  ++GN   LNYPSF++    
Sbjct  613   GLIYDILTVDYLDFLCALNYTSSQIMKVSRRNYTCDPSKTYSVGN---LNYPSFAL----  665

Query  2036  NLQ---TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             N+Q      Y RTV NV +  + + +VT +T + V ++V P  L F +  +  SY VTF 
Sbjct  666   NVQGSGAYTYTRTVTNVGEAGSYSVKVTSET-TIVNISVVPAVLNFKEVNEKKSYSVTFN  724

Query  2207  ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                S    ++SFGS++WSDG H+V SP+A+SW
Sbjct  725   VDSSKASGSNSFGSIQWSDGIHVVGSPVAISW  756



>emb|CDY67452.1| BnaCnng55020D [Brassica napus]
Length=748

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/744 (48%), Positives = 478/744 (64%), Gaps = 47/744 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H  WY S + ++S       S+E+LYTY +  HGF+ RLTP +
Sbjct  32    TYIVHMAKSQMPSSFDHHSLWYESSLKSIS------ESAEMLYTYNNAIHGFATRLTPEE  85

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISV P++  EL TTR+P FLGL   +S L P +  G+D++IGVLD+G+WP
Sbjct  86    ADSLKTQPGVISVRPEQRYELHTTRTPLFLGLGVHNSGLFPETGPGSDVVIGVLDTGVWP  145

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGEPKS  658
             E  SFSD G  PIP++W+ +CE G  F  + CNRK+IGAR +  GYEAE          S
Sbjct  146   ESKSFSDEGYGPIPSTWKGECEAGTKFTTSLCNRKLIGARFFVCGYEAE----------S  195

Query  659   ARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILS  838
              RD +GHGTH AS AAGS V  AN+ G A G ARG+A  AR+AVYKVCW   C ++D+L+
Sbjct  196   PRDDDGHGTHTASTAAGSIVEGANLLGFANGTARGMAYRARVAVYKVCWKPQCFSSDVLA  255

Query  839   GMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPY  1018
             G+D+A+ D V+VLSLSL  +++      Y  D +A+GAF A+++G+ VSC+AGN GP P 
Sbjct  256   GIDKAIEDNVNVLSLSLGKRNRD-----YTND-VAMGAFSAMERGIFVSCSAGNDGPSPS  309

Query  1019  TAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANS-  1195
             +  N+APWI TVGA T+DR+FPA+VTLGN +S+ G SL+         +P VY GSA++ 
Sbjct  310   SLSNVAPWITTVGAGTLDRDFPALVTLGNGKSYIGASLFKKDALPPTLLPFVYAGSASNN  369

Query  1196  ----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
                  +C  G L   KV G+IV CE+G++    +KG  V  AGG+GMI+PN  N G +L 
Sbjct  370   ATYGKFCLSGTLIPEKVYGKIVMCEKGENDR-AEKGEVVKAAGGLGMILPNRANRGEELA  428

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
               A  +P   V    G+IIR+YV+T   PTA I  +GTV+   PS P +AAFS RGPN +
Sbjct  429   AKAHVLPATTVGQKAGDIIRRYVKTDPSPTASIVIQGTVVKVKPS-PVLAAFSSRGPNPI  487

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             TP ILKPD+IAPGVNILAAWTG+L            EFN+ISGTSM+CPHVSGLAA+LK 
Sbjct  488   TPNILKPDLIAPGVNILAAWTGALGPSGLASDTSRVEFNIISGTSMSCPHVSGLAALLKS  547

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
             ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV P  A+ PGL+Y
Sbjct  548   VHPDWSPAAIRSALMTTAYNTYKDGK-PLLDILTVKPSTPFGHGAGHVSPATAISPGLIY  606

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTV  2050
             D    DY+DFLC + Y+S +I    R +    C  R + +   LNYPSFSV    +  T 
Sbjct  607   DLTTKDYIDFLCALNYNSSQIGCVTRGN--YACDPRKMYSVADLNYPSFSVSVHGSGGTY  664

Query  2051  IYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQS  2221
              Y RTV NV    +   +V  +T + V+++V P  L F    +  SY VTF    S+   
Sbjct  665   KYTRTVTNVGGAGSYTVKVISETAA-VKISVEPAVLNFKKVNEKKSYSVTFTVVSSMAPR  723

Query  2222  ADSFGSLRWSDGTHLVTSPIAVSW  2293
             ++SFGS+ WSDG H+V SP+A+SW
Sbjct  724   SNSFGSIEWSDGKHVVASPVAISW  747



>ref|XP_010939822.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=769

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/757 (48%), Positives = 486/757 (64%), Gaps = 47/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+  ++IV M KS  P  F+ H +WY + + ++S       S+++LY Y+ VAHGFSARL
Sbjct  31    EKRVTYIVHMAKSRMPATFTEHGNWYDASLRSVS------DSAKILYLYDTVAHGFSARL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP++A  L ++ GV+ VL +   EL TTR+P+FLGL   S  L P ++  +D+++GVLD+
Sbjct  85    TPAEAQALESLDGVLCVLAEVRYELHTTRTPEFLGL-DKSDGLVPQANTASDVVVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPER SF D G  P+P  W+  CE G +F ATSCNRK+IGAR + +GYEA +G PI  
Sbjct  144   GVWPERKSFDDTGFGPVPAGWKGACEEGKDFKATSCNRKLIGARFFSKGYEASMG-PIDE  202

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD++GHGTH ++ AAGSAV +A++ G A G ARG++T AR+A YKVCW G C 
Sbjct  203   SRESRSPRDIDGHGTHTSTTAAGSAVTDASLLGFATGTARGMSTRARVAAYKVCWAGGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD AV DG HVLSLSL      G    Y  D +AIGAF A++KGV+VSC+AGN
Sbjct  263   SSDILAAMDAAVDDGCHVLSLSLG-----GGMSDYYRDSVAIGAFNAMEKGVLVSCSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APWI TVGA T+DR+FPA V LGN +++TG SLYSG       +P+VY 
Sbjct  318   AGPTDSSLSNVAPWITTVGAGTLDRDFPAYVVLGNGKNYTGVSLYSGKPLPSTPLPIVYA  377

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A++      C PG L   KV G+IV C++G  +  V KG  V +AGG GM++ N    
Sbjct  378   GNASNSTSGNLCMPGTLIPEKVAGKIVLCDRG-ISPRVQKGYVVREAGGAGMVLANTDAN  436

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P + V    G+ IR Y+ + + PTA + F GT +G  PS P VAAFS R
Sbjct  437   GEELVADAHLLPASGVGEKAGDAIRAYLLSETSPTASVVFGGTKVGVRPS-PVVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG++            EF++ISGTSM+CPHVSGLA
Sbjct  496   GPNAVTPEILKPDLIAPGVNILAGWTGAVGPTGLSVDSRRVEFSIISGTSMSCPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY+    G G L+D+ T +  TP  YG+GHVDP  A++
Sbjct  556   ALLKGAHPDWSPAAIRSALMTTAYSAYPGGDG-LLDVATGKAATPFDYGAGHVDPPRAME  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD   +DY+DFLC + Y S +IA   + +    C ++       LNYPSF+V F  
Sbjct  615   PGLVYDLTADDYIDFLCALNYTSLQIAAVAKRTNYA-CDDKKTYAVSGLNYPSFAVAFAT  673

Query  2036  N------LQTVIYKRTVKNVAKVRNVAYQVTVQTP---SNVRVTVSPNRLVFTDRIDTLS  2188
                     +TV + RT+ NV +     Y+ TV T      V+V V P  L FT   +  S
Sbjct  674   TSGNGGGAETVKHTRTLTNVGEPGT--YKATVATSVTGGEVKVAVEPAELRFTKGGEKQS  731

Query  2189  YEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y V+F   SL   +  FG L WSDG H+V SPIA SW
Sbjct  732   YTVSFSAPSLPSGSLGFGRLEWSDGKHVVASPIAFSW  768



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/745 (48%), Positives = 476/745 (64%), Gaps = 39/745 (5%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H +WY S + ++S       S+ELLYTYE+  HGFS RLT  +
Sbjct  31    TYIVHMAKSQMPSSFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFSTRLTQEE  84

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G+WP
Sbjct  85    ADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEHTADLFPEAGSYSDVVVGVLDTGVWP  144

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  S+SD G  PIP+SW+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI    E 
Sbjct  145   ESKSYSDEGFGPIPSSWKGGCEAGTNFTASLCNRKLIGARFFARGYESTMG-PIDESKES  203

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH +S AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C ++DI
Sbjct  204   RSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPRARVAVYKVCWLGGCFSSDI  263

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN GP 
Sbjct  264   LAAIDKAIADNVNV-----LSMSLGGGMSDYYRDGVAIGAFAAMERGILVSCSAGNAGPS  318

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
               +  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G+A 
Sbjct  319   SSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNAS  378

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    G +L
Sbjct  379   NATNGNLCMTGTLIPEKVKGKIVMCDRGINAR-VQKGDVVKAAGGVGMILANTAANGEEL  437

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P   V    G+IIR YV T   PTA I   GTV+G  PS P VAAFS RGPN 
Sbjct  438   VADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPS-PVVAAFSSRGPNS  496

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA+LK
Sbjct  497   ITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLK  556

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
              ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV PT A +PGL+
Sbjct  557   SVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFDHGAGHVSPTTATNPGLI  615

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V   + +  
Sbjct  616   YDLTTEDYLGFLCALNYTSPQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNV-DGVGA  672

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQ  2218
               Y RTV +V      + +VT +T + V+++V P  L F +  +  SY VTF    S   
Sbjct  673   YKYTRTVTSVGGAGTYSVKVTSET-TGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPS  731

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSW  2293
              ++SFGS+ WSDG H+V SP+A+SW
Sbjct  732   GSNSFGSIEWSDGKHVVGSPVAISW  756



>ref|XP_010105479.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04835.1| Subtilisin-like protease [Morus notabilis]
Length=776

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/761 (47%), Positives = 482/761 (63%), Gaps = 50/761 (7%)
 Frame = +2

Query  107   EEPK-SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
             + PK ++I+ M KS KP +F  H +WY S + ++S       S+E+LYTY++V HGFS R
Sbjct  32    QRPKRTYIIHMDKSNKPAVFDDHVNWYDSSLKSVSD------SAEMLYTYDNVIHGFSTR  85

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             +T  +A  L N PGV+SV+P+   EL TTR+P FLGL   S +L  +SD  +D+IIGVLD
Sbjct  86    ITEEEAHLLNNQPGVVSVIPETRYELHTTRTPDFLGL-KESYSLIAASDKASDVIIGVLD  144

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV  643
             +G+WPE  S+ D+GL P+P SW+ KCE G NF ++SCNRK+IGAR++Y+GYE E G+   
Sbjct  145   TGVWPEIESYDDKGLGPVPKSWKGKCEAGKNFNSSSCNRKLIGARSFYKGYEKEAGRIDE  204

Query  644   G-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH ++ AAGS V++A+V G+A G ARG+A  AR+A YKVCWL  C 
Sbjct  205   KVESKSPRDDDGHGTHTSTTAAGSHVSSASVLGYASGTARGMAPTARVATYKVCWLKGCF  264

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++D+++G D+A+ADGVH+    L+     G    Y  D++AI  F A  +G++VS +AGN
Sbjct  265   DSDLIAGFDKAIADGVHI----LSMSLGGGSGTEYHSDILAIATFAATARGILVSASAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPS-RIQVPVVY  1177
              GP   T  N APWI TVGA TIDR+FPA V LGN + + G SLY G Q S ++ VP+VY
Sbjct  321   SGPYHGTVFNAAPWITTVGAGTIDRDFPAYVKLGNGQEYKGVSLYKGKQLSDKVLVPIVY  380

Query  1178  GGS----ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI-VPNLP  1342
             G S    ++  +C PG L   K +G+IV C  G +   V  G+ V  AGG+GMI   +  
Sbjct  381   GASVSNDSDGAFCLPGSLIPKKTKGKIVICFHGRNGR-VQAGLVVKDAGGIGMIYTRDDD  439

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
             + G +L  +A  +P A V++  G  IR+YV + + PTA I    T +G  PS P VA+F 
Sbjct  440   SHGEELVADAHLLPAAFVSLEKGLEIRRYVDSVANPTATIIQGATKLGVQPS-PIVASFR  498

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN  TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSG
Sbjct  499   SRGPNRRTPEILKPDLIAPGVNILAGWTGAVGPSGLSLDKRRVNFNIISGTSMSCPHVSG  558

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             LAA+LK  +P WSPAAI+S+LMTTAY+   +G+ T+ D+ T +  TP  +G+GHVDP  A
Sbjct  559   LAALLKAAHPKWSPAAIRSSLMTTAYSTYKNGK-TIEDVVTARAATPFDFGAGHVDPVAA  617

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             +DPGLVYDA V DY++FLC + Y   +I    +      C +    + G LNYPSF+V F
Sbjct  618   LDPGLVYDATVEDYINFLCALDYAPEQIKTVTKRD--FTCNSTKKYSVGDLNYPSFAVPF  675

Query  2030  -----------KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRI  2176
                        KN  QT+ Y RT+ NV       Y+V+V    +V++ V P  L F    
Sbjct  676   KAESEEEVGATKNVSQTMTYTRTLTNVGA--PAKYEVSVSKIDSVKILVKPKSLSFKKAY  733

Query  2177  DTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +  +Y VTF   +L+     FG L WSDG H+V SPIA SW
Sbjct  734   EKKTYTVTFVASTLQWGTKHFGRLEWSDGKHIVGSPIAFSW  774



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/754 (48%), Positives = 486/754 (64%), Gaps = 43/754 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV + KS+ P+ F  H  WY S + ++S       S+E+LY Y +V HGFSARLT
Sbjct  31    KKSTYIVHVAKSQMPESFENHKHWYDSSLKSVS------DSAEMLYVYNNVVHGFSARLT  84

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L    G++SVLP+   EL TTR+P FLGL   S++  P S+  +D+I+GVLD+G
Sbjct  85    VQEAESLERQSGILSVLPEMKYELHTTRTPSFLGL-DRSADFFPESNAMSDVIVGVLDTG  143

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVG  646
             +WPE  SF D GL P+P+SW+ +CE G NF +++CNRK+IGAR + +GYE  +G   +  
Sbjct  144   VWPESKSFDDTGLGPVPDSWKGECESGTNFSSSNCNRKLIGARYFSKGYETTLGPVDVSK  203

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KSARD +GHGTH A+ AAGS V  A++ G+A G ARG+AT AR+AVYKVCW+G C ++
Sbjct  204   ESKSARDDDGHGTHTATTAAGSIVQGASLFGYASGTARGMATRARVAVYKVCWIGGCFSS  263

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MD+A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN G
Sbjct  264   DILAAMDKAIDDNVNVLSLSLG-----GGNSDYYRDSVAIGAFAAMEKGILVSCSAGNAG  318

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P PY+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY G+
Sbjct  319   PGPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGDLSLSKMLPFVYAGN  378

Query  1187  A----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             A    N   C  G L   KV+G+IV C++G +   V KG  V +AGGVGM++ N    G 
Sbjct  379   ASNTTNGNLCMTGTLIPEKVKGKIVLCDRGINPR-VQKGSVVKEAGGVGMVLANTAANGD  437

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  +P   V    GE I++Y+ +   PTA I F+GT +G  PS P VAAFS RGP
Sbjct  438   ELVADAHLLPATTVGQTTGEAIKKYLTSDPNPTATILFEGTKVGIKPS-PVVAAFSSRGP  496

Query  1535  NFLTPEILKPDVIAPGVNILAAWTG-----SLTE------FNMISGTSMACPHVSGLAAM  1681
             N +T EILKPD+IAPGVNILA WTG      L E      FN+ISGTSM+CPHVSGLAA+
Sbjct  497   NSITQEILKPDIIAPGVNILAGWTGGVGPTGLAEDTRRVGFNIISGTSMSCPHVSGLAAL  556

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             LK  +P WSPAAI+SALMTTAYTV  +G G L D+ T +P+TP  +G+GHVDP  A++PG
Sbjct  557   LKGAHPDWSPAAIRSALMTTAYTVYKNG-GALQDVSTGKPSTPFDHGAGHVDPVAALNPG  615

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             LVYD   +DY++FLC + Y S +I    R +   +C      +   LNYPSF+V+F   +
Sbjct  616   LVYDLRADDYLNFLCALNYTSIQINSIARRN--YNCETSKKYSVTDLNYPSFAVVFLEQM  673

Query  2042  QT--------VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
                       V Y RT+ NV             + ++V+V+V P  LVFT   +  SY V
Sbjct  674   TAGSGSSSSSVKYTRTLTNVGPAGTYKVSTVFSSSNSVKVSVEPETLVFTRVNEQKSYTV  733

Query  2198  TFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             TF   S   + + FG + WSDG H+V SP+A+SW
Sbjct  734   TFTAPSTPSTTNVFGRIEWSDGKHVVGSPVAISW  767



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/745 (48%), Positives = 473/745 (63%), Gaps = 39/745 (5%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H +WY S + ++S       S+ELLYTYE+  HGFS RLT  +
Sbjct  27    TYIVHMAKSQMPSTFDLHSNWYDSSLRSVS------DSAELLYTYENAIHGFSTRLTQEE  80

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G+WP
Sbjct  81    ADSLMTQPGVISVLPEHRYELHTTRTPLFLGLEDHTADLFPETGSYSDVVVGVLDTGVWP  140

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  S+SD G  PIP++W+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI    E 
Sbjct  141   ESKSYSDEGFGPIPSTWKGGCEAGTNFTASLCNRKLIGARFFARGYESTMG-PIDESKES  199

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH +S AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C ++DI
Sbjct  200   RSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPRARVAVYKVCWLGGCFSSDI  259

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN GP 
Sbjct  260   LAAIDKAIADNVNV-----LSMSLGGGMSDYYRDGVAIGAFAAMERGILVSCSAGNAGPS  314

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
              Y+  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G+A 
Sbjct  315   SYSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNAS  374

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    G +L
Sbjct  375   NATNGNLCMTGTLIPEKVKGKIVMCDRGVNAR-VQKGDVVKAAGGVGMILANTAANGEEL  433

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P   V    G+IIR YV T   PTA I   GTV+G  PS P VAAFS RGPN 
Sbjct  434   VADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPS-PVVAAFSSRGPNS  492

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP ILKPD+IAPGVNILAAWT +             EFN+ISGTSM+CPHVSGLAA+LK
Sbjct  493   ITPNILKPDLIAPGVNILAAWTTAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLK  552

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
              ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV PT A +PGL+
Sbjct  553   SVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFDHGAGHVSPTTATNPGLI  611

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V   +    
Sbjct  612   YDLSTEDYLGFLCALNYTSSQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNV-DGAGA  668

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQ  2218
               Y RTV +V      + +VT +T    +++V P  L F +  +  SY VTF    S   
Sbjct  669   YKYTRTVTSVGGAGTYSVKVTSET-RGAKISVEPAVLNFKEANEKKSYTVTFTVDSSKAS  727

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSW  2293
              ++SFGS+ WSDG H+V SP+A+SW
Sbjct  728   GSNSFGSIEWSDGKHVVGSPVAISW  752



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/755 (48%), Positives = 483/755 (64%), Gaps = 49/755 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K+++V M KS  P  F+ H +WY S + ++S       S+ +LYTY++V HGFS RLT  
Sbjct  31    KTYVVHMDKSTMPATFNDHFEWYDSSLKSVSA------SAAMLYTYKNVIHGFSTRLTAK  84

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A  L   PG++SVLP+   EL TTR+P+FLGL   S  L P+S+  +++I+GVLD+G+W
Sbjct  85    EAESLQKQPGIVSVLPEVRYELHTTRTPEFLGL-GKSETLFPTSEVQSEVIVGVLDTGVW  143

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PE  SF D G+ P+P  W+  CEVG NF ++SCNRK+IGAR++ RGYE  +G PI    E
Sbjct  144   PEIKSFDDTGMGPVPRGWKGVCEVGRNFKSSSCNRKLIGARSFSRGYEEAVG-PIDETAE  202

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD +GHGTH ++ AAGS V  A++ G A G ARG+A  AR+A YKVCWL  C  +D
Sbjct  203   SKSPRDDDGHGTHTSTTAAGSVVNGASLFGFASGTARGMAAQARVATYKVCWLAGCFGSD  262

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+GMD+A+ DGV+V      S S  G    Y  D +AIGAF A+ +G+ VSC+AGN GP
Sbjct  263   ILAGMDKAIEDGVNV-----MSMSIGGGLTDYYRDTVAIGAFTAMAQGIFVSCSAGNGGP  317

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                +  N+APWI TVGA T+DR FP  V+LGN +SF+G SLYS    S   VP+V   + 
Sbjct  318   YANSISNVAPWITTVGAGTLDRNFPTYVSLGNGKSFSGVSLYSRRPLSGSMVPIVDAANV  377

Query  1190  NSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             +S      C  G L  +KV G+IV C++G + S V+KGV V  AGGVGMI+ N  + G +
Sbjct  378   SSTSSGNLCMTGSLIPAKVAGKIVVCDRGGN-SRVEKGVEVKDAGGVGMILTNTDSYGEE  436

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P+A V    G+ I+ Y+ +   P A I  +GT +G  PS P VAAFS RGPN
Sbjct  437   LVADAQLLPSANVGEKAGDAIKNYISSDPGPMATIISRGTQLGIQPS-PVVAAFSSRGPN  495

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+L
Sbjct  496   PITPEILKPDLIAPGVNILAGWTGAVGPTGLENDKRHVSFNIISGTSMSCPHVSGLAALL  555

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSP+AI+SALMTTAY+   +G+ TL+D+ T QP+TP  +G+GHVDP  A+DPGL
Sbjct  556   KAAHPEWSPSAIRSALMTTAYSTYGNGK-TLLDISTGQPSTPFDFGAGHVDPVAALDPGL  614

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFL-RNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             VYDA V DY+DFLC + Y S +I     R+   +  +  +LG+   +NYPSFSV F+   
Sbjct  615   VYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLGD---VNYPSFSVPFETAS  671

Query  2042  ---------QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                       TV Y RT+ NV         V+ Q+ S V++ V P  L F+ + +  SY 
Sbjct  672   GTWGGVGAPSTVKYTRTLTNVGTPTTYKASVSSQSTS-VKILVEPESLSFSRQYEKKSYV  730

Query  2195  VTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF   S+     SF  L+WSDG H+V SPIA SW
Sbjct  731   VTFTASSMPSGTTSFARLQWSDGKHVVGSPIAFSW  765



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/748 (48%), Positives = 475/748 (64%), Gaps = 39/748 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV M KS+ P  F  H +WY S + ++S       S+ELLYTYE+  HGFS RLT
Sbjct  35    EQGTYIVHMAKSQMPSTFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFSTRLT  88

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G
Sbjct  89    QEEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEHTADLFPETGASSDVVVGVLDTG  148

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  S+SD G  PIP +W+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI   
Sbjct  149   VWPESKSYSDAGFGPIPATWKGGCETGTNFTASHCNRKLIGARFFARGYESTMG-PIDES  207

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C +
Sbjct  208   KESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPRARVAVYKVCWLGGCFS  267

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN 
Sbjct  268   SDILAAIDKAIADNVNV-----LSMSLGGGMSDYYRDGVAIGAFAAMERGILVSCSAGNA  322

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  ++  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G
Sbjct  323   GPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAG  382

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV+G+IV C++G +   V KG  V  AGG+GMI+ N    G
Sbjct  383   NASNATNGNLCMSGTLIPEKVKGKIVMCDRGVNAR-VQKGDVVKAAGGLGMILANTAANG  441

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    G+IIR YV T   PTA I   GTV+G  PS P VAAFS RG
Sbjct  442   EELVADAHLLPATTVGEKAGDIIRHYVTTDPHPTASISILGTVVGVKPS-PVVAAFSSRG  500

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA
Sbjct  501   PNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAA  560

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GH  P  A +P
Sbjct  561   LLKSVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFDHGAGHASPATATNP  619

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GL+YD    DY+ FLC + Y S +I +  R +    C      +   LNYPSF+V   + 
Sbjct  620   GLIYDLTTEDYLGFLCALNYTSSQIRIVSRRN--YTCDPSKSYSVADLNYPSFAVNV-DG  676

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSL  2212
                  Y RTV +V      + +V  +T + V+++V P  L F    +  SY VTF   S 
Sbjct  677   AGAYKYTRTVTSVGGAGTYSVKVASET-TGVKISVEPAVLDFKAANEKKSYTVTFTVDST  735

Query  2213  RQS-ADSFGSLRWSDGTHLVTSPIAVSW  2293
             + S ++SFGS+ WSDG H+V SP+A+SW
Sbjct  736   KGSGSNSFGSIEWSDGKHVVGSPVAISW  763



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/753 (48%), Positives = 488/753 (65%), Gaps = 46/753 (6%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             P ++IV M KS+ P  F  H  WY S + ++S       S+E+LYTY    HGFS RLTP
Sbjct  38    PSTYIVHMAKSQMPASFEHHTHWYDSSLKSVS------DSAEMLYTYTSAIHGFSTRLTP  91

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              QA+ L++ PGV+SVLP+   EL TTR+P+FLGL   +  + P SD   D+IIGVLD+G+
Sbjct  92    EQAASLSSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETM-PQSDSAGDVIIGVLDTGV  150

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPE  SF D G  P+P+SW   CE G NF +++CNRK+IGAR + +GYEA +G PI    
Sbjct  151   WPESKSFDDTGFGPVPSSWNGTCESGTNFNSSNCNRKLIGARYFAKGYEATLG-PIEESK  209

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD +GHGTH A+ AAGS V  A++ G+A G ARG+A +ARIA YKVCW+G C ++
Sbjct  210   ESKSPRDDDGHGTHTATTAAGSFVPGASLLGYAPGTARGMAPHARIAAYKVCWVGGCFSS  269

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MD+A+ D V+VLS+SL      G    Y  D +A+GAF A++KG+++SC+AGN G
Sbjct  270   DILAAMDKAIDDNVNVLSMSLG-----GGNSDYFRDSVAMGAFSAMEKGILISCSAGNAG  324

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG---VQPSRIQVPVVY  1177
             P  Y+  N APWI TVGA T+DR+FPA V+LGN ++F+G SLY G     PS +  P +Y
Sbjct  325   PSAYSLSNSAPWITTVGAGTLDRDFPAFVSLGNGKNFSGVSLYRGNSNSMPSAL-TPFIY  383

Query  1178  GGSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              G+A++      C  G L   +V+G+IV C++G +   V KG  V  AGG+GMI+ N   
Sbjct  384   AGNASNATSGNLCMMGTLSPDQVKGKIVMCDRGVNAR-VQKGAVVKAAGGLGMILANTAA  442

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  +A  +P   V   + ++I+ Y+ +   PTA I F+GT +G  PS P VAAFS 
Sbjct  443   NGEELVADAHLLPATSVGQRNSDVIKSYLFSDPNPTATILFEGTKVGVQPS-PVVAAFSS  501

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +T +ILKPD++APGVNILA W+G+              FN+ISGTSM+CPHVSGL
Sbjct  502   RGPNSITADILKPDIVAPGVNILAGWSGAAGPTGLAIDARRVAFNIISGTSMSCPHVSGL  561

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK  +P WSPAAI+SALMTTAYT   +G+  L D+ T +P+TP  +G+GHVDP  A+
Sbjct  562   AALLKGAHPEWSPAAIRSALMTTAYTAYKNGQ-KLQDVATGKPSTPFDHGAGHVDPISAL  620

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             +PGLVYD  V+DY++FLC + Y + +I+   + S   D + R   +   LNYPSF+V F+
Sbjct  621   NPGLVYDLTVDDYLNFLCALNYSASEISSLAKRSYTCDEKRRY--SVRDLNYPSFAVNFE  678

Query  2033  N---NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
             +   +     Y RTV NV +       VT   PS V++TV P+ L F    +  +Y VTF
Sbjct  679   DRTTSTNVAKYTRTVTNVGRAGTYKATVTSDNPS-VKITVEPDTLSFGQVNEKKAYTVTF  737

Query  2204  Q---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 S   +A+SFG L WSDG H+V SPIA+SW
Sbjct  738   SASGSAPLNANSFGRLEWSDGKHVVGSPIAMSW  770



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/758 (48%), Positives = 483/758 (64%), Gaps = 49/758 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +  K++I+ M K+  P+ F  H  WY S + ++S       S+++LYTY  V HGFS RL
Sbjct  9     QSKKTYIIHMDKANVPESFDDHLQWYDSALKSVS------ESADILYTYNTVIHGFSTRL  62

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +A  L    G++SV+P+ + EL TTR+P+FLGL    +   P+SD   ++++GVLD+
Sbjct  63    TPEEAELLEKQGGILSVVPEMVYELHTTRTPEFLGLGKNDAVF-PASDSVGEVVVGVLDT  121

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL PIP++W+  CE G NF +++CNRK++GAR + RGYEA  G P+  
Sbjct  122   GVWPELKSFDDTGLGPIPSTWKGTCETGTNFNSSNCNRKLVGARYFSRGYEAAFG-PVDE  180

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+ AAGSAV+ A++ G A G ARG+A  ARIA YKVCWLG C 
Sbjct  181   TAESKSPRDDDGHGTHTATTAAGSAVSGASLFGFATGIARGMAPQARIAAYKVCWLGGCF  240

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DI++ M++AV DGV+V+S+S+      G    Y  D +A GAF A  +G++VSC+AGN
Sbjct  241   GSDIVAAMEKAVEDGVNVISMSIG-----GGLSDYYRDTVATGAFTATAQGILVSCSAGN  295

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P +  NLAPWI TVGA T+DR+FPA VTLGN ++++G SLY+G       VP+VY 
Sbjct  296   GGPSPGSLTNLAPWITTVGAGTLDRDFPAYVTLGNGKNYSGASLYNGKASIDSLVPLVYA  355

Query  1181  G----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G    S +   C    L  ++V G+IV C++G + S V KG+ V  AGGVGMI+ N    
Sbjct  356   GNITNSTSGSLCMSDSLIPAQVAGKIVICDRGGN-SRVQKGLEVKNAGGVGMILANTDLY  414

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +PTA V    G+II+ Y  +   P ARI   GT +G  PS P VAAFS R
Sbjct  415   GEELVADAHLLPTAAVGQKSGDIIKSYAFSDPKPVARIASGGTHLGIVPS-PVVAAFSSR  473

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTPE+LKPD+IAPGVNILA WTG++             FN+ISGTSM+CPH+SGLA
Sbjct  474   GPNLLTPEVLKPDLIAPGVNILAGWTGAVGPTGLTDDKRRVNFNIISGTSMSCPHISGLA  533

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSP AI+SALMTTAYT   SG+ T+ID+ T QP+TP  YG+GHV+P  A+D
Sbjct  534   ALLKAAHPDWSPTAIRSALMTTAYTTYKSGK-TIIDVSTGQPSTPFDYGAGHVNPVAALD  592

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLF-  2029
             PGLVYDA V DY+DFLC + Y + +I +  +     D  +  +LG+   LNYPSFSV   
Sbjct  593   PGLVYDATVEDYLDFLCALNYSAAQIKIATKRDYTCDPSKKYSLGD---LNYPSFSVPLQ  649

Query  2030  --------KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTL  2185
                     K  + TV Y RT+ NV         V+ Q  S V+++V P  L F+ + +  
Sbjct  650   TASGKGGGKGVITTVKYTRTLTNVGDPATYKVSVSSQIRS-VKISVEPESLSFSQQYEKK  708

Query  2186  SYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             SY VTF   S+     SF  L WS+G  +V SPIA SW
Sbjct  709   SYTVTFTATSMPSGTSSFAHLEWSNGKQVVGSPIAFSW  746



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/763 (47%), Positives = 478/763 (63%), Gaps = 50/763 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++  ++IV + KS+ P  F  H  WY S + ++S       S+E+LYTY +  HGF+ RL
Sbjct  33    QKKNTYIVHVAKSQMPASFDDHTRWYDSSLKSVS------ESAEMLYTYNNAIHGFATRL  86

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L + PG++ VLP+   EL TTR+P FLGL   S+NL P SD   D+I+ VLD+
Sbjct  87    TAQEAKSLQDQPGILYVLPEVKYELHTTRTPSFLGL-QQSANLFPESDSEGDVIVAVLDT  145

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIV  643
             G+WPE  SF D G+ P+P SW+  CE G NF +  CN+K+IGAR +  GYEA +G   + 
Sbjct  146   GVWPESKSFDDTGMGPVPASWKGACETGTNFTSNHCNKKLIGARYFSTGYEATLGPIDVT  205

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH ++ AAG+ V  A++ G+A G ARG+A  AR+AVYKVCW+G C +
Sbjct  206   KESKSPRDDDGHGTHTSTTAAGAIVGGASLFGYASGSARGMAYRARVAVYKVCWIGGCFS  265

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ +D+A+ D V+VLSLSL      G    Y  D +AIGAF A++KG+ VSC+AGN 
Sbjct  266   SDILAAIDRAIEDSVNVLSLSLG-----GGTADYYRDSVAIGAFSAMEKGIFVSCSAGNA  320

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  YT  NLAPWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY G
Sbjct  321   GPSAYTLSNLAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYKGDSLPAKLLPFVYAG  380

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV+G+IV C++G +   V KG  V  AGG GM++ N    G
Sbjct  381   NASNSTNGNLCMTGTLIPEKVKGKIVLCDRGINPR-VQKGAVVKGAGGAGMVLANTAANG  439

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P + V    G+ IR YV + + PTA I F+GT +G  PS P VAAFS RG
Sbjct  440   EELVADAHLLPASTVGQKSGDAIRDYVLSDANPTATILFEGTKVGIEPS-PVVAAFSSRG  498

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPEILKPD+IAPGVNI+A WTG++            EFN+ISGTSM+CPHVSGLAA
Sbjct  499   PNAITPEILKPDLIAPGVNIIAGWTGAVGPTGLAEDPRRVEFNIISGTSMSCPHVSGLAA  558

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
              +K  +P WSPAAI+SALMTTAYT   +G   LID+ T + +TP+ +G+GHVDP  A++P
Sbjct  559   FVKGAHPDWSPAAIRSALMTTAYTAYKNGGEKLIDVSTGKASTPYDHGAGHVDPVAALNP  618

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD   +DY++FLC + Y S +I    R +    C      + G  NYPSFSV  +  
Sbjct  619   GLVYDLTTDDYLNFLCALNYTSLQIQGVARRN--YSCDAGKTYSIGDFNYPSFSVSLQTQ  676

Query  2039  L--------------QTVIYKRTVKNVAKVR-NVAYQVTVQTPS-NVRVTVSPNRLVFTD  2170
             +                V Y RT+ NV        Y+V++ T S  V++TV P+ L FT 
Sbjct  677   VIGGGGGSRSGGGSKSVVKYTRTLTNVGGGSGGSTYKVSISTTSPAVKITVEPDTLTFTK  736

Query  2171  RIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               +  SY VTF   S+  + + FG + WSDG H+V SP+ +SW
Sbjct  737   AYEKKSYTVTFSATSMPSNTNEFGRIEWSDGKHVVGSPVVISW  779



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/758 (48%), Positives = 486/758 (64%), Gaps = 49/758 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +   ++I+ M KS  P  F  H  WY S + ++S       S+++LY Y +V HGFS RL
Sbjct  31    QSKNTYIIHMDKSYMPASFDDHLQWYDSSLKSVS------ESADMLYDYNNVIHGFSTRL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L    G+ISVLP+ + EL TTR+P+FLGL   S    P+SD  +++++GVLD+
Sbjct  85    TSEEAELLEKQEGIISVLPEMIYELHTTRTPEFLGL-GKSEAFFPTSDSVSEVVVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL PIP +W+ +CE G NF ++SCNRK+IGAR + +GYEA  G P+  
Sbjct  144   GVWPEAKSFDDTGLGPIPRTWKGECETGKNFNSSSCNRKLIGARFFSKGYEAAFG-PVDE  202

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH ++ AAGSAV+ A++ G A G ARG+AT AR+A YKVCWLG C 
Sbjct  203   TVESRSPRDDDGHGTHTSTTAAGSAVSGASLFGFATGIARGMATQARVAAYKVCWLGGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DI++ MD+AV DGV+V+S+S+      G    Y  D++AIGAF A  +G++VSC+AGN
Sbjct  263   GSDIVAAMDKAVEDGVNVISMSIG-----GGLSDYYRDIVAIGAFTATAQGILVSCSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APWI TVGA T+DR+FPA V LGN ++F+G SLYSG   S   VP+V  
Sbjct  318   GGPSQGSLSNIAPWITTVGAGTLDRDFPAYVRLGNGKNFSGASLYSGKPLSDSLVPLVSA  377

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A++      C  G L  +KV G+IV C++G + S V KG+ V  AGG+GMI+ N    
Sbjct  378   GNASNATSGSLCMSGTLIPTKVAGKIVICDRGGN-SRVQKGLEVKNAGGIGMILANTELY  436

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +PTA V     ++I++Y  +   PTA I F GT IG  PS P VAAFS R
Sbjct  437   GDELVADAHLLPTAAVGQTSADVIKRYAFSDLKPTATIAFGGTHIGVEPS-PVVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGS-----LTE------FNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG+     LT+      FN+ISGTSM+CPHVSGLA
Sbjct  496   GPNLVTPEILKPDIIAPGVNILAGWTGAAGPTGLTDDTRRVSFNIISGTSMSCPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A +K  +  WSPAAI+SALMTTAYT   SG+ T++D+ T QP TP  YG+GHV+P  A+D
Sbjct  556   AFIKAAHQDWSPAAIRSALMTTAYTAYKSGK-TILDVSTGQPATPFDYGAGHVNPLAALD  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFK  2032
             PGLVYDA V DY+ FLC + Y + +I   +      D  +  +LG+   LNYPSFSV  +
Sbjct  615   PGLVYDATVEDYLGFLCALNYSAAQIKAVINRDFTCDPAKKYSLGD---LNYPSFSVPLE  671

Query  2033  NN---------LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTL  2185
                          TV Y RT+ NV         V+ +TPS V+++V P  L F+++ +  
Sbjct  672   TASGKGGGAGVTSTVKYTRTLTNVGTPATYKVSVSSETPS-VKISVEPESLSFSEQYEKK  730

Query  2186  SYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             SY VTF   SL     +F  L WS G H+V SPIA SW
Sbjct  731   SYTVTFSATSLPSGTTNFARLEWSSGKHVVGSPIAFSW  768



>ref|NP_001048301.1| Os02g0779200 [Oryza sativa Japonica Group]
 dbj|BAD19517.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10215.1| Os02g0779200 [Oryza sativa Japonica Group]
 gb|EAZ24820.1| hypothetical protein OsJ_08598 [Oryza sativa Japonica Group]
Length=782

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/716 (51%), Positives = 466/716 (65%), Gaps = 30/716 (4%)
 Frame = +2

Query  236   ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  415
              LLY+Y H A G +ARLTP QA+ +   PGV++V PD+  +L TT +P FL L   S  L
Sbjct  72    RLLYSYAHAATGVAARLTPEQAAHVEAQPGVLAVHPDQARQLHTTHTPAFLHLTQASGLL  131

Query  416   GPSSDYGADI-IIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPNFPATS-CNRK  583
               ++  GA   I+GVLD+GI+P  R SF+   GL P P S+   C    +F A++ CN K
Sbjct  132   PAAASGGASSPIVGVLDTGIYPIGRGSFAPTDGLGPPPASFSGGCVSTASFNASAYCNNK  191

Query  584   IIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEA  757
             +IGA+ +Y+GYEA +G  I    E KS  D  GHGTH AS AAGS V  A    +ARG+A
Sbjct  192   LIGAKFFYKGYEAALGHAIDETEESKSPLDTEGHGTHTASTAAGSPVTGAGFFDYARGQA  251

Query  758   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDL  937
              G++  A IA YK+CW   C ++DIL+ MD+AVADGV V+SLS+ +    G+A  +  D 
Sbjct  252   VGMSPAAHIAAYKICWKSGCYDSDILAAMDEAVADGVDVISLSVGAG---GYAPSFFRDS  308

Query  938   IAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSF  1117
             IAIG+F AV KG++VS +AGN GP  YTA N+APWILTVGASTIDREFPA V LGN + +
Sbjct  309   IAIGSFHAVSKGIVVSASAGNSGPGEYTATNIAPWILTVGASTIDREFPADVVLGNGQVY  368

Query  1118  TGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVA  1297
              G SLYSG   +   +PVVY G   S  C  G+LD +KV G+IV CE+G +  +  KG A
Sbjct  369   GGVSLYSGEPLNSTLLPVVYAGDCGSRLCIIGELDPAKVSGKIVLCERGSNARVA-KGGA  427

Query  1298  VSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGT  1477
             V  AGG GMI+ N    G +L  ++  +P  +V    G+ I+ YV++   PTA I F+GT
Sbjct  428   VKVAGGAGMILVNTAESGEELVADSHLVPATMVGQKFGDKIKYYVQSDPSPTATIVFRGT  487

Query  1478  VIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGS-----------LTEF  1624
             VIG SPSAPRVAAFS RGPN+  PEILKPDVIAPGVNILAAWTG              EF
Sbjct  488   VIGKSPSAPRVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGESAPTDLDIDPRRVEF  547

Query  1625  NMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPT  1804
             N+ISGTSM+CPHVSGLAA+L++  P WSPAAIKSALMTTAY VDNS    + DL T   +
Sbjct  548   NIISGTSMSCPHVSGLAALLRQAQPDWSPAAIKSALMTTAYNVDNS-SAVIKDLATGTES  606

Query  1805  TPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNL  1984
             TP   G+GHVDP  A+DPGLVYDAG  DYV FLCT+GY    I+LF  +  + +C  +  
Sbjct  607   TPFVRGAGHVDPNRALDPGLVYDAGTEDYVSFLCTLGYSPSIISLFTTDGSVANCSTK-F  665

Query  1985  GNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVF  2164
                G LNYP+F+V+  +   +V Y R V+NV    N  Y+  + +PS V VTVSP++LVF
Sbjct  666   PRTGDLNYPAFAVVLSSYKDSVTYHRVVRNVGSNANAVYEAKIDSPSGVDVTVSPSKLVF  725

Query  2165  TDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSW--EGRSVS  2311
              +   +LSY++T  +     +  +  +FGS+ WSDG H VTSPIAV+W   GR+ S
Sbjct  726   DESHQSLSYDITIAASGNPVIVDTEYTFGSVTWSDGVHDVTSPIAVTWPSNGRAAS  781



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/752 (48%), Positives = 478/752 (64%), Gaps = 46/752 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M K + P  F  H  WY S + ++S       S+E+LYTY++V HGFS RLT  +
Sbjct  35    TYIVHMAKFQMPASFDEHTHWYDSSLKSVS------DSAEMLYTYDNVIHGFSTRLTDEE  88

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PG++SVLP+   EL TTR+P+FLGL   +  L P SD  +++ +GVLD+GIWP
Sbjct  89    AKLLEAQPGILSVLPEVRYELHTTRTPEFLGL-DKNEGLFPQSDIASEVFVGVLDTGIWP  147

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D+GL P+P+ W+ +CEVG NF  ++CNRK+IGAR + +GYEA +G PI    E 
Sbjct  148   ESLSFDDKGLGPVPSGWKGECEVGKNFNTSNCNRKLIGARFFSKGYEATLG-PIDETKES  206

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH ++ AAGS V  A++ G+A G ARG+AT AR+AVYKVCW+G C +ADI
Sbjct  207   KSPRDDDGHGTHTSTTAAGSVVDGASLFGYAAGAARGMATRARVAVYKVCWIGGCFSADI  266

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ M++A+ DGV+V+S+SL      G    Y +D +A+GAF A+++G++VSC+AGN GP+
Sbjct  267   LAAMEKAIDDGVNVISMSLG-----GGMADYYKDTVAVGAFAAMERGILVSCSAGNAGPN  321

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
              Y+  N+APWI TVGA T+DR+FPA V LGN ++F+G SLYSG       +  VY G+A 
Sbjct  322   SYSLSNVAPWITTVGAGTLDRDFPAYVNLGNGKNFSGVSLYSGKPLPDSLIEFVYAGNAT  381

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L   KV G+IV C++G +   V KG  V QAGGVGMI+ N    G +L
Sbjct  382   NVTNGNLCMVGTLIPEKVAGKIVLCDRGINAR-VQKGFVVKQAGGVGMILANTAANGEEL  440

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P   V    G++I+ Y+ +   PTA I F GT +G  PS P VAAFS RGPN 
Sbjct  441   VADAHLLPATAVGEKTGDMIKNYLFSDPSPTATILFGGTKVGIQPS-PVVAAFSSRGPNA  499

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TPEILKPD+IAPGVNI+A W+G++             FN+ISGTSM+CPHVSGLAA+LK
Sbjct  500   ITPEILKPDLIAPGVNIIAGWSGAVGPTGLSMDSRRVNFNIISGTSMSCPHVSGLAALLK  559

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P WSPAAIKSALMTTAY    +G   + D+ T + +TP  +G+GHVDP  A+DPGLV
Sbjct  560   AAHPDWSPAAIKSALMTTAYITYKNGI-KIQDVATGRASTPFDHGAGHVDPVSALDPGLV  618

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN----  2035
             YD  V+DY+DFLC + Y S +I    R +   D   +   +   LNYPSF++ F      
Sbjct  619   YDITVDDYLDFLCALQYTSLQINSIARRNFTCDATKKY--SVTDLNYPSFAIPFDTAQSG  676

Query  2036  ----NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                    TV Y RT+ NV         VT Q  S V++ V P  L F+   +  +Y VTF
Sbjct  677   RTAAATTTVKYTRTLTNVGTPATYKASVTSQVAS-VKILVEPESLAFSQTNEKKTYTVTF  735

Query  2204  Q--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                S+     SF  L WSDG H+V SPIA SW
Sbjct  736   SGGSMPSGTTSFARLEWSDGKHVVGSPIAFSW  767



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/754 (47%), Positives = 483/754 (64%), Gaps = 44/754 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ K++IV M KS+ P  F  H  WY S + ++S       S+++LY Y++  HGFS RL
Sbjct  7     QDKKTYIVHMAKSQMPASFEQHVHWYDSSLKSVS------GSAQMLYFYDNAIHGFSTRL  60

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +A  L N PG++SVLP+   EL TTRSP+FLGL   S+++ P SD   D+IIGVLD+
Sbjct  61    TPEEAELLENQPGILSVLPELRYELHTTRSPEFLGL-DKSADMFPQSDSVGDVIIGVLDT  119

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF+D GL P+P +W+ +CE G NF + +CNRK+IGAR +  GYEA +G PI  
Sbjct  120   GVWPESKSFADTGLGPVPATWKGQCESGTNFTSANCNRKLIGARFFGNGYEATLG-PIDE  178

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH AS A GS V  A++ G+A G ARG+AT+AR+AVYKVCWLG C 
Sbjct  179   SKESKSPRDDDGHGTHTASAAGGSVVEGASLFGYAAGTARGMATHARVAVYKVCWLGGCF  238

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+A+ADGV+VLS+SL      G    Y +D +AIGAF A++KG++VSC+AGN
Sbjct  239   SSDILAAMDKAIADGVNVLSMSLG-----GGMSDYYKDSVAIGAFAAMEKGILVSCSAGN  293

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP  Y+  N+APWI TVGA T+DR+FPA V+LGN R+++G SL+ G       +P VY 
Sbjct  294   AGPTSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGRNYSGVSLFKGSNLPGKLLPFVYA  353

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C    L   KV G++V C++G +   V KG  V +AGG+GM++ N    
Sbjct  354   GNASNSTNGNLCMMDSLIPEKVAGKLVLCDRGVNAR-VQKGAVVKEAGGLGMVLANTAAN  412

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V   +G++I+ Y+ + S PTA I F+GT +G  PS P VAAFS R
Sbjct  413   GEELVADAHLLPATSVGQKNGDLIKSYLSSDSNPTATILFEGTKVGIQPS-PVVAAFSSR  471

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP+ILKPD+IAPGVNILA W+GS+            EFN+ISGTSM+CPHVSGLA
Sbjct  472   GPNSITPDILKPDLIAPGVNILAGWSGSVGPTGLSTDPRRVEFNIISGTSMSCPHVSGLA  531

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY    +G+  L D  + + +TP  +G+GHVDP  A+D
Sbjct  532   ALLKAAHPDWSPAAIRSALMTTAYVAYKNGQ-KLKDTASGKDSTPFDHGAGHVDPVSALD  590

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD    DY+ FLC + Y + +I    R     D   +   N    NYPSF+V F  
Sbjct  591   PGLVYDLTSEDYLSFLCALNYTASQITSLARRRFSCDSNKKYSLN--DFNYPSFAVNFDT  648

Query  2036  NLQ------TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRID--TLSY  2191
                         Y RT+ NV         ++ Q  + V+++V+P  L F+   +  T + 
Sbjct  649   TQMINGGSSVAKYTRTLTNVVGAGTYKASISGQL-TGVKISVNPQVLNFSQAKEKKTFTV  707

Query  2192  EVTFQSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              VT  SL  + ++F  L WSDG H+V SPIAVSW
Sbjct  708   TVTGSSLPINTNAFARLEWSDGKHVVGSPIAVSW  741



>ref|XP_003550312.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/754 (47%), Positives = 479/754 (64%), Gaps = 46/754 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++I+ M ++  P  F+ H  W+ + + + SP      S+E+LYTY+HVAHGFSARLTP 
Sbjct  41    KTYIIHMDETTMPLTFTDHLSWFDASLKSASP------SAEILYTYKHVAHGFSARLTPK  94

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
                 LA  PG++SV+P+   +L TTR+P FLGL   ++ L P+S+  + ++IG+LD+G+W
Sbjct  95    DVDTLAKQPGILSVIPELKYKLHTTRTPNFLGL-DKATTLLPASEQQSQVVIGLLDTGVW  153

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PE  S  D GL P+P++W+ +CE+G N  +++CNRK++GAR + +GYEA +G PI    E
Sbjct  154   PELKSLDDTGLGPVPSTWKGQCEIGNNMNSSNCNRKLVGARFFSKGYEAALG-PIDTTTE  212

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KSARD +GHG+H  + AAGS V  A++ G A G ARG+AT AR+AVYKVCWLG C  +D
Sbjct  213   SKSARDDDGHGSHTLTTAAGSVVPEASLFGLASGTARGMATQARVAVYKVCWLGGCFTSD  272

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             I +G+D+A+ DGV+VLS+S+      G  + Y  D+IAIG+F A+  G++VS +AGN GP
Sbjct  273   IAAGIDKAIEDGVNVLSMSIG-----GSLMEYYRDIIAIGSFTAMSHGILVSTSAGNGGP  327

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                +  N+APWI TVGA TIDR+FPA +TLG  +++TG SLYSG   S   +P+VY G+A
Sbjct  328   SQGSLSNVAPWITTVGAGTIDRDFPAYITLGTGKTYTGASLYSGKPLSDSPLPLVYAGNA  387

Query  1190  NS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             ++    + C    L   KV G+IV CE+G +   V+KG+ V  AGG GMI+ N    G +
Sbjct  388   SNSSVGYLCLQDSLIPEKVSGKIVICERGGNPR-VEKGLVVKLAGGAGMILANSEAYGEE  446

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  ++  +P A +     EI++ YV ++  PTA+I F GT +   PS P VAAFS RGPN
Sbjct  447   LVADSHLLPAASLGQKSSEILKNYVSSSPNPTAKIAFLGTHLQVQPS-PVVAAFSSRGPN  505

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              LTP+ILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+L
Sbjct  506   ALTPKILKPDLIAPGVNILAGWTGAVGPTGLTVDTRHVSFNIISGTSMSCPHVSGLAAIL  565

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAAI+SALMTTAYT   +G  T+ D+ T QP TP  YG+GHVDP  A+DPGL
Sbjct  566   KGAHPQWSPAAIRSALMTTAYTSYKNGE-TIQDISTGQPGTPFDYGAGHVDPVAALDPGL  624

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF-----  2029
             VYDA V+DY+ F C + Y S +I L  R      C  +        NYPSF+V       
Sbjct  625   VYDANVDDYLGFFCALNYSSFQIKLAARRD--YTCDPKKDYRVEDFNYPSFAVPMDTASG  682

Query  2030  ----KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
                  + L+TV Y R + NV         V     SNV+  V PN L FT+  +   Y V
Sbjct  683   IGGGSDTLKTVKYSRVLTNVGAPGTYKASVMSLGDSNVKTVVEPNTLSFTELYEKKDYTV  742

Query  2198  TF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +F   S+     SF  L W+DG H V SPIA SW
Sbjct  743   SFTYTSMPSGTTSFARLEWTDGKHKVGSPIAFSW  776



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/745 (48%), Positives = 475/745 (64%), Gaps = 39/745 (5%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H +WY S + ++S       S+ELLYTYE+  HGFS RLT  +
Sbjct  31    TYIVHMAKSQMPSSFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFSTRLTQEE  84

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G+WP
Sbjct  85    ADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEHTADLFPEAGSYSDVVVGVLDTGVWP  144

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  S+SD G  PIP+SW+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI    E 
Sbjct  145   ESKSYSDEGFGPIPSSWKGGCEAGTNFTASLCNRKLIGARFFARGYESTMG-PIDESKES  203

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH +S AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C ++DI
Sbjct  204   RSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPRARVAVYKVCWLGGCFSSDI  263

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN GP 
Sbjct  264   LAAIDKAIADNVNV-----LSMSLGGGMSDYYRDGVAIGAFAAMERGILVSCSAGNAGPS  318

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
               +  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G+A 
Sbjct  319   SSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNAS  378

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    G +L
Sbjct  379   NATNGNLCMTGTLIPEKVKGKIVMCDRGINAR-VQKGDVVKAAGGVGMILANTAANGEEL  437

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P   V    G+IIR YV T   PTA I   GTV+G  PS P VAAFS RGPN 
Sbjct  438   VADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPS-PVVAAFSSRGPNS  496

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA+LK
Sbjct  497   ITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLK  556

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
              ++P  SPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV PT A +PGL+
Sbjct  557   SVHPECSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFDHGAGHVSPTTATNPGLI  615

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V   + +  
Sbjct  616   YDLTTEDYLGFLCALNYTSPQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNV-DGVGA  672

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQ  2218
               Y RTV +V      + +VT +T + V+++V P  L F +  +  SY VTF    S   
Sbjct  673   YKYTRTVTSVGGAGTYSVKVTSET-TGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPS  731

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSW  2293
              ++SFGS+ WSDG H+V SP+A+SW
Sbjct  732   GSNSFGSIEWSDGKHVVGSPVAISW  756



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/748 (47%), Positives = 475/748 (64%), Gaps = 39/748 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV M +S+ P  F  H +WY S + ++S       S+ELLYTYE+  HGF+ RLT
Sbjct  29    EHGTYIVHMAQSQMPSSFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFATRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PGV+SVLP+   EL TTR+P FLGL   +++L P +    D+++GVLD+G
Sbjct  83    QDEADSLMAQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTGASTDVVVGVLDTG  142

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  S+SD G  P+P++W+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI   
Sbjct  143   VWPESKSYSDEGFGPVPSTWKGGCETGTNFTASHCNRKLIGARFFARGYESTMG-PIDES  201

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V  A++ G+A G ARG+A +AR+AVYKVCWLG C +
Sbjct  202   KESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPHARVAVYKVCWLGGCFS  261

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN 
Sbjct  262   SDILAAIDKAIADNVNV-----LSMSLGGGTSEYYRDGVAIGAFAAMERGILVSCSAGNA  316

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  ++  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G
Sbjct  317   GPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAG  376

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    G
Sbjct  377   NASNATNGNLCMTGTLIPEKVKGKIVMCDRGINAR-VQKGDVVKAAGGVGMILANTAANG  435

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    G++IR YV T   PTA I   GTV+G  PS P VAAFS RG
Sbjct  436   EELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATISILGTVVGVKPS-PVVAAFSSRG  494

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA
Sbjct  495   PNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAA  554

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV P  A +P
Sbjct  555   LLKAVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFEHGAGHVSPATATNP  613

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GL+YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V  +  
Sbjct  614   GLIYDLTTEDYLGFLCALNYTSSQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNVE-E  670

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QS  2209
                  Y RTV +V      + ++T +T + V+++V P  L F    +  SY VTF    S
Sbjct  671   AGAYKYTRTVTSVGGAGTYSVKLTSETTA-VKISVEPAVLNFKAANEKQSYTVTFTVDSS  729

Query  2210  LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 ++SFG++ WSDG H+V SP+A+SW
Sbjct  730   KASGSNSFGTIEWSDGKHVVGSPVAISW  757



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/748 (47%), Positives = 475/748 (64%), Gaps = 39/748 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV M +S+ P  F  H +WY S + ++S       S+ELLYTYE+  HGF+ RLT
Sbjct  30    EHGTYIVHMAQSQMPSSFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFATRLT  83

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PGV+SVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G
Sbjct  84    QDEADSLMAQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTGASSDVVVGVLDTG  143

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  S+SD G  P+P++W+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI   
Sbjct  144   VWPESKSYSDEGFGPVPSTWKGGCETGTNFTASHCNRKLIGARFFARGYESTMG-PIDES  202

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C +
Sbjct  203   KESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGMAPRARVAVYKVCWLGGCFS  262

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN 
Sbjct  263   SDILAAIDKAIADNVNV-----LSMSLGGGTSEYYRDGVAIGAFAAMERGILVSCSAGNA  317

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  ++  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G
Sbjct  318   GPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAG  377

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    G
Sbjct  378   NASNATNGNLCMTGTLIPEKVKGKIVLCDRGVNAR-VQKGDVVKAAGGVGMILANTAANG  436

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    G++IR YV T   PTA +   GTV+G  PS P VAAFS RG
Sbjct  437   EELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATVSILGTVVGVKPS-PVVAAFSSRG  495

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA
Sbjct  496   PNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAA  555

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV P  A +P
Sbjct  556   LLKAVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFEHGAGHVSPATATNP  614

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GL+YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V  +  
Sbjct  615   GLIYDLTTEDYLGFLCALNYTSSQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNVE-E  671

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QS  2209
                  Y RTV +V      + ++T +T + V+++V P  L F    +  SY VTF    S
Sbjct  672   AGAYKYTRTVTSVGGAGTYSVKLTSETTA-VKISVEPAVLNFKAANEKQSYTVTFTVDSS  730

Query  2210  LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 ++SFG++ WSDG H+V SP+A+SW
Sbjct  731   KASGSNSFGTIEWSDGKHVVGSPVAISW  758



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/750 (48%), Positives = 482/750 (64%), Gaps = 43/750 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY S       L + S S+E+LYTY +  HGF+ RLT
Sbjct  29    QQSTYIVHMAKSQMPSSFDQHSLWYES------SLKSASESAEMLYTYNNAIHGFATRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L   PGVISV  ++  EL TTR+P FLGL   ++ L P +   +D++IGVLDSG
Sbjct  83    PEEADSLMVQPGVISVQSEQQYELHTTRTPLFLGLEVHNAGLFPETGAASDVVIGVLDSG  142

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SFSD G  PIP +W+  C+ G  F  + CNRK+IGAR + RGYEA I  P+   
Sbjct  143   VWPESKSFSDEGYGPIPPTWKGGCDAGTRFTMSLCNRKLIGARFFVRGYEA-INGPVDES  201

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH AS AAGS V  AN+ G A G ARGIA  AR+AVYKVCW   C +
Sbjct  202   KESKSPRDDDGHGTHTASTAAGSVVEGANLLGFANGTARGIAYRARVAVYKVCWQPGCFS  261

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+G+D+A+ D V++      S S +G    Y +D IAIGAF A+++G+ VSC+AGN+
Sbjct  262   SDILAGIDKAIEDNVNI-----LSISLSGITTYYTDD-IAIGAFAAMERGIFVSCSAGNF  315

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQVPVVY  1177
             GP P++  N+APWI TVGA T+DR+FPA+  LGN +++TG SL+ G    P+++ +P +Y
Sbjct  316   GPSPFSVTNIAPWITTVGAGTLDRDFPALAILGNGKNYTGVSLFKGDDELPAKL-LPFIY  374

Query  1178  GGSANS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              G+A+     + CFPG L   KV+G+IV C+ G     +  G  V  AGG+GMI+ NL  
Sbjct  375   AGNASDDAIGYLCFPGTLIPEKVKGKIVMCDTGGVAPAM-IGEVVKSAGGLGMIIANLAG  433

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +++  A  +P   V    G+IIR+YV T   PTA I  +GTV+   PS P +AAFS 
Sbjct  434   RGEEVQAEAHFLPATAVGEKAGDIIRRYVLTDPNPTASIVIQGTVVNVKPS-PVLAAFSS  492

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TP ILKPD+IAPGVNILAAWTGSL            EFN+ISGTSM+CPHVSGL
Sbjct  493   RGPNPITPNILKPDLIAPGVNILAAWTGSLGPTGLASDTRRVEFNIISGTSMSCPHVSGL  552

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK ++P WSPAAI+SALMTTAY     G   +ID+ T +P+TP  +G+GHV PT AV
Sbjct  553   AALLKSVHPEWSPAAIRSALMTTAYNTYKDGN-PIIDISTGKPSTPFEHGAGHVSPTTAV  611

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             +PGL+YD    DY+DFLC + Y+S +I +  R +    C +    +   LNYPSF+V  +
Sbjct  612   NPGLIYDLTTVDYLDFLCALKYNSSQIGVVSRGN--YTCDSSKTYSVADLNYPSFAVNVE  669

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--  2206
              +  T  Y R V +V    + + +VT +T + V++++ P  L F +  +  SY VTF   
Sbjct  670   GS-DTYKYTRPVTSVGGAGSYSVKVTSET-TAVKISIEPAVLNFREVNEKKSYSVTFTVD  727

Query  2207  -SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  728   LSKPSGSNSFGSIEWSDGKHVVASPVAISW  757



>gb|KFK28394.1| hypothetical protein AALP_AA8G509300 [Arabis alpina]
Length=754

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/750 (47%), Positives = 483/750 (64%), Gaps = 41/750 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++  ++IV M +S+ P  F  H +WY S + ++S       S+ELLYTYE+  HGF+ RL
Sbjct  24    QKQGTYIVHMARSQMPSSFQLHSNWYDSSLRSIS------TSAELLYTYENAIHGFATRL  77

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+
Sbjct  78    TQQEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLEEHNADLFPQTGASSDVVVGVLDT  137

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  S+SD G  PIP++W+  CE+G NF A+ CNRK+IGAR + +GYEA +G PI  
Sbjct  138   GVWPESKSYSDEGFGPIPSTWKGTCEIGTNFTASLCNRKLIGARFFSKGYEATMG-PIDE  196

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAGS V  A++ G A G ARG+A  AR+AVYKVCW+G C 
Sbjct  197   SKESRSPRDDDGHGTHTSSTAAGSFVEGASLLGFANGTARGMAPKARVAVYKVCWVGGCF  256

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ +D+A+ D V+V      S S  G    Y  D +AIG+F A++KG++VSC+AGN
Sbjct  257   SSDILAAIDKAIDDNVNV-----LSMSLGGGMSDYYRDSVAIGSFAAMEKGILVSCSAGN  311

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ-PSRIQVPVVY  1177
              GP  ++  N+APWI TVGA T+DR+FPA+  LGN ++++G SL+ G   PS++ +P VY
Sbjct  312   AGPSSFSLSNVAPWITTVGAGTLDRDFPALAVLGNGKNYSGVSLFKGDSLPSKL-LPFVY  370

Query  1178  GGSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              G+A    N   C  G L    V+G+IV C++G +   V KG  V  AGGVGMI+ N   
Sbjct  371   AGNASNATNGNLCMSGTLIPELVKGKIVMCDRGVNAR-VQKGEVVKAAGGVGMILANTAA  429

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  +A  +PT  V    G++IR YV T   PTA +  +GTV+   PS P VAAFS 
Sbjct  430   NGEELVADAHLLPTTAVGQKAGDLIRHYVLTEPNPTASVLIQGTVVNIKPS-PVVAAFSS  488

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGL
Sbjct  489   RGPNSITPNILKPDLIAPGVNILAAWTGAQGPTGLASDSRRVEFNIISGTSMSCPHVSGL  548

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK ++P WSPAAI+SALMTTAY     G+  ++D+ T +P+TP  +GSGHV PT A+
Sbjct  549   AALLKSVHPEWSPAAIRSALMTTAYQTYKDGK-PILDIATGKPSTPFDHGSGHVSPTTAI  607

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             +PGL+YD    DY+ FLC + Y S +I    R +  + C +    +   LNYPSF+V   
Sbjct  608   NPGLIYDLTTEDYLGFLCALNYTSSQIRSVARRN--LTCDSSKSYSVADLNYPSFAVNV-  664

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---  2203
             +      Y RTV +V      + ++  +T + V+++V P  L F +  +  SY VTF   
Sbjct  665   DGAGAYKYTRTVTSVGGSGTYSVKLYSETTA-VKISVEPAVLNFKEVNEKKSYTVTFTVD  723

Query  2204  QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              S    ++SFGS+ WSDG H+V SP+AVSW
Sbjct  724   SSKGSGSNSFGSIEWSDGKHVVASPVAVSW  753



>ref|XP_003544482.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=774

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/754 (47%), Positives = 478/754 (63%), Gaps = 46/754 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++I+ M KS  P  F+ H  W+ S + + SP      S+E+LYTY+HVAHGFS RLTP 
Sbjct  38    KTYIIHMDKSTMPLTFTDHLSWFDSSLKSASP------SAEILYTYKHVAHGFSTRLTPE  91

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
              A  L+  PG++SV+P+   +L TTR+P FLGL   ++ L P+S+  + +IIGVLD+G+W
Sbjct  92    DADTLSKQPGILSVIPELKYKLHTTRTPSFLGL-DKATTLLPASEQQSQVIIGVLDTGVW  150

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PE  S  D GL P+P++W+ +CE+G N  +++CNRK++GAR + +GYEA +G PI    E
Sbjct  151   PELKSLDDTGLGPVPSTWKGQCEIGNNMNSSNCNRKLVGARFFSKGYEAALG-PIDTTTE  209

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KSARD +GHG+H  + AAGS V  A++ G A G ARG+AT AR+AVYKVCWLG C  +D
Sbjct  210   SKSARDDDGHGSHTLTTAAGSVVPEASLFGLASGTARGMATQARVAVYKVCWLGGCFTSD  269

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             I +G+D+A+ DGV+VLS+S+      G  + Y  D+IAIG+F A   G++VS +AGN GP
Sbjct  270   IAAGIDKAIEDGVNVLSMSIG-----GSLMEYYRDIIAIGSFTATSHGILVSTSAGNGGP  324

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                +  N+APWI TVGA TIDR+FPA +TLG  +++TG SLY G   S   +P+VY G+A
Sbjct  325   SQGSLSNVAPWITTVGAGTIDRDFPAYITLGTGKTYTGASLYRGKPLSDSPLPLVYAGNA  384

Query  1190  NS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             ++    + C    L   KV G+IV CE+G +   V+KG+ V  AGG GMI+ N    G +
Sbjct  385   SNSSVGYLCLQDSLIPEKVSGKIVICERGGNPR-VEKGLVVKLAGGAGMILANSEAYGEE  443

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  ++  +P A +     EI++ YV ++  PTA+I F GT +   PS P VAAFS RGPN
Sbjct  444   LVADSHLLPAASLGQKSSEILKNYVSSSPNPTAKIAFLGTHLQVQPS-PVVAAFSSRGPN  502

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              LTP+ILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+L
Sbjct  503   ALTPKILKPDLIAPGVNILAGWTGAVGPTGLTVDSRHISFNIISGTSMSCPHVSGLAAIL  562

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAAI+SALMTTAYT   +G  T+ D+ T QP TP  YG+GHVDP  A+DPGL
Sbjct  563   KGAHPQWSPAAIRSALMTTAYTSYKNGE-TIQDVSTGQPATPFDYGAGHVDPVAALDPGL  621

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL-  2041
             VYDA V+DY+ F C + Y S +I L  R      C ++ +      NYPSF+V  +    
Sbjct  622   VYDANVDDYLGFFCALNYSSFQIKLAARRD--FTCDSKKVYRVEDFNYPSFAVPLETTSG  679

Query  2042  --------QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
                     +TV Y R + NV         V      NV++ V P  L FT+  +   Y V
Sbjct  680   IGGGSDAPKTVKYSRVLTNVGAPGTYKASVVSLGDLNVKIVVEPETLSFTELYEKKGYMV  739

Query  2198  TFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +F+  S+     SF  L W+DG H V SPIA SW
Sbjct  740   SFRYTSMPSGTTSFARLEWTDGKHRVGSPIAFSW  773



>ref|XP_010519206.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010519207.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=775

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/753 (48%), Positives = 474/753 (63%), Gaps = 35/753 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
              E K+++V M K+  P+ +S H +WYSS+I ++   ++    + +LYTY+ V HG +ARL
Sbjct  30    REKKTYVVHMDKTAMPESYSDHIEWYSSMIKSVVSETHVEEETRILYTYQKVFHGVAARL  89

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN--LGPSSDYGADIIIGVL  460
             +  +A  L    GV++V+P+R  EL TTRSP FLGL    S   +        D+I+GVL
Sbjct  90    SKEEAGRLEQESGVVAVIPERRYELHTTRSPTFLGLERRDSENTVWEEKLMDHDVIVGVL  149

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+GIWPE  SF+D G++P+P +WR  CE G  F    CNRKI+GAR +Y+GYEA  GK  
Sbjct  150   DTGIWPESQSFNDTGMSPVPATWRGACETGRGFTKNHCNRKIVGARVFYKGYEAATGKID  209

Query  641   VG-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD +GHGTH A+  AGS V  AN+ G+A G ARG+A  ARIA YKVCW+G C
Sbjct  210   EQLEYKSPRDRDGHGTHTAATVAGSPVRGANLLGYAYGTARGMAPRARIAAYKVCWVGGC  269

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DILS +D+AVADGVHVLS+SL      G    Y  D ++I AFGA++ GV VSC+AG
Sbjct  270   FSSDILSAVDRAVADGVHVLSISLG-----GGISTYYRDSLSIAAFGAMEMGVFVSCSAG  324

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPV  1171
             N GPDP +  N++PWI TVGAST+DR+FPA V LG+ R+  G SLY G  V     Q P+
Sbjct  325   NGGPDPISLTNVSPWITTVGASTMDRDFPATVNLGSGRTVRGVSLYKGTTVLSKNRQYPL  384

Query  1172  VYGGSAN-----SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
             VY GS       S +C  G LD   V G+IV C++G  T  V KG  V +AGG+GMI+ N
Sbjct  385   VYMGSNASSPDPSSFCLDGALDRRHVAGKIVICDRG-VTPRVQKGQVVREAGGIGMILTN  443

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  +   +P   V   +G++I+QY  T+  PTA ++  GT +G  PS P VAA
Sbjct  444   TATNGEELVADCHLLPAVAVGEKEGKMIKQYAMTSRRPTANLQILGTRLGIKPS-PVVAA  502

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGPNFLT EILKPD++APGVNILAAWTG +            +FN++SGTSM+CPHV
Sbjct  503   FSSRGPNFLTLEILKPDLVAPGVNILAAWTGDMGPSSLSSDHRRVKFNILSGTSMSCPHV  562

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SG+AA++K  +P WSPAAIKSAL+TTAY  DN+    L D  T  P+TP+ +G+GH++P 
Sbjct  563   SGVAALIKARHPDWSPAAIKSALLTTAYVHDNN-LNPLRDASTGAPSTPYDHGAGHINPL  621

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+DPGLVYD G  DY +FLCT      ++ +F R+S  + CRN  L  PG LNY + S 
Sbjct  622   KALDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFSRHSNRI-CRN-TLSGPGDLNYAAISA  679

Query  2024  LF--KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             +F    N+  +   RTV NV      +Y+V V       V V P  L FT +   LSY +
Sbjct  680   VFTENTNVSALTLHRTVTNVGP-HVSSYKVVVSPFKGASVIVEPKMLNFTSKHQKLSYRI  738

Query  2198  TFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             TF++ LRQ    FG L W   TH V SPI V+W
Sbjct  739   TFRTKLRQKRPEFGGLVWRSSTHKVRSPIVVTW  771



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/760 (47%), Positives = 487/760 (64%), Gaps = 52/760 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E +++IV M KSE P +F  H  WY S + ++S       S+E+LYTY +V HGFS RLT
Sbjct  28    EKRTYIVHMAKSEMPAVFQDHTHWYDSSLKSVS------DSAEMLYTYNNVIHGFSTRLT  81

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  +   PG++SVLP+   EL TTR+P FLGL   ++ + P SD  +++I+GVLD+G
Sbjct  82    PEEAQAMETRPGILSVLPELRYELHTTRTPSFLGLDQNAA-MFPESDSVSEVIVGVLDTG  140

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D G  P+P+SW+ +CE+G NF  ++CNRK++GAR + RGYEA +G PI   
Sbjct  141   VWPESPSFDDTGFGPVPSSWKGECEIGTNFTKSNCNRKLVGARYFARGYEATLG-PIDES  199

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V+ A++ G+A G ARG+A  +R+AVYKVCW+G C +
Sbjct  200   KESRSPRDDDGHGTHTSSTAAGSVVSGASLFGYAAGTARGMAPRSRVAVYKVCWIGGCFS  259

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ MD+A+ D  +VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN 
Sbjct  260   SDILAAMDKAIDDNANVLSLSLG-----GGMSDYYRDSVAIGAFAAMEKGILVSCSAGNA  314

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  Y+  N+APWI TVGA T+DR+FPA V+LGN ++F+G SLY G       +P VY G
Sbjct  315   GPSAYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGVSLYRGDSLPGKLLPFVYAG  374

Query  1184  S----ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +     N   C  G L   KV+G+IV C++G +   V KG  V  AGG+GM++ N    G
Sbjct  375   NVSNVTNGNLCMTGTLIPEKVKGKIVLCDRGVNPR-VQKGSVVKAAGGIGMVLTNTAANG  433

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V  + GE I+QY+ + S PTA + F+GT +G  PS P VAAFS RG
Sbjct  434   EELVADAHLLPATAVGQSTGEAIKQYLFSDSNPTATVLFEGTKVGIEPS-PVVAAFSSRG  492

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +T EILKPD+IAPGVNILA W+G++             FN+ISGTSM+CPHVSGLAA
Sbjct  493   PNSITAEILKPDLIAPGVNILAGWSGAVGPTGLAEDDRRVAFNIISGTSMSCPHVSGLAA  552

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTTAYT   +G+  + D+ T +P+TP  +G+GHVDP  A++P
Sbjct  553   LLKAAHPDWSPAAIRSALMTTAYTAYKNGK-LIQDVSTGKPSTPFDHGAGHVDPVSALNP  611

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD GV DY++FLC + Y S +I    R      C  R   +   LNYPSF+V  +  
Sbjct  612   GLVYDLGVEDYLNFLCALNYTSAQIKSLARRD--FSCDTRKTYSVNDLNYPSFAVPLQAQ  669

Query  2039  L------------QTVIYKRTVKNVAKVRNVAYQV-TVQTPSNVRVTVSPNRLVFTDRID  2179
             +              V + RT+ NV       Y+V T  +  +V+++V P  L F+   +
Sbjct  670   MGSTGGSGSGTGSTVVKHTRTLTNVGPPGT--YKVSTSSSSDSVKISVDPATLTFSQTNE  727

Query  2180  TLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               SY VTF   S+  + + F  + WSDG H+V SP+A+SW
Sbjct  728   KKSYTVTFTAPSMPSNTNEFARIEWSDGKHVVGSPVAISW  767



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/748 (47%), Positives = 473/748 (63%), Gaps = 39/748 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV M +S+ P  F  H +WY S + ++S       S+ELLYTYE+  HGF+ RLT
Sbjct  30    EQGTYIVHMAQSQMPSSFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFATRLT  83

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PGV+SVLP+   EL TTR+P FLGL   +++L P +    D+++GVLD+G
Sbjct  84    QDEADSLMTQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTGASTDVVVGVLDTG  143

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  S+SD G  P+P++W+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI   
Sbjct  144   VWPESKSYSDEGFGPVPSTWKGGCETGTNFTASHCNRKLIGARFFARGYESTMG-PIDES  202

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V  A++ G A G ARG++  AR+AVYKVCWLG C +
Sbjct  203   KESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGTARGMSPRARVAVYKVCWLGGCFS  262

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN 
Sbjct  263   SDILAAIDKAIADNVNV-----LSMSLGGGTSEYYRDGVAIGAFAAMERGILVSCSAGNA  317

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  ++  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G
Sbjct  318   GPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAG  377

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV+G+IV C++G +   V KG  V +AGGVGMI+ N    G
Sbjct  378   NASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNAR-VQKGDVVKEAGGVGMILANTAANG  436

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    G++IR YV T   PTA I   GTV+G  PS P VAAFS RG
Sbjct  437   EELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATISILGTVVGVKPS-PVVAAFSSRG  495

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP ILKPD+IAPGVNILAAWT +             EFN+ISGTSM+CPHVSGLAA
Sbjct  496   PNSITPNILKPDLIAPGVNILAAWTRAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAA  555

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV P  A +P
Sbjct  556   LLKAVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFEHGAGHVSPATATNP  614

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GL+YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V  +  
Sbjct  615   GLIYDLTTEDYLGFLCALNYTSSQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNVE-E  671

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QS  2209
                  Y RTV +V      + ++T +T + V+++V P  L F    +  SY VTF    S
Sbjct  672   AGAYKYTRTVTSVGGAGTYSVKLTSETTA-VKISVEPAVLNFKAANEKQSYTVTFTVDSS  730

Query  2210  LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 ++SFG++ WSDG H+V SP+A+SW
Sbjct  731   KASGSNSFGTIEWSDGKHVVGSPVAISW  758



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/755 (48%), Positives = 480/755 (64%), Gaps = 49/755 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K+++V M KS  P  F+ H +WY S + ++S       S+ +LYTY++V HGFS RLT  
Sbjct  31    KTYVVHMDKSTMPATFNDHFEWYDSSLKSVSA------SAAMLYTYKNVIHGFSTRLTAK  84

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A  L   PG++SVLP+   EL TTR+P+FLGL   S  L P+S+  +++I+GVLD+G+W
Sbjct  85    EAESLQKQPGIVSVLPEVRYELHTTRTPEFLGL-GKSETLFPASEAQSEVIVGVLDTGVW  143

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PE  SF D G+ P+P  W+  CEVG NF ++SCNRK+IGAR++ RGYE  +G PI    E
Sbjct  144   PEIKSFDDTGMGPVPRGWKGVCEVGRNFKSSSCNRKLIGARSFSRGYEEAVG-PIDETAE  202

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD +GHGTH ++ AAGS V  A++ G A G ARG+A  AR+A YKVCWL  C  +D
Sbjct  203   SKSPRDDDGHGTHTSTTAAGSVVNGASLFGFASGTARGMAAQARVATYKVCWLAGCFGSD  262

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+GMD+AV DGV+V      S S  G    Y  D +AIGAF A+ +G+ VSC+AGN GP
Sbjct  263   ILAGMDKAVEDGVNV-----LSMSIGGGLTDYYRDTVAIGAFTAMAQGIFVSCSAGNGGP  317

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
                +  N+APWI TVGA T+DR+FP  V LGN ++F+G SLYS    S   VP+V     
Sbjct  318   YADSISNVAPWITTVGAGTLDRDFPTYVRLGNGKNFSGVSLYSRRPSSGSMVPIVDAADV  377

Query  1190  NSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             +S      C  G L  +KV G+IV C++G + S V+KGV V  AGGVGMI+ N  + G +
Sbjct  378   SSTSSGNLCMTGSLIPAKVAGKIVVCDRGGN-SRVEKGVEVKDAGGVGMILTNTDSYGEE  436

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P+A V    G+ I+ Y+ +   P A I  +GT +G  PS P VAAFS RGPN
Sbjct  437   LVADAQLLPSANVGEKAGDAIKNYISSDPGPMATIISRGTQLGIQPS-PVVAAFSSRGPN  495

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+L
Sbjct  496   PITPEILKPDLIAPGVNILAGWTGAVGPTGLESDKRHVSFNIISGTSMSCPHVSGLAALL  555

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSP+AIKSALMTTAY+ + +G+ TL+D+ T QP+TP  +G+GHVDP  A+DPGL
Sbjct  556   KAAHPEWSPSAIKSALMTTAYSTNGNGK-TLLDISTGQPSTPFDFGAGHVDPVAALDPGL  614

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFL-RNSPLVDCRNRNLGNPGSLNYPSFSVLFKN--  2035
             VYDA V DY+DFLC + Y S +I     R+   +  +  +LG+   +NYPSFSV F+   
Sbjct  615   VYDATVQDYLDFLCALDYSSFQIKQATNRDFACLSSKTYSLGD---VNYPSFSVPFETAS  671

Query  2036  -------NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                       TV Y RT+ NV               ++V++ V P  L F+ + +  SY 
Sbjct  672   GTWGGVGATSTVKYTRTLTNVG-TPTTYMVSVSSQSTSVKILVEPESLSFSRQYEKKSYV  730

Query  2195  VTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF   S+     SF  L+WSDG H+V SPIA SW
Sbjct  731   VTFTASSMPSGTTSFARLQWSDGKHVVGSPIAFSW  765



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/759 (47%), Positives = 485/759 (64%), Gaps = 43/759 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             EE KS+IV+M KS KP  FS H  WY+S+I  +S   + S  + +LY Y+ V HGFSA+L
Sbjct  30    EEIKSYIVYMDKSMKPDHFSLHQHWYASMIDRVS--GSKSDPAAMLYMYDTVMHGFSAKL  87

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T + A  + N+ G ++V PD L  L TTR+P FLGL S    L P S YG D+I+G+LD+
Sbjct  88    TSTGAQAMENIDGCLAVFPDSLSRLHTTRTPDFLGLNS-IDGLWPQSHYGEDVIVGLLDT  146

Query  467   GIWPERSSFSDRGLNP-IPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV  643
             G+WPE  SFSD GL   +P  W+ +CEVG +F A+ CN K+IGAR + +GYEA  G+   
Sbjct  147   GVWPESKSFSDEGLTSRVPAKWKGECEVGSDFNASHCNNKLIGARYFVKGYEAMYGRIDK  206

Query  644   GEP-KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
              E  +S RD +GHGTH +S AAGS V  A++ G ARG ARGIAT AR+AVYKVCW  TC 
Sbjct  207   KEDYRSPRDADGHGTHTSSTAAGSEVPGASLFGFARGTARGIATKARLAVYKVCWAVTCV  266

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             N+D+L+GM+ AVADGV +LSLSL         +PY  D IAIGA GA++KGV VSC+AGN
Sbjct  267   NSDVLAGMEAAVADGVDLLSLSLGIVDD----VPYYHDTIAIGALGAIEKGVFVSCSAGN  322

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP  Y   N APWI TVGASTIDREFPA V LGN +S+ G+SL      ++ Q+P+VYG
Sbjct  323   AGP--YAIFNTAPWITTVGASTIDREFPAPVVLGNGKSYMGSSLDKDKTLAKEQLPLVYG  380

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
              +A+S     +C  G LD   VRG+IV C+  ++   ++KG+ V +AGG GMI+ +   E
Sbjct  381   KTASSKQYANFCIDGSLDPDMVRGKIVLCDL-EEGGRIEKGLVVRRAGGAGMILASQFKE  439

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
                    ++ +P  +V +  GE I+ Y+ T   P A I+ +G  +     AP V AFS R
Sbjct  440   EDYSATYSNLLPATMVDLKAGEYIKAYMNTTRNPLATIKTEGLTVIGKARAPVVIAFSSR  499

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLA  1675
             GPN + PEILKPD++APGVNILAAWTG  +           +FN+ISGTSM+CPHV+G+A
Sbjct  500   GPNRVAPEILKPDLVAPGVNILAAWTGHTSPTGLISDKRRVDFNIISGTSMSCPHVAGIA  559

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+++  +P+W+PAAIKSALMT++   DN  +  + D  T  P    A G+GHV+P  A+D
Sbjct  560   ALIRSAHPAWTPAAIKSALMTSSALFDNR-KSPISDSITALPADALAMGAGHVNPNAALD  618

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLV-DCRNRNLGNPGSLNYPSFSVLFK  2032
             PGLVYD G++DYV FLC++ Y ++ I +  +N+      R+R    PG LNYPSFSV+FK
Sbjct  619   PGLVYDLGIDDYVSFLCSLNYTAKHIQILTKNATSCPKLRSR----PGDLNYPSFSVVFK  674

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
                   + +RTV NV    +V Y++ V++P NV V V P  L FT + +  +Y V F+S 
Sbjct  675   PRSLVRVTRRTVTNVGGAPSV-YEMAVESPENVNVIVEPRTLAFTKQNEKATYTVRFESK  733

Query  2213  RQSADS------FGSLRW---SDGTHLVTSPIAVSWEGR  2302
               S +       FG + W     GT +V SP+A++W+ +
Sbjct  734   IASDNKSKRHRGFGQILWKCVKGGTQVVRSPVAIAWKDK  772



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/748 (48%), Positives = 479/748 (64%), Gaps = 41/748 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M KSE P  F  H  WY S + ++S       S+++LYTY++V HGFS +LT  
Sbjct  31    KTYIVHMAKSEMPASFLHHTHWYDSSLKSVS------DSAQMLYTYDNVIHGFSTQLTNE  84

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A +L +  G+++VLP+   EL TTR+PQFLGL S +++L P SD  +++I+GVLD+G+W
Sbjct  85    EAQQLESQAGILAVLPELRYELHTTRTPQFLGL-SKAADLFPESDSASEVIVGVLDTGVW  143

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             PE  SF+D GL PIP+ W+  CE G NF +++CNRK+IGAR + +GYEA +G PI    E
Sbjct  144   PESKSFADTGLGPIPSGWKGACEAGTNFNSSNCNRKLIGARYFAKGYEATLG-PIDETKE  202

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD +GHG+H AS AAGS V  A++ G+A G ARG+AT AR+A+YKVCW+G C ++D
Sbjct  203   SKSPRDDDGHGSHTASTAAGSVVEGASLFGYAEGTARGMATRARVAIYKVCWIGGCFSSD  262

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+ M++A+ D V+VLS+SL      G    Y  D +AIGAF A++KG++VSC+AGN GP
Sbjct  263   ILAAMEKAIDDNVNVLSMSLG-----GGMSDYYRDSVAIGAFAAMEKGILVSCSAGNAGP  317

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA  1189
              PY+  N+APWI TVGA T+DR+FPA VTLGN R+++G SLY G       +P VY G+A
Sbjct  318   SPYSLSNVAPWITTVGAGTLDRDFPAYVTLGNGRNYSGVSLYRGSPLPGKLLPFVYAGNA  377

Query  1190  ----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
                 N   C  G L   KV G+IV C++G +   V KG  V  AG VGMI+ N    G +
Sbjct  378   SNATNGNLCMMGTLIPEKVAGKIVLCDRGMNAR-VQKGAVVKAAGAVGMILANTAANGEE  436

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P   V    G+ I+ Y+ +   PT  I F+GT +G  PS P VAAFS RGPN
Sbjct  437   LVADAHLLPATAVGQKSGDAIKGYLFSNPNPTVTIFFEGTKVGIEPS-PVVAAFSSRGPN  495

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TPEILKPD IAPGVNILA W+G++            EFN+ISGTSM+CPHVSGLAA+L
Sbjct  496   SITPEILKPDFIAPGVNILAGWSGAVGPTGLVTDTRRVEFNIISGTSMSCPHVSGLAALL  555

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAAI+SALMTTAYT D   +  + D+ T + +TP  +G+GHVDP  A++PGL
Sbjct  556   KAAHPDWSPAAIRSALMTTAYT-DYKNKEKMQDIATGKASTPFDHGAGHVDPVSALNPGL  614

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN---  2035
             VYD  V DY+ FLC + Y   +I    R +   D   +   +   LNYPSFSV F     
Sbjct  615   VYDLTVEDYLGFLCALNYSEFQIRSLARRNFSCDASKKY--SVTDLNYPSFSVNFDTITG  672

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR  2215
                 V Y RT+ NV         ++ QTP  V++++ P  L F+   +  SY VT     
Sbjct  673   GSSVVKYTRTLTNVGSPGTYKASISPQTP-GVKISIQPETLSFSQANEKKSYTVTVTGSS  731

Query  2216  QSAD--SFGSLRWSDGTHLVTSPIAVSW  2293
             Q ++  SF  L WSDG + V SPIA+SW
Sbjct  732   QPSNTFSFARLEWSDGKYTVGSPIAISW  759



>emb|CDY29697.1| BnaA04g17300D [Brassica napus]
Length=747

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/748 (49%), Positives = 487/748 (65%), Gaps = 50/748 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY+S + ++S       S+ELLYTY +  HGFS RLT
Sbjct  29    QQATYIVHMAKSQMPSSFDLHSLWYASSLKSVS------ESAELLYTYNNAIHGFSTRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L   PGVISVLP++  EL TTR+P FLGL   + +L P ++  +D+++GV+D+G
Sbjct  83    PQEADSLMTQPGVISVLPEQQYELHTTRTPLFLGLDVHNGDLFPETEASSDVVVGVIDTG  142

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPER SFSD+G  PIP++W+ KCEVG NF A+ CNRK+IGAR + RGYEAE G PI   
Sbjct  143   VWPERKSFSDKGYGPIPSTWKGKCEVGTNFTASLCNRKLIGARFFARGYEAEKG-PIDES  201

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGS V  AN  G A G ARG+A  AR+AVYKVCW G C +
Sbjct  202   KESRSPRDDDGHGTHTSSTAAGSVVEGANFLGFANGTARGMAPGARLAVYKVCWKGGCFD  261

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +D+L+ +D+A+ D V+VLS+S+         L Y  + IAIGAF A+++G++VSC+AGN 
Sbjct  262   SDVLAAIDKAIDDNVNVLSISMDD-----LTLDYYRNDIAIGAFAAMERGILVSCSAGNS  316

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP      N+APWI TVGA TIDR+FPA+V LGN  +++G SL  G     + +P VY G
Sbjct  317   GPRSSDISNVAPWITTVGAGTIDRDFPALVILGNGNNYSGVSLIKGDALPEL-LPFVYAG  375

Query  1184  SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
             +A++        + +  +G+IV C++G +   V+KG  V   GG+GMI+ N    G +L 
Sbjct  376   NASN------ATNGNFFKGKIVMCDRGVNFR-VEKGEVVKAVGGLGMILANTAENGEELV  428

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              +A  +P   V    GEIIR YV T   PTA I  +GTV+   PS P VAAFS RGPN  
Sbjct  429   ADAHLLPATAVGEKAGEIIRHYVITHPNPTASILTQGTVVNVQPS-PVVAAFSLRGPNPT  487

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA+LK 
Sbjct  488   TPNILKPDLIAPGVNILAAWTGAKGPTELASDTRRVEFNIISGTSMSCPHVSGLAALLKS  547

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
             ++P WSPAAI+SALMTTAY+    G+  LID+ T +P+TP  +G+GHV PT AV+PGL+Y
Sbjct  548   VHPEWSPAAIRSALMTTAYSTYKDGK-PLIDIATGKPSTPFDHGAGHVSPTMAVNPGLIY  606

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNLQ-  2044
             D    DY+DFLC + Y S +I    R +   D  +  ++GN   LNYPSF++    N+Q 
Sbjct  607   DILTVDYLDFLCALNYTSSQIMKVSRRNYTCDPSKTYSVGN---LNYPSFAL----NVQG  659

Query  2045  --TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---S  2209
                  Y RTV NV +  + + +VT +T + V ++V P  L F +  +  SY VTF    S
Sbjct  660   SGAYTYTRTVTNVGEAGSYSVKVTSET-TIVNISVVPAVLNFKEVNEKKSYSVTFNVDSS  718

Query  2210  LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 ++SFGS++WSDG H+V SP+A+SW
Sbjct  719   KASGSNSFGSIQWSDGIHVVGSPVAISW  746



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/756 (48%), Positives = 475/756 (63%), Gaps = 54/756 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P  F  H  WY +       L + S S+E+LYTY +  HGFS +LTP +
Sbjct  28    TYIVHMAKSEMPASFQHHTHWYDA------SLKSASDSAEMLYTYSNAIHGFSTQLTPEE  81

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGV+ VLP+   EL TTR+P+FLGL   ++ L P S   +D+IIGVLD+G+WP
Sbjct  82    AEMLKFQPGVLFVLPELKYELHTTRTPEFLGL-DQNNELFPESQSASDVIIGVLDTGVWP  140

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D GL P+P SW+  CEVG NF +++CNRK+IGAR + +GYEA +G PI    E 
Sbjct  141   ESKSFDDSGLGPVPASWKGTCEVGTNFSSSACNRKLIGARYFSKGYEATLG-PIDTSKES  199

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH ++ AAGS V  A++ G+A G ARG+AT ARIA YKVCWLG C ++DI
Sbjct  200   KSPRDDDGHGTHTSTTAAGSVVTGASLFGYAPGTARGMATRARIAAYKVCWLGGCFSSDI  259

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L  +DQA+ D V+V      S S  G    Y  D +AIGAF A++KG+++SC+AGN GP 
Sbjct  260   LMAIDQAIDDNVNV-----LSMSLGGGMSDYFRDSVAIGAFSAMEKGILISCSAGNAGPS  314

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI--QVPVVYGGS  1186
              Y+  N APWI TVGA T+DR+FPA ++LGN ++F+G SLY G   +      P +Y G+
Sbjct  315   AYSLSNSAPWITTVGAGTLDRDFPAFLSLGNGKNFSGVSLYRGNSEATALEMTPFIYAGN  374

Query  1187  ANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             A++      C  G L   KV+G+IV C++G +   V KG  V  AGGVGM++ N    G 
Sbjct  375   ASNSTSGNLCMMGSLIPEKVKGKIVMCDRGVNAR-VQKGTVVKAAGGVGMVLSNTGANGE  433

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  +P   V   + ++I+ Y+ +   PTA I F+GT +G  PS P VAAFS RGP
Sbjct  434   ELVADAHLLPATAVGQKNADLIKSYLFSDPNPTAAILFEGTKVGIEPS-PVVAAFSSRGP  492

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAM  1681
             N +TP+ILKPD++APGVNILA W+G++             FN+ISGTSM+CPHVSGLAA+
Sbjct  493   NSITPDILKPDMVAPGVNILAGWSGAVGPTGLAVDSRRVAFNIISGTSMSCPHVSGLAAL  552

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             LK  +P WSPAAI+SALMTTAYT   SG+  L D+ T +P+TP  +G+GHVDP  A++PG
Sbjct  553   LKGAHPEWSPAAIRSALMTTAYTAYKSGQ-KLQDVATGKPSTPFDHGAGHVDPVSALNPG  611

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             LVYD  V+DY++FLC + Y   +I    +      C      +   LNYPSF+V    NL
Sbjct  612   LVYDLTVDDYLNFLCALNYTETEITSLAKRK--FTCDESKSYSVRDLNYPSFAV----NL  665

Query  2042  QT--------VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             +T          Y RT+ NV         VT   P NV++TV P  L F    +  SY V
Sbjct  666   ETGSSSKSTVSKYSRTLTNVGPAGTYKVTVTQDNP-NVKITVEPESLSFAAANEKKSYTV  724

Query  2198  TFQ---SLRQSA-DSFGSLRWSDGTHLVTSPIAVSW  2293
             +F    SL  S  +SFG L WSDG H+V SPIA+SW
Sbjct  725   SFAVTGSLPTSTLNSFGRLEWSDGKHIVGSPIAISW  760



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/747 (47%), Positives = 481/747 (64%), Gaps = 43/747 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P  F  H  WY S + ++S       S+ELLYTY +  HGFS RLTP +
Sbjct  32    TYIVHMEKSEMPSSFDLHSLWYDSSLRSVS------ESAELLYTYTNAIHGFSTRLTPEE  85

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G+WP
Sbjct  86    ADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDIHNADLFPETGASSDVVVGVLDTGVWP  145

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SFSD G  PIP++W+  CEVG NF A+ CNRK+IGAR + RGYEA +G P+    E 
Sbjct  146   ESKSFSDEGFGPIPSTWKGGCEVGTNFTASLCNRKLIGARFFARGYEATMG-PVDESKES  204

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH +S AAGS V  A++ G A G ARG+A  AR+AVYKVCW G C ++DI
Sbjct  205   RSPRDDDGHGTHTSSTAAGSVVEGASLLGFANGTARGMAPRARVAVYKVCWQGGCFSSDI  264

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A+ D V+V      S S  G    Y  D +AIG+F A+++G++VSC+AGN GP 
Sbjct  265   LAAIDKAIDDNVNV-----LSMSLGGGMSDYYRDGVAIGSFAAMERGILVSCSAGNAGPS  319

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG-VQPSRIQVPVVYGGSA  1189
              ++  N+APWI TVGA TIDR+FPA+  LGN ++++G SL+ G   P+++ +P VY G+A
Sbjct  320   SFSLSNVAPWITTVGAGTIDRDFPALAILGNGKNYSGVSLFKGDALPAKL-LPFVYAGNA  378

Query  1190  ----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
                 N   C  G L   KV+G+IV C++G +   V KG  V  AGG+GMI+ N    G +
Sbjct  379   SNATNGNLCMTGTLIPEKVKGKIVMCDRGVNAR-VQKGDVVKAAGGLGMILANTAANGEE  437

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P   V    G+IIR YV T   PTA I  +GTV+   PS P VAAFS RGPN
Sbjct  438   LVADAHLLPATTVGEKAGDIIRHYVLTDPNPTATILIQGTVVNVQPS-PVVAAFSSRGPN  496

Query  1538  FLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSGLAAML  1684
              +TP ILKPD+IAPGVNILA WTG+             EFN+ISGTSM+CPHVSGLAA++
Sbjct  497   SITPNILKPDLIAPGVNILAGWTGAEGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALI  556

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K ++P WSPAAI+SALMTTAY     G+  ++D+ T +P+TP  +G+GHV PT A++PGL
Sbjct  557   KSVHPEWSPAAIRSALMTTAYKTYKDGK-PILDIATGKPSTPFDHGAGHVSPTTAINPGL  615

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKNNL  2041
             +YD    DY+ FLC + Y S +I    R +   D  ++ ++ +   LNYPSF+ L  +  
Sbjct  616   IYDLTTADYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYSIAD---LNYPSFA-LNVDGA  671

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSL  2212
                 Y RTV +V      + ++T +T + V+++V P  L F +  +  SY VTF    S 
Sbjct  672   GAYKYTRTVTSVGGAGTYSVKITSETTA-VKISVQPAVLNFKEANEKKSYTVTFTVDSSK  730

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                ++SFGS+ WSDG H+V SP+A+SW
Sbjct  731   ASGSNSFGSIEWSDGKHVVASPVAISW  757



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/762 (48%), Positives = 471/762 (62%), Gaps = 47/762 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFST-HHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
             E+ K++IV M KS  P  ++  H +WY + + ++S  SN      +LY Y+ V HGFSAR
Sbjct  27    EKRKTYIVHMAKSAMPAEYADDHREWYGASLRSVSAASN------MLYAYDTVLHGFSAR  80

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG---PSSDYGADIIIG  454
             LT  +A++LA + GV++V P+   EL TTR+P+FLG+  G ++ G   P S   AD+++G
Sbjct  81    LTAQEAADLACLGGVLAVNPEARYELHTTRTPEFLGIADGGADQGGLFPQSGTAADVVVG  140

Query  455   VLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK  634
             VLD+G+WPE  S+ D GL  +P+ W+ +C  G  F A++CNRK++GAR + RGYEA +G 
Sbjct  141   VLDTGVWPESRSYDDAGLGEVPSFWKGRCVEGAGFNASACNRKLVGARFFNRGYEAAMGP  200

Query  635   PIVG-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLG  811
                  E +S RD +GHGTH +S AAG+AV  A++ G A G ARG+A  AR+AVYKVCWLG
Sbjct  201   MDTDRESRSPRDDDGHGTHTSSTAAGAAVPGASLFGFASGTARGMAPRARVAVYKVCWLG  260

Query  812   TCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C ++DIL+GMD AVADG  VLSLSL      G A  Y  D +AIGAF A+++ V+VSC+
Sbjct  261   GCFSSDILAGMDAAVADGCGVLSLSLG-----GGAADYSRDSVAIGAFSAMEQNVLVSCS  315

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPV  1171
             AGN GP   T  N+APWI TVGA T+DR+FPA V LGN +++TG SLYSG       +P+
Sbjct  316   AGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVALGNGKNYTGVSLYSGKALPSTPLPI  375

Query  1172  VYGGSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             +Y  +A++      C PG L   KV G+IV C++G  ++ V KG  V  AGG GM++ N 
Sbjct  376   IYAANASNSTAGNLCMPGTLTPEKVAGKIVVCDRGV-SARVQKGFVVRDAGGAGMVLSNT  434

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  +A  +P   V   +G  I+ YV +   PTA I   GT +G  PS P VAAF
Sbjct  435   AANGQELVADAHLLPATGVGEREGVAIKSYVASDPSPTATIVVAGTQVGVHPS-PVVAAF  493

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPN +TPEILKPD+IAPGVNILAAWTG               FN+ISGTSM+CPHVS
Sbjct  494   SSRGPNMVTPEILKPDIIAPGVNILAAWTGKAGPTGLAADTRRVGFNIISGTSMSCPHVS  553

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             GLAA+L+  +P WSPAA++SALMTTAY   + G   L+D  T    TP  YG+GHVDP+ 
Sbjct  554   GLAALLRSAHPDWSPAAVRSALMTTAYATYSGGSSPLLDAATGATATPFDYGAGHVDPSR  613

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             AVDPGLVYD G  DYVDFLC + Y    IA   R+       NR   + G LNYPSFSV 
Sbjct  614   AVDPGLVYDLGTRDYVDFLCALKYSPAMIATVARSRDFSCAENRTY-SVGGLNYPSFSVA  672

Query  2027  F---------KNNLQTVIYKRTVKNV--AKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2173
             F          +   TV + RT+ NV  A    V+  V       V V V P  L FT  
Sbjct  673   FSTANGEGGESSAAATVTHTRTLTNVGGAGTYKVSTSVAGAAAQGVTVAVEPTELAFTSA  732

Query  2174  IDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2293
              +  SY V F S  Q + +  FG L WSDG H V SPIA +W
Sbjct  733   GEKKSYTVRFTSRSQPSGTSGFGRLVWSDGKHSVASPIAFTW  774



>ref|XP_003538797.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/758 (46%), Positives = 499/758 (66%), Gaps = 46/758 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F+ H  WY SI+ ++S       S+E+LYTY++  HG S RLT
Sbjct  33    QKNTYIVHMAKSKMPASFNHHSVWYKSIMKSIS------NSTEMLYTYDNTIHGLSTRLT  86

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L +  G++ VLP+++ +  TTR+P+FLGL    +++ P S+  +DI+IG+LD+G
Sbjct  87    LEEARLLKSQTGILKVLPEKIYKPLTTRTPKFLGL-DKIADMFPKSNEASDIVIGLLDTG  145

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D GL PIP+SW+ KCE G NF   +CN+K+IGAR + +GYEA +G P+   
Sbjct  146   VWPESKSFEDTGLGPIPSSWKGKCESGDNFTTLNCNKKLIGARFFLKGYEASMG-PLNAT  204

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              + +S RD +GHGTH AS AAGSAV  A++ G+A G ARG+A+ AR+AVYKVCW  TC+ 
Sbjct  205   NQFRSPRDADGHGTHTASTAAGSAVKGASLFGYASGTARGMASRARVAVYKVCWGDTCAV  264

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ MD A++D V+V+S SL      G A+ YDE+ +AIGAF A++KG++VSCAAGN 
Sbjct  265   SDILAAMDAAISDNVNVISASLG-----GGAIDYDEENLAIGAFAAMEKGIVVSCAAGNT  319

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GPD  +  N+APW++TVGA T+DR+FP  V LGN ++++G S+Y G       VP++Y G
Sbjct  320   GPDSSSLQNIAPWMITVGAGTLDRDFPVNVNLGNGQNYSGVSIYDGKFSRHTLVPLIYAG  379

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C    LD  KV+G+IV C++G ++S V+KG+ V  AGGVGM++ N  ++G
Sbjct  380   NASAKIGAELCETDSLDPKKVKGKIVLCDRG-NSSRVEKGLVVKSAGGVGMVLANSESDG  438

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +PT  V    G++I+ Y++ A  PT+R+ F+GT +G  PS P VAAFS RG
Sbjct  439   EELVADAHLLPTTAVGFKAGKLIKLYLQDARKPTSRLMFEGTKVGIEPS-PVVAAFSSRG  497

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPE+LKPD IAPGVNILAA+T  +            +FN+ISGTSMACPH SG+AA
Sbjct  498   PNPITPEVLKPDFIAPGVNILAAFTKLVGPTNLDQDDRRVDFNIISGTSMACPHASGIAA  557

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K  +P WSPAAI+SALMTTAYT  N+G+  L+D  T  P+TP   G+GHV+P  A++P
Sbjct  558   LIKSFHPDWSPAAIRSALMTTAYTTYNNGK-KLLDSATNGPSTPFEVGAGHVNPVAALNP  616

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK--  2032
             GLVYD  V+DY++FLC + Y   +I +  R      C      +   LNYPSF V+FK  
Sbjct  617   GLVYDLAVDDYLNFLCALNYTPDRIEVVARRK--FRCNAHKHYSVTDLNYPSFGVVFKPK  674

Query  2033  ---NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                +    V +KRT+ NV         VTV   S+V++ V PN L F ++ +  SY +TF
Sbjct  675   VGGSGATIVKHKRTLTNVGDAGTYKVSVTVDI-SSVKIAVEPNVLSF-NKNEKKSYTITF  732

Query  2204  QSLR---QSADSFGSLRWSDGTHLVTSPIAVSWE-GRS  2305
                     S   FG L WS+G ++V SPI+++WE GR+
Sbjct  733   TVSGPPPPSNFGFGRLEWSNGKNVVGSPISITWESGRA  770



>gb|KHN12975.1| Subtilisin-like protease [Glycine soja]
Length=751

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/758 (46%), Positives = 499/758 (66%), Gaps = 46/758 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F+ H  WY SI+ ++S       S+E+LYTY++  HG S RLT
Sbjct  14    QKNTYIVHMAKSKMPASFNHHSVWYKSIMKSIS------NSTEMLYTYDNTIHGLSTRLT  67

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L +  G++ VLP+++ +  TTR+P+FLGL    +++ P S+  +DI+IG+LD+G
Sbjct  68    LEEARLLKSQTGILKVLPEKIYKPLTTRTPKFLGL-DKIADMFPKSNEASDIVIGLLDTG  126

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D GL PIP+SW+ KCE G NF   +CN+K+IGAR + +GYEA +G P+   
Sbjct  127   VWPESKSFEDTGLGPIPSSWKGKCESGDNFTTLNCNKKLIGARFFLKGYEASMG-PLNAT  185

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              + +S RD +GHGTH AS AAGSAV  A++ G+A G ARG+A+ AR+AVYKVCW  TC+ 
Sbjct  186   NQFRSPRDADGHGTHTASTAAGSAVKGASLFGYASGTARGMASRARVAVYKVCWGDTCAV  245

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ MD A++D V+V+S SL      G A+ YDE+ +AIGAF A++KG++VSCAAGN 
Sbjct  246   SDILAAMDAAISDNVNVISASLG-----GGAIDYDEENLAIGAFAAMEKGIVVSCAAGNT  300

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GPD  +  N+APW++TVGA T+DR+FP  V LGN ++++G S+Y G       VP++Y G
Sbjct  301   GPDSSSLQNIAPWMITVGAGTLDRDFPVNVNLGNGQNYSGVSIYDGKFSRHTLVPLIYAG  360

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C    LD  KV+G+IV C++G ++S V+KG+ V  AGGVGM++ N  ++G
Sbjct  361   NASAKIGAELCETDSLDPKKVKGKIVLCDRG-NSSRVEKGLVVKSAGGVGMVLANSESDG  419

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +PT  V    G++I+ Y++ A  PT+R+ F+GT +G  PS P VAAFS RG
Sbjct  420   EELVADAHLLPTTAVGFKAGKLIKLYLQDARKPTSRLMFEGTKVGIEPS-PVVAAFSSRG  478

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPE+LKPD IAPGVNILAA+T  +            +FN+ISGTSMACPH SG+AA
Sbjct  479   PNPITPEVLKPDFIAPGVNILAAFTKLVGPTNLDQDDRRVDFNIISGTSMACPHASGIAA  538

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K  +P WSPAAI+SALMTTAYT  N+G+  L+D  T  P+TP   G+GHV+P  A++P
Sbjct  539   LIKSFHPDWSPAAIRSALMTTAYTTYNNGK-KLLDSATNGPSTPFEVGAGHVNPVAALNP  597

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK--  2032
             GLVYD  V+DY++FLC + Y   +I +  R      C      +   LNYPSF V+FK  
Sbjct  598   GLVYDLAVDDYLNFLCALNYTPDRIEVVARRK--FRCNAHKHYSVTDLNYPSFGVVFKPK  655

Query  2033  ---NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                +    V +KRT+ NV         VTV   S+V++ V PN L F ++ +  SY +TF
Sbjct  656   VGGSGATIVKHKRTLTNVGDAGTYKVSVTVDI-SSVKIAVEPNVLSF-NKNEKKSYTITF  713

Query  2204  QSLR---QSADSFGSLRWSDGTHLVTSPIAVSWE-GRS  2305
                     S   FG L WS+G ++V SPI+++WE GR+
Sbjct  714   TVSGPPPPSNFGFGRLEWSNGKNVVGSPISITWESGRA  751



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/757 (48%), Positives = 482/757 (64%), Gaps = 48/757 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + +++IV M KS+ P  F+ H  WY + + ++S       ++E++Y Y+  AHGFSARL+
Sbjct  31    KKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVS------DAAEIIYAYDTAAHGFSARLS  84

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P++A  L + PGV+ V+ +   EL TTR+P+FLGL   S  L P S+  +D+++GVLD+G
Sbjct  85    PAEARALEHRPGVLGVVLEERYELHTTRTPEFLGL-DRSEGLIPQSNTESDVVVGVLDTG  143

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPAT-SCNRKIIGARAYYRGYEAEIGKPI--  640
             +WPER S+ D GL P+P SW+  CE G +F A  +CNRK++GAR + +GYEA +G PI  
Sbjct  144   VWPERKSYDDAGLGPVPASWKGVCEEGKDFKAADACNRKLVGARFFSKGYEASMG-PIDE  202

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAGS V +AN+ G+A G ARG++T AR+AVYKVCWLG C 
Sbjct  203   TKESRSPRDNDGHGTHTSSTAAGSVVPDANLLGYAAGTARGMSTRARVAVYKVCWLGGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+A+ DG  VLSLSL      G    Y  D +AIGAF A+ KGV+VSC+AGN
Sbjct  263   SSDILAAMDKAIEDGCGVLSLSLG-----GGMSDYYRDSVAIGAFNAMAKGVVVSCSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA TIDR+FPA V LG+ +++TG SLYSG       +P++Y 
Sbjct  318   AGPGTSTLSNVAPWITTVGAGTIDRDFPAYVVLGDGKNYTGVSLYSGKPLPSSSLPLIYA  377

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV G+IV C++G +   V KG  V  AGG GMI+ N    
Sbjct  378   GNATNATNGNLCMVGTLLPDKVSGKIVLCDRGINAR-VQKGFVVRDAGGAGMILANTAAN  436

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +   P A + F GT +G  PS P VAAFS R
Sbjct  437   GEELVADAHLLPATAVGEKAGDAIKSYLFSDPNPKATVAFGGTKVGVMPS-PVVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP+ILKPD++APGVNILAAW+GS+           TEFN+ISGTSM+CPHVSGLA
Sbjct  496   GPNAVTPDILKPDLVAPGVNILAAWSGSVGPTGQAADPRRTEFNIISGTSMSCPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A L+  +P WSP AIKSALMTTAY  D  G G ++D+ T +P TP  +G+GHVDP  A+D
Sbjct  556   AFLRGAHPDWSPGAIKSALMTTAY-ADYPGGGGILDVATGRPATPFDFGAGHVDPPKALD  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF--  2029
             PGLVYD  V+DY+DFLC + Y + +IA   R S   +C N+       LNYPSF+V F  
Sbjct  615   PGLVYDLTVDDYLDFLCALNYTTLQIASVSRRSNF-NCDNKKAYAVSDLNYPSFAVAFAT  673

Query  2030  -------KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                     +   TV + RT+ NV       Y+ TV  P   +VTV P+ L F    +  S
Sbjct  674   ASGAGGGGSAATTVKHTRTLTNVGAPGT--YKATVSAPQEAKVTVDPSELSFAAAGEKKS  731

Query  2189  YEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2293
             Y V F +  Q + +  FG L WSDG H+V SP++ +W
Sbjct  732   YTVAFSAASQPSGTAAFGRLEWSDGKHVVASPLSFTW  768



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/606 (55%), Positives = 427/606 (70%), Gaps = 23/606 (4%)
 Frame = +2

Query  554   NFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavana  727
             +FPA++CN+KIIGARA+YRGYE+ + +PI    E KS RD  GHGTH AS AAGS V+NA
Sbjct  4     DFPASACNKKIIGARAFYRGYESYMERPIDETEESKSPRDTEGHGTHTASTAAGSLVSNA  63

Query  728   nvnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltskskt  907
             ++  +ARGEARG+A  ARIAVYK+CW   C ++DIL+ MDQA+ADGV V+SLS+ +    
Sbjct  64    SLFDYARGEARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVGAS---  120

Query  908   GFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPA  1087
             G+A  YD+D IAIG+FGA Q GV+VSC+AGN GP P+TA N+APWILTVGASTIDREFPA
Sbjct  121   GYAPQYDQDSIAIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPA  180

Query  1088  VVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGD  1267
                LG+ R F G SLY+G      ++ +VYGG     +C+ G+L+ SKV+G+IV C++G 
Sbjct  181   DAILGDGRIFGGVSLYAGESLPDFKLHLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGG  240

Query  1268  DTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASF  1447
             +   V+KG AV  AGG+GMI+ N    G +L  ++  IP  +V    G+ IR+Y++ + +
Sbjct  241   NAR-VEKGAAVKLAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQY  299

Query  1448  PTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL----  1615
             PTA I F+GTVI  SP AP+VAAFS RGPN LT EILKPDVIAPGVNILAAWTGS     
Sbjct  300   PTATIVFRGTVISPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTD  359

Query  1616  -------TEFNMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGT  1774
                     +FN+ISGTSM+CPHVSGLAA+L+K YP WSPAAIKSALMTTAY +DNSG   
Sbjct  360   LEIDPRRVDFNIISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALMTTAYNLDNSGE-N  418

Query  1775  LIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNS  1954
             + DL + + +TP  +G+GHVDP  A++PGLVYD  V++YV FLC+IGYD ++I++F+R  
Sbjct  419   IKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREP  478

Query  1955  PLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVR  2134
                D   R L  PG+LNYPSFSV+F +N   V YKR VKNV    +  Y+V V  P NV 
Sbjct  479   VSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVA  538

Query  2135  VTVSPNRLVFTDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSWEG  2299
             V V P++L F+     L+YE+TF S     L  S    GS+ WSDG HLV SPIAV W  
Sbjct  539   VNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQSGSIEWSDGVHLVRSPIAVRWIQ  598

Query  2300  RSVSEL  2317
              SVS +
Sbjct  599   GSVSSM  604



>ref|XP_011028928.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/758 (47%), Positives = 484/758 (64%), Gaps = 49/758 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +  K+FIV M  S+    +  H  WY S + ++S       S+++LY Y ++ HGFS RL
Sbjct  41    QTKKTFIVHMDMSKMAATYEDHFQWYDSSLKSVS------ESADMLYAYNNIIHGFSTRL  94

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYG-ADIIIGVLD  463
             TP +A  L   PG++SVLP+ + +L TT SP+FLGL  G S+  PS+    +++I+GVLD
Sbjct  95    TPEEAELLEKQPGILSVLPEMIYKLHTTHSPEFLGL--GKSDAVPSASASISEVIVGVLD  152

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +G+WPE  SF D GL PIP++W+  CEVG NF ++SCNRK+IGA+ + +GYEA  G PI 
Sbjct  153   TGVWPEIKSFDDTGLGPIPSTWKGTCEVGKNFNSSSCNRKLIGAQYFSKGYEAAFG-PID  211

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD +GHGTH A+ AAGSAV+ A++ G+A G ARG+AT AR+A YKVCWLG C
Sbjct  212   ETMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYAFGTARGMATQARVAAYKVCWLGGC  271

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ M++AVADGV+V+S+S+      G    Y+ D +AIGAF AV +G++VSC+AG
Sbjct  272   FSSDILAAMEKAVADGVNVISMSIG-----GGISDYNRDTVAIGAFRAVAQGILVSCSAG  326

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP   +  N+APWI TVGA T+DR+FPA V LGN ++++G SLYSG   S   +P+VY
Sbjct  327   NGGPSAGSLTNVAPWITTVGAGTLDRDFPAYVNLGNGKNYSGISLYSGKPLSDSLLPLVY  386

Query  1178  GGSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              G+A++      C  G L  S V G+IV C++G + S V KG+ V  +GG+GMI+ N   
Sbjct  387   AGNASNSTSGNLCMTGTLIPSHVAGKIVICDRGLN-SRVQKGMVVRDSGGLGMILANTEL  445

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  +A  +PT+ V     + I+ Y  + + P A I   GT +G  PS P +AAFS 
Sbjct  446   YGEELVADAHLLPTSTVGQRTADAIKNYAFSDAKPMATIASGGTKLGVEPS-PVLAAFSS  504

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TPE+LKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGL
Sbjct  505   RGPNLVTPEVLKPDLIAPGVNILAGWTGAVGPTGLTSDKRHVSFNIISGTSMSCPHVSGL  564

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA++K  +  WSPAAIKSALMTTAY    +G   ++D+ T QP+TP  +G+GHV+P  A+
Sbjct  565   AALIKAAHQDWSPAAIKSALMTTAYATYKNGE-NILDVATGQPSTPFDFGAGHVNPVAAL  623

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             DPGLVYDA V+DY+DF C + Y +  I           C +    + G LNYPSFSV  +
Sbjct  624   DPGLVYDASVDDYIDFFCALNYSASDIKQIANKD--FTCDSSKKYSLGDLNYPSFSVPLQ  681

Query  2033  NN---------LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTL  2185
                          TV Y RT+ NV         +T +TPS V++ V P  L F+   +  
Sbjct  682   TASGKGGGAGVTSTVKYTRTLTNVGAPATYKLSMTSKTPS-VKILVEPESLSFSKEYEKK  740

Query  2186  SYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +Y VTF  +S+    +SF  L WSDG H+V SPIA SW
Sbjct  741   TYTVTFTAKSMPSGTNSFAHLEWSDGKHVVGSPIAFSW  778



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/746 (48%), Positives = 475/746 (64%), Gaps = 44/746 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY S + ++S       S+E++YTY +  HGF+ RLT
Sbjct  28    QQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVS------ESAEMIYTYNNAIHGFATRLT  81

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L   PGVISV  ++  EL TTR+P FLGL   ++ L P +   +DI+IGVLD+G
Sbjct  82    PGEADSLMTQPGVISVQQEQKYELHTTRTPLFLGLDGQNAGLFPETGASSDIVIGVLDTG  141

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVG  646
             IWPE  SFSD G  PIP++W+ +C+ G NF A+ CNRK+IGAR +  GYE + GK     
Sbjct  142   IWPESKSFSDEGYGPIPSTWKGECQAGTNFTASLCNRKLIGARFFSDGYERDYGKINQAD  201

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD  GHGTH AS AAG+ V  AN  G A G A G+A   R++VYKVCW   C ++
Sbjct  202   ESKSPRDDFGHGTHTASTAAGNVVKGANYLGFASGTASGMAHRVRVSVYKVCWKSACVSS  261

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+GMD+A+ D VH+      S S  G +  Y  + I++GAF A+++G+ VSC+AGN G
Sbjct  262   DILAGMDKAIEDNVHI-----MSLSIGGKSTSYTGE-ISMGAFSAMERGIFVSCSAGNDG  315

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG-VQPSRIQVPVVYGG  1183
             P P +  N APWI TVGAS+IDREFP VV LGN +++TG SL++G   P+++ +P VYG 
Sbjct  316   PSPSSLSNAAPWITTVGASSIDREFPGVVILGNGKNYTGVSLFNGNALPAKL-LPFVYGN  374

Query  1184  SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
                  YC  G L+  KV+G+IV C + DD+   +KG  V  AGG+GMI+ N    G ++ 
Sbjct  375   -----YCSRGTLNPEKVKGKIVMCIK-DDSVRTEKGEVVKAAGGLGMILANAAGSGEEVL  428

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              +A  +P   V    G+IIR+YV T   PTA I  +GTV+   PS P VAAFS RGPN +
Sbjct  429   ADAHVLPVTAVGQKAGDIIRRYVLTDPNPTASILIRGTVVNVRPS-PMVAAFSSRGPNTI  487

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-------------TEFNMISGTSMACPHVSGLAAML  1684
             TP ILKPD+IAPGVNILAAWTG+L              EFN+ SGTSM+CPHVSGLAA+L
Sbjct  488   TPNILKPDLIAPGVNILAAWTGALGPSGLGTTSDTRRVEFNINSGTSMSCPHVSGLAALL  547

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K ++P WSPAAI+SALMTTAY     G+  ++D+ T +P+TP  +G+GHV PT AV+PGL
Sbjct  548   KSVHPEWSPAAIRSALMTTAYNTYKDGK-PILDVATGKPSTPFEHGAGHVSPTAAVNPGL  606

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQ  2044
             +YD    DY+DF+C   Y+S  I +  R +    C  R       LNYPSF+V  K +  
Sbjct  607   IYDLTTEDYIDFICASNYNSSLITIISRGN--YACP-RKTHPAADLNYPSFAVNVKGS-G  662

Query  2045  TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA  2224
             T  Y RTV NV    + + +VT +T + V+++V P  L F +  +  SY VTF  +   A
Sbjct  663   TYKYTRTVTNVGGAGSYSVKVTSETTA-VKISVEPAVLNFKEVNEKKSYSVTFTVISSKA  721

Query  2225  ---DSFGSLRWSDGTHLVTSPIAVSW  2293
                +SFGS+ WSDG H+V SP+A+SW
Sbjct  722   PMSNSFGSIEWSDGKHVVASPVAISW  747



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/757 (48%), Positives = 478/757 (63%), Gaps = 46/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+ +++IV M KS  P  F+ H  WY + + ++S       S+E+LY+Y+ V+HGFS RL
Sbjct  25    EKRRTYIVHMAKSRMPATFTDHGHWYHASLRSVS------DSAEILYSYDTVSHGFSTRL  78

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP++A+ L +  GV+SVLP+   EL TTR+P FLGL   S  L P +D G+D+++G+LD+
Sbjct  79    TPAEAATLESREGVLSVLPEVRYELHTTRTPMFLGLDE-SHGLFPQADTGSDVVVGLLDT  137

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             G+WPER SF D G  P+P  W+  CE   +F ATSCNRK+IGAR + + YEA +G PI G
Sbjct  138   GVWPERKSFDDTGFGPVPAGWKGACEEAKDFKATSCNRKLIGARFFSKSYEATVG-PING  196

Query  647   --EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD  GHGTH A+ AAGSAV +A++ G A G ARG+AT AR+A YKVCW   C 
Sbjct  197   TTESRSPRDDEGHGTHTATTAAGSAVTDASLFGFANGTARGMATRARVAAYKVCWAAGCF  256

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+AV DG HVLSLSL      G    Y ED IAIGAF A++KG+++SC+AGN
Sbjct  257   SSDILAAMDRAVDDGCHVLSLSLG-----GEMTEYYEDSIAIGAFNAMEKGLLISCSAGN  311

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APWI+TVGA TIDR+FPA V LGN +++TG SLYSG    +  +P VY 
Sbjct  312   GGPIASSVTNVAPWIITVGAGTIDRDFPAYVVLGNGKNYTGVSLYSGKLLPKSPLPFVYA  371

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A++      C PG L   KV G+IV C++G +   V KG  V +AGG GM++ N    
Sbjct  372   GNASNATDGNLCIPGTLIPEKVAGKIVLCDRGINWR-VQKGYVVREAGGAGMVLANADTY  430

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G ++  +A  +P   V    G+ IR Y+R+   P A I F GT IG  PS P VAAFS R
Sbjct  431   GEEVVADAHLLPATAVGQKAGDAIRAYLRSNKNPKATIVFGGTKIGVRPS-PVVAAFSSR  489

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +T EILKPD+IAPGVNILA WTG+              FN+ISGTSM+CPHVSG+A
Sbjct  490   GPNLVTSEILKPDLIAPGVNILAGWTGAAGPTGLSGDSRRVVFNIISGTSMSCPHVSGIA  549

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAA++SALMTTAY+    G   L D+ T +  TP  YG+GHVDP  AVD
Sbjct  550   ALLKAAHPDWSPAAVRSALMTTAYSAYPGGDSGLFDVATGKAATPFDYGAGHVDPPRAVD  609

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGL+YD    DY+DFLC + Y SR IA   + +    C          LNYPSF+V+F+ 
Sbjct  610   PGLIYDLTTEDYIDFLCALKYTSRHIATVAKRTNYT-CDGTKTYAVSGLNYPSFAVVFQR  668

Query  2033  -----NNLQTVIYKRTVKNVAKVRNVAYQVTVQT---PSNVRVTVSPNRLVFTDRIDTLS  2188
                    + TV + RTV NV       Y+ TV T      V+V V P  L FT + +  S
Sbjct  669   ASGAGGRVATVKHTRTVTNVGDPGT--YKSTVTTAVAGGAVKVVVEPAELSFTKKGERRS  726

Query  2189  Y--EVTFQSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y   ++  SL   +  FG L WSDG H+V SPIA SW
Sbjct  727   YTVSLSSPSLPSVSSGFGRLEWSDGKHVVASPIAFSW  763



>gb|KHN21060.1| Subtilisin-like protease [Glycine soja]
Length=726

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/746 (47%), Positives = 473/746 (63%), Gaps = 54/746 (7%)
 Frame = +2

Query  152   PQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVI  331
             P  F+ H  W+ + + + SP      S+E+LYTY+HVAHGFSARLTP     LA  PG++
Sbjct  2     PLTFTDHLSWFDASLKSASP------SAEILYTYKHVAHGFSARLTPKDVDTLAKQPGIL  55

Query  332   SVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLN  511
             SV+P+   +L TTR+P FLGL   ++ L P+S+  + ++IG+LD+G+WPE  S  D GL 
Sbjct  56    SVIPELKYKLHTTRTPNFLGL-DKATTLLPASEQQSQVVIGLLDTGVWPELKSLDDTGLG  114

Query  512   PIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGT  685
             P+P++W+ +CE+G N  +++CNRK++GAR + +GYEA +G PI    E KSARD +GHG+
Sbjct  115   PVPSTWKGQCEIGNNMNSSNCNRKLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGS  173

Query  686   hvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADG  865
             H  + AAGS V  A++ G A G ARG+AT AR+AVYKVCWLG C  +DI +G+D+A+ DG
Sbjct  174   HTLTTAAGSVVPEASLFGLASGTARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDG  233

Query  866   VHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWI  1045
             V+VLS+S+      G  + Y  D+IAIG+F A+  G++VS +AGN GP   +  N+APWI
Sbjct  234   VNVLSMSIG-----GSLMEYYRDIIAIGSFTAMSHGILVSTSAGNGGPSQGSLSNVAPWI  288

Query  1046  LTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANS----FYCFPG  1213
              TVGA TIDR+FPA +TLG  +++TG SLYSG   S   +P+VY G+A++    + C   
Sbjct  289   TTVGAGTIDRDFPAYITLGTGKTYTGASLYSGKPLSDSPLPLVYAGNASNSSVGYLCLQD  348

Query  1214  QLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAV  1393
              L   KV G+IV CE+G +   V+KG+ V  AGG GMI+ N    G +L  ++  +P A 
Sbjct  349   SLIPEKVSGKIVICERGGNPR-VEKGLVVKLAGGAGMILANSEAYGEELVADSHLLPAAS  407

Query  1394  VTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVI  1573
             +     EI++ YV ++  PTA+I F GT +   PS P VAAFS RGPN LTP+ILKPD+I
Sbjct  408   LGQKSSEILKNYVSSSPNPTAKIAFLGTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLI  466

Query  1574  APGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYPSWSPAAI  1720
             APGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+LK  +P WSPAAI
Sbjct  467   APGVNILAGWTGAVGPTGLTVDTRHVSFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAI  526

Query  1721  KSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDF  1900
             +SALMTTAYT   +G  T+ D+ T QP TP  YG+GHVDP  A+DPGLVYDA V+DY+ F
Sbjct  527   RSALMTTAYTSYKNGE-TIQDISTGQPGTPFDYGAGHVDPVAALDPGLVYDANVDDYLGF  585

Query  1901  LCTIGYDSRKIALFLRN----SPLVDCRNRNLGNPGSLNYPSFSVLF---------KNNL  2041
              C + Y S +I L  R      P  D R  +       NYPSF+V            + L
Sbjct  586   FCALNYSSFQIKLAARRDYTCDPKKDYRVED------FNYPSFAVPMDTASGIGGGSDTL  639

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLR  2215
             +TV Y R + NV         V     SNV+  V PN L FT+  +   Y V+F   S+ 
Sbjct  640   KTVKYSRVLTNVGAPGTYKASVMSLGDSNVKTVVEPNTLSFTELYEKKDYTVSFTYTSMP  699

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 SF  L W+DG H V SPIA SW
Sbjct  700   SGTTSFARLEWTDGKHKVGSPIAFSW  725



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/757 (47%), Positives = 482/757 (64%), Gaps = 47/757 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV+M  + + +   TH  WY + + +LS       +  LLY+Y    HGF+A L P 
Sbjct  27    QTYIVYMNAAHRTEAHPTHAHWYEAHLRSLS----IDPARHLLYSYSAAVHGFAAVLHPE  82

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLI-------SGSSNLGPSSDYGADIIIG  454
             Q   L   P V++V PD L+ L TTRSP FLGL        S S +L P++    D++IG
Sbjct  83    QLPLLRRHPAVLNVHPDPLLPLHTTRSPHFLGLSPWPPAPSSRSHSLDPAA-AATDVVIG  141

Query  455   VLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK  634
             VLD+G+WPE  SF D GL  +P+ WR  CE G +FP++ CNRK++GAR++ RGY A  G 
Sbjct  142   VLDTGVWPESPSFDDAGLPEVPSRWRGACEAGVDFPSSLCNRKLVGARSFGRGYRAAAGG  201

Query  635   PIVGEPK----SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
                 +P+    S RD +GHGTH AS AAG+ VANA++ G+A G ARG+A  AR+AVYKVC
Sbjct  202   GDADKPREEYASPRDRDGHGTHTASTAAGAPVANASLLGYASGVARGMAPGARVAVYKVC  261

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W   C  +DIL+G+D+A+ DGV VLSLSL      G + P+  D +A+GAF AVQ+G+ V
Sbjct  262   WANGCYGSDILAGIDKAIEDGVDVLSLSLG-----GGSAPFSRDPVAVGAFSAVQRGIFV  316

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             +C+AGN GP P +  N APWI TVGA T+DR+FPA V LGN   + G SL SG       
Sbjct  317   ACSAGNSGPSPSSLTNTAPWITTVGAGTLDRDFPATVQLGNGERYAGLSLCSGAGLEDQM  376

Query  1163  VPVVYG-----GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI  1327
             VP+VYG     GS +S +C PG LD  +V+G++VFC++G +   V+KG  V +AGGVGMI
Sbjct  377   VPIVYGKGVQVGSNSSKFCMPGTLDPEQVKGKVVFCDRGINAR-VEKGQVVKEAGGVGMI  435

Query  1328  VPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPR  1507
             + N    G +L  ++  +PT  V    G +IR +VRT+S PTA + F+GTV+G  PS P 
Sbjct  436   LANAAVNGEELVADSHLLPTVAVGAKSGNLIRDFVRTSSNPTAMLSFRGTVLGVQPS-PV  494

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMAC  1654
             VAAFS RGPN + P++LKPD+I PGVNILAAW+GS+           + FN++SGTSM+C
Sbjct  495   VAAFSSRGPNTVVPQLLKPDLIGPGVNILAAWSGSVGPTGLAKDERRSAFNIMSGTSMSC  554

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PH+SG+AA+LK  +P WSP+AIKSALMTTAYT DN+G   L+D     P TP AYGSGHV
Sbjct  555   PHISGVAALLKAAHPDWSPSAIKSALMTTAYTDDNTGS-PLVDGAGGSPATPWAYGSGHV  613

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
             DP  A+ PGL+YD G  DY+ FLC++ Y +  I    +++    C +R L NPG+LNYPS
Sbjct  614   DPQKALSPGLIYDIGTGDYLAFLCSLEYSTDHIQAISKSTNKT-C-SRRLPNPGNLNYPS  671

Query  2015  FSVLF-KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
             FSV+F + + + V Y R + NV  V    Y V V  P  V+VTV P +L+F      L Y
Sbjct  672   FSVVFGRRSRRFVKYNRVLTNVG-VPGSVYNVKVGGPPGVKVTVKPTKLIFNQVGQKLRY  730

Query  2192  EVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSW  2293
             +VTF S +       +FG + WS   H V SP++  W
Sbjct  731   KVTFTSTKAGDPVDMAFGWITWSSEQHQVRSPVSYRW  767



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/745 (48%), Positives = 472/745 (63%), Gaps = 41/745 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H +WY S + ++S       S+ELLYTYE+  HGFS RLT  +
Sbjct  22    TYIVHMAKSQTPSSFDLHSNWYDSSLRSIS------DSAELLYTYENAIHGFSTRLTQEE  75

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISVLP+   EL TTR+P FLGL   +++L P +   +D+++GVLD+G+WP
Sbjct  76    ADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEHTADLFPEAGSYSDVVVGVLDTGVWP  135

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  S+SD G  PIP+SW+  CE G NF A+ CNRK+IGAR + RGYE+ +G PI    E 
Sbjct  136   ESKSYSDEGFGPIPSSWKGGCEAGTNFTASLCNRKLIGARFFARGYESTMG-PIDESKES  194

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH +S AAGS V  A++ G+A G ARG+     +AVYKVCWLG C ++DI
Sbjct  195   RSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGML--HALAVYKVCWLGGCFSSDI  252

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A+AD V+V      S S  G    Y  D +AIGAF A+++G++VSC+AGN GP 
Sbjct  253   LAAIDKAIADNVNV-----LSMSLGGGMSDYYRDGVAIGAFAAMERGILVSCSAGNAGPS  307

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
               +  N+APWI TVGA T+DR+FPA+  LGN ++FTG SL+ G       +P +Y G+A 
Sbjct  308   SSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNAS  367

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    G +L
Sbjct  368   NATNGNLCMTGTLIPEKVKGKIVMCDRGINAR-VQKGDVVKAAGGVGMILANTAANGEEL  426

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P   V    G+IIR YV T   PTA I   GTV+G  PS P VAAFS RGPN 
Sbjct  427   VADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPS-PVVAAFSSRGPNS  485

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLAA+LK
Sbjct  486   ITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLK  545

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
              ++P WSPAAI+SALMTTAY     G+  L+D+ T +P+TP  +G+GHV PT A +PGL+
Sbjct  546   SVHPEWSPAAIRSALMTTAYKTYKDGK-PLLDIATGKPSTPFDHGAGHVSPTTATNPGLI  604

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V   +    
Sbjct  605   YDLTTEDYLGFLCALNYTSPQIRSVSRRN--YTCDPSKSYSVADLNYPSFAVNV-DGAGA  661

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQ  2218
               Y RTV +V      + +VT +T + V+++V P  L F +  +  SY VTF    S   
Sbjct  662   YKYTRTVTSVGGAGTYSVKVTSET-TGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPS  720

Query  2219  SADSFGSLRWSDGTHLVTSPIAVSW  2293
              ++SFGS+ WSDG H+V SP+A+SW
Sbjct  721   GSNSFGSIEWSDGKHVVGSPVAISW  745



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/757 (46%), Positives = 486/757 (64%), Gaps = 47/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ K++IV M K + P+ F  H  WY S + ++S       S+E++Y Y +V HGFS RL
Sbjct  23    DKKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVS------DSAEMIYAYNNVVHGFSTRL  76

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG+++V+P+   EL TTRSPQFLGL   ++NL P S+  +++IIGVLD+
Sbjct  77    TTEEAQRLEAQPGILAVVPEMRYELHTTRSPQFLGL-DKNANLYPESNSVSEVIIGVLDT  135

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL P+P+SW+ +CE G NF A++CNRK+IGAR + +GYEA +G PI  
Sbjct  136   GVWPESKSFDDTGLGPVPSSWKGECESGTNFSASNCNRKLIGARFFSKGYEATLG-PIDE  194

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH AS AAGS V NA++ G+A G ARG+A  AR+A YKVCW G C 
Sbjct  195   SKESRSPRDDDGHGTHTASTAAGSVVENASLFGYASGTARGMAARARVAAYKVCWAGGCF  254

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DI++ MD+AV D V+V+S+SL      G    Y +D +A GAF A++KG++VSC+AGN
Sbjct  255   SSDIVAAMDKAVEDNVNVMSMSLG-----GGVSDYYKDSVATGAFAAMEKGILVSCSAGN  309

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P++  N +PWI TVGA T+DR+FPA V+LG++++F+G SLY G       +P +Y 
Sbjct  310   AGPSPFSLSNTSPWITTVGAGTLDRDFPAYVSLGDAKNFSGVSLYRGKSLPGTLLPFIYA  369

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
              +A    N   C  G L   KV G++VFC++G +   V KG  V  AGG+GM++ N    
Sbjct  370   ANASNSGNGNLCMTGTLIPEKVAGKVVFCDRGVNPR-VQKGAVVKAAGGIGMVLANTAAN  428

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  +P   V    G+IIR+Y+ +   PT  I F+GT +G  PS P VAAFS R
Sbjct  429   GEELVADSHLLPATAVGQKSGDIIRKYLVSDPKPTVTILFEGTKLGIEPS-PVVAAFSSR  487

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP++LKPD+IAPGVNILA W+ S+            +FN+ISGTSM+CPHVSGLA
Sbjct  488   GPNSITPQLLKPDIIAPGVNILAGWSKSVGPSGLAIDDRRVDFNIISGTSMSCPHVSGLA  547

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  +P WSPAAI+SALMTTAYT   +G+  + D+ T +P+TP  +G+GHVDP  A++
Sbjct  548   ALIKGAHPDWSPAAIRSALMTTAYTAYKNGQ-KIQDIATGKPSTPFDHGAGHVDPVSALN  606

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD  V+DY++FLC + Y   +I    R     D + +   N   LNYPSF+V+F  
Sbjct  607   PGLVYDLTVDDYLNFLCALNYTPSQINSLARKDFTCDSKKKYSVN--DLNYPSFAVVFDG  664

Query  2036  NLQTVI-------YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
              L           + RT+ NV         ++ +T S V+++V P  L FT   +  SY 
Sbjct  665   VLGGGGSGSSVVKHTRTLTNVGSPGTYKVSISSETKS-VKISVEPESLSFTGANEKKSYT  723

Query  2195  VTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF S       SA+ FG + WSDG H+V SPIA SW
Sbjct  724   VTFTSNGSAAPSSAEGFGRIEWSDGKHVVGSPIAFSW  760



>ref|XP_009112374.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=758

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/750 (47%), Positives = 481/750 (64%), Gaps = 43/750 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY S + ++S       S+ ++YTY +  HGF+ RLT
Sbjct  29    QQATYIVHMAKSQMPSSFDQHSLWYDSSLRSVS------ESAAMIYTYNNAIHGFATRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L   PGVISV  ++  EL TTR+P FLGL   +  L P +   ++++IGVLDSG
Sbjct  83    PEEADSLMTQPGVISVRQEQRHELHTTRTPLFLGLDVHNGGLFPETSTSSNLVIGVLDSG  142

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SFSD G  PIP +W+  C+ G  F  + CNRK+IGAR + RGYEA I  P+   
Sbjct  143   VWPESKSFSDEGYGPIPPTWKGGCDAGTRFTMSLCNRKLIGARFFVRGYEA-INGPVDES  201

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH AS AAGS V  AN+ G A G ARGIA  AR+AVYKVCW   C +
Sbjct  202   KESKSPRDDDGHGTHTASTAAGSVVEGANLLGFANGTARGIAYRARVAVYKVCWQPGCFS  261

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+G+D+A+ D V++      S S +G    Y +D IAIGAF A+++G+ VSC+AGN+
Sbjct  262   SDILAGIDKAIEDNVNI-----LSISLSGITTYYTDD-IAIGAFAAMERGIFVSCSAGNF  315

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQVPVVY  1177
             GP P++  N+APWI TVGA T+DR+FPA+  LGN +++TG SL+ G    P+++ +P +Y
Sbjct  316   GPSPFSVTNIAPWITTVGAGTLDRDFPALAILGNGKNYTGVSLFKGDDELPAKL-LPFIY  374

Query  1178  GGSANS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              G+A+     + CFPG L   KV+G+IV C+ G     +  G  V  AGG+GMI+ NL  
Sbjct  375   AGNASDDAIGYLCFPGTLIPEKVKGKIVMCDTGGVAPAM-IGEVVKSAGGLGMIIANLAG  433

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +++  A  +P   V    G+IIR+YV T   PTA I  +GTV+   PS P +AAFS 
Sbjct  434   RGEEVQAEAHFLPATAVGEKAGDIIRRYVLTDPNPTASIVIQGTVVNVKPS-PVLAAFSS  492

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TP ILKPD+IAPGVNILAAWTGSL            EFN+ISGTSM+CPHVSGL
Sbjct  493   RGPNPITPNILKPDLIAPGVNILAAWTGSLGPTGLASDTRRVEFNIISGTSMSCPHVSGL  552

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK ++P WSPAAI+SALMTTAY     G   +ID+ T +P+TP  +G+GHV PT AV
Sbjct  553   AALLKSVHPEWSPAAIRSALMTTAYNTYKDGN-PIIDISTGKPSTPFEHGAGHVSPTTAV  611

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             +PGL+YD    DY+DFLC + Y+S +I +  R +    C +    +   LNYPSF+V  +
Sbjct  612   NPGLIYDLTTVDYLDFLCALKYNSSQIGVVSRGN--YTCDSSKTYSVADLNYPSFAVNVE  669

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--  2206
              +  T  Y R V +V    + + +VT +T + V++++ P  L F +  +  SY VTF   
Sbjct  670   GS-DTYKYTRPVTSVGGAGSYSVKVTSET-TAVKISIEPAVLNFREVNEKKSYSVTFTVD  727

Query  2207  -SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  728   LSKPSGSNSFGSIEWSDGKHVVASPVAISW  757



>ref|XP_007160895.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
 gb|ESW32889.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
Length=777

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/753 (46%), Positives = 468/753 (62%), Gaps = 44/753 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++I+ M KS  P  FS H +W+ S + ++S       S+E+LYTY+HVAHGFS RLTP 
Sbjct  41    KTYIIHMDKSTMPSTFSDHLNWFDSSLKSVS------ASAEILYTYKHVAHGFSTRLTPK  94

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A  LAN PG++SV P+   +L TTR+PQFLGL   S+ L P+S+  + +IIGVLD+G+W
Sbjct  95    EAETLANQPGILSVTPEHRYKLHTTRTPQFLGL-DQSTTLLPASEQQSQVIIGVLDTGVW  153

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVGEP  652
             PE  S  D GL P+P +W+ +CEVG N  ++ CNRK++GAR + +GYE+ +G   +  E 
Sbjct  154   PELKSLDDTGLGPVPATWKGECEVGNNMNSSHCNRKLVGARFFSKGYESALGPVDLSTES  213

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KSARD  GHG+H  + AAGS V  A++ G A G ARG+A  AR+A YKVCWLG C ++DI
Sbjct  214   KSARDDEGHGSHTLTTAAGSVVPEASLFGLASGTARGMAAQARVAAYKVCWLGGCFSSDI  273

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
              +G+D+A+ DGV+VLS+S+      G    Y  D+IAIG+F A   G++VS +AGN GP 
Sbjct  274   AAGIDKAIEDGVNVLSMSIG-----GSLTEYYRDIIAIGSFTATSHGILVSMSAGNAGPS  328

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
               T  N++PW+ TVGA T+DR+FPA++TLGN +++ G SLY+G       +P+VY G+A+
Sbjct  329   SSTLSNVSPWVTTVGAGTLDRDFPALITLGNGKTYAGASLYNGKPVLDSPLPLVYAGNAS  388

Query  1193  S----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             +    + C    L   KV G+IV CE+G +   V+KG+ V  AGG GMI+ N    G +L
Sbjct  389   NSSVGYLCLQDSLIPEKVSGKIVICERGGNPR-VEKGLVVKLAGGAGMILANNEAFGEEL  447

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +   +P A +     +I++ Y  +++ PTA+I F GT +   PS P VAAFS RGPN 
Sbjct  448   VTDPHLLPAASLGQKSSQILKSYASSSANPTAKIAFLGTQLEVKPS-PVVAAFSSRGPNA  506

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTP ILKPD IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+LK
Sbjct  507   LTPNILKPDFIAPGVNILAGWTGAVGPTGLTADDRHVSFNIISGTSMSCPHVSGLAAILK  566

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P WSPAAI+SALMTTAYT   +G   ++D+ T QP TP  YG+GHVDP  A+DPGLV
Sbjct  567   GAHPQWSPAAIRSALMTTAYTSYKNG-AAILDVATGQPATPFDYGAGHVDPVAALDPGLV  625

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-----  2032
             YDA V DY+ F C + Y S +I L  R      C  +        NYPSF+V  +     
Sbjct  626   YDANVEDYLGFFCALNYTSFQIKLASRTD--FTCDPKKEYRVEDFNYPSFAVALETASGI  683

Query  2033  ----NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
                 +  +TV Y R + NV         V     S V++ V P  L F    +  SY V+
Sbjct  684   GGGSDAPKTVKYSRVLTNVGAPGTYEASVVALGDSTVKIVVEPETLSFAQEYEKKSYTVS  743

Query  2201  F--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F   S+     SF  L W DG H V SPIA SW
Sbjct  744   FTYTSMPSGTSSFARLEWKDGKHTVASPIAFSW  776



>emb|CDY00497.1| BnaA10g07760D [Brassica napus]
Length=775

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/753 (47%), Positives = 475/753 (63%), Gaps = 35/753 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLS-PLSNHSRSSELLYTYEHVAHGFSARL  286
             + K+++V M KS  P  ++ H  WYSS I +++ P S+    + +LYTY+   HG +ARL
Sbjct  29    QKKTYVVHMDKSAMPSPYTNHLQWYSSKIDSVTDPKSHEEEGNRILYTYQTAFHGLAARL  88

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             +  +A+ L   PGV++V+P+   EL TTRSP+FLGL    S  +        D+++GVLD
Sbjct  89    SKEEAARLEEEPGVVAVIPETRYELHTTRSPRFLGLERQESERVWAERVTDHDVVVGVLD  148

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK   
Sbjct  149   TGIWPESESFNDTGMSPVPSTWRGVCETGRGFLKHNCNRKIVGARVFYRGYEAATGKIDQ  208

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+G C 
Sbjct  209   ELEYRSPRDKDGHGTHTAATVAGSPVRGANLLGFAYGTARGMAPKARVAAYKVCWVGGCF  268

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DILS +DQAVADGVHVLS+SL      G    Y  D +AI  FGA++ GV VSC+AGN
Sbjct  269   SSDILSAVDQAVADGVHVLSISLG-----GGISTYSRDSLAIATFGAMEMGVFVSCSAGN  323

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V LG  R F G SLY G  V     Q P+V
Sbjct  324   GGPDPISLTNVSPWITTVGASTMDRDFPATVRLGTRRVFKGVSLYKGRTVLSRGKQYPLV  383

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G   S      +C  G LD   V G+IV C++G  T  V KG  V +AGGVGMI+ N 
Sbjct  384   YLGRNASSPDPTSFCLDGALDQHNVAGKIVICDRG-VTPRVQKGQVVKRAGGVGMILTNT  442

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  +   +P   V   +G++I++Y  T+   TA +E  GT +G  PS P VAAF
Sbjct  443   ATNGEELVADCHLLPAVAVGEKEGKVIKEYAMTSKRATASLEILGTRVGIKPS-PVVAAF  501

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAW+G +            +FN++SGTSM+CPHVS
Sbjct  502   SSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDKRRVKFNILSGTSMSCPHVS  561

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA+++  +P WSPAA+KSALMTTAY  DN     L D    +P++P+ +G+GH+DP  
Sbjct  562   GVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLE-PLTDAAGAEPSSPYDHGAGHIDPLK  620

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLG-NPGSLNYPSFSV  2023
             A+DPGLVYD G  +Y DFLCT      ++ +F ++S    CR+   G NPG+LNYP+ S 
Sbjct  621   AIDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNR-SCRHSLAGNNPGNLNYPAISA  679

Query  2024  LFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             LF  N  ++ +  +RTV NV      +Y+V+V       VTV P  L FT +   LSY V
Sbjct  680   LFPENTHVKAMTLRRTVTNVGP-HVSSYKVSVSPFKGATVTVQPKTLNFTTKHQKLSYTV  738

Query  2198  TFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             TF++ LR     FG L W   TH V SP+ ++W
Sbjct  739   TFRTKLRMKRPEFGGLLWKSATHKVRSPVIITW  771



>ref|XP_007136744.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
 gb|ESW08738.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
Length=777

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/753 (47%), Positives = 478/753 (63%), Gaps = 48/753 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++I++  K   P  F+ H  WY S + ++S       S+E LYTY+HVAHGFS RLT  +
Sbjct  44    TYIIYTDKFSMPSSFNDHLLWYDSSLKSVS------DSAERLYTYQHVAHGFSTRLTTQE  97

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L+  PG++SV+P+   +L TTR+P+FLGL      L  +S   +D+++GVLD+G+WP
Sbjct  98    AELLSKQPGILSVIPEIRYDLHTTRTPEFLGL-EKFITLSLASGRQSDVVVGVLDTGVWP  156

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D+GL P+P+SW+ +CE G NF   +CN+K++GAR + +GYEA  G PI    E 
Sbjct  157   ELKSFDDKGLGPVPSSWKGECERGKNFGPANCNKKLVGARFFAKGYEAAFG-PIDESTES  215

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH ++ AAGSAVA A++ G A G ARG+AT AR+A YKVCWLG C ++DI
Sbjct  216   KSPRDDDGHGTHTSTTAAGSAVAGASLFGFANGTARGMATQARVATYKVCWLGGCFSSDI  275

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
              +G+D+A+ADGV++LS+S+      G    Y  D IAIG F A    ++VS +AGN GP 
Sbjct  276   AAGIDKAIADGVNILSMSIG-----GGLTDYYRDTIAIGTFAATAHRILVSNSAGNGGPS  330

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS--  1186
               +  N+APW+ TVGA TIDR+FPA VTLGN +S+TG SLY+G  P +  +P+VY G+  
Sbjct  331   QASLSNVAPWLTTVGAGTIDRDFPAYVTLGNGKSYTGVSLYNGKLPPKSPIPIVYAGNVS  390

Query  1187  --ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
               +    C  G L A+KV G+IV C++G +   V+KG+ V  AGG GMI+ N  + G +L
Sbjct  391   GDSEGSLCSKGSLIAAKVAGKIVICDRGGNAR-VEKGLVVKSAGGSGMILANSEDYGEEL  449

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P   +      ++++YV ++  PTA++ F GT +G  PS P VAAFS RGPN 
Sbjct  450   VADSYLLPAIALGQKSSNVLKKYVFSSPNPTAKLSFGGTHLGVQPS-PVVAAFSSRGPNL  508

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             LTP++LKPD+IAPGVNILA WTG++            EFN+ISGTSM+CPHVSGLAA+LK
Sbjct  509   LTPKVLKPDLIAPGVNILAGWTGAVGPTGMTEDTRHVEFNIISGTSMSCPHVSGLAALLK  568

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P WSPAAI+SALMTT+Y    +G+ TL D+YT  P TP  +G+GHVDP  A DPGLV
Sbjct  569   GTHPEWSPAAIRSALMTTSYRTYKNGQ-TLKDVYTGLPATPFDFGAGHVDPVAAFDPGLV  627

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL--  2041
             YDA V+DY+ F C + Y S +I L  R      C  R       LNYPSF+V F      
Sbjct  628   YDATVDDYLSFFCALNYSSYQIKLVARRD--FTCSKRKKYRVEDLNYPSFAVPFNTAFGV  685

Query  2042  -------QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
                      V YKRT+ NV       Y+V+V    +V++ V P  L F    +  SY VT
Sbjct  686   KGGSQKPTAVQYKRTLTNVGA--PATYKVSVTQSPSVKIVVEPQTLSFRQLNEKKSYTVT  743

Query  2201  FQSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
             F S  +    +SF  L WSDG H V+SPIA SW
Sbjct  744   FTSSSKPSGTNSFAYLEWSDGKHKVSSPIAFSW  776



>ref|XP_010688373.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=813

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/757 (48%), Positives = 488/757 (64%), Gaps = 50/757 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E +++IV M KS  P  F  HH+WY       S L + + S+++LYTY  V HGFS RLT
Sbjct  77    ERRTYIVHMDKSHMPASFEDHHEWY------YSSLRSAADSAQMLYTYNSVIHGFSTRLT  130

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A+ L N PG +S++P+   EL TTR+P FLGL   +  L P+S    D+IIG++D+G
Sbjct  131   DEEATSLENQPGTLSLVPETRYELHTTRTPAFLGL-GINDKLLPTSTSQGDVIIGLIDTG  189

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D GL+P+P+SW+ +CE G NF +++CNRK+IGAR + +GYEA +G PI   
Sbjct  190   VWPELKSFDDMGLDPVPSSWKGECEEGTNFKSSNCNRKLIGARFFCKGYEAILG-PIDES  248

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH A+ AAGSA  +AN+ G+A G ARG+A +ARIA YK CWLG C  
Sbjct  249   TESKSPRDDDGHGTHTATTAAGSATTSANLFGYASGTARGMAPHARIAAYKACWLGGCFT  308

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ M++A+ D V +LS+S+      G    Y  D +A+GAF A++KG++VSC+AGN 
Sbjct  309   SDILAAMEKAIDDRVDILSMSIG-----GSISEYYRDTVAVGAFTAMKKGILVSCSAGNA  363

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGV-QPSRIQVPVVYG  1180
             GPD  +  NLAPWI TVGA TIDR+FPA V LG+ R+FTG SLYSG   PS++ + + Y 
Sbjct  364   GPDSGSLSNLAPWITTVGAGTIDRDFPAYVILGDGRNFTGASLYSGKPLPSKL-LSLTYA  422

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G A++     +C  G L++  V+G+IV C++G + S V KG+ V +AGGVGMI+ N    
Sbjct  423   GKASNMTSGSFCMTGSLNSEDVKGKIVVCDRGGN-SRVQKGLVVRKAGGVGMILANTEAY  481

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  IP A + +   E I++Y+ +   PTA I F GT +G  PS P VA+FS R
Sbjct  482   GEELVADAHLIPAASLGLKGAEDIKKYISSGRKPTATIGFSGTELGVQPS-PVVASFSSR  540

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTPEILKPD+IAPGVNILA WTG +             FN+ISGTSM+CPH+SGLA
Sbjct  541   GPNPLTPEILKPDLIAPGVNILAGWTGKVGPTGLDGDTRHVSFNIISGTSMSCPHLSGLA  600

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  +P WSPAAIKSALMTTAYT   +G+ T+ID+ T  P+TP  YG+GHVDP  A+D
Sbjct  601   ALVKASHPEWSPAAIKSALMTTAYTAYKNGK-TIIDVATGLPSTPFDYGAGHVDPIAALD  659

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYDA V DYVDFLC + Y S +I      +    C +      G LNYPS +V  + 
Sbjct  660   PGLVYDATVKDYVDFLCALNYSSDQIK--HTTAEEYSCSSSKTYKLGDLNYPSLAVTLET  717

Query  2036  N--------LQTVIYKRTVKNVAKVRNVAYQVTVQT-PSNVRVTVSPNRLVFTDRIDTLS  2188
                      + T+ Y RT+ NV   R   Y+ +V T  ++++V V P  L F    +  S
Sbjct  718   TPENQDRKAMSTMKYTRTLTNVG--RPATYKASVSTRTASLKVIVEPESLSFNTINEKKS  775

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             + VT    S+     SF  L WSDG H VTSPIA +W
Sbjct  776   FTVTVSADSMPSGTSSFAHLTWSDGKHTVTSPIAFTW  812



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/757 (47%), Positives = 488/757 (64%), Gaps = 53/757 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P  F  H  WY S + T+S       S+E++Y Y +  HGFS +LTP Q
Sbjct  40    TYIVHMAKSEMPASFEHHTHWYDSSLKTVS------DSAEMVYIYSNAIHGFSTKLTPEQ  93

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L + PGV+SVLP+   EL TTR+P+FLGL   +  + P S+  +D+IIGVLD+G+WP
Sbjct  94    AESLQSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETI-PQSNSESDVIIGVLDTGVWP  152

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D GL P+P SW+  CE G NF +++CNRK+IGAR + +GYEA +G PI    E 
Sbjct  153   ESKSFDDTGLGPVPGSWKGACESGTNFNSSNCNRKLIGARYFAKGYEATVG-PIETSKES  211

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH AS AAGSAV+ A++ G+A G ARG+A  ARIA YKVCW+G C ++DI
Sbjct  212   KSPRDDDGHGTHTASTAAGSAVSGASLFGYAPGTARGMAPRARIAAYKVCWVGGCFSSDI  271

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             ++ +DQA+AD V+VLS+SL      G    Y  D +AIGAF A++KG+++SC+AGN GP 
Sbjct  272   VAAIDQAIADNVNVLSMSLG-----GGMSDYFRDSVAIGAFSAMEKGILISCSAGNAGPS  326

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG---VQPSRIQVPVVYGG  1183
              Y+  N APWI TVGA T+DR+FPA V+LGN ++F+G SLY G     P+ +  P VY G
Sbjct  327   AYSLSNSAPWITTVGAGTLDRDFPAFVSLGNGKNFSGVSLYRGNSNAAPTAL-TPFVYAG  385

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C  G L   +V+G+IV C++G +   V KG  V  AGGVGMI+ N    G
Sbjct  386   NASNATSGNLCMMGTLIPERVKGKIVMCDRGVNAR-VQKGAVVKAAGGVGMILANTAANG  444

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  ++  +P   V   + ++I+ Y+     PTA I F+GT +G  PS P VAAFS RG
Sbjct  445   EELVADSHLLPATSVGQQNADVIKSYLLKDPNPTATILFEGTKVGVQPS-PVVAAFSSRG  503

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP++LKPD++APGVNILA W+G++             FN+ISGTSM+CPHVSGLAA
Sbjct  504   PNSVTPDVLKPDIVAPGVNILAGWSGAIGPTGLAIDARRVAFNIISGTSMSCPHVSGLAA  563

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTTAYT   +G+  L D+ T +P+TP  +G+GHVDP  A++P
Sbjct  564   LLKGAHPEWSPAAIRSALMTTAYTAYKNGQ-KLQDVATGKPSTPFDHGAGHVDPISALNP  622

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD  V+DY++FLC + Y + +I    + S    C  +   +   LNYPSF+V F++ 
Sbjct  623   GLVYDLTVDDYLNFLCALNYSASEINSLAKRS--YTCDEKKKYSVRDLNYPSFAVNFESR  680

Query  2039  L-------QTVIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYE  2194
                       V Y RT+ NV       Y+ +V + S  V+++V P  L F+   +   Y 
Sbjct  681   YGGGTTSSNVVKYTRTLTNVGPPGT--YKASVTSESQLVKISVEPETLSFSQANEKKVYT  738

Query  2195  VTFQSL----RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF ++      + +SFG + WSDG H+V SPIA+SW
Sbjct  739   VTFSAVGSVPANAVNSFGRVEWSDGKHIVGSPIAISW  775



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/749 (47%), Positives = 479/749 (64%), Gaps = 40/749 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  +  H  WY S + ++S       S++LLYTY +  HGFS RLT
Sbjct  30    QQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVS------ESAQLLYTYNNAIHGFSTRLT  83

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLIS-GSSNLGPSSDYGADIIIGVLDS  466
             P +A  L   PGVISVLP+   EL TTRSP FLGL    +++L P +   +D+++GVLD+
Sbjct  84    PEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASSDVVVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SFSD+G  P+P++W+  CE G NF A+ CNRK+IGAR + RGYEA +G P+  
Sbjct  144   GVWPESKSFSDKGFGPVPSTWKGGCEAGTNFTASLCNRKLIGARFFARGYEATMG-PVDE  202

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAGS V  A++ G A G ARG+   AR+AVYKVCWLG C 
Sbjct  203   SKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGTARGMDPRARVAVYKVCWLGGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ +D+A+ D V+VLS+SL      G    Y  D +AIGAF A+++G+ VSC+AGN
Sbjct  263   SSDILAAIDKAIEDNVNVLSMSLG-----GGMSDYYRDGVAIGAFAAMERGIFVSCSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P++  N+APWI TVGA T+DR+FPA+  LGN ++F+G SL+ GV      +P +Y 
Sbjct  318   AGPSPFSLSNVAPWITTVGAGTLDRDFPAIAILGNGKNFSGVSLFKGVALPDKLLPFIYA  377

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    
Sbjct  378   GNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNAR-VQKGDVVKAAGGVGMILANTAAN  436

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+IIR+YV T   PTA +  +GTV+   PS P VAAFS R
Sbjct  437   GEELVADAHMLPATTVGEKAGDIIRRYVLTDPNPTASVLIQGTVVNVQPS-PVVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP ILKPD+IAPGVNILAAWTG+             EFN+ISGTSM+CPHVSGLA
Sbjct  496   GPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRVEFNIISGTSMSCPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY     G+  ++D+ T +P+TP  +G+G+V PT A +
Sbjct  556   ALLKSAHPEWSPAAIRSALMTTAYRSYKDGK-PILDIATGKPSTPFDHGAGYVSPTIATN  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V    
Sbjct  615   PGLVYDLTTVDYLGFLCALNYTSSQIRSVSRRN--FTCDPTKTYSIADLNYPSFAVNVDG  672

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---Q  2206
             +     Y RTV +V    +   +VT ++ + V+++V+P  L F +  +  SY VTF    
Sbjct  673   S-GAYKYTRTVTSVGGAGSYKVEVTSESTA-VKISVAPAVLNFKEVNEKKSYTVTFTVDS  730

Query  2207  SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             S    ++SFGS+ WSDG H+V SP+A++W
Sbjct  731   SKASGSNSFGSIEWSDGKHVVASPVAITW  759



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/748 (48%), Positives = 469/748 (63%), Gaps = 39/748 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + +++IV M KS+ P  F+ H  WY + + ++S       ++E+LY Y+ VAHGFSARLT
Sbjct  28    KKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVS------DTAEILYAYDTVAHGFSARLT  81

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P++A  +   PGV+ V+ +   EL TTR+P+FLGL   +    P S+  +D+++GVLD+G
Sbjct  82    PAEARAMERRPGVLGVMAEARYELHTTRTPEFLGL-DRTEGFIPQSNTTSDVVVGVLDTG  140

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPAT-SCNRKIIGARAYYRGYEAEIGKPI--  640
             +WPER S+ D GL P+P SW+  CE G +F A  +CNRK++GAR + +GYEA +G PI  
Sbjct  141   VWPERKSYDDAGLGPVPASWKGACEEGKDFKAANACNRKLVGARFFSQGYEARMG-PINL  199

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S  AGSAV + +  G+A G ARG++T ARIAVYKVCWLG C 
Sbjct  200   TRESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGYAAGTARGMSTRARIAVYKVCWLGGCF  259

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DIL+ MD+A+ DG  VLSLSL      G    Y  D IA+GAF A+  GV+VSC+AGN
Sbjct  260   GSDILAAMDKAIEDGCGVLSLSLG-----GGMSDYYRDNIAVGAFSAMAMGVVVSCSAGN  314

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA T+DR+FPA V L N +++TG SLYSG       +P +Y 
Sbjct  315   AGPGASTLSNVAPWITTVGAGTLDRDFPANVLLSNGKNYTGVSLYSGKPLPSSPLPFIYA  374

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV G+IV C++G +   V KG  V  AGG GMI+ N    
Sbjct  375   GNATNTTNGNLCMTGTLLPDKVAGKIVLCDRGINAR-VQKGSVVRDAGGAGMILANTAAN  433

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +   PTA I F+GT +G  PS P VAAFS R
Sbjct  434   GEELVADAHLLPATAVGEIAGDAIKSYLFSDPNPTATIAFRGTKVGVKPS-PVVAAFSSR  492

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GP+ +TP+ILKPD+IAPGVNILAAWTGS+           TEFN+ISGTSM+CPHVSGL 
Sbjct  493   GPSAITPDILKPDLIAPGVNILAAWTGSVGPTGQAADPRRTEFNIISGTSMSCPHVSGLL  552

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSP AIKSALMTTAY     G G ++D+ T +  TP  +G+GHVDP  A+D
Sbjct  553   ALLKGAHPDWSPGAIKSALMTTAYAA-YPGDGGILDVATGRAATPFDFGAGHVDPPKALD  611

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD    DY+DFLC + Y   +IA   R +    C  +       LNYPSF+V F  
Sbjct  612   PGLVYDLTTEDYLDFLCALNYTPLQIARLSRLTNYT-CDRQKAYEVSDLNYPSFAVAFAT  670

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR  2215
                TV + RT+ NV       Y+ TV  P  V+V V P  L F+   +  +Y VTF +  
Sbjct  671   ASTTVKHTRTLTNVGAPGT--YKATVSAPEGVKVVVEPTALTFSALGEKKNYTVTFSTAS  728

Query  2216  QSADS--FGSLRWSDGTHLVTSPIAVSW  2293
             Q + S  FG L WSD  H+V SP+A SW
Sbjct  729   QPSGSTAFGRLEWSDAQHVVASPLAFSW  756



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/752 (46%), Positives = 477/752 (63%), Gaps = 36/752 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV+M KS KP+ FS H  WY+S+I  +S   ++S  + +LYTY+ V HGF+A+LT +
Sbjct  43    QSYIVYMDKSMKPEHFSLHQHWYTSLIDEVS--GSNSDPAAMLYTYDTVTHGFAAKLTST  100

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A  + N  G ++V PD +  + TTR+P FLGL S S  L P S Y  DII+GVLD+GIW
Sbjct  101   EAQAMENTDGCLAVFPDYVYRVHTTRTPDFLGL-SSSHGLWPLSHYADDIIVGVLDTGIW  159

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGEP-  652
             PE  SFSD+GL  +P  W+ +CE+G  F A+ CN K+IGAR + +GYEA+ G     E  
Sbjct  160   PESKSFSDQGLTQVPARWKGECEMGTEFNASHCNNKLIGARFFLKGYEAKYGHVDEMENY  219

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD  GHGTH +S AAG+ V  +++ G A G ARGIAT AR+AVYKVCW   C ++D+
Sbjct  220   RSPRDEGGHGTHTSSTAAGAEVPGSSLLGFAAGTARGIATKARLAVYKVCWPEECLSSDL  279

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+GM+ A++DGV +LSLS++        LPY +D IAIGA GA++KGV VSCAAGN GP 
Sbjct  280   LAGMEAAISDGVDLLSLSISDSRN----LPYYKDAIAIGALGAIEKGVFVSCAAGNAGPI  335

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
             P    N APWI TVGASTIDREFPA V LGN +++ G+SLY G      Q+P++YG SA+
Sbjct  336   PSKIFNTAPWITTVGASTIDREFPAPVVLGNGKNYRGSSLYKGKTLGNGQLPLIYGKSAS  395

Query  1193  S----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             S     +C  G LD+++V G+IV C+ G      + G+ V QAGG GMI  N   +G  L
Sbjct  396   SNETAKFCLAGSLDSNRVSGKIVLCDLGGGEGTAEMGLVVRQAGGAGMIQANRLVDGEDL  455

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +   +P   V    G  I+ Y+     PTA I+ +G  +     AP VA+FS RGPN 
Sbjct  456   WTDCHFLPATKVDFKSGIEIKAYINRTKNPTATIKAEGATVVGKTRAPVVASFSSRGPNP  515

Query  1541  LTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAMLK  1687
             L PEILKPD+IAPGVN+LAAW+G ++           ++N+ISGTSMACPHV+G+AA++ 
Sbjct  516   LVPEILKPDLIAPGVNVLAAWSGHVSPTGLTSDKRRVDYNIISGTSMACPHVTGIAALIL  575

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
              ++ +W+PAAIKSALMT++   D+S R  + +  T  P    A G+GHV+P+ A+DPGLV
Sbjct  576   AVHSAWTPAAIKSALMTSSVPFDHSKR-LISESVTALPADAFAIGAGHVNPSAALDPGLV  634

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YDA  +DYV FLC++ Y   +I +  R +    C   +   PG LNYPSFSV+FK     
Sbjct  635   YDADFDDYVSFLCSLNYTRSQIHILTRKAS--SCTRIHSQQPGDLNYPSFSVVFKPLNLV  692

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD  2227
                +RTV NV     V Y+V++++P  V + V P  LVF ++ +  SY V F+S   S +
Sbjct  693   RALRRTVTNVGGAPCV-YEVSMESPPGVNIIVEPRTLVFKEQNEKASYTVRFESKTASHN  751

Query  2228  ------SFGSLRW---SDGTHLVTSPIAVSWE  2296
                    FG + W     GT +V SP+A+ WE
Sbjct  752   KSSGRQEFGQIWWKCVKGGTQVVRSPVAIVWE  783



>ref|XP_002301156.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
 gb|EEE80429.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
Length=779

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/757 (47%), Positives = 472/757 (62%), Gaps = 46/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +  K+FI+ M KS  P  +  H  WY S + ++S       S+++LYTY ++ HGFS +L
Sbjct  40    QTKKTFIIQMDKSNMPANYYDHFQWYDSSLKSVS------ESADMLYTYNNIIHGFSTQL  93

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +A  L    G++SVLP+ + +L TT +P+FLGL    + L P+S   +++I+GVLD+
Sbjct  94    TPDEAELLEKQSGILSVLPEMIYKLHTTHTPEFLGLGKSDAVLLPASASLSEVIVGVLDT  153

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL PIP++W+  C+VG NF ++SCNRK+IGA+ + +GYEA  G PI  
Sbjct  154   GVWPEIKSFGDTGLGPIPSTWKGSCQVGKNFNSSSCNRKLIGAQYFSKGYEAAFG-PIDE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+ AAGSAV+ A++ G+A G ARG+AT AR+A YKVCWLG C 
Sbjct  213   TMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYASGIARGMATEARVAAYKVCWLGGCF  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ M++AVADGV+V      S S  G    Y  D +AIGAF A  +G++VSC+AGN
Sbjct  273   SSDILAAMEKAVADGVNV-----MSMSIGGGLSDYTRDTVAIGAFRAAAQGILVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P +  N+APWI TVGA T+DR+FPA V+LG+ + ++G SLYSG   S   VP+VY 
Sbjct  328   GGPSPGSLSNVAPWITTVGAGTLDRDFPAFVSLGDGKKYSGISLYSGKPLSDSLVPLVYA  387

Query  1181  G----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G    S +   C  G L  ++V G+IV C++G + S V KG+ V  +GG+GMI+ N    
Sbjct  388   GNVSNSTSGSLCMTGTLIPAQVAGKIVICDRGGN-SRVQKGLVVKDSGGLGMILANTELY  446

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +PTA V +     I+ Y      P   I   GT +G  PS P VAAFS R
Sbjct  447   GEELVADAHLLPTAAVGLRTANAIKNYAFLDPKPMGTIASGGTKLGVEPS-PVVAAFSSR  505

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPE+LKPD+IAPGVNILA WTG              EFN+ISGTSM+CPHVSGLA
Sbjct  506   GPNLVTPEVLKPDLIAPGVNILAGWTGGAGPTGLTNDKRHVEFNIISGTSMSCPHVSGLA  565

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  +  WSPAAIKSALMTTAY    +G   L+D+ T QP+TP  YG+GHV+P  A+D
Sbjct  566   ALIKAAHQDWSPAAIKSALMTTAYATYKNGE-NLLDVATGQPSTPFDYGAGHVNPVAALD  624

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYDA V+DY+ F C + Y +  I        + D   +   + G LNYPSFSV  + 
Sbjct  625   PGLVYDATVDDYISFFCALNYSASDIKQITTKDFICDSSKKY--SLGDLNYPSFSVPLQT  682

Query  2036  N---------LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                         TV Y RT+ NV         +T QT S V++ V P  L F    +  S
Sbjct  683   ASGKEGGDGVKSTVKYTRTLTNVGAPATYKVSMTSQTTS-VKMLVEPESLSFAKEYEKKS  741

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF   S+    +SF  L WSDG H+V SPIA SW
Sbjct  742   YTVTFTATSMPSGTNSFAHLEWSDGKHVVRSPIAFSW  778



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/753 (47%), Positives = 474/753 (63%), Gaps = 35/753 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLS-PLSNHSRSSELLYTYEHVAHGFSARL  286
             + K+++V M KS  P  ++ H  WYSS I +++ P S+    + +LYTY+   HG +ARL
Sbjct  29    QKKTYVVHMDKSAMPSPYTNHLQWYSSKIDSVTDPKSHEEEGNRILYTYQTAFHGLAARL  88

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             +  +A+ L   PGV++V+P+   EL TTRSP+FLGL    S  +        D+++GVLD
Sbjct  89    SKEEAARLEEEPGVVAVIPETRYELHTTRSPRFLGLERQESERVWAERVTDHDVVVGVLD  148

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPE  SF+D G++P P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK   
Sbjct  149   TGIWPESESFNDTGMSPGPSTWRGACETGRGFLKHNCNRKIVGARVFYRGYEAATGKIDQ  208

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+G C 
Sbjct  209   ELEYRSPRDKDGHGTHTAATVAGSPVRGANLLGFAYGTARGMAPKARVAAYKVCWVGGCF  268

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DILS +DQAVADGVHVLS+SL      G    Y  D +AI  FGA++ GV VSC+AGN
Sbjct  269   SSDILSAVDQAVADGVHVLSISLG-----GGISTYSRDSLAIATFGAMEMGVFVSCSAGN  323

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V LG  R F G SLY G  V     Q P+V
Sbjct  324   GGPDPISLTNVSPWITTVGASTMDRDFPATVRLGTRRVFKGVSLYKGRTVLSRGKQYPLV  383

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G   S      +C  G LD   V G+IV C++G  T  V KG  V +AGGVGMI+ N 
Sbjct  384   YLGRNASSPDPTSFCLDGALDQHNVAGKIVICDRG-VTPRVQKGQVVKRAGGVGMILTNT  442

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  +   +P   V   +G++I++Y  T+   TA +E  GT +G  PS P VAAF
Sbjct  443   ATNGEELVADCHLLPAVAVGEKEGKVIKEYAMTSKRATASLEILGTRVGIKPS-PVVAAF  501

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAW+G +            +FN++SGTSM+CPHVS
Sbjct  502   SSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDKRRVKFNILSGTSMSCPHVS  561

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA+++  +P WSPAA+KSALMTTAY  DN     L D    +P++P+ +G+GH+DP  
Sbjct  562   GVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLE-PLTDAAGAEPSSPYDHGAGHIDPLK  620

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLG-NPGSLNYPSFSV  2023
             A+DPGLVYD G  +Y DFLCT      ++ +F ++S    CR+   G NPG+LNYP+ S 
Sbjct  621   AIDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNR-SCRHSLAGNNPGNLNYPAISA  679

Query  2024  LFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             LF  N  ++ +  +RTV NV      +Y+V+V       VTV P  L FT +   LSY V
Sbjct  680   LFPENTHVKAMTLRRTVTNVGP-HVSSYKVSVSPFKGATVTVQPKTLNFTTKHQKLSYTV  738

Query  2198  TFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             TF++ LR     FG L W   TH V SP+ ++W
Sbjct  739   TFRTKLRMKRPEFGGLLWKSATHKVRSPVIITW  771



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/750 (47%), Positives = 479/750 (64%), Gaps = 40/750 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  +++V M   + P+ F  H  WY++ + ++SP      S+++LYTY +V HGFS RLT
Sbjct  11    EKTTYVVRMASHQMPKAFERHAHWYAASLKSVSP------SADMLYTYNNVVHGFSTRLT  64

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PGVISV P+   EL TTR+P+FLGL   +  L P +D  +D+++GVLD+G
Sbjct  65    DDEARSLQGQPGVISVWPELKYELHTTRTPEFLGLGKSTDALFPETDSVSDVVVGVLDTG  124

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG-  646
             +WPE  SF+D GL P+P SW+  CE G NF ++ CNRK+IGAR + RGYEA +G PI   
Sbjct  125   VWPESHSFADDGLGPVPASWKGFCEEGTNFTSSHCNRKLIGARFFSRGYEATLG-PIDAS  183

Query  647   -EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH AS AAGS V  A++ G A G ARG+AT AR+AVYKVCWLG C +
Sbjct  184   RESKSPRDDDGHGTHTASTAAGSVVEGASLFGFAAGTARGMATRARVAVYKVCWLGGCFS  243

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL G+DQAV D V+V      S S  G    Y  D +A+GAF A+QKG+ +S +AGN 
Sbjct  244   SDILKGLDQAVEDNVNV-----LSMSLGGGMSEYYRDSVAVGAFAAMQKGIFISSSAGNA  298

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  ++  N+APWI TVGA T+DR+FPA V+LG+ ++++G SLY G       +P++Y G
Sbjct  299   GPSDFSLSNVAPWITTVGAGTLDRDFPAYVSLGSGQNYSGVSLYKGDALPHGMLPLIYAG  358

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV G++V C++G +   V KG  V  AGG+GM++ N  + G
Sbjct  359   NASNATNGNLCMMGTLIPEKVAGKMVLCDRGLNAR-VQKGAVVKAAGGLGMVLANTASNG  417

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P + V    G  I++Y+ + + PT  I F+GT +G  PS P VAAFS RG
Sbjct  418   EELVADAHLLPASCVGEKSGNAIKKYLFSDTNPTVTILFEGTKVGVQPS-PVVAAFSSRG  476

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP+ILKPD+IAPGVNI+A W+G L             FN+ISGTSM+CPHVSGLAA
Sbjct  477   PNLITPQILKPDIIAPGVNIIAGWSGKLGPTGLAIDSRRVAFNIISGTSMSCPHVSGLAA  536

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTTAY+    G+  L+D+ T +P+TP  +G+GH DP  A+DP
Sbjct  537   LLKGAHPEWSPAAIRSALMTTAYSSYKDGQ-ILLDIATGKPSTPFDHGAGHADPVAALDP  595

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD  V+DY+DFLC + Y   +I+   R     D + +   +   LNYPSF+V F++N
Sbjct  596   GLVYDLTVDDYLDFLCALNYTDDQISGLTRKEFSCDAKKKY--SVTDLNYPSFAVNFQSN  653

Query  2039  LQTVIYK--RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--  2206
               + +Y   RT+ NV         +  +T S V+++V P  L F+   +  SY VTF   
Sbjct  654   GGSSVYNYSRTLTNVGPAGTYKLSLKSETQS-VKISVEPETLSFSHANEKKSYTVTFTAV  712

Query  2207  -SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              S+   + SFG + WSDG H+V SPIA SW
Sbjct  713   GSMSPDSKSFGRIEWSDGKHIVGSPIAFSW  742



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/749 (48%), Positives = 482/749 (64%), Gaps = 44/749 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M +S+ P  F  H  WY S + ++S       S+ELLYTY++  HGFS RLTP +
Sbjct  35    TYIVHMARSQMPASFDHHSHWYDSSLRSVS------DSAELLYTYDNAIHGFSTRLTPEE  88

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISVLP+   EL TTR+P FLGL   +++L P SD   D+++GVLD+G+WP
Sbjct  89    AESLTGQPGVISVLPELRYELHTTRTPLFLGL-DHNADLFPQSDSATDVVVGVLDTGVWP  147

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D G  P+P+ W+  CE G NF A+SCN K+IGAR + RGYEA +G PI    E 
Sbjct  148   ESKSFDDSGFGPVPSGWKGACETGTNFSASSCNHKLIGARFFARGYEATMG-PIDESKES  206

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KSARD +GHGTH +S AAGS V  A++ G+A G ARG+A  AR+AVYKVCWLG C ++DI
Sbjct  207   KSARDDDGHGTHTSSTAAGSIVEGASLLGYAAGTARGMAPRARVAVYKVCWLGGCFSSDI  266

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A+ DGV+VLS+SL      G    Y  D +AIGAF A++KG++VSC+AGN GP 
Sbjct  267   LAAIDRAIEDGVNVLSMSLG-----GGMSDYYRDSVAIGAFAAMEKGILVSCSAGNAGPS  321

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG-VQPSRIQVPVVYGGSA  1189
              ++  N+APWI TVGA T+DR+FPA VT GN ++++G SL+ G   P+++ +P VY G+A
Sbjct  322   SFSLSNVAPWITTVGAGTLDRDFPAQVTFGNGKNYSGVSLFKGDALPAKL-LPFVYAGNA  380

Query  1190  ----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
                 N   C  G L   +V+G+IV C++G +   V KG  V  AGG+GMI+ N    G +
Sbjct  381   SNATNGNLCMTGTLIPERVKGKIVMCDRGVNAR-VQKGQVVKDAGGIGMILANTAANGEE  439

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P   V    G+ IR+YV T   PTA I F+GTV+G  PS P VAAFS RGPN
Sbjct  440   LVADAHLLPATAVGEKSGDEIREYVLTNPNPTATIVFEGTVVGIQPS-PVVAAFSSRGPN  498

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TPEILKPD+IAPGVNILAAWTG               FN+ISGTSM+CPHVSGLAA+L
Sbjct  499   SITPEILKPDLIAPGVNILAAWTGEAGPTGLAADERRVGFNIISGTSMSCPHVSGLAALL  558

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAAI+SALMTTAY+     +  ++D+ T + +TP  +G+GHV P +A++PGL
Sbjct  559   KAAHPDWSPAAIRSALMTTAYSSYKDQK-PILDVATGKSSTPFDHGAGHVSPVNAINPGL  617

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV---LFKN  2035
             VYD    DY+ FLC + Y + +I    R++    C      +   LNYPSF+V     ++
Sbjct  618   VYDLSAEDYIGFLCALKYTASQIKSVARSN--FTCDPSKTYSVTDLNYPSFAVNIDTTRS  675

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---  2206
               +   Y RTV +V        +++ +T + V++ V P  L F +  +  SY VTF    
Sbjct  676   GTRAYKYTRTVTSVGGAGTYRVKISSETTA-VKIAVEPAVLSFKEVNEKQSYTVTFTVSS  734

Query  2207  SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             S   +++SFG + WSDG H+V SP+A SW
Sbjct  735   SSAPTSNSFGRIEWSDGKHVVGSPVAFSW  763



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/748 (48%), Positives = 470/748 (63%), Gaps = 39/748 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + +++IV M KS+ P  F+ H  WY + + ++S       ++E+LY Y+ VAHGFSARLT
Sbjct  28    KKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVS------DTAEILYAYDTVAHGFSARLT  81

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P++A  +   PGV+ V+ +   EL TTR+P+FLGL   +    P S+  +D+++GVLD+G
Sbjct  82    PAEARAMERRPGVLGVMAEARYELHTTRTPEFLGL-DRTEGFIPQSNTTSDVVVGVLDTG  140

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPAT-SCNRKIIGARAYYRGYEAEIGKPI--  640
             +WPER S+ D GL P+P SW+  CE G +F A  +CNRK++GAR + +GYEA +G PI  
Sbjct  141   VWPERKSYDDAGLGPVPASWKGACEEGKDFKAANACNRKLVGARFFSKGYEARMG-PINL  199

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S  AGSAV + +  G+A G ARG++T ARIAVYKVCWLG C 
Sbjct  200   TKESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGYAAGTARGMSTRARIAVYKVCWLGGCF  259

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DIL+ MD+A+ DG  VLSLSL      G    Y  D IA+GAF A+  GV+VSC+AGN
Sbjct  260   GSDILAAMDKAIEDGCGVLSLSLG-----GGMSDYYRDNIAVGAFSAMAMGVVVSCSAGN  314

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA T+DR+FPA V L N +++TG SLYSG       +P +Y 
Sbjct  315   AGPGASTLSNVAPWITTVGAGTLDRDFPANVLLSNGKNYTGVSLYSGKPLPSSPLPFIYA  374

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV G+IV C++G +   V KG+ V  AGG GMI+ N    
Sbjct  375   GNATNTTNGNLCITGTLLPDKVAGKIVLCDRGINAR-VQKGLVVRDAGGAGMILANTAAN  433

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +   PTA I F+GT +G  PS P VAAFS R
Sbjct  434   GEELVADAHLLPATAVGEIAGDAIKSYLFSDPNPTATIAFRGTKVGVKPS-PVVAAFSSR  492

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GP+ +TP+ILKPD+IAPGVNILAAWTGS+           TEFN+ISGTSM+CPHVSGL 
Sbjct  493   GPSAITPDILKPDLIAPGVNILAAWTGSVGPTGQAVDPRRTEFNIISGTSMSCPHVSGLL  552

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSP AIKSALMTTAY     G G ++D+ T +  TP  +G+GHVDP  A+D
Sbjct  553   ALLKGAHPDWSPGAIKSALMTTAYAA-YPGDGGILDVATGRAATPFDFGAGHVDPPKALD  611

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVY+    DY+DFLC + Y   +IA   R +    C  +       LNYPSF+V F  
Sbjct  612   PGLVYNLTNEDYLDFLCALNYTPLQIARLSRLTNYT-CDRQKAYEVSDLNYPSFAVAFAT  670

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLR  2215
                TV + RT+ NV       Y+ TV  P +V+V V P  L F    +  +Y VTF +  
Sbjct  671   ASTTVKHTRTLTNVGAPGT--YKATVSAPEDVKVVVEPTALTFAALGEKKNYTVTFSTAS  728

Query  2216  QSADS--FGSLRWSDGTHLVTSPIAVSW  2293
             Q + S  FG L WSD  H+V SP+A SW
Sbjct  729   QPSGSTAFGRLEWSDAQHVVASPLAFSW  756



>ref|XP_004292169.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/756 (47%), Positives = 478/756 (63%), Gaps = 50/756 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K+FI  + +  KP +F +H+ WY+S           +   ++L+ Y+ V HGFSA LT  
Sbjct  28    KTFIFRVDRFSKPSIFPSHYHWYTS---------EFADPPQILHLYDTVFHGFSAALTSD  78

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             QA+ L++ P V+ V  DR   L TTRSPQFLGL      L   SDYG+D+I+GV D+G+W
Sbjct  79    QAASLSHHPAVLHVFEDRRRHLHTTRSPQFLGL-RNQRGLWSESDYGSDVIVGVFDTGVW  137

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEA--EIGKPIVG-  646
             PER SFSD  L P+P  WR  CE G  F A++CN+K+IGAR + +G+EA    G P+   
Sbjct  138   PERRSFSDLNLGPVPKRWRGVCETGDRFAASNCNKKLIGARFFIKGHEAAANAGGPMTAI  197

Query  647   ----EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E +SARD +GHGTH AS A G     A+++G+A G A+G+A  AR+A YKVCW  +
Sbjct  198   NGSVEFRSARDADGHGTHTASTATGRYAFEASMSGYASGIAKGVAPKARLAAYKVCWKDS  257

Query  815   -CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C ++DIL+  D AV DGV V+S+S+      G + PY  D IAIG++GAV  GV VSC+
Sbjct  258   GCFDSDILAAFDAAVKDGVDVISISIGGGD--GVSSPYYLDPIAIGSYGAVSHGVFVSCS  315

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPV  1171
             AGN GP+  +  NLAPW+ TVGA TIDR FPAVV LG+ R  +G SLY+G        PV
Sbjct  316   AGNDGPNGMSVTNLAPWLTTVGAGTIDRNFPAVVVLGDGRRLSGVSLYAGAPLKGKMYPV  375

Query  1172  VYGGSANSF---YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             VY G +       C    LD  +VRG+IV C++G++  +  KG+ V +AGGVGMI+ N  
Sbjct  376   VYPGQSGMLSASLCMENSLDPRQVRGKIVICDRGNNPRVA-KGMVVKKAGGVGMILANGI  434

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G  L  +A  +PTA V   +G+ ++ YV +  +P+A I+F+GTVIG  P AP VA+FS
Sbjct  435   TNGEGLVGDAHLLPTAAVGADEGDAVKAYVSSTRYPSATIDFQGTVIGIKP-APVVASFS  493

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN L PEILKPD+IAPGVNILAAWT ++           TEFN++SGTSMACPHVSG
Sbjct  494   GRGPNGLNPEILKPDLIAPGVNILAAWTDAVGPTGLQTDNRKTEFNILSGTSMACPHVSG  553

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
              AA+LK  +P WSPAAI+SA+MTTA   +N  + T+ D  T +P+TP+  G+GH++   A
Sbjct  554   AAALLKSAHPDWSPAAIRSAMMTTAGITNNLNK-TMTDEATGKPSTPYDLGAGHLNLDRA  612

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             +DPGLVYD    DYV FLC++GY  R I +  R+ P   C  +   +PG+LNYPS +VLF
Sbjct  613   MDPGLVYDITGEDYVRFLCSVGYGPRVIQVITRSPP--KCPGKTT-SPGNLNYPSIAVLF  669

Query  2030  KNN---LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
               +   L +  + RTV NV +  N  Y+  ++ P  V+VTV P++LVFT+ +   SY VT
Sbjct  670   PTSAAGLSSKTFVRTVTNVGQ-PNAVYRPMIEAPRGVKVTVKPSKLVFTEAVKKRSYLVT  728

Query  2201  FQSLR------QSADSFGSLRWSDGTHLVTSPIAVS  2290
                 R      +S   FGSL WSDG H+V SPI V+
Sbjct  729   VAVDRSNLVLGESGGVFGSLYWSDGKHVVRSPIVVT  764



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/764 (48%), Positives = 488/764 (64%), Gaps = 49/764 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPL---SNHSRSSELLYTYEHVAHGFSARL  286
             +++IVF+    KP +F TH  WY S + +LS     ++HS +S +L+TYE V HGFSA+L
Sbjct  33    RTYIVFVQHDAKPSVFPTHKHWYDSSLRSLSSTIQTTSHSETSRILHTYETVFHGFSAKL  92

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             +P +A +L  V G++ V+P+++ ELQTTRSPQFLGL  + S+ L   SD+G+D++IGV+D
Sbjct  93    SPLEADQLQKVSGIVGVIPEQVRELQTTRSPQFLGLKTTDSAGLLKESDFGSDLVIGVID  152

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPER SF+DR L P+P  W+ +C  G +FPATSCNRK+IGAR +  GYEA  GK   
Sbjct  153   TGIWPERQSFNDRNLGPVPAKWKGECVGGKDFPATSCNRKLIGARFFCGGYEATNGKMNE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH ASIAAG  V  A+  G+ARG A G+A  AR+A YKVCW   C 
Sbjct  213   TLESRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGVAAGMAPKARLAAYKVCWNAGCY  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+  D AVADG  V+SLS+         +PY  D IAIGAFGA   GV VS +AGN
Sbjct  273   DSDILAAFDAAVADGADVVSLSVGGV-----VVPYYLDSIAIGAFGASDHGVFVSASAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYS--GVQPSRIQVPVV  1174
              GP   T  N+APW+ TVGA T+DR+FPA V LGN +   G S+Y   G+ P R+  P++
Sbjct  328   GGPGGLTVTNVAPWVTTVGAGTMDRDFPANVKLGNGKLIPGVSVYGGPGLAPGRL-YPLI  386

Query  1175  YGGSA-----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y GS      +S  C  G LD S V+G+IV C++G + S   KG  V +AGG+GMI+ N 
Sbjct  387   YAGSVGGDGYSSSLCLEGSLDPSFVKGKIVLCDRGIN-SRATKGEVVRKAGGIGMILANG  445

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASF----PTARIEFKGTVIGNSPSAPR  1507
               +G  L  +   +P   +  + G+ IR+Y+  AS     PTA I F+GT +G  P AP 
Sbjct  446   VFDGEGLVADCHVLPATAIGASGGDEIRKYITVASKSKSPPTATIIFRGTRLGVRP-APV  504

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMAC  1654
             VA+FS RGPN  +PEILKPDVIAPG+NILAAW   +           TEFN++SGTSMAC
Sbjct  505   VASFSARGPNPESPEILKPDVIAPGLNILAAWPDRVGPSGIPSDKRRTEFNILSGTSMAC  564

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PH+SGLAA+LK  +P WSPAAI+SALMTTAYT DN G  T++D  T   +T   +G+GHV
Sbjct  565   PHISGLAALLKAAHPEWSPAAIRSALMTTAYTEDNRGE-TMLDEATGNTSTVMDFGAGHV  623

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDC-RNRNLGNPGSLNYP  2011
              P  A+DPGL+YD   NDY+DFLC   Y    I +  R   + DC + R  G+ G+LNYP
Sbjct  624   HPQKAMDPGLIYDLTSNDYIDFLCNSNYTVTNIQMITRK--MADCSKARKAGHVGNLNYP  681

Query  2012  SFSVLFKNNLQ---TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDT  2182
             S S +F+   +   +  + RTV NV    +V YQVTV+ P+   VTV P +LVF      
Sbjct  682   SMSAVFQQYGKHKFSTHFIRTVTNVGDPNSV-YQVTVKPPTGTLVTVQPEKLVFRRLGQK  740

Query  2183  LSYEVTFQSLR------QSADSFGSLRWSDGTHLVTSPIAVSWE  2296
             L++ V  +++        ++   GS+ W+DG H VTSPI V+ E
Sbjct  741   LNFLVRVEAMAVKLSPGSTSIKSGSIVWADGKHTVTSPIVVTLE  784



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/754 (48%), Positives = 473/754 (63%), Gaps = 49/754 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H  WY S       L + S S+E+LYTY    HGF+ RLTP +
Sbjct  32    TYIVHMAKSQMPSSFDQHSLWYES------SLKSASESAEMLYTYNSAIHGFATRLTPEE  85

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISV P++  EL TTR+P FLGL   ++ L P +   +D++IGVLDSG+WP
Sbjct  86    ADSLMTQPGVISVQPEQQYELHTTRTPLFLGLDVHNAGLFPETGAASDVVIGVLDSGVWP  145

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SFSD G  PIP +W+ +CE G  F A+ CNRK+IGAR +  GYE + G P+    E 
Sbjct  146   ESKSFSDEGYGPIPTTWKGECEAGTKFTASHCNRKLIGARFFVHGYEGKYG-PVDESKES  204

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH AS AAGS V  AN+ G A G ARG+A  AR+AVYKVCW   C ++D+
Sbjct  205   RSPRDDDGHGTHTASTAAGSIVEGANLLGFANGTARGMAYRARVAVYKVCWKPKCFSSDV  264

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+G+D+A+ D V+VLSLSL  + +         + IA+GAF A++KG+ VSC+AGN GP 
Sbjct  265   LAGIDKAIEDNVNVLSLSLGKRKRD------YTNHIAMGAFSAMEKGIFVSCSAGNDGPS  318

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
             P +  N+APWI TVGA TIDR+FP +VTLGN +S+ G SL+         +P VY GSA 
Sbjct  319   PSSLSNVAPWITTVGAGTIDRDFPTLVTLGNGKSYIGASLFKKDALPPKLLPFVYAGSAS  378

Query  1190  -NSFY---CFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
              N+ Y   C  G L   KV G+IV CE+G++    +KG  V  AGG+GMI+ N  + G +
Sbjct  379   NNATYGKSCLSGTLIPEKVYGKIVMCEKGENGR-AEKGEVVKAAGGIGMILANRASRGEE  437

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L   A  +P   V    G+IIR+YV T   PT  I  +GTV+   PS P +AAFS RGPN
Sbjct  438   LAAYAHVLPATNVGQKAGDIIRRYVMTDPNPTVSIVIQGTVVNVKPS-PVLAAFSSRGPN  496

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TP ILKPD+IAPGVNILAAWTG+L            EFN+ISGTSM+CPHVSGLAA+L
Sbjct  497   PITPNILKPDLIAPGVNILAAWTGALGPSGLASDTRRVEFNIISGTSMSCPHVSGLAALL  556

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K ++P WSPAAI+SALMTTAY+    G+  L+D+ T +P+TP  +G+GHV P  A+ PGL
Sbjct  557   KSVHPEWSPAAIRSALMTTAYSTYKDGQ-PLLDIATVKPSTPFGHGAGHVSPAMAISPGL  615

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQ  2044
             +YD    DY+DFLC + Y+  +I    R      C      +   LNYPSF+V    +  
Sbjct  616   IYDLTTEDYIDFLCALKYNQSQIIKVSRGD--YTCDPSKTYSVADLNYPSFAVNVDKS-D  672

Query  2045  TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT--------  2200
             T  Y RTV NV    + + +V  +T + V+++V P  L F +  +  SYEVT        
Sbjct  673   TYKYTRTVTNVGGAGSYSVKVISET-TEVKISVEPAVLTFKEVNEKKSYEVTFTVNSSKP  731

Query  2201  --FQSLRQSA-DSFGSLRWSDGTHLVTSPIAVSW  2293
               F S R S  +SFGS+ WSDG H+V SP+A+SW
Sbjct  732   PRFSSFRPSGFNSFGSIEWSDGKHVVASPVAISW  765



>ref|XP_003570496.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=785

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/720 (50%), Positives = 466/720 (65%), Gaps = 32/720 (4%)
 Frame = +2

Query  212   LSNHSRSSE--LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  385
             L  H RS    LLYTY H A G +ARLT  QA+ +A  PGV++V  D    L TT +P F
Sbjct  62    LPRHLRSPRPRLLYTYAHAATGVAARLTEEQAAHVAAQPGVLAVHRDEARRLHTTHTPAF  121

Query  386   LGLISGSSNLGPSSDYGADIIIGVLDSGIWP-ERSSF-SDRGLNPIPNSWRNKCEVGPNF  559
             L L   S  L  +    +D+++GVLD+GI+P  R SF     L   P S+R  C     F
Sbjct  122   LRLDQASGILPAAPGAASDVVVGVLDTGIYPIGRGSFLPSSNLGAPPKSFRGGCVSAGAF  181

Query  560   PATS-CNRKIIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavanan  730
              A++ CN K++GA+ YY+GYE  +G+ +    E KS  D  GHG+H AS AAGS VA A+
Sbjct  182   NASAYCNAKLVGAKFYYKGYEEGLGRAMDEAEESKSPLDTEGHGSHTASTAAGSPVAGAS  241

Query  731   vnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktG  910
             +  +ARG+A G+A  ARIA YK+CW   C ++DIL+  D+AV DGV V+SLS+ + S   
Sbjct  242   LFDYARGQAVGMAPGARIAAYKICWANGCYDSDILAAFDEAVYDGVDVISLSVGAGS---  298

Query  911   FALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAV  1090
              A P+  D IAIGAFGA++KG++VS +AGN GP  YTA N+APWILTVGAST+DREFPA 
Sbjct  299   LAPPFFRDSIAIGAFGAMKKGIVVSASAGNSGPGEYTATNIAPWILTVGASTVDREFPAD  358

Query  1091  VTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDD  1270
             V LG+ + + G SLY+G      ++PVVY     S YC+ G LD SKV G+IV C++G +
Sbjct  359   VLLGDGKVYGGVSLYAGEPLGSRKLPVVYAADCGSAYCYRGSLDESKVAGKIVICDRGGN  418

Query  1271  TSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFP  1450
                V+KG AV  AGG+GMI+ N  + G +L  +A  +P  +V    G+ I+QYV++   P
Sbjct  419   AR-VEKGAAVKLAGGIGMILANTEDSGEELIADAHLVPATMVGQTFGDKIKQYVKSDPSP  477

Query  1451  TARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGS------  1612
             TA I F+GTVI  SPSAPRVAAFS RGPN+   EILKPDVIAPGVNILAAWTG       
Sbjct  478   TATIAFRGTVIAGSPSAPRVAAFSSRGPNYRAREILKPDVIAPGVNILAAWTGESAPTDL  537

Query  1613  -----LTEFNMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTL  1777
                    EFN+ISGTSM+CPHVSGLAA+L++ +P WSPAA+KSALMTTAY  DNSG  T+
Sbjct  538   AIDPRRVEFNIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYNEDNSGE-TI  596

Query  1778  IDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSP  1957
              DL T   +TP   G+GHVDP +A+DPGLVYDA  +DYV FLC +GY    I++F R+  
Sbjct  597   KDLATGVESTPFVRGAGHVDPNNALDPGLVYDADADDYVGFLCALGYSPSLISVFTRDGS  656

Query  1958  LVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRV  2137
             + DC ++     G LNYP+F+ +F ++  TV Y R V+NV    N  Y+    +P+ V V
Sbjct  657   VADC-SKKPARSGDLNYPTFAAVFGSDNDTVTYHRVVRNVGSNANAVYEARFVSPAGVDV  715

Query  2138  TVSPNRLVFTDRIDTLSYEVTFQ-------SLRQSADSFGSLRWSDGT-HLVTSPIAVSW  2293
             TV+P++L F +   +L Y++T          +  +  SFGSL WSDG  H VTS IAV+W
Sbjct  716   TVTPSKLAFDEEHQSLGYKITLAVSTKKNPVIVNAKYSFGSLTWSDGAGHNVTSAIAVTW  775



>ref|XP_003523991.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN04450.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/752 (47%), Positives = 477/752 (63%), Gaps = 47/752 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++I+ M K   P+ F+ H  W+ S + ++S       S+E+LYTY+ VAHGFS RLT  +
Sbjct  38    TYIIHMDKFNMPESFNDHLLWFDSSLKSVS------DSAEMLYTYKKVAHGFSTRLTTQE  91

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L+  PGV+SV+P+   +L TTR+P+FLGL +  S L  +S   +D+I+GVLD+G+WP
Sbjct  92    AELLSKQPGVLSVIPEVRYDLHTTRTPEFLGL-AKYSTLSLASGKQSDVIVGVLDTGVWP  150

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D GL P+P+SW+ +CE G NF  ++CN+K++GAR + RGYEA  G PI    E 
Sbjct  151   ELKSFDDTGLGPVPSSWKGECERGKNFNPSNCNKKLVGARFFSRGYEAAFG-PIDEKTES  209

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHG+H ++ AAGSAV  A++ G A G ARG+AT AR+A YKVCWLG C  +DI
Sbjct  210   KSPRDDDGHGSHTSTTAAGSAVVGASLFGFANGTARGMATQARLATYKVCWLGGCFTSDI  269

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
              +G+D+A+ DGV++LS+S+      G  + Y +D IAIG F A   G++VS +AGN GP 
Sbjct  270   AAGIDKAIEDGVNILSMSIG-----GGLMDYYKDTIAIGTFAATAHGILVSNSAGNGGPS  324

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
               T  N+APW+ TVGA TIDR+FPA +TLGN + +TG SLY+G  P    +P+VY  +  
Sbjct  325   QATLSNVAPWLTTVGAGTIDRDFPAYITLGNGKMYTGVSLYNGKLPPNSPLPIVYAANVS  384

Query  1190  --NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
               +   C  G L A KV G+IV C++G +   V+KG+ V  AGG+GMI+ N  + G +L 
Sbjct  385   DESQNLCTRGTLIAEKVAGKIVICDRGGNAR-VEKGLVVKSAGGIGMILSNNEDYGEELV  443

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              ++  +P A +       +++YV ++  PTA++ F GT +G  PS P VAAFS RGPN L
Sbjct  444   ADSYLLPAAALGQKSSNELKKYVFSSPNPTAKLGFGGTQLGVQPS-PVVAAFSSRGPNVL  502

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             TP+ILKPD+IAPGVNILA WTG++            EFN+ISGTSM+CPHV+GLAA+LK 
Sbjct  503   TPKILKPDLIAPGVNILAGWTGAVGPTGLTEDTRHVEFNIISGTSMSCPHVTGLAALLKG  562

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
              +P WSPAAI+SALMTTAY    +G+ T+ D+ T  P TP  YG+GHVDP  A DPGLVY
Sbjct  563   THPEWSPAAIRSALMTTAYRTYKNGQ-TIKDVATGLPATPFDYGAGHVDPVAAFDPGLVY  621

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL---  2041
             D  V+DY+ F C + Y S +I L  R      C  RN      LNYPSF+V F       
Sbjct  622   DTSVDDYLSFFCALNYSSYQIKLVARRD--FTCSKRNNYRVEDLNYPSFAVPFNTAYGVK  679

Query  2042  ------QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                    TV Y RT+ NV       Y+V+V    +V++ V P  L F    +  +Y VTF
Sbjct  680   GGSRKPATVQYTRTLTNVGA--PATYKVSVSQSPSVKIMVQPQTLSFGGLNEKKNYTVTF  737

Query  2204  QSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
              S  +    +SF  L WSDG H VTSPIA SW
Sbjct  738   TSSSKPSGTNSFAYLEWSDGKHKVTSPIAFSW  769



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/708 (50%), Positives = 458/708 (65%), Gaps = 28/708 (4%)
 Frame = +2

Query  236   ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  415
              L+YTY   A G +ARLT +QA+ +A  PGV++V  D   +L TT +P+FL L S +  L
Sbjct  74    RLVYTYARAATGVAARLTEAQAAHVAAQPGVLAVHRDEARQLHTTHTPEFLRLSSAAGLL  133

Query  416   GPSSDYGADIIIGVLDSGIWP-ERSSF--SDRGLNPIPNSWRNKCEVGPNFPATS-CNRK  583
               +S   +D+++GVLD+GI+P  R SF  +  GL P P+S+   C     F A++ CN K
Sbjct  134   PAASGAVSDVVVGVLDTGIYPLNRGSFKPAGDGLGPPPSSFSGGCVSAAAFNASAYCNSK  193

Query  584   IIGARAYYRGYEAEIGKPIVG--EPKSARDVNGHGThvasiaagsavananvnghaRGEA  757
             ++GA+ +Y+GYEA +G PI    E KS  D  GHGTH AS AAGS V  A    +ARG A
Sbjct  194   LVGAKFFYKGYEAGLGHPINENLESKSPLDTEGHGTHTASTAAGSPVDGAGFYNYARGRA  253

Query  758   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDL  937
              G+A  ARIA YK+CW   C ++DIL+  D+AV DGV+V+SLS+ S    G+A  + ED 
Sbjct  254   VGMAPTARIAAYKICWKSGCYDSDILAAFDEAVGDGVNVISLSVGSS---GYASAFYEDS  310

Query  938   IAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSF  1117
             IAIGAFGAV+KG++VS +AGN GP  YTA N+APWILTV AS+IDREFPA   LG+   +
Sbjct  311   IAIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVAASSIDREFPADAILGDGSVY  370

Query  1118  TGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVA  1297
              G SLY+G   +  ++PVVY     S  C  G+LD  KV G+IV CE+G +  +  KG A
Sbjct  371   GGVSLYAGDPLNSTKLPVVYAADCGSRLCGRGELDKDKVAGKIVLCERGGNARVA-KGAA  429

Query  1298  VSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGT  1477
             V +AGG+GMI+ N    G +L  ++  IP  +V    G+ IRQYV T   PTA I F GT
Sbjct  430   VQEAGGIGMILANTEESGEELIADSHLIPATMVGQKFGDKIRQYVTTDPSPTATIVFHGT  489

Query  1478  VIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EF  1624
             VIG SPSAPRVAAFS RGPN+   EILKPDV APGVNILAAWTG  +            F
Sbjct  490   VIGKSPSAPRVAAFSSRGPNYRAAEILKPDVTAPGVNILAAWTGEASPTDLEIDPRRVPF  549

Query  1625  NMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPT  1804
             N+ISGTSM+CPHVSGLAA+L++ +P WSPAA+KSALMTTAY +DNSG   + DL T   +
Sbjct  550   NIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYNLDNSGE-IIKDLATGSQS  608

Query  1805  TPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNL  1984
             TP   G+GHVDP  A++PGLVYDA   DY+ FLC +GY   +IA+F R+  + DC ++  
Sbjct  609   TPFVRGAGHVDPNSALNPGLVYDADTADYIGFLCALGYTPSQIAVFTRDGSVADC-SKKP  667

Query  1985  GNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVF  2164
                G LNYP+F+ +F +   +V Y R V NV       Y+  V++P+ V   V+P +LVF
Sbjct  668   ARSGDLNYPAFAAVFSSYKDSVTYHRVVSNVGGDPKAVYEAKVESPAGVDAKVTPAKLVF  727

Query  2165  TDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              +   +L+YE+T        +     SFGS+ WSDG H VTSPIAV+W
Sbjct  728   DEEHRSLAYEITLAVAGNPVIVDGKYSFGSVTWSDGVHNVTSPIAVTW  775



>ref|XP_006841997.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
 gb|ERN03672.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
Length=753

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/753 (48%), Positives = 483/753 (64%), Gaps = 49/753 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFS-THHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             K+F+V M KS  P+ ++  H  WY SI      + +  +S+E+LYTY+ V HGF+ARLT 
Sbjct  22    KTFLVHMAKSMMPESYNGDHQAWYMSI------MKSAVQSTEILYTYDTVLHGFAARLTD  75

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              +A  L   P  +SV  + + +L TTR+P+FLGL  G++ L P SDY  D+I+GVLD+G 
Sbjct  76    EEAELLRQRPEALSVYEEAVYQLHTTRTPEFLGL-DGNNGLWPESDYATDVIVGVLDTGA  134

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
              PE  S+ D GL P+P+ WR +C+ G NF A+SCNRK+IGA+ + +GYEA +G PI    
Sbjct  135   SPESKSYVDAGLGPVPSKWRGECQTGKNFDASSCNRKLIGAQFFSKGYEAVMG-PIDETK  193

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS +D +GHGTH ++ AAG+ V +A++ G+A G ARG+AT ARIA YKVCW G C ++
Sbjct  194   ESKSPKDDDGHGTHTSTTAAGAYVEHASLFGYAEGTARGMATRARIAAYKVCWAGGCFSS  253

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DI++ MD+AVADGVH+LSLSL      G ++ YD D IA+GAFGA++ GV VSC+AGN G
Sbjct  254   DIIAAMDRAVADGVHILSLSLG-----GGSIDYDRDSIAVGAFGAMEHGVFVSCSAGNSG  308

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
              D Y+  N+APWI T+GA T+DR+FPA V LGN ++F+G SLYSG   S+  +P +Y  +
Sbjct  309   SDTYSVSNVAPWIATIGAGTLDRDFPAYVALGNGQNFSGVSLYSGKPLSQSPLPFIYAAN  368

Query  1187  A----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             A    N   C  G L   KV G+IV C++G  T+ V KG  V +AGGVGM++ N  + G 
Sbjct  369   ASNTTNGNLCLDGTLVEEKVAGKIVLCDRG-VTARVAKGAVVRKAGGVGMVLANTASNGE  427

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  +P   V    GE I+ Y+ +   PTA I F GT +   PS P VAAFS RGP
Sbjct  428   ELVADAHLLPATGVGEKSGEEIKSYLLSDKNPTANIVFLGTKVNIRPS-PVVAAFSSRGP  486

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAM  1681
             N LT  ILKPD+IAPGVNILA W+ ++            E+N+ISGTSM+CPH+SGLAA+
Sbjct  487   NPLTSAILKPDMIAPGVNILAGWSDTIGPTGLPSDTRRVEYNIISGTSMSCPHISGLAAL  546

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             LK  +P WSPA IKSALMTTAY VDN+G   L D+ T +P T   +G+GHVDP  A+DP 
Sbjct  547   LKAAHPEWSPATIKSALMTTAYKVDNTGE-MLRDVATGRPATYFDFGAGHVDPQKALDPR  605

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL  2041
             LVYD    DY+DFLC + Y S +I+   + +    C + N  + G+LNYPSF+V F+   
Sbjct  606   LVYDTTPTDYLDFLCALNYSSTRISAIAKRT--YACGSGN--SVGNLNYPSFAVPFETAT  661

Query  2042  QT-------VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
              T       + Y RTV NV +     Y+ +V     V++TV P  L F ++    S+ VT
Sbjct  662   STESSTPKVLTYSRTVTNVGQ--PATYRASVIGGDPVKITVEPESLTFGEKGQKKSFTVT  719

Query  2201  FQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F   SL   +  F +L  SDGT  V SPIA++W
Sbjct  720   FTAGSLPSGSMKFATLELSDGTRTVASPIAMTW  752



>ref|XP_007226995.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
 gb|EMJ28194.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
Length=769

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/756 (47%), Positives = 471/756 (62%), Gaps = 48/756 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             K++I+ M KS+ P  F   H  WY S + ++S       S+++LYTY  + HGFS RLT 
Sbjct  33    KTYIIHMDKSQMPASFEDDHFQWYDSSLKSVS------NSADMLYTYRTIIHGFSTRLTA  86

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              +A  L   PG++SVLP+R  EL TTR+P+FLGL    + L P+SD  + +I+GV+D+G+
Sbjct  87    EEAELLEKQPGILSVLPERKYELHTTRTPEFLGLGKSEAFL-PASDKVSQVIVGVVDTGV  145

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPE  S+ D GL  +P+SW+  CEVG NF ++SCNRK+IGAR + +GYEA +G PI    
Sbjct  146   WPELKSYDDTGLAAVPSSWKGSCEVGTNFSSSSCNRKLIGARYFSKGYEAALG-PIDEKT  204

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD +GHGTH +S A GSAV  A++  +A G ARG+A  AR+A YK CWLG C  +
Sbjct  205   ESKSPRDDDGHGTHTSSTATGSAVPGASLFSYASGTARGMAPQARVATYKACWLGGCFGS  264

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DI + M++AV DGV+VLSLS+      G    Y  D +AIGAF A  +G++VSC+AGN G
Sbjct  265   DITAAMEKAVEDGVNVLSLSIG-----GSQSDYYRDTVAIGAFSAAAQGILVSCSAGNGG  319

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             PD  +  N+APWI TVGA T+DR+FPA V+LGN + + G SLY G   S   +P+VY  +
Sbjct  320   PDSGSLSNVAPWITTVGAGTLDRDFPAFVSLGNEKKYRGISLYRGTPLSSGLLPLVYARN  379

Query  1187  ANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             A++      C P  L  +KV G+IV C++G  T  V K + V +AGG+GMI+ N    G 
Sbjct  380   ASTSSTGELCSPESLIPAKVAGKIVVCDRG-GTPRVRKSLVVKKAGGLGMILANTDTYGE  438

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  +PTA V    G+ I+ Y+ + S PTA I    T +   PS P VA+FS RGP
Sbjct  439   ELVADAYLLPTAAVGQKAGDAIKSYIASGSNPTATIALGDTELDVQPS-PVVASFSSRGP  497

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAM  1681
             N +TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+
Sbjct  498   NLITPEILKPDLIAPGVNILAGWTGAVGPTGLAEDKRRVTFNIISGTSMSCPHVSGLAAL  557

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             +   +P WSPAAIKSALMTT+YT   +G  T+ D+ T  P TP  YG+GHVDP  A+DPG
Sbjct  558   VMAAHPEWSPAAIKSALMTTSYTTYKTGE-TIKDIATGNPATPFDYGAGHVDPVAALDPG  616

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN--  2035
             LVYDA V DY+ FLC + Y + +I L         C +    +   LNYPSF+V  +   
Sbjct  617   LVYDAAVEDYLSFLCALNYTTTQIKLTTHKD--FTCDSSKKYSLRDLNYPSFAVPLETAS  674

Query  2036  -------NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                       TV Y RT+ NV         V+ QTPS V++TV P  L F+   +  +Y 
Sbjct  675   GKGGGSGASTTVKYTRTLTNVGTPATYKVSVSSQTPS-VKITVEPESLSFSQAYEKKTYT  733

Query  2195  VTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSWE  2296
             VTF   S      SFG L WSDG H V SPIA SWE
Sbjct  734   VTFVASSSPSGTTSFGRLEWSDGKHTVGSPIAFSWE  769



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/752 (47%), Positives = 481/752 (64%), Gaps = 43/752 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+  ++IV M K E P  F  H  WY S + ++S       S+++LYTYE+  HGFS RL
Sbjct  34    EKKATYIVHMSKPEMPASFEHHTHWYESSLKSVS------DSAQMLYTYENAIHGFSTRL  87

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T ++A  L + PG++SV+ +   EL TTR+P+FLGL   S++L P SD  +++IIGVLD+
Sbjct  88    TLAEAKLLESQPGILSVMLELRYELHTTRTPEFLGL-DKSADLLPQSDSVSEVIIGVLDT  146

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D G  P+P+SW+ +CE G NF   +CNRK+IGAR + RGYEA +G P+  
Sbjct  147   GVWPESKSFLDTGFGPVPSSWKGECESGTNFTTKNCNRKLIGARFFARGYEATLG-PVDE  205

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH +S A GS+VA+A++ G+A G ARG+A  AR+AVYKVCW+G C 
Sbjct  206   SKESKSPRDDDGHGTHTSSTAGGSSVADASLFGYAAGTARGMAARARVAVYKVCWVGGCF  265

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+A+ DGV+VLS+SL      G    Y  D +AIGAF A++KG+ VSC+AGN
Sbjct  266   SSDILAAMDKAIDDGVNVLSMSLG-----GSMSYYYRDSVAIGAFAAMEKGIFVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GP  Y+  N+APWI TVGA T+DR+FPA V+LGN ++++G SLY G  + P ++ +P V
Sbjct  321   AGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGKNYSGVSLYKGDAILPGKL-LPFV  379

Query  1175  YGGSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             Y G+A    N   C  G L   +V G+IV C++G +   V KG  V  AGG+GM++ N  
Sbjct  380   YAGNASNATNGNLCMMGTLIPEQVAGKIVLCDRGVNPR-VQKGAVVKAAGGIGMVLSNTD  438

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G +L  +A  +P   V    G+ I+ Y+ +   PTA I F+GT +G  PS P VAAFS
Sbjct  439   ANGEELVADAHLLPATAVGKKGGDEIKNYLFSDPKPTATILFEGTKVGIQPS-PVVAAFS  497

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN +TP+ILKPD+IAPGVNILA W GS             EFN+ISGTSM+CPHVSG
Sbjct  498   SRGPNSITPDILKPDMIAPGVNILAGWVGSAGPTGLATDGRRVEFNIISGTSMSCPHVSG  557

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             LAA++K  +P WSPAAIKSALMTTAY    +G   L D+ T + +TP  +G+GHVDP  A
Sbjct  558   LAALIKAAHPDWSPAAIKSALMTTAYVTYKNGN-KLQDVATGKDSTPFDHGAGHVDPVSA  616

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             ++PGLVYD   +DY++FLC + Y + +I    R     D   +   +   LNYPSF+V F
Sbjct  617   LNPGLVYDLTADDYLNFLCALNYSATEITSLARRKFTCDASKKY--SVTDLNYPSFAVNF  674

Query  2030  KNNLQTVIYK--RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
              +     + K  RT+ NV         +T+Q+P  V+V V P  L F    +  SY VTF
Sbjct  675   GSGGADAVIKHSRTLTNVGAPGTYKVLITLQSP-GVKVAVEPETLSFRQANEKKSYTVTF  733

Query  2204  QSLRQSAD--SFGSLRWSDGTHLVTSPIAVSW  2293
                   AD  SFG + WS+G  +V SPIAVSW
Sbjct  734   TGSSMPADTNSFGRIEWSNGKQIVGSPIAVSW  765



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/757 (47%), Positives = 487/757 (64%), Gaps = 53/757 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P  F  H  WY S + T+S       S+E++Y Y +  HGFS +LTP+Q
Sbjct  41    TYIVHMAKSEMPASFEHHTHWYDSSLKTVS------DSAEMMYIYSNAIHGFSTKLTPAQ  94

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L + PGV+SVLP+   EL TTR+P+FLGL   +  + P S+  +D+IIGVLD+G+WP
Sbjct  95    AESLQSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETI-PQSNSESDVIIGVLDTGVWP  153

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D GL P+P SW+  CE G NF +++CNRK+IGAR + +GYEA  G PI    E 
Sbjct  154   ESKSFDDTGLGPVPGSWKGACESGTNFNSSNCNRKLIGARYFAKGYEATRG-PIETSKES  212

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH AS AAGS V+ A++ G+A G ARG+A  ARIA YKVCW+G C ++DI
Sbjct  213   KSPRDDDGHGTHTASTAAGSVVSGASLFGYALGTARGMAPRARIAAYKVCWVGGCFSSDI  272

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             ++ +DQA+AD V+VLS+SL      G    Y  D +AIGAF A++KG+++SC+AGN GP 
Sbjct  273   VAAIDQAIADNVNVLSMSLG-----GGMSDYFRDSVAIGAFSAMEKGILISCSAGNAGPS  327

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG---VQPSRIQVPVVYGG  1183
              Y+  N APWI TVGA T+DR+FPA V+LGN ++F+G SLY G     P+ +  P VY  
Sbjct  328   AYSLSNSAPWITTVGAGTLDRDFPAFVSLGNGKNFSGVSLYRGNSNAAPTAL-TPFVYAA  386

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C  G L   +V+G+IV C++G +   V KG  V  AGGVGM++ N    G
Sbjct  387   NASNATSGNLCMMGTLIPEQVKGKIVMCDRGVNAR-VQKGAVVKAAGGVGMVLANTAANG  445

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V + + ++I+ Y+     PTA I F+GT +G  PS P VAAFS RG
Sbjct  446   EELVADAHLLPATSVGLQNADVIKSYLFKDPNPTATILFEGTKVGVQPS-PVVAAFSSRG  504

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP++LKPD++APGVNILA W+G++             FN+ISGTSM+CPHVSGLAA
Sbjct  505   PNSVTPDVLKPDIVAPGVNILAGWSGAIGPTGLAIDARRVAFNIISGTSMSCPHVSGLAA  564

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTTAYT   +G+  L D+ T +P+TP  +G+GHVDP  A++P
Sbjct  565   LLKGAHPEWSPAAIRSALMTTAYTAYKNGQ-KLQDVATGKPSTPFDHGAGHVDPISALNP  623

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD  V+DY++FLC + Y + +I    + S    C  +   +   LNYPSF+V F++ 
Sbjct  624   GLVYDLTVDDYLNFLCALNYSATEINSLAKRS--YTCDEKKKYSVRDLNYPSFAVNFESR  681

Query  2039  L-------QTVIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYE  2194
                       V Y RT+ NV    +  Y+ +V + S  V+++V P  L F+   +   Y 
Sbjct  682   YGGGTTSSNVVRYTRTLTNVGP--SGTYKASVTSESQLVKISVEPETLSFSQANEKKGYT  739

Query  2195  VTFQSL----RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VT  ++      + +SFG + WSDG H+V SPIA+SW
Sbjct  740   VTLSAVGSVPANAENSFGRVEWSDGKHIVGSPIAISW  776



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/757 (47%), Positives = 478/757 (63%), Gaps = 50/757 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++  ++I+ M KSE P  F  H  WY S + ++S       S+E+LYTY++V HGFS +L
Sbjct  27    DQRATYIIHMAKSEMPASFEHHTHWYESSLKSVS------DSAEILYTYDNVIHGFSTQL  80

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG++SVLP+   EL TTRSP+FLGL   S+NL P+S   +++I+GVLD+
Sbjct  81    TREEAESLEQRPGILSVLPELKYELHTTRSPEFLGL-DKSANLFPTSGSASEVIVGVLDT  139

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL P+P+SW+  CE G NF A++CNRK+IGAR + RGYEA +G PI  
Sbjct  140   GVWPESKSFDDTGLGPVPSSWKGACETGTNFNASNCNRKLIGARYFARGYEATLG-PIDE  198

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH AS AAGS V  A++ G+A G ARG+AT AR+A YKVCW+G C 
Sbjct  199   SKESKSPRDDDGHGTHTASTAAGSVVEGASLFGYAAGTARGMATRARVAAYKVCWVGGCF  258

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ ++QA+ D V+V      S S  G    Y +D IAIGAF A++KG++VSC+AGN
Sbjct  259   SSDILAAIEQAIDDNVNV-----LSMSLGGGTSDYYKDSIAIGAFAAMEKGILVSCSAGN  313

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP  Y+  N+APWI TVGA T+DR+FPA V+LGN ++++G SLY G       +P VY 
Sbjct  314   AGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGQNYSGVSLYKGDGLPGKLLPFVYA  373

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C    L   KV G+IV C++G +   V KG  V  AGG+GM++ N    
Sbjct  374   GNASNATNGNLCMMDTLIPEKVAGKIVMCDRGVNAR-VQKGAVVKAAGGLGMVLANTEGN  432

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +   PT  I F+GT +G  PS P VAAFS R
Sbjct  433   GEELVADAHLLPATAVGQKFGDAIKSYLVSDPKPTVTILFEGTKVGVEPS-PVVAAFSSR  491

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPE+LKPD+IAPGVNILA W+G++             FN+ISGTSM+CPHVSGLA
Sbjct  492   GPNSITPELLKPDMIAPGVNILAGWSGAVGPTGLATDSRRVSFNIISGTSMSCPHVSGLA  551

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY    +G+  L D+ T + +TP  +G+GHV+P  A++
Sbjct  552   ALLKAAHPEWSPAAIRSALMTTAYVSYKNGQ-KLQDIATGKASTPFDHGAGHVNPVSALN  610

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD  V+DY+ FLC + Y + +I    R     D   R   +    NYPSF+V    
Sbjct  611   PGLVYDLTVDDYLGFLCALNYTASQINSLARRKFTCDASKRY--SLADFNYPSFAV----  664

Query  2036  NLQT---------VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
             N++T         + Y R++ NV         +T  T   V+++V P  L FT   +  S
Sbjct  665   NIETAQSSSGSSVLKYTRSLTNVGPPGTYKVFITSSTGPGVKISVEPATLSFTQANEKKS  724

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF   S+  + +SF  L WSDG ++V SPIA+SW
Sbjct  725   YTVTFTVSSMPSNTNSFAHLEWSDGKYIVGSPIAISW  761



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/708 (50%), Positives = 458/708 (65%), Gaps = 28/708 (4%)
 Frame = +2

Query  236   ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  415
              L+YTY   A G +ARLT +QA+ +A  PGV++V  D   +L TT +P+FL L S +  L
Sbjct  74    RLVYTYARAATGVAARLTEAQAAHVAAQPGVLAVHRDEARQLHTTHTPEFLRLSSAAGLL  133

Query  416   GPSSDYGADIIIGVLDSGIWP-ERSSF--SDRGLNPIPNSWRNKCEVGPNFPATS-CNRK  583
               +S   +D+++GVLD+GI+P  R SF  +  GL P P+S+   C     F A++ CN K
Sbjct  134   PAASGAVSDVVVGVLDTGIYPLNRGSFKPAGDGLGPPPSSFSGGCVSAAAFNASAYCNSK  193

Query  584   IIGARAYYRGYEAEIGKPIVG--EPKSARDVNGHGThvasiaagsavananvnghaRGEA  757
             ++GA+ +Y+GYEA +G PI    E KS  D  GHGTH AS AAGS V  A    +ARG A
Sbjct  194   LVGAKFFYKGYEAGLGHPINENLESKSPLDTEGHGTHTASTAAGSPVDGAGFYNYARGRA  253

Query  758   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDL  937
              G+A  ARIA YK+CW   C ++DIL+  D+AV DGV+V+SLS+ S    G+A  + ED 
Sbjct  254   VGMAPTARIAAYKICWKSGCYDSDILAAFDEAVGDGVNVISLSVGSS---GYASAFYEDS  310

Query  938   IAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSF  1117
             IAIGAFGAV+KG++VS +AGN GP  YTA N+APWILTV AS+IDREFPA   LG+   +
Sbjct  311   IAIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVAASSIDREFPADAILGDGSVY  370

Query  1118  TGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVA  1297
              G SLY+G   +  ++PVVY     S  C  G+LD  KV G+IV CE+G +  +  KG A
Sbjct  371   GGVSLYAGDPLNSTKLPVVYAADCGSRLCGRGELDKDKVAGKIVLCERGGNARVA-KGAA  429

Query  1298  VSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGT  1477
             V +AGG+GMI+ N    G +L  ++  IP  +V    G+ IRQYV T   PTA I F GT
Sbjct  430   VQEAGGIGMILANTEESGEELIADSHLIPATMVGQKFGDKIRQYVTTDPSPTATIVFHGT  489

Query  1478  VIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EF  1624
             VIG SPSAPRVAAFS RGPN+   EILKPDV APGVNILAAWTG  +            F
Sbjct  490   VIGKSPSAPRVAAFSSRGPNYRAAEILKPDVTAPGVNILAAWTGEASPTDLEIDPRRVPF  549

Query  1625  NMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPT  1804
             N+ISGTSM+CPHVSGLAA+L++ +P WSPAA+KSALMTTAY +DNSG   + DL T   +
Sbjct  550   NIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYNLDNSGE-IIKDLATGSQS  608

Query  1805  TPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNL  1984
             TP   G+GHVDP  A++PGLVYDA   DY+ FLC +GY   +IA+F R+  + DC ++  
Sbjct  609   TPFVRGAGHVDPNSALNPGLVYDADTADYIGFLCALGYTPSQIAVFTRDGSVADC-SKKP  667

Query  1985  GNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVF  2164
                G LNYP+F+ +F +   +V Y R V NV       Y+  V++P+ V   V+P +LVF
Sbjct  668   ARSGDLNYPAFAAVFSSYKDSVTYHRVVSNVGGDPKAVYEAKVESPAGVDAKVTPAKLVF  727

Query  2165  TDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              +   +L+YE+T        +     SFGS+ WSDG H VTSPIAV+W
Sbjct  728   DEEHRSLAYEITLAVAGNPVIVDGKYSFGSVTWSDGVHNVTSPIAVTW  775



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/753 (47%), Positives = 476/753 (63%), Gaps = 42/753 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++  ++I+ M KSE P  F  H  WY S + ++S       S+E+LYTY++V HGFS +L
Sbjct  28    DQRATYIIHMAKSEMPASFEHHTHWYESSLKSVS------DSAEILYTYDNVIHGFSTQL  81

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG++SVLP+   EL TTRSP+FLGL   S+NL P+S   +++I+GVLD+
Sbjct  82    TREEAESLEQRPGILSVLPELKYELHTTRSPEFLGL-DKSANLFPTSGSASEVIVGVLDT  140

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL P+P+SW+  CE G NF A++CNRK+IGAR + RGYEA +G PI  
Sbjct  141   GVWPESKSFDDTGLGPVPSSWKGACETGTNFNASNCNRKLIGARYFARGYEATLG-PIDE  199

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH AS AAGS V  A++ G+A G ARG+AT AR+A YKVCW+G C 
Sbjct  200   SKESKSPRDDDGHGTHTASTAAGSVVEGASLFGYAAGTARGMATRARVAAYKVCWVGGCF  259

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ ++QA+ D V+V      S S  G    Y +D +AIGAF A++KG++VSC+AGN
Sbjct  260   SSDILAAIEQAIDDNVNV-----LSMSLGGGTSDYYKDSVAIGAFAAMEKGILVSCSAGN  314

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP  Y+  N+APWI TVGA T+DR+FPA V+LGN ++++G SLY G       +P VY 
Sbjct  315   AGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGQNYSGVSLYKGDGLPGKLLPFVYA  374

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C    L   KV G+IV C++G +   V KG  V  AGG+GM++ N  + 
Sbjct  375   GNASNATNGNLCMMDTLIPEKVAGKIVMCDRGVNAR-VQKGAVVKAAGGLGMVLANTESN  433

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +   PT  I F+GT +G  PS P VAAFS R
Sbjct  434   GEELVADAHLLPATAVGQKFGDAIKSYLVSDPKPTVTILFEGTKVGVEPS-PVVAAFSSR  492

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPE+LKPD+IAPGVNILA W+G++             FN+ISGTSM+CPHVSGLA
Sbjct  493   GPNSITPELLKPDMIAPGVNILAGWSGAVGPTGLATDSRRVGFNIISGTSMSCPHVSGLA  552

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY    +G+  L D+ T + +TP  +G+GHV+P  A++
Sbjct  553   ALLKAAHPEWSPAAIRSALMTTAYVSYKNGQ-KLQDIATGKASTPFDHGAGHVNPVSALN  611

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF--  2029
             PGLVYD  V+DY+ FLC + Y + +I    R     D   R   +    NYPSF+V    
Sbjct  612   PGLVYDLTVDDYLGFLCALNYTASQINSLARRKFTCDASKRY--SLADFNYPSFAVNIDA  669

Query  2030  ---KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
                 +    + Y RT+ NV         +T  T   V+++V P  L FT   +  SY VT
Sbjct  670   AQSSSGSSVLKYSRTLTNVGPPGTYKVSITSSTGPGVKISVEPATLSFTQANEKKSYTVT  729

Query  2201  F--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F   S+  + +SF  L WSDG ++V SPIA+SW
Sbjct  730   FTVSSMPSNTNSFARLEWSDGKYIVGSPIAISW  762



>ref|XP_006374838.1| hypothetical protein POPTR_0014s01910g [Populus trichocarpa]
 gb|ERP52635.1| hypothetical protein POPTR_0014s01910g [Populus trichocarpa]
Length=779

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/757 (47%), Positives = 480/757 (63%), Gaps = 47/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +  K+FIV M  S+    +  H  WY S + ++S       S+++LY Y ++ HGFS RL
Sbjct  41    QTKKTFIVHMDMSKMAATYEDHFQWYDSSLKSVS------ESADMLYAYNNIIHGFSTRL  94

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +A  L   PG+++VLP+ + +L TT SP+FLGL   S  + P+S   +++I+GVLD+
Sbjct  95    TPEEAELLEKQPGILAVLPEMIYKLHTTHSPEFLGL-GKSDAVPPASASMSEVIVGVLDT  153

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL PIP++W+  C VG NF ++SCNRK+IGA+ + +GYEA  G PI  
Sbjct  154   GVWPEIKSFDDTGLGPIPSTWKGTCAVGKNFNSSSCNRKLIGAQYFSKGYEAAFG-PIDE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+ AAGSAV+ A++ G+A G ARG+AT AR+A YKVCWLG C 
Sbjct  213   TMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYAFGTARGMATQARVAAYKVCWLGGCF  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ M++AVADGV+V+S+S+      G    Y+ D +AIGAF AV +G++VSC+AGN
Sbjct  273   SSDILAAMEKAVADGVNVISMSIG-----GGISDYNRDTVAIGAFRAVAQGILVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P +  N+APWI TVGA T+DR+FPA V+LGN ++++G SLYSG   S   +P+VY 
Sbjct  328   GGPSPGSLTNVAPWITTVGAGTLDRDFPAYVSLGNGKNYSGISLYSGKPLSDSLLPLVYA  387

Query  1181  G----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G    S +   C  G L  S+V G+IV C++G + S V KG+ V  +GG+GMI+ N    
Sbjct  388   GNVSNSTSGNLCMTGTLVPSQVAGKIVICDRGLN-SRVQKGMVVRDSGGLGMILANTELY  446

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +PT+ V     + I+ Y  +   P A I   GT +G  PS P +AAFS R
Sbjct  447   GEELVADAHLLPTSTVGQRTADAIKNYAFSDPKPMATIASGGTKLGVEPS-PVLAAFSSR  505

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPE+LKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLA
Sbjct  506   GPNLVTPEVLKPDLIAPGVNILAGWTGAVGPTGLTSDKRHVSFNIISGTSMSCPHVSGLA  565

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  +  WSPAAIKSALMTTAY    +G   ++D+ T QP+TP  +G+GHV+P  A+D
Sbjct  566   ALVKAAHQDWSPAAIKSALMTTAYATYKNGE-NILDVATGQPSTPFDFGAGHVNPVAALD  624

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYDA V+DY++F C + Y +  I           C +    + G LNYPSFSV  + 
Sbjct  625   PGLVYDASVDDYINFFCALNYSASDIKQITNKD--FTCDSSKKYSLGDLNYPSFSVPLET  682

Query  2036  N---------LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                         TV Y RT+ NV         +T +TPS V++ V P  L F    +  +
Sbjct  683   ASGKGGGAGVTSTVKYTRTLTNVGVPATYKLSMTSKTPS-VKILVEPESLSFAKEYEKKT  741

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF   S+    +SF  L WSDG H+V SPIA SW
Sbjct  742   YTVTFTATSMPSGTNSFAHLEWSDGKHVVGSPIAFSW  778



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/758 (47%), Positives = 477/758 (63%), Gaps = 43/758 (6%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE--------LLYTYEHVAH  268
             P+++I+ M KSE PQ F+ H  WY+S I +++  S     +E        ++Y+YE   H
Sbjct  35    PRTYIIHMAKSEMPQSFTHHLQWYASTIKSVTTSSKPEAVAEDEEDPAERIIYSYETAFH  94

Query  269   GFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADII  448
             GF+A+LT  +A  L ++PGV +VLP+ + +L TTRSP+FLG+    + +  ++    D+I
Sbjct  95    GFAAKLTEDEAEMLQSIPGVAAVLPETVYQLHTTRSPRFLGITGKRNRIWSAALSDHDVI  154

Query  449   IGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI  628
             +G+LD+GIWPE  SFSDRG+ P+P  W+  CE+G  F A +CN+KI+GAR +YRGYE   
Sbjct  155   VGILDTGIWPESPSFSDRGMTPVPPRWKGGCEIGRGFTAKNCNQKIVGARIFYRGYEEAS  214

Query  629   GK-PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCW  805
             G      E KS RD +GHGTH A+  AG+ V  AN+ G+ARG ARG+A  AR+AVYKVCW
Sbjct  215   GAIDEKSEFKSPRDQDGHGTHTAATVAGAPVRGANLLGYARGTARGMAPRARVAVYKVCW  274

Query  806   LGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVS  985
              G C ++DIL+ +D+AVADGV V      S S  G    Y  D +++ AFGA++KGV V+
Sbjct  275   TGGCFSSDILAAVDRAVADGVDV-----LSISLGGGVSSYYRDSLSVAAFGAMEKGVFVA  329

Query  986   CAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG---VQPSR  1156
             C+AGN GPDP +  N++PWI TVGAST+DR+FPA V LGN  + TG SLY G   + P R
Sbjct  330   CSAGNGGPDPISLTNVSPWIATVGASTMDRDFPATVRLGNGMNLTGVSLYKGRRNLSPRR  389

Query  1157  IQVPVVYGGSANSF-----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVG  1321
              Q P+VY G   S       C  G LD   V G+IV C++G +   V KG  V  A GVG
Sbjct  390   -QYPLVYMGGNTSIPDQKSLCLEGTLDPHVVAGKIVICDRGINPR-VQKGQVVKGARGVG  447

Query  1322  MIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFP-TARIEFKGTVIGNSPS  1498
             MI+ N    G +L  ++  +P   V  A G +I+QY +  S P TA + F+GT +G  PS
Sbjct  448   MILANTAANGEELVADSHLLPAVAVGEAAGNVIKQYSKIGSHPTTATMAFEGTKVGIRPS  507

Query  1499  APRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTS  1645
              P VAAFS RGPN LT EILKPD++APGVNILAAW+G  +           +FN++SGTS
Sbjct  508   -PVVAAFSSRGPNILTLEILKPDIVAPGVNILAAWSGDASPSSLLADHRRVKFNILSGTS  566

Query  1646  MACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGS  1825
             M+CPHV G+AA+LK  +P WSPAAIKSALMTTAYT DN+ R  L D  T  P+ P+ +G+
Sbjct  567   MSCPHVGGVAALLKASHPDWSPAAIKSALMTTAYTHDNTFR-PLKDAATGAPSNPYDHGA  625

Query  1826  GHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLN  2005
             GH+ P  AVDPGL+YD   +DY +FLCT      ++ +F ++S    C+ R L +PG LN
Sbjct  626   GHIRPAKAVDPGLIYDISPDDYFEFLCTQKLTPSQLKVFTKSSNRT-CKQR-LASPGDLN  683

Query  2006  YPSFSVLFKNNLQTVI-YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDT  2182
             YP+ S +F+     V+   RTV NV    +  Y V V     V V V P  L FT +   
Sbjct  684   YPAISAVFREQPAPVLTLHRTVTNVGPPVST-YHVKVTPFRGVDVAVEPKTLHFTHQNQK  742

Query  2183  LSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSW  2293
             LSY+VTF++   Q     G+L WSDG HLV SP+ ++W
Sbjct  743   LSYKVTFRTKSPQPIPDLGALIWSDGIHLVRSPVVITW  780



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/757 (46%), Positives = 479/757 (63%), Gaps = 50/757 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++  ++I+ M KSE P  F  H  WY S + ++S       S+E+LYTY++V HGFS +L
Sbjct  27    DQRATYIIHMAKSEMPASFEHHTHWYESSLKSVS------DSAEILYTYDNVIHGFSTQL  80

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG++SVLP+   EL TTRSP+FLGL   S+NL P+S   +++I+GVLD+
Sbjct  81    TREEAESLEQRPGILSVLPELKYELHTTRSPEFLGL-DKSANLFPTSGSASEVIVGVLDT  139

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL P+P+SW+  CE G NF A++CNRK+IGAR + RGYEA +G PI  
Sbjct  140   GVWPESKSFDDTGLGPVPSSWKGACETGTNFNASNCNRKLIGARYFARGYEATLG-PIDE  198

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH AS AAGS V  A++ G+A G ARG+AT AR+A YKVCW+G C 
Sbjct  199   SKESKSPRDDDGHGTHTASTAAGSVVEGASLFGYAAGTARGMATRARVAAYKVCWVGGCF  258

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ ++QA+ D V+V      S S  G    Y +D +AIGAF A++KG++VSC+AGN
Sbjct  259   SSDILAAIEQAIDDNVNV-----LSMSLGGGTSDYYKDSVAIGAFAAMEKGILVSCSAGN  313

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP  Y+  N+APWI TVGA T+DR+FPA V+LGN ++++G SLY G       +P VY 
Sbjct  314   AGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGQNYSGVSLYKGDGLPGKLLPFVYA  373

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C    L   KV G+IV C++G +   V KG  V  AGG+GM++ N  + 
Sbjct  374   GNASNATNGNLCMMDTLIPEKVAGKIVMCDRGVNAR-VQKGAVVKAAGGLGMVLANTESN  432

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +   PT  I F+GT +G  PS P VAAFS R
Sbjct  433   GEELVADAHLLPATAVGQKFGDAIKSYLVSDPKPTVTILFEGTKVGVEPS-PVVAAFSSR  491

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPE+LKPD+IAPGVNILA W+G++             FN+ISGTSM+CPHVSGLA
Sbjct  492   GPNSITPELLKPDMIAPGVNILAGWSGAVGPTGLATDSRRVSFNIISGTSMSCPHVSGLA  551

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY    +G+  L D+ T + +TP  +G+GHV+P  A++
Sbjct  552   ALLKAAHPEWSPAAIRSALMTTAYVSYKNGQ-KLQDIATGKASTPFDHGAGHVNPVSALN  610

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD  V+DY+ FLC + Y + +I    R     D   R   +    NYPSF+V    
Sbjct  611   PGLVYDLTVDDYLGFLCALNYTASQINSLARRKFTCDASKRY--SLADFNYPSFAV----  664

Query  2036  NLQT---------VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
             N++T         + Y R++ NV         +T  T   V+++V P  L FT   +  S
Sbjct  665   NIETAQSSSGSSVLKYTRSLTNVGPPGTYKVFITSSTGPGVKISVEPATLSFTQANEKKS  724

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF   S+  + +SF  L WSDG ++V SPIA+SW
Sbjct  725   YTVTFTVSSMPSNTNSFAHLEWSDGKYIVGSPIAISW  761



>ref|XP_011017137.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/757 (47%), Positives = 471/757 (62%), Gaps = 46/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +  K+FI+ M KS  P  +  H  WY S + ++S       S+++LYTY ++ HGFS +L
Sbjct  40    QTKKTFIIQMDKSNMPATYYDHFQWYDSSLKSVS------ESADMLYTYNNIIHGFSTQL  93

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +A  L    G++SVLP+ + +L TT +P+FLGL    + L P+S   +++I+GVLD+
Sbjct  94    TPEEAELLEKQSGILSVLPEMIYKLHTTHTPEFLGLGKSDAVLLPASASLSEVIVGVLDT  153

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL PIP++W+  CEVG NF ++SCNRK+IGA+ + +GYEA  G PI  
Sbjct  154   GVWPEIKSFDDTGLGPIPSTWKGSCEVGKNFNSSSCNRKLIGAQYFSKGYEASFG-PIDE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+ AAGSAV+ A++ G+A G ARG+AT AR+A YKVCWLG C 
Sbjct  213   TMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYASGIARGMATEARVAAYKVCWLGGCF  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ M++AVADGV+V      S S  G    Y  D +AIGAF A  +G++VSC+AGN
Sbjct  273   SSDILAAMEKAVADGVNV-----MSMSIGGGLSDYTRDTVAIGAFRAAAQGILVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P +  N+APWI TVGA T+DR+FPA V+LGN R  +G SLYSG   S   +P+VY 
Sbjct  328   GGPSPGSLSNVAPWITTVGAGTLDRDFPAYVSLGNGRKHSGISLYSGKPLSDSLMPLVYA  387

Query  1181  G----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G    S +   C  G L  ++V G+IV C++G + S V KG+ V  +GG+GMI+ N    
Sbjct  388   GNVSNSTSGSLCMIGTLIPAQVAGKIVICDRGGN-SRVQKGLVVKDSGGLGMILANTELY  446

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +PTA V +     I+ Y      P   I   GT +G  PS P VAAFS R
Sbjct  447   GEELVADAHLLPTAAVGLRTANAIKNYAFLDPKPVGTIASGGTKLGVEPS-PVVAAFSSR  505

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPE+LKPD+IAPGVNILA WTG              EFN+ISGTSM+CPHVSGLA
Sbjct  506   GPNLVTPEVLKPDLIAPGVNILAGWTGGAGPTGLTNDKRHVEFNIISGTSMSCPHVSGLA  565

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  +  WSPAAIKSALMTTAY    +G   ++D+ T QP+TP  YG+GHV+P  A+D
Sbjct  566   ALIKAAHQDWSPAAIKSALMTTAYATYKNGE-NILDVATGQPSTPFDYGAGHVNPVAALD  624

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYDA V+DY+ F C + Y +  I   + N   + C +    + G LNYPSFSV  + 
Sbjct  625   PGLVYDATVDDYISFFCALNYSASDIKQ-ITNKDFI-CNSSKEYSLGDLNYPSFSVPLQT  682

Query  2036  N---------LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                          V Y RT+ NV         +T QT S V++   P  L F    +  S
Sbjct  683   ASGKEGGAGMKSRVKYTRTLTNVGAPATYKVSMTSQTTS-VKMLAEPESLSFAKEYEKKS  741

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF   S+    +SF  L WSDG H+V SPIA SW
Sbjct  742   YTVTFTATSMPSGTNSFAHLEWSDGKHVVRSPIAFSW  778



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/752 (47%), Positives = 480/752 (64%), Gaps = 43/752 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+  ++IV M K E P  F  H  WY S + ++S       S+++LYTYE+  HGFS RL
Sbjct  34    EKKATYIVHMSKPEMPASFEHHTHWYESSLKSVS------DSAQMLYTYENAIHGFSTRL  87

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T ++A  L + PG++SV+ +   EL TTR+P+FLGL   S++L P SD  +++IIGVLD+
Sbjct  88    TLAEAKLLESQPGILSVMLELRYELHTTRTPEFLGL-DKSADLLPQSDSVSEVIIGVLDT  146

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D G  P+P+SW+ +CE G NF   +CNRK+IGAR + RGYEA +G P+  
Sbjct  147   GVWPESKSFLDTGFGPVPSSWKGECESGTNFTTKNCNRKLIGARFFARGYEATLG-PVDE  205

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH +S A GS VA+A++ G+A G ARG+A  AR+AVYKVCW+G C 
Sbjct  206   SKESKSPRDDDGHGTHTSSTAGGSFVADASLFGYAAGTARGMAARARVAVYKVCWVGGCF  265

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+A+ DGV+V      S S  G    Y  D +AIGAF A++KG+ VSC+AGN
Sbjct  266   SSDILAAMDKAIDDGVNV-----LSMSLGGSMSYYYRDSVAIGAFAAMEKGIFVSCSAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GP  Y+  N+APWI TVGA T+DR+FPA  +LGN ++++G SLY G  + P ++ +P V
Sbjct  321   SGPSSYSLSNVAPWITTVGAGTLDRDFPAFASLGNGKNYSGVSLYKGDAILPGKL-LPFV  379

Query  1175  YGGSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             Y G+A    N   C  G L   +V G+IV C++G +   V KG  V  AGG+GM++ N  
Sbjct  380   YAGNASNATNGNLCMMGALIPEQVAGKIVLCDRGVNPR-VQKGAVVKAAGGLGMVLSNTD  438

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G +L  +A  +P   V    G+ I++Y+ + S PT  I F+GT +G  PS P VAAFS
Sbjct  439   ANGEELVADAHLLPATAVGQKGGDEIKKYLFSDSKPTVNILFEGTKVGIQPS-PVVAAFS  497

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN +TP+ILKPD+IAPGVNILA W GS+            EFN+ISGTSM+CPHVSG
Sbjct  498   SRGPNSITPDILKPDMIAPGVNILAGWVGSVGPTGLATDGRRVEFNIISGTSMSCPHVSG  557

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             LAA++K  +P WSPAAIKSALMTTAY    +G   L D+ T + +TP  +G+GHVDP  A
Sbjct  558   LAALIKAAHPDWSPAAIKSALMTTAYVTYKNGN-KLQDVATGKDSTPFDHGAGHVDPVSA  616

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             ++PGLVYD   +DY++FLC + Y + +I    R     D   +   +   LNYPSF+V F
Sbjct  617   LNPGLVYDLTADDYLNFLCALNYSATEITSLARRKFTCDASKKY--SVTDLNYPSFAVNF  674

Query  2030  KNNLQTVIYK--RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
              +    V+ K  RT+ NV         +++Q+P  V+V V P  L F    +  SY VTF
Sbjct  675   GSGSADVVIKHSRTLTNVGAPGTYKVLISLQSP-GVKVAVEPETLSFRQANEKKSYTVTF  733

Query  2204  --QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                S+    ++FG + WS+G  +V SPIAVSW
Sbjct  734   TGSSMPAGTNTFGRIEWSNGKQIVGSPIAVSW  765



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/746 (47%), Positives = 484/746 (65%), Gaps = 41/746 (5%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV + KSE P+ F  H  WY S + T+S       S+E++YTY++  HG++ RLT  +
Sbjct  34    TYIVHVAKSEMPESFEHHAVWYESSLKTVS------DSAEMIYTYDNAIHGYATRLTAEE  87

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L    G+++VLP+   EL TTR+P FLGL   S++L P S  G+D+I+GVLD+G+WP
Sbjct  88    ARLLQRQTGILAVLPETRYELFTTRTPLFLGL-DKSADLFPESSSGSDVIVGVLDTGVWP  146

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D GL P+P++W+  CE G NF A++CNRK+IGAR + +G EA +G PI    E 
Sbjct  147   ESKSFDDTGLGPVPSTWKGACETGTNFTASNCNRKLIGARFFAKGVEAMLG-PINETEES  205

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +SARD +GHGTH +S AAGS V+ A++ G+A G ARG+AT AR+A YKVCW G C ++DI
Sbjct  206   RSARDDDGHGTHTSSTAAGSVVSGASLLGYASGTARGMATRARVAAYKVCWKGGCFSSDI  265

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +++A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN GP 
Sbjct  266   LAAIERAILDNVNVLSLSLG-----GGISDYYRDSVAIGAFSAMEKGILVSCSAGNSGPG  320

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG----  1180
             PY+  N+APWI TVGA T+DR+FPA V LGN  +F+G SLY G       +P+VY     
Sbjct  321   PYSLSNVAPWITTVGAGTLDRDFPAYVALGNGLNFSGVSLYRGNALPDSSLPLVYAGNVS  380

Query  1181  -GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
              G+ N   C  G L   KV G+IV C++G  T+ V KG  V  AG +GM++ N    G +
Sbjct  381   NGAMNGNLCITGTLSPEKVAGKIVLCDRG-LTARVQKGSVVKSAGALGMVLSNTAANGEE  439

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P   V    G+ I++Y+ + + PT +I F+GT +G  PS P VAAFS RGPN
Sbjct  440   LVADAHLLPATAVGQKAGDAIKKYLVSDAKPTVKIFFEGTKVGIQPS-PVVAAFSSRGPN  498

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +TP+ILKPD+IAPGVNILA W+ ++            +FN+ISGTSM+CPHVSGLAA++
Sbjct  499   SITPQILKPDLIAPGVNILAGWSKAVGPTGLPVDNRRVDFNIISGTSMSCPHVSGLAALI  558

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAA++SALMTTAYTV  +G   L D  T +P+TP  +GSGHVDP  A++PGL
Sbjct  559   KSAHPDWSPAAVRSALMTTAYTVYKTGE-KLQDSATGKPSTPFDHGSGHVDPVAALNPGL  617

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQ  2044
             VYD  V+DY+ FLC + Y + +I+   +      C      +   LNYPSF+VLF+++  
Sbjct  618   VYDLTVDDYLGFLCALNYSAAEISTLAKRK--FQCDAGKQYSVTDLNYPSFAVLFESSGS  675

Query  2045  TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL---R  2215
              V + RT+ NV         VT  T S V+++V P  L F +  +  ++ VTF S    +
Sbjct  676   VVKHTRTLTNVGPAGTYKASVTSDTAS-VKISVEPQVLSFKEN-EKKTFTVTFSSSGSPQ  733

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW  2293
              + ++FG + WSDG HLV SPI+V+W
Sbjct  734   HTENAFGRVEWSDGKHLVGSPISVNW  759



>gb|AGN03879.1| senescence-associated subtilisin protease [Triticum aestivum]
Length=786

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/710 (49%), Positives = 460/710 (65%), Gaps = 31/710 (4%)
 Frame = +2

Query  236   ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  415
              LLYTY   A G +ARLT +QA+ +A  PGV++V  D+  +L TT +P+FL L S +  L
Sbjct  75    RLLYTYARAATGVAARLTEAQAAHVAAQPGVLAVHRDQARQLHTTHTPEFLHLNSAAGVL  134

Query  416   GPSSDYGA--DIIIGVLDSGIWP-ERSSFS--DRGLNPIPNSWRNKCEVGPNFPATS-CN  577
               +S  GA  D+++GVLD+GI+P  RSSF     GL P P+S+   C     F A++ CN
Sbjct  135   PAASGSGAVSDVVVGVLDTGIYPLNRSSFKPVGDGLGPPPSSFSGGCVSAAKFNASAFCN  194

Query  578   RKIIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRG  751
              K+IGA+ +Y+GYE  +G PI    E KS  D  GHGTH AS AAGS V  A    +ARG
Sbjct  195   SKLIGAKFFYKGYEEGLGHPINETLESKSPLDTEGHGTHTASTAAGSPVDGAGFYQYARG  254

Query  752   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDE  931
              A G+A  ARIA YK+CW   C ++DIL+  D+AV DGV+V+SLS+ S     +A  + E
Sbjct  255   RAVGMAPTARIAAYKICWKSGCFDSDILAAFDEAVGDGVNVISLSVGST----YAADFYE  310

Query  932   DLIAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSR  1111
             D IAIGAFGAV+KG++VS +AGN GP  YTA N+APWILTVGAST+DREFPA   LG+  
Sbjct  311   DSIAIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVGASTVDREFPADAVLGDGS  370

Query  1112  SFTGTSLYSGVQPSRIQVPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKG  1291
              + G SLY+G   +  ++P+VY     S  C  G+LD  KV G+IV CE+G +   V+KG
Sbjct  371   VYGGVSLYAGDPLNSTKLPLVYAADCGSRLCLIGELDKDKVAGKIVLCERGVNAR-VEKG  429

Query  1292  VAVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFK  1471
              AV +AGG+GMI+ N    G +L  +   IP+ +V    G+ IR YV+T   PTA I F 
Sbjct  430   AAVGKAGGIGMILANTEESGEELIADPHLIPSTMVGQKFGDKIRHYVKTDPSPTATIVFH  489

Query  1472  GTVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------  1618
             GTVIG SPSAPRVA+FS RGPN   PEILKPDV APGVNILA WTG  +           
Sbjct  490   GTVIGKSPSAPRVASFSSRGPNSRAPEILKPDVTAPGVNILADWTGEASPTDLDIDPRRV  549

Query  1619  EFNMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQ  1798
              FN+ISGTSM+CPHVSGLAA+L++ +P WSP  +KSALMTTAY +DNSG   + DL T  
Sbjct  550   PFNIISGTSMSCPHVSGLAALLRQAHPDWSPTVVKSALMTTAYNMDNSGE-IIKDLATGT  608

Query  1799  PTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNR  1978
              +TP   G+GHVDP  A++PGLVYDA   DY+ FLC +GY   +IA+F R+  + DC ++
Sbjct  609   ESTPFVRGAGHVDPISALNPGLVYDADTADYIGFLCALGYTPAQIAVFTRDGSVADC-SK  667

Query  1979  NLGNPGSLNYPSFSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRL  2158
                  G LNYP+F+ +F +   +V Y R V+NV    +  Y+  V++P+ V   V+P +L
Sbjct  668   KPARSGDLNYPAFAAVFSSYKDSVTYHRVVRNVGSDASAVYEAKVESPAGVDAKVTPAKL  727

Query  2159  VFTDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VF +   +L+YE+T        +  +  SFGS+ WSDG H VTSPIAV+W
Sbjct  728   VFDEEHRSLAYEITLAVSGNPVIVDAKYSFGSVTWSDGKHNVTSPIAVTW  777



>gb|KFK26784.1| hypothetical protein AALP_AA8G293000 [Arabis alpina]
Length=758

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/751 (47%), Positives = 471/751 (63%), Gaps = 35/751 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE--LLYTYEHVAHGFSARLT  289
             K+++V M KS  P  ++ H  WY+S I++++   +H    +  +LYTY+   HG +ARL+
Sbjct  14    KTYVVHMDKSAMPSPYTDHLQWYTSKINSVTERHSHEEEEDNRILYTYQTAFHGLAARLS  73

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLDS  466
               +A  L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GVLD+
Sbjct  74    QEEAERLEEEAGVVAVIPETKYELHTTRSPTFLGLERQESERVWAERVTDHDVVVGVLDT  133

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK    
Sbjct  134   GIWPESQSFNDTGMSPVPSTWRGACETGKRFLRQNCNRKIVGARVFYRGYEAATGKIDEE  193

Query  647   -EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+G C +
Sbjct  194   LEYRSPRDRDGHGTHTAATVAGSPVRGANLLGFAYGTARGMAPKARVAAYKVCWVGGCFS  253

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DILS +DQAVADGV VLS+SL      G    Y  D +AI  FGA++ GV VSC+AGN 
Sbjct  254   SDILSAVDQAVADGVQVLSISLG-----GGISTYSRDSLAIATFGAMEMGVFVSCSAGNG  308

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVVY  1177
             GPDP +  N++PWI TVGAST+DR+FPA V LG  RSF G SLY G  V     Q P+VY
Sbjct  309   GPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRSFKGVSLYKGRTVLSKNKQYPLVY  368

Query  1178  GGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
              G   S      +C  G LD   V G+IV C++G  T  V KG  V +AGG+GMI+ N  
Sbjct  369   FGRNASSPDPTSFCLDGALDRRHVAGKIVICDRG-VTPRVQKGQVVKRAGGIGMILTNTA  427

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT +G  PS P VAAFS
Sbjct  428   TNGEELVADSHLLPAVAVGEKEGKVIKQYAMTSKRATATLEILGTKVGIKPS-PVVAAFS  486

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSG  1669
              RGPNFL+ EILKPDV+APGVNILAAW+G +            +FN++SGTSM+CPHVSG
Sbjct  487   SRGPNFLSLEILKPDVLAPGVNILAAWSGDMAPSSLSSDRRRVKFNILSGTSMSCPHVSG  546

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             +AA+++  +P WSPAAIKSALMTTAY  DN  +  + D     P+TP+ +GSGH+DP  A
Sbjct  547   VAALIRSRHPDWSPAAIKSALMTTAYVHDNMLK-PITDASGAAPSTPYDHGSGHIDPLKA  605

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             +DPGLVYD G  DY +FLCT      ++ +F ++S    C+N    NPG+LNYP+ S LF
Sbjct  606   IDPGLVYDIGPQDYFEFLCTQDLTPAQLKVFTKHSNRT-CKNTLANNPGNLNYPAISALF  664

Query  2030  KNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
               N  ++ +  +RTV NV      +Y+V+V       VTV P  L FT +   LSY VTF
Sbjct  665   PENARVKVMTLRRTVTNVGP-HISSYKVSVSPFKGASVTVQPKTLNFTLKHQKLSYTVTF  723

Query  2204  QS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             ++ LR     FG L W   TH V SP+ ++W
Sbjct  724   RTKLRMKRPEFGGLLWKSATHKVRSPVIITW  754



>dbj|BAJ86110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/757 (47%), Positives = 478/757 (63%), Gaps = 40/757 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+  ++IV M KS  P  ++ H +WY + + ++S  +  + ++++LY Y+ V HGFSARL
Sbjct  27    EQRATYIVHMAKSAMPAEYADHGEWYGASLRSVS--AGGAPAAKMLYAYDTVLHGFSARL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +AS++A + GV++V P+   EL TTR+P+FLGL +G+  L P S    D+++GVLD+
Sbjct  85    TEQEASDMAGMEGVLAVNPETRYELHTTRTPEFLGL-AGNEGLFPQSGTAGDVVVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG-KPIV  643
             G+WPE  S+ D GL  +P+SW+  C  G +F +++CNRK+IGAR + RGYEA +G     
Sbjct  144   GVWPESKSYDDAGLGEVPSSWKGTCMAGADFNSSACNRKLIGARFFNRGYEAAMGPMDTS  203

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAG+AVA+A++ G A G ARG+A  AR+AVYKVCWLG C +
Sbjct  204   RESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGTARGMAPKARVAVYKVCWLGGCFS  263

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+GMD AVADG  VLSLSL      G +  Y  D +AIGAF A+++ V+VSC+AGN 
Sbjct  264   SDILAGMDAAVADGCGVLSLSLG-----GGSADYARDSVAIGAFAAMEQNVLVSCSAGNA  318

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   T  N+APWI TVGA T+DR+FPA V LGN +++TG SLY+G  P     P++Y G
Sbjct  319   GPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYTGVSLYAGKAPPTTPTPLIYAG  378

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C PG L   KV+G+IV C++G  ++ V KG  V  AGG GM++ N    G
Sbjct  379   NASNSTSGNLCMPGTLSPEKVQGKIVVCDRG-ISARVQKGFVVRDAGGAGMVLANTAANG  437

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P A V   +G  I+ Y+ +A+ PTA I   GT +   PS P VAAFS RG
Sbjct  438   QELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIAGTQVNVRPS-PLVAAFSSRG  496

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPEILKPD+I PGVNILAAWTG               FN+ISGTSM+CPHVSGLAA
Sbjct  497   PNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRVSFNIISGTSMSCPHVSGLAA  556

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGT-LIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             +L+  +P WSPAA++SALMTTAY+    G G+ ++D  T    TP  YG+GHVDPT AV+
Sbjct  557   LLRSAHPEWSPAAVRSALMTTAYSTYTGGAGSPILDAATGAAATPFDYGAGHVDPTRAVE  616

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYD G  DYVDFLC + Y    IA   R S    C      +  +LNYPSFSV +  
Sbjct  617   PGLVYDLGTGDYVDFLCALKYTPNMIAALAR-SKAYGCAANKTYSVSNLNYPSFSVAYST  675

Query  2033  -------NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
                    +   TV + RT+ NV          +V   S V V V P  L FT   +  SY
Sbjct  676   ANGEAGDSGATTVTHTRTLTNVGAAGTYKVDASVSM-SGVTVDVKPTELEFTAIGEKKSY  734

Query  2192  EVTFQSLRQS---ADSFGSLRWSDGTHLVTSPIAVSW  2293
              V+F + +        FG L WSDG H V SPIA++W
Sbjct  735   TVSFTAAKSQPSGTAGFGRLVWSDGKHTVASPIALTW  771



>ref|XP_008220305.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=769

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/755 (48%), Positives = 470/755 (62%), Gaps = 48/755 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             K++I+ M KS+ P  F   H  WY S + ++S       S+++LYTY  + HGFS RLT 
Sbjct  33    KTYIIHMDKSQMPASFEDDHFQWYDSSLKSVS------NSADMLYTYRTIIHGFSTRLTA  86

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
              +A  L   PG++SVLP+R  EL TTR+P+FLGL   S  L P+SD  +++I+GV+D+G+
Sbjct  87    EEAELLEKQPGILSVLPERKYELHTTRTPEFLGL-GKSEALLPASDKVSEVIVGVVDTGV  145

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPE  S+ D GL  +P SW+  CEVG NF ++SCNRK+IGAR + +GYEA +G PI    
Sbjct  146   WPELKSYDDTGLAAVPTSWKGSCEVGTNFSSSSCNRKLIGARYFSKGYEAALG-PIDEKT  204

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD +GHGTH +S AAGSAV  A++  +A G ARG+A  AR+A YK CWLG C  +
Sbjct  205   ESKSPRDDDGHGTHTSSTAAGSAVRGASLFSYASGTARGMAPQARVATYKACWLGGCFGS  264

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DI + M++AV DGV+VLSLS+      G    Y  D +AIGAF A  +G++VSC+AGN G
Sbjct  265   DITAAMEKAVEDGVNVLSLSIG-----GSQSEYYRDTVAIGAFSAAAQGILVSCSAGNGG  319

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG--  1180
             PD  +  N+APWI TVGA T+DR+FPA V+LGN + + G SLY G   S   +P+VY   
Sbjct  320   PDSGSLSNVAPWITTVGAGTLDRDFPAFVSLGNQKKYRGISLYRGTSLSSGLLPLVYARN  379

Query  1181  --GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
                S+N   C P  L  +KV G+IV C++G  T  V K + V +AGG+GMI+ N  + G 
Sbjct  380   ASTSSNGALCSPESLIPAKVAGKIVVCDRG-GTPRVQKSLVVKKAGGLGMILANTDSYGE  438

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  + TA V    G+ I+ Y+ + S PTA I    T +   PS P VA+FS RGP
Sbjct  439   ELVADAYLLATAAVGQKAGDAIKSYIASGSNPTATIALGETELDVQPS-PVVASFSSRGP  497

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAM  1681
             N +TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA+
Sbjct  498   NLITPEILKPDLIAPGVNILAGWTGAVGPTGLAEDKRRVTFNIISGTSMSCPHVSGLAAL  557

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             +   +P WSPAAIKSALMTT+YT   +G  T+ D+ T  P TP  YG+GHVDP  A+DPG
Sbjct  558   VMAAHPEWSPAAIKSALMTTSYTTYKTGE-TIKDIATGNPATPFDYGAGHVDPVAALDPG  616

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN--  2035
             LVYDA V DY+ FLC + Y + +I L         C +    +   LNYPSF+V  +   
Sbjct  617   LVYDAAVEDYLSFLCALNYTTTQIKLTTHKD--FTCDSSKKYSLRDLNYPSFAVPLETAS  674

Query  2036  -------NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                       TV Y RT+ NV         V+ QTPS V++TV P  L F+   +  +Y 
Sbjct  675   GKGGGSRASTTVKYTRTLTNVGTPATYKVSVSSQTPS-VKITVDPESLSFSQAYEKKTYT  733

Query  2195  VTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF   S      SFG L WSDG H V SPIA SW
Sbjct  734   VTFVTSSSPSGTTSFGRLEWSDGKHTVGSPIAFSW  768



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/754 (47%), Positives = 478/754 (63%), Gaps = 45/754 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E +++IV M   +KP  ++THHDWYS+ + +LS  +  S    LLYTY +  +GF+A L 
Sbjct  24    EKRTYIVHMKNHDKPLAYATHHDWYSANLQSLSASAEDS----LLYTYTNSYNGFAASLD  79

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLIS----GSSNLGPSSDYGADIIIGV  457
             P QA  L     V+ V  D +  L TTR+P+FLGL       + ++  +SD   D+I+GV
Sbjct  80    PDQAELLRKSDSVVGVYEDTVYTLHTTRTPEFLGLAVDKGLSAQDVNQASD---DVIVGV  136

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKP  637
             LD+G+WPE  SF + G+  IP  W+ +CE  P+F    CN+K+IGAR++ +GY+   G  
Sbjct  137   LDTGVWPESKSFDETGMPEIPARWKGECESAPDFDPKLCNKKLIGARSFSKGYQMSSGGG  196

Query  638   IVGEPK----SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCW  805
              +G+ +    S RD +GHGTH AS AAGS VANA++ G+A G ARG+AT AR+A YKVCW
Sbjct  197   SIGKQRKEVVSPRDRDGHGTHTASTAAGSHVANASLLGYASGTARGMATRARVAAYKVCW  256

Query  806   LGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVS  985
                C  +DIL+G+D+A++DGV VLS+SL      G + PY  D IAIGAF AV+KG+ VS
Sbjct  257   STGCFGSDILAGIDRAISDGVDVLSMSLG-----GGSAPYYHDTIAIGAFSAVEKGIFVS  311

Query  986   CAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQV  1165
             C+AGN GP   +  N+APWI+TVGA T+DR+FPA   LGN   FTG SLYSG       V
Sbjct  312   CSAGNSGPSRASLANVAPWIMTVGAGTLDRDFPAYAVLGNKNRFTGVSLYSGPGMGDKPV  371

Query  1166  PVVYGGSANSF---YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
              +VY   ANS     C  G L+   VRG++V C++G +   V+KG  V +AGG+GMI+ N
Sbjct  372   GLVYSKGANSSSGNLCLAGSLEPEVVRGKVVLCDRGVNAR-VEKGAVVREAGGIGMILAN  430

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  ++   P   V +  G+ IR+YVR+   PTA + F GTV+   PS P VAA
Sbjct  431   TAASGEELVADSHLSPAVAVGMKVGDQIREYVRSDPNPTALLSFGGTVLNVRPS-PVVAA  489

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGPN +TP+ILKPDVI PGVNILAAW+ ++           T+FN++SGTSM+CPH+
Sbjct  490   FSSRGPNLVTPQILKPDVIGPGVNILAAWSEAIGPTGLEKDTRKTKFNIMSGTSMSCPHI  549

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SGLAA+LK  +P WSP+AIKSALMTTAY  DN+ +  L D    Q +TP A+G+GHVDP 
Sbjct  550   SGLAALLKAAHPDWSPSAIKSALMTTAYVTDNT-KSPLRDAEGDQVSTPWAHGAGHVDPQ  608

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+ PGLVYD  V++Y++FLC++ Y +  I   +++     C ++   +PG+LNYPSFSV
Sbjct  609   KALSPGLVYDISVDEYINFLCSLDYTTDHIQTIVKHRNFT-C-SKKFSDPGALNYPSFSV  666

Query  2024  LFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
             LF N  + V Y R + NV    +V Y V V  P  V+VTV P +L F    + L Y VTF
Sbjct  667   LFANK-RVVRYTRRLTNVGAAASV-YTVAVNAPPTVKVTVKPAKLAFKSVGERLRYTVTF  724

Query  2204  ----QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                  + R S   FGS+ WS+  H V SP A +W
Sbjct  725   VASRGAARTSRSEFGSIVWSNAEHQVRSPAAFAW  758



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/749 (48%), Positives = 481/749 (64%), Gaps = 34/749 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             + +IV M K+  P +F+TH  WY+S + T +  ++ +  S LLYTY+   HG++A L+P 
Sbjct  39    RVYIVRMSKAHMPPVFTTHDHWYASELQT-TIDADANADSRLLYTYDSAFHGYAALLSPY  97

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGL--ISGSSNLGPSSDYGADIIIGVLDSG  469
             +A +L +   V++V  + + EL TTRSP FLGL       ++        D++IGVLD+G
Sbjct  98    EAEKLRSYDSVLAVYEEYVYELHTTRSPAFLGLGGYDAPVDMASLDQASEDVVIGVLDTG  157

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG----KP  637
             +WPE  SFSD G+  +P  W+  CE GP+FPA++CNRK+IGAR++ RGY A  G      
Sbjct  158   VWPESPSFSDAGMAVVPPKWQGACESGPDFPASACNRKLIGARSFSRGYLAAEGLGGSSN  217

Query  638   IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E  S RD +GHGTH AS AAG+AV  A++ G+ARG ARG+A  AR+AVYKVCW   C
Sbjct  218   SSMESASPRDRDGHGTHTASTAAGAAVPGASLFGYARGTARGMAQRARVAVYKVCWSSGC  277

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+GMD+AV DGV VLSLSL      G A PY  D IAIGAF A +KGV VSC+AG
Sbjct  278   FSSDILAGMDRAVTDGVDVLSLSLG-----GGAAPYYRDAIAIGAFSAAEKGVFVSCSAG  332

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GPD  T  N+APWI T+GA T+DR+FPA V L N++ FTG SLYSG      ++ +VY
Sbjct  333   NAGPDASTLANVAPWIATIGAGTLDRDFPAYVLLDNNQRFTGVSLYSGRGLKGKRLSIVY  392

Query  1178  GGSA---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G S+   +S  C  G LD   VRG+IV C++G +   V+KG  V  AGG GMI+ N    
Sbjct  393   GQSSGLNSSNLCLAGTLDPKLVRGKIVLCDRGINAR-VEKGEVVRSAGGAGMILANTAAN  451

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTAS-FPTARIEFKGTVIGNSPSAPRVAAFSC  1525
             G +L  ++ ++P   V    G+ IR YVR  S    A +  +GTV+G  PS P VAAFS 
Sbjct  452   GEELVADSHQLPAVAVGKKAGDEIRAYVRGKSGIARATLAIRGTVLGVRPS-PVVAAFSS  510

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TP++LKPDV+ PGVNILA WTG+            T+FN+ISGTSM+CPH+SG+
Sbjct  511   RGPNMVTPQVLKPDVVGPGVNILAGWTGAAGPSGLAKDKRRTKFNIISGTSMSCPHISGV  570

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK  +P WSPAAIKSALMTTAYT D +G   L D  T   +TP A+GSGHVDP +A+
Sbjct  571   AALLKAAHPDWSPAAIKSALMTTAYTRDTTGS-PLRDAATGGLSTPLAHGSGHVDPQNAL  629

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             DPGL+YD   +DY+DFLC++ Y   ++ +  ++S     R++ L + G+LNYPSFSV+F+
Sbjct  630   DPGLIYDLSTSDYLDFLCSLNYSDTQVRIVSKHSNFSCPRDKVL-DTGNLNYPSFSVIFR  688

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
                + V Y R + NV +  +V Y V+V  P  V +TV P RLVF    +   Y V F S 
Sbjct  689   GYEKVVRYSRVLTNVGEPSSV-YTVSVSAPEGVGITVKPQRLVFKGVGNKQGYTVEFASK  747

Query  2213  RQSAD--SFGSLRWSDGTHLVTSPIAVSW  2293
              +++    FG + WS+  H V SPIA SW
Sbjct  748   IKTSGPMDFGWILWSNQKHKVRSPIAFSW  776



>ref|XP_002283279.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=765

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/757 (47%), Positives = 472/757 (62%), Gaps = 47/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++  ++IV M KS  P  F  H  WY S + T S       S+++LYTY +V HGFS RL
Sbjct  27    QQKNTYIVHMDKSNMPTTFDDHFQWYDSSLKTAS------SSADMLYTYNNVVHGFSTRL  80

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L    G++SVLP+   EL TTR+P+FLGL    + L P +D  +++I+GVLD+
Sbjct  81    TTEEAELLRGQLGILSVLPEARYELHTTRTPEFLGLGKSVAFL-PQADSASEVIVGVLDT  139

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SF D GL P+P+SW+ +CE G  FP +SCNRK+IGAR + RGYE   G P+  
Sbjct  140   GVWPELKSFDDTGLGPVPSSWKGECETGKTFPLSSCNRKLIGARFFSRGYEVAFG-PVNE  198

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHG+H ++ A GSAV  A++ G A G ARG+AT+AR+A YKVCWLG C 
Sbjct  199   TIESRSPRDDDGHGSHTSTTAVGSAVEGASLFGFAAGTARGMATHARVAAYKVCWLGGCY  258

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DI++ MD+AV DGV VLS+S+      G    Y +D +AIGAF A+++G++VSC+AGN
Sbjct  259   GSDIVAAMDKAVQDGVDVLSMSIG-----GGLSDYTKDSVAIGAFRAMEQGILVSCSAGN  313

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP P +  N+APWI TVGA T+DR+FPA V LG+ + F+G SLYSG   S   +P+VY 
Sbjct  314   GGPAPSSLSNVAPWITTVGAGTLDRDFPAFVMLGDGKKFSGVSLYSGKPLSDSLIPLVYA  373

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C P  L   KV G+IV C++G +   V KG+ V +AGGVGMI+ N    
Sbjct  374   GNASSSPNGNLCIPDNLIPGKVAGKIVLCDRGSNAR-VQKGIVVKEAGGVGMILTNTDLY  432

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +PTA V    G+ I+ Y+ +   P A I   GT +G  PS P VA+FS R
Sbjct  433   GEELVADAHLLPTAAVGQKAGDSIKSYISSDPNPMATIAPGGTQVGVQPS-PVVASFSSR  491

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLA
Sbjct  492   GPNPVTPEILKPDIIAPGVNILAGWTGAVGPTGLQVDTRKVSFNIISGTSMSCPHVSGLA  551

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P W PAAIKSALMTTAY     G  T+ D+ T +P TP  YG+GHV+P  A+D
Sbjct  552   ALLKAAHPEWRPAAIKSALMTTAYHTYKGGE-TIQDVATGRPATPFDYGAGHVNPVSALD  610

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYDA V+DY+ F C + Y   +I  F       D   +   +   LNYPSF+V  + 
Sbjct  611   PGLVYDATVDDYLSFFCALNYKQDEIKRFTNRDFTCDMNKKY--SVEDLNYPSFAVPLQT  668

Query  2036  ---------NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                       L  V Y RT+ NV         V+ Q  S+V+++V P  L F++  +  S
Sbjct  669   ASGKGGGSGELTVVKYTRTLTNVGTPATYKVSVSSQI-SSVKISVEPESLTFSEPNEKKS  727

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF   S+     SF  L WSDG H+V SP+A SW
Sbjct  728   YTVTFTASSMPSGMTSFAHLEWSDGKHIVGSPVAFSW  764



>ref|XP_003525925.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/753 (48%), Positives = 476/753 (63%), Gaps = 50/753 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++I+ M K   P+ F+ H  WY S + ++S       S+E LYTY+ VAHGFS RLT  +
Sbjct  38    TYIIHMDKFNMPESFNDHLHWYDSSLKSVS------DSAERLYTYKKVAHGFSTRLTTQE  91

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L+  PGV+SV+P+   EL TTR+P+FLGL +  + L  +S   +D+I+GVLD+G+WP
Sbjct  92    AELLSKQPGVLSVIPEVRYELHTTRTPEFLGL-AKYTTLSLASGKQSDVIVGVLDTGVWP  150

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D GL P+P+SW+ +CE G NF  ++CN+K++GAR + RGYEA  G PI    E 
Sbjct  151   ELKSFDDTGLEPVPSSWKGECERGKNFKPSNCNKKLVGARFFSRGYEAAFG-PIDEKTES  209

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHG+H ++ AAGSAV  A++ G A G ARG+AT AR+A YKVCWLG C  +DI
Sbjct  210   KSPRDDDGHGSHTSTTAAGSAVFGASLFGFANGTARGMATQARVATYKVCWLGGCFTSDI  269

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
              +G+D+A+ DGV++LS+S+      G    Y +D IAIG F A   G++VS +AGN GP 
Sbjct  270   AAGIDKAIEDGVNILSMSIG-----GGLTDYYKDTIAIGTFAATAHGILVSNSAGNGGPS  324

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
               T  N+APW+ TVGA TIDR+FPA +TLGN + +TG SLY+G  P    +P+VY G+A+
Sbjct  325   QATLSNVAPWLTTVGAGTIDRDFPAYITLGNGKIYTGVSLYNGKLPLNSPLPIVYAGNAS  384

Query  1193  SF---YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLE  1363
                   C  G L A KV G+IV C++G +   V+KG+ V  AGG+GMI+ N  + G +L 
Sbjct  385   EESQNLCTRGSLIAKKVAGKIVICDRGGNAR-VEKGLVVKSAGGIGMILSNNEDYGEELV  443

Query  1364  PNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFL  1543
              ++  +P A +       +++YV +   PTA++ F GT +G  PS P VAAFS RGPN L
Sbjct  444   ADSYLLPAAALGQKSSNELKKYVFSFPNPTAKLGFGGTQLGVQPS-PVVAAFSSRGPNVL  502

Query  1544  TPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKK  1690
             TP+ILKPD+IAPGVNILA WTG++            +FN+ISGTSM+CPHV+GLAA+LK 
Sbjct  503   TPKILKPDLIAPGVNILAGWTGAVGPTGLAEDTRHVDFNIISGTSMSCPHVTGLAALLKG  562

Query  1691  IYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVY  1870
             I+P WSPAAI+SALMTTAY    +G+ T+ D+ T  P TP  YG+GHVDP  A DPGLVY
Sbjct  563   IHPEWSPAAIRSALMTTAYRTYKNGQ-TIKDVATGLPATPFDYGAGHVDPVAAFDPGLVY  621

Query  1871  DAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL---  2041
             D  V+DY+ F C + Y   +I L  R      C  R       LNYPSF+V F       
Sbjct  622   DTTVDDYLSFFCALNYSPYQIKLVARRD--FTCSKRKKYRVEDLNYPSFAVPFNTAYGVK  679

Query  2042  ------QTVIYKRTVKNVAKVRNVAYQVTV-QTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
                    TV Y RT+ NV       Y+V+V Q+P  V++ V P  L F    +  +Y VT
Sbjct  680   GGSSKPATVQYTRTLTNVGAAGT--YKVSVSQSP--VKIVVQPQTLSFRGLNEKKNYTVT  735

Query  2201  FQSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
             F S  +     SF  L WSDG H VTSPIA SW
Sbjct  736   FMSSSKPSGTTSFAYLEWSDGKHKVTSPIAFSW  768



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/752 (47%), Positives = 478/752 (64%), Gaps = 48/752 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M  ++KP  ++TH +WYS  + +L+  +  S    LLYTY+    GF+A LTP 
Sbjct  33    KTYIVHMKHNQKPASYATHTEWYSDHLQSLTSAAPDS----LLYTYDAAYSGFAAALTPE  88

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYG--------ADIII  451
             +A  +     V+ V  D +  L TTR+P+FLGL   ++  GP + +          D+II
Sbjct  89    EADSIRQSDSVLGVYEDTVYTLHTTRTPEFLGL---NTEPGPWTGHSLQELNKASQDVII  145

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNF-PATSCNRKIIGARAYYRGYEAEI  628
             GVLD+G+WPE  SF+D G+  +P  WR +CE   +F P   CN+K+IGAR + +G+    
Sbjct  146   GVLDTGVWPESKSFADFGMPDVPTRWRGRCEAAGDFNPKIHCNKKLIGARFFSKGHNIVS  205

Query  629   GKPIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             G     E +S RD +GHGTH AS AAGS V NA++ G+ARG ARG+AT+AR+A YKVCW 
Sbjct  206   GAK---EAQSPRDNDGHGTHTASTAAGSQVQNASLLGYARGNARGMATHARLATYKVCWK  262

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C  +DIL+ M++A+ DGV VLS+SL      G + PY  D IAIGAF AV++G+ VSC
Sbjct  263   SGCLGSDILAAMERAILDGVDVLSMSLG-----GGSAPYFRDTIAIGAFAAVERGIFVSC  317

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP   +  N+APWI+TVGA TIDR+FPA  TLGN   + G SLYSG    R  V 
Sbjct  318   SAGNSGPTKESLANVAPWIMTVGAGTIDRDFPAFSTLGNGEKYNGVSLYSGKGMGRKSVE  377

Query  1169  VVYGGSANSF--YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             +VYG +AN+    C PG LD++ VRG++V C++G     V+KG+ V  AGGVGMI+ N  
Sbjct  378   LVYGKNANTTGNLCLPGSLDSAAVRGKVVLCDRGISPR-VEKGMVVRDAGGVGMILANTA  436

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G +L  ++  +P   V    G+ IR+YV+TA  P A + F GTV+   PS P VAAFS
Sbjct  437   ESGEELVADSHLLPAVAVGRKIGDEIRRYVKTARNPRASLSFAGTVVNVKPS-PVVAAFS  495

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN +TP+ILKPDVI PGVNILAAW+ ++           T+FN+ISGTSM+CPH+SG
Sbjct  496   SRGPNMVTPQILKPDVIGPGVNILAAWSQAVGPTGLDTDTRKTQFNIISGTSMSCPHISG  555

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             LAA+LK  +P+WSP+AIKSALMTTAYT DN+    L D      +TP A+G+GHVDP  A
Sbjct  556   LAALLKAAHPNWSPSAIKSALMTTAYTHDNA-NSPLRDAADYSLSTPWAHGAGHVDPHKA  614

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             + PGLVYDA   DYV FLC++GY    + +  ++ P + C  R   +PG LNYPSFSV+F
Sbjct  615   LSPGLVYDATPEDYVSFLCSLGYTKEMVQIVAKH-PNITCSKR-FHDPGQLNYPSFSVMF  672

Query  2030  KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS  2209
             +     V Y R + NV     + Y+V+V  P NV V+VSP+ LVF +  D   + VTF  
Sbjct  673   RKT-GVVRYSRELTNVGPA-GLTYRVSVDAPPNVEVSVSPSTLVFKNVGDKRRFRVTFVW  730

Query  2210  LRQSA----DSFGSLRWSDGTHLVTSPIAVSW  2293
              ++        FGS+ WS+  H V+SP+A SW
Sbjct  731   KKEVGPVVRHGFGSIVWSNALHRVSSPVAYSW  762



>dbj|BAJ96698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/758 (47%), Positives = 480/758 (63%), Gaps = 42/758 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+  ++IV M KS  P  ++ H +WY + + ++S  +  + ++++LY Y+ V HGFSARL
Sbjct  27    EQRATYIVHMAKSAMPAEYADHGEWYGASLRSVS--AGGAPAAKMLYAYDTVLHGFSARL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +AS++A + GV++V P+   EL TTR+P+FLGL +G+  L P S    D+++GVLD+
Sbjct  85    TEQEASDMAGMEGVLAVNPETRYELHTTRTPEFLGL-AGNEGLFPQSGTAGDVVVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  S+ D GL  +P+SW+  C  G +F +++CNRK+IGAR + RGYEA + +P+  
Sbjct  144   GVWPESKSYDDAGLGEVPSSWKGTCMAGADFNSSACNRKLIGARFFNRGYEAAM-RPMDT  202

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAG+AVA+A++ G A G ARG+A  AR+AVYKVCWLG C 
Sbjct  203   SRESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGTARGMAPKARVAVYKVCWLGGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+GMD AVADG  VLSLSL      G +  Y  D +AIGAF A+++ V+VSC+AGN
Sbjct  263   SSDILAGMDAAVADGCGVLSLSLG-----GGSADYARDSVAIGAFAAMEQNVLVSCSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA T+DR+FPA V LGN +++TG SLY+G  P     P++Y 
Sbjct  318   AGPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYTGVSLYAGKAPPTTPTPLIYA  377

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A++      C PG L   KV+G+IV C++G  ++ V KG  V  AGG GM++ N    
Sbjct  378   GNASNSTSGNLCMPGTLSPEKVQGKIVVCDRG-ISARVQKGFVVRDAGGAGMVLANTAAN  436

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P A V   +G  I+ Y+ +A+ PTA I   GT +   PS P VAAFS R
Sbjct  437   GQELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIAGTQVNVRPS-PLVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+I PGVNILAAWTG               FN+ISGTSM+CPHVSGLA
Sbjct  496   GPNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRVSFNIISGTSMSCPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGT-LIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             A+L+  +P WSPAA++SALMTTAY+    G G+ ++D  T    TP  YG+GHVDPT AV
Sbjct  556   ALLRSAHPEWSPAAVRSALMTTAYSTYTGGAGSPILDAATGAAATPFDYGAGHVDPTRAV  615

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             +PGLVYD G  DYVDFLC + Y    IA   R S    C      +  +LNYPSFSV + 
Sbjct  616   EPGLVYDLGTGDYVDFLCALKYTPNMIAALAR-SKAYGCAANKTYSVSNLNYPSFSVAYS  674

Query  2033  --------NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                     +   TV + RT+ NV          +V   S V V V P  L FT   +  S
Sbjct  675   TANGEAGDSGATTVTHTRTLTNVGAAGTYKVDASVSM-SGVTVDVKPTELEFTAIGEKKS  733

Query  2189  YEVTFQSLRQS---ADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y V+F + +        FG L WSDG H V SPIA++W
Sbjct  734   YTVSFTAAKSQPSGTAGFGRLVWSDGKHTVASPIALTW  771



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/757 (46%), Positives = 486/757 (64%), Gaps = 48/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             EE +++IV M  S+ P+ F     WY S + ++S       S+E+LY Y +V HGFS RL
Sbjct  30    EERRTYIVHMATSQMPESFQERAHWYDSSLKSVS------ESAEMLYKYSNVIHGFSTRL  83

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PG++S+L +   EL TTR+P+FLGL   S++L P S   +++IIGVLD+
Sbjct  84    TAEEARSLQGRPGILSILEEVRYELHTTRTPEFLGL-DKSADLFPESGSASEVIIGVLDT  142

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPE  SF D GL PIP+SW+ +CE G NF ++SCNRK+IGAR + +GYEA +G PI  
Sbjct  143   GIWPESKSFDDTGLGPIPSSWKGECETGTNFTSSSCNRKLIGARFFSKGYEATLG-PIDE  201

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+ AAGS V  A++ G A G ARG+AT ARIA YKVCW+G C 
Sbjct  202   SKESKSPRDDDGHGTHTATTAAGSVVEGASLFGFAEGTARGMATRARIAAYKVCWIGGCF  261

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             + DIL+ +D+AV D V++LSLSL      G    Y  D +A+GAFGA++KG++VSC+AGN
Sbjct  262   STDILAALDKAVEDNVNILSLSLG-----GGMSDYYRDSVAMGAFGAMEKGILVSCSAGN  316

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PY+  N+APWI TVGA T+DR+FPA V+LGN ++++G SLY G       +P VY 
Sbjct  317   SGPSPYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGKNYSGVSLYRGDPLPGTLLPFVYA  376

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C    L   KV G++V C++G +   V KG  V  AGG+GM++ N    
Sbjct  377   GNASNAPNGNLCMTNTLIPEKVAGKMVMCDRGVNPR-VQKGSVVKAAGGIGMVLANTGTN  435

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I+ Y+ +    T  I F+GT +G  PS P VAAFS R
Sbjct  436   GEELVADAHLLPATAVGQKSGDAIKSYLFSDHDATVTILFEGTKVGIQPS-PVVAAFSSR  494

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP+ILKPD+IAPGVNILA W+G++            +FN+ISGTSM+CPH+SGLA
Sbjct  495   GPNSITPDILKPDLIAPGVNILAGWSGAVGPTGLPTDKRHVDFNIISGTSMSCPHISGLA  554

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
              +LK  +P WSPAAI+SALMTTAYT   SG+  + D+ T +P+T   +G+GHVDP  A++
Sbjct  555   GLLKAAHPEWSPAAIRSALMTTAYTNYKSGQ-KIQDVATGKPSTAFDHGAGHVDPVSALN  613

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGL+YD  V+DY++FLC I Y + +I++  + +   D   +   +   LNYPSF+V  + 
Sbjct  614   PGLIYDLTVDDYLNFLCAINYSAPQISILAKRNFTCDTDKKY--SVADLNYPSFAVPLQT  671

Query  2036  NL--------QTVIYKRTVKNVAKVRNVAYQVTVQTPS-NVRVTVSPNRLVFTDRIDTLS  2188
              L          V + RT+ NV       Y+V++ + S +V+++V P  L F++  +  S
Sbjct  672   PLGGGGEGSSTVVKHTRTLTNVGSPST--YKVSIFSESESVKISVEPGSLSFSELNEKKS  729

Query  2189  YEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             ++VTF   S+  + + FG + WSDG H+V SPI VSW
Sbjct  730   FKVTFTATSMPSNTNIFGRIEWSDGKHVVGSPIVVSW  766



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/746 (50%), Positives = 477/746 (64%), Gaps = 34/746 (5%)
 Frame = +2

Query  122   FIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELL-YTYEHVAHGFSARLTPSQ  298
             +IV M   EKP LF THHDWY S + +L   S+ S SS  L Y+Y     GF+A L PSQ
Sbjct  31    YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSD-YGADIIIGVLDSGIW  475
             A+ L   P V+ V  D +  L TTR+P+FLGL +  S   P+ D   AD++IGVLD+G+W
Sbjct  91    AASLRRSPAVLGVYEDAVYSLHTTRTPEFLGLSAELSAHDPNPDPSSADVVIGVLDTGVW  150

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGEPK  655
             PE  SF D G+  +P  WR +CE GP+F    CN+K+IGAR++ +GY    G   + +PK
Sbjct  151   PESRSFDDSGMPDVPARWRGQCESGPDFDPRLCNKKLIGARSFSKGYHMASGGSFLKDPK  210

Query  656   ---SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
                S RD  GHGTH AS AAGS VANA++ G+A G ARG+AT AR+A YKVCW   C  +
Sbjct  211   ETDSPRDQEGHGTHTASTAAGSRVANASLLGYASGTARGMATRARVASYKVCWRNGCFGS  270

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+GMDQA+ DGV VLSLSL      G + PY  D IAIG+F AV++G+ VSC+AGN G
Sbjct  271   DILAGMDQAILDGVDVLSLSLG-----GGSAPYYRDTIAIGSFAAVERGIFVSCSAGNAG  325

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY--G  1180
             P   T  N+APWI+TVGA T+DR+FPA   LGN   FTG SLYSG    +  V +VY  G
Sbjct  326   PARATLANVAPWIMTVGAGTLDRDFPAYAVLGNKNRFTGVSLYSGPGMGKKLVGLVYDKG  385

Query  1181  GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                +   C PG L  + VRG++V C++G +   V+KG  V  AGGVGMI+ N    G +L
Sbjct  386   SDGSGNLCLPGSLQPALVRGKVVVCDRGTNAR-VEKGSVVRAAGGVGMILANTAASGEEL  444

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               ++  +P   V    G++IR+Y  +   PTA I F GTV+G  PS P VAAFS RGPN 
Sbjct  445   VADSHLLPAVAVGRKVGDLIREYASSNLNPTATIGFGGTVLGVQPS-PVVAAFSSRGPNL  503

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP+ILKPDVI PGVNILAAW+G++           T+FN++SGTSM+CPH+SGLAA+LK
Sbjct  504   VTPQILKPDVIGPGVNILAAWSGAVGPTGLEKDTRKTQFNIMSGTSMSCPHISGLAALLK  563

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P+WSP+AIKSALMTT+YT DN+   +L D      +TP A+GSGHVDP  A+ PGLV
Sbjct  564   AAHPNWSPSAIKSALMTTSYTHDNT-NSSLRDAAGGTYSTPWAHGSGHVDPEKALSPGLV  622

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YD   +DYV FLC++ Y   ++    +  P V C +R   +PG LNYPSFSVLF +  + 
Sbjct  623   YDISTDDYVAFLCSLDYTIDQVRAVAKR-PNVTC-SRKFADPGQLNYPSFSVLFGSK-RI  679

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQ  2218
             V Y R + NV    +V Y VTV  P  V VTV P +LVF    D  SY VTF   + + Q
Sbjct  680   VRYTRQLTNVGAAGSV-YAVTVMGPPAVEVTVKPPKLVFAKVGDRRSYTVTFVSKKGMNQ  738

Query  2219  SADS-FGSLRWSDGTHLVTSPIAVSW  2293
             +  S FGS+ WS+  + V SP+A +W
Sbjct  739   TVRSDFGSIVWSNAQNEVRSPVAYAW  764



>ref|XP_003549134.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/755 (46%), Positives = 478/755 (63%), Gaps = 40/755 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHT---LSPLSNHSRSSELLYTYEHVAHGFSARL  286
             K++++ M KS  P+ F  H +WYSS + +    SP ++      ++YTY++  HG +A+L
Sbjct  33    KTYLIQMDKSTMPKAFPNHLEWYSSKVKSALSTSPEADMDNEERIIYTYQNAFHGVAAKL  92

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSNLGPSSDYGADIIIGVLD  463
             T  +A +L    GV+++ PD   EL TTRSP FLGL  + S+N+      G D+I+GV+D
Sbjct  93    TEGEAKKLEAEEGVVAIFPDTKYELHTTRSPIFLGLEPAKSTNMWSEKLAGHDVIVGVVD  152

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPE  SF D G+ P+P  W+  CE+G  F  + CN+K++GAR +Y GYEA IG+   
Sbjct  153   TGIWPESESFKDVGMRPVPAHWKGACEIGTGFTKSHCNKKVVGARVFYHGYEAAIGRINE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+   GS V  AN+ G+A G ARG+A  ARIA YKVCW+G C 
Sbjct  213   QKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGTARGMAPGARIAAYKVCWVGGCF  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DI+S +D+AVADGV+VLS+SL      G    Y  D +++ AFGA+++GV VSC+AGN
Sbjct  273   SSDIVSAIDKAVADGVNVLSISLG-----GGVSSYYRDSLSVAAFGAMERGVFVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V LGN +  TG SLY G  V     Q P+V
Sbjct  328   AGPDPASLTNVSPWITTVGASTMDRDFPADVRLGNGKKVTGVSLYKGKNVLSIEKQYPLV  387

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y GS +S       C  G LD   V G+IV C++G     V KG  V  AGGVGMI+ N 
Sbjct  388   YMGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPR-VQKGNVVRSAGGVGMILTNT  446

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   +   +G+ ++ YV ++   TA + FKGT +G  PS P VAAF
Sbjct  447   EANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKSSTATLAFKGTRLGIKPS-PIVAAF  505

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPNFLT +ILKPD++APGVNILAAW+ ++            +FN++SGTSM+CPHVS
Sbjct  506   SSRGPNFLTLDILKPDLVAPGVNILAAWSEAIGPSGLKIDNRKVKFNIVSGTSMSCPHVS  565

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA++K  +P WSPAAIKSALMTTAY +DN+ + TL D  T +P++P+ +G+GH+DP  
Sbjct  566   GIAALVKSRHPEWSPAAIKSALMTTAYVLDNT-KKTLRDASTAKPSSPYDHGAGHIDPIR  624

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+DPGLVYD    DY +FLCT      ++ +F + S    CR+ +L +PG LNYP+ S +
Sbjct  625   ALDPGLVYDIVPQDYFEFLCTQNLTPTQLKVFAKYSNR-SCRH-SLASPGDLNYPAISSV  682

Query  2027  FKNNLQT-----VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
             F     T     VI  RTV NV    +  Y V V       + V P  L FT +   LSY
Sbjct  683   FTQKTPTSFPSPVIVHRTVTNVGP-PDSKYHVVVSPFKGASIKVEPETLNFTGKHQKLSY  741

Query  2192  EVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             ++TF+  +RQ++  FGS+ W DG H V SPI ++W
Sbjct  742   KITFKPKVRQTSPEFGSMEWKDGLHTVRSPIMITW  776



>emb|CDX99895.1| BnaC09g28100D [Brassica napus]
Length=775

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/753 (47%), Positives = 473/753 (63%), Gaps = 35/753 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLS-PLSNHSRSSELLYTYEHVAHGFSARL  286
             + K+++V M KS  P  ++ H  WYSS I +++ P S+    + +LYTY+   HG +ARL
Sbjct  29    QKKTYVVHMDKSAMPSPYTNHLQWYSSKIDSVTDPKSHEEEGNRILYTYQTAFHGLAARL  88

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             +  +A +L   PGV++V+P+   EL TTRSP+FLGL    S  +        D+I+GVLD
Sbjct  89    SKEEAEKLEKEPGVVAVIPETRYELHTTRSPKFLGLERQESERVWAERVTDHDVIVGVLD  148

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPE  SF+D G++P+P++WR  CE G  F  ++CNRKI+GAR +YRGYEA  GK   
Sbjct  149   TGIWPESESFNDTGMSPVPSTWRGACETGRGFLRSNCNRKIVGARVFYRGYEAATGKIDQ  208

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+G C 
Sbjct  209   ELEYRSPRDKDGHGTHTAATVAGSPVRGANLLGFAYGTARGMAPKARVAAYKVCWVGGCF  268

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DILS +DQAVADGVHV      S S  G    Y  D +AI  FGA++ GV VSC+AGN
Sbjct  269   SSDILSAVDQAVADGVHV-----LSISLGGGISTYSRDSLAIATFGAMEMGVFVSCSAGN  323

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V LG +R F G SLY G  V     Q P+V
Sbjct  324   GGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTTRVFKGVSLYKGRTVLSRAKQYPLV  383

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G   S      +C  G LD   V G+IV C++G  T  V KG  V +AGGVG+I+ N 
Sbjct  384   YLGRNASSPDPTSFCLDGALDQHNVAGKIVICDRG-VTPRVQKGQVVKRAGGVGIILTNT  442

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  +   +P   V   +G++I++Y  T+   TA +E  GT +G  PS P VAAF
Sbjct  443   ATNGEELVADCHLLPAVAVGEKEGKVIKEYAMTSKRATASLEILGTRVGIKPS-PVVAAF  501

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAW+G +             FN++SGTSM+CPHVS
Sbjct  502   SSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDKRRVNFNILSGTSMSCPHVS  561

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA+++  +P WSPAA+KSALMTTAY  DN     L D    +P++P+ +G+GH+DP  
Sbjct  562   GVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLE-PLTDAAGAEPSSPYDHGAGHIDPLK  620

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLG-NPGSLNYPSFSV  2023
             A+DPGLVYD G  +Y DFLCT      ++ +F ++S    CR+   G NPG+LNYP+ S 
Sbjct  621   AMDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNR-SCRHSLAGNNPGNLNYPAISA  679

Query  2024  LFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             LF  N  ++ +  +RTV NV      +Y+V++       VTV P  L FT +   LSY V
Sbjct  680   LFPENTHVKAMTLRRTVTNVGP-HVSSYKVSLSPFKGATVTVQPKTLNFTTKHQKLSYTV  738

Query  2198  TFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             TF++ LR     FG L W   TH V SP+ ++W
Sbjct  739   TFRTKLRMKRPEFGGLLWKSSTHKVRSPVIITW  771



>ref|XP_007155854.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
 gb|ESW27848.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
Length=794

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/750 (46%), Positives = 486/750 (65%), Gaps = 42/750 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV + KSE PQ F  H  WY S + ++S       S++++YTY++  HG++ RLT
Sbjct  64    ERATYIVHVAKSEMPQSFDHHAMWYESSLKSVS------NSAQMIYTYDNAIHGYATRLT  117

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L +  G+++VLP+   EL TTR+PQFLGL   S+++ P S+  +D+++GVLD+G
Sbjct  118   PEEARLLESQTGILAVLPEMRYELHTTRTPQFLGL-DKSADMFPESNSASDVVVGVLDTG  176

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D GL P+P+SW+ +CE G NF  ++CNRK+IGAR + +G EA +G PI   
Sbjct  177   VWPESKSFDDTGLGPVPSSWKGECETGTNFSTSNCNRKLIGARFFAKGCEAMLG-PINET  235

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH AS AAGS V+ A++ G+A G ARG+AT ARIA YKVCW G C +
Sbjct  236   EESRSPRDDDGHGTHTASTAAGSVVSGASLFGYASGTARGMATRARIAAYKVCWKGGCFS  295

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ ++ A+ D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN 
Sbjct  296   SDILAAIESAIQDNVNVLSLSLG-----GGMADYYRDSVAIGAFSAMEKGILVSCSAGNA  350

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP PY+  N+APWI TVGA T+DR+FPA V+LGN  +F+G SLY G       +P VY G
Sbjct  351   GPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGLNFSGVSLYRGNALPDSPLPFVYAG  410

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV G+IV C++G  T+ V KG  V  AG +GM++ N    G
Sbjct  411   NASNATNGNLCVTGTLSPEKVAGKIVLCDRG-LTARVQKGSVVKSAGALGMVLSNTAANG  469

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P + V    G+ I++Y+ T + PT  I F+GT +G  PS P VAAFS RG
Sbjct  470   EELVADAHLLPASAVGEKAGDAIKKYLFTEAKPTVSILFEGTKVGIQPS-PVVAAFSSRG  528

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP+ILKPD+IAPGVNILA W+ ++            +FN+ISGTSM+CPHVSGLAA
Sbjct  529   PNSITPQILKPDLIAPGVNILAGWSKAVGPTGLPVDNRRVDFNIISGTSMSCPHVSGLAA  588

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K ++P WSPAA++SALMTTAYTV  +G   L D  T +P+TP  +G+GHVDP  A++P
Sbjct  589   LIKSVHPEWSPAAVRSALMTTAYTVYKTG-AKLQDSATGKPSTPFDHGAGHVDPVTALNP  647

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD  V+DY+ FLC + Y + +I    +     +C      +   LNYPSF+VLF++ 
Sbjct  648   GLVYDLTVDDYLGFLCALNYSASEINTLAKRK--FECNAGKQYSVNDLNYPSFAVLFESG  705

Query  2039  LQT--VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
               +  V + RT+ NV         VT  T S V+++V P  +   +  +  S+ VTF S 
Sbjct  706   SGSGVVKHSRTLTNVGPAGTYKASVTSDTAS-VKISVDPQVVTLKEN-EKKSFVVTFSSS  763

Query  2213  RQSAD---SFGSLRWSDGTHLVTSPIAVSW  2293
               + D   +FG L WSDG H+V +PI+++W
Sbjct  764   ASAQDKVNAFGRLEWSDGKHVVATPISINW  793



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/757 (46%), Positives = 474/757 (63%), Gaps = 48/757 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ +++I+ M KS KP  F  H +WY S + ++S       S+++LYTY +V HGFS  L
Sbjct  31    QQKRTYIIHMDKSNKPATFDNHFNWYDSSLKSVS------DSADMLYTYNNVIHGFSTSL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L   PGV+SVL +   EL TTR+P+FLGL   S  L P+SD  +++I+GVLD+
Sbjct  85    TEKEAQFLKQQPGVLSVLQENRYELHTTRTPEFLGL-GRSDALFPASDKLSEVIVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             G+WPE  S+ D GL  +P+SW+ +CEVG NF ++SCN K+IGAR +  GYE   G PI  
Sbjct  144   GVWPESKSYDDAGLRRVPSSWKGECEVGKNFNSSSCNMKLIGARYFSAGYEEAFG-PIDE  202

Query  647   --EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH ++ AAGS V  A++ G A G ARG+AT AR+A YKVCWLG C 
Sbjct  203   KVESKSPRDDDGHGTHTSTTAAGSTVVEASLFGFASGTARGMATTARVATYKVCWLGGCF  262

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DIL+G+D+A+ DGV VLSLS+      G    Y  D +AIG F AV  G++VS +AGN
Sbjct  263   GSDILAGIDKAIDDGVDVLSLSIG-----GGLNDYYRDTVAIGTFAAVAHGIVVSVSAGN  317

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APW+ TVGA T+DR+FPA V+LGN + + G SLYSG   S   V +VYG
Sbjct  318   GGPGSGSLSNVAPWLTTVGAGTLDRDFPAYVSLGNGQKYKGVSLYSGKPLSEELVQIVYG  377

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
              +AN+      C PG LD++KV G++V C++G +     KG  V  AGGVGMI+ N  + 
Sbjct  378   RTANNSTNGNLCLPGSLDSAKVTGKLVVCDRGGNPR-AQKGQVVKDAGGVGMILSNTESY  436

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G +I+ Y+R+ + PTA I    T +G  PS P VAAFS R
Sbjct  437   GEELVADAHLLPAVTVGQRTGNLIKTYLRSDANPTATITQGSTQLGIQPS-PVVAAFSSR  495

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG               FN++SGTSM+CPHVSGLA
Sbjct  496   GPNPITPEILKPDLIAPGVNILAGWTGRAGPTGLDTDNRRVSFNIVSGTSMSCPHVSGLA  555

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY+    G+ T+ D+ T    TP  YG+GHVDP  A++
Sbjct  556   ALLKAAHPEWSPAAIRSALMTTAYSTYKGGK-TISDISTGSSATPFDYGAGHVDPVAALE  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYDA V DY+ F C + Y + +I    +      C +    + G  NYPSF+V  + 
Sbjct  615   PGLVYDATVQDYISFFCALNYSASQIKTVTKGD--YTCDHTKKYSLGDFNYPSFAVPLET  672

Query  2033  --------NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
                     +   TV Y RT+ NV +     Y+V++ +  +V+++V P  L F++  +  +
Sbjct  673   ASSSEGGADASSTVKYTRTLTNVGE--PATYKVSISSDPSVKISVQPESLSFSEAYEKKT  730

Query  2189  YEVTFQSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF +  Q     SF  L WSDG H V+SPIA SW
Sbjct  731   YTVTFTANSQPSGTTSFARLEWSDGKHAVSSPIAFSW  767



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/752 (47%), Positives = 481/752 (64%), Gaps = 43/752 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +E +++IV M KS+ P  F  H  WY S + ++S       S++++Y+Y+ V HGFSARL
Sbjct  35    QERRTYIVHMAKSQMPAAFQHHAHWYDSSLKSVS------GSAQMIYSYDTVVHGFSARL  88

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L    G+++V+P+   EL TTR+P+FLGL   SS+L P+S+   ++++GVLD+
Sbjct  89    TAEEAGSLEARHGILAVMPELRYELHTTRTPEFLGL-DKSSSLLPASESVNEVVVGVLDT  147

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIV  643
             G+WPE  SF D GL  +P+ WR  CE G NF A +CNRK+IGAR + +GYEA +G   + 
Sbjct  148   GVWPESKSFDDTGLGAVPSGWRGACESGTNFTAANCNRKLIGARFFSKGYEATMGPIDVS  207

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KSARD +GHGTH AS AAGSAV  A++ G+A G ARG+AT AR+A YKVCWLG C +
Sbjct  208   KESKSARDDDGHGTHTASTAAGSAVDGASLFGYAPGTARGMATRARVAAYKVCWLGGCFS  267

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ M++AV DGV+VLSLSL      G +  +  D +AIGAF A +KG+ VSC+AGN 
Sbjct  268   SDILAAMEKAVVDGVNVLSLSLG-----GGSPDFYRDSVAIGAFAAAEKGIFVSCSAGNA  322

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   +  N+APWI TVGA T+DR+FPA VTLGN ++F+G SLYSG     + +P VY G
Sbjct  323   GPSSMSLSNVAPWIATVGAGTLDRDFPAYVTLGNGKNFSGVSLYSGNSKGTL-LPFVYAG  381

Query  1184  ----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
                 + N   C  G LD +KV+G+IV C++G +   V KG  V  AGG GM++ N    G
Sbjct  382   NVSNATNGNLCMMGTLDPAKVKGKIVLCDRGVNAR-VQKGSVVQLAGGAGMVLANTAANG  440

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P   V    G+ I+ Y+ +   PTA I F+GT +G  PS P VAAFS RG
Sbjct  441   EELVADAHLLPATAVGEKSGDAIKSYLFSDPNPTATILFEGTKVGIQPS-PVVAAFSSRG  499

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP +LKPD+IAPGVNILA WTG +             FN+ISGTSM+CPHVSGLAA
Sbjct  500   PNSITPAVLKPDMIAPGVNILAGWTGGIGPTGLAVDDRRVAFNIISGTSMSCPHVSGLAA  559

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTTAY    +G G L D+ T + +TP  +G+GHVDP  A++P
Sbjct  560   LLKAAHPDWSPAAIRSALMTTAYVAYKNG-GKLQDVATGKDSTPFDHGAGHVDPVSALNP  618

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKN  2035
             GLVYD  V DY+ FLC + Y S +I    R +   D  ++ +L +   LNYPSF+  F +
Sbjct  619   GLVYDLTVEDYLGFLCGLNYTSSQINTLARRNYTCDPSKSYSLYD---LNYPSFAASFDS  675

Query  2036  NL---QTVIYKRTVKNVAKVRNVAYQVTVQTPS-NVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                   T+ Y RT+ NV       Y+ T  + S  +++ V P+ L F+   +  S+ VT 
Sbjct  676   TSGGPTTIKYTRTLTNVGAATGT-YKATASSGSAGLKIAVVPDTLSFSKAGEKKSFTVTV  734

Query  2204  --QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                ++  S ++FG L WSDG   V SP+A SW
Sbjct  735   TGSAMPASTNAFGQLEWSDGKQTVRSPMAFSW  766



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/755 (47%), Positives = 471/755 (62%), Gaps = 40/755 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+ +++IV M KS  P  ++ H +WY + + ++S  ++ ++   +LY Y+ V HGFSARL
Sbjct  23    EKRRTYIVHMAKSAMPAEYADHAEWYGASLRSVSASASAAK---MLYAYDTVLHGFSARL  79

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +AS+LA+  GV++V P+   EL TTR+P+FLG+      L P S    D+++GVLD+
Sbjct  80    TPQEASDLASAEGVLAVNPEARYELHTTRTPEFLGIAG--QGLSPQSGTAGDVVVGVLDT  137

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATS-CNRKIIGARAYYRGYEAEIGKPIV  643
             G+WPE  S+ D GL  +P  W+ +CE GP F A++ CNRK++GAR + +GYEA +G    
Sbjct  138   GVWPESKSYDDAGLAEVPAWWKGQCEAGPGFDASAACNRKLVGARFFSKGYEAAMGPMDT  197

Query  644   G-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S  D +GHGTH +S AAG+AV  A++ G A G ARG+A  AR+A YKVCWLG C 
Sbjct  198   DRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGTARGMAPRARVAAYKVCWLGGCF  257

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+GMD AVADG  VLSLSL      G A  Y  D +AIGAF A ++ V+VSC+AGN
Sbjct  258   SSDILAGMDAAVADGCGVLSLSLG-----GGAADYSRDSVAIGAFAATEQNVLVSCSAGN  312

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA T+DR+FPA V LG+ +++TG SLY+G       +P+VY 
Sbjct  313   AGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYTGVSLYAGKPLPSAPIPIVYA  372

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
              +A++      C PG L   KV G+IV C++G  ++ V KG+ V  AGG GM++ N    
Sbjct  373   ANASNSTAGNLCMPGTLVPEKVAGKIVVCDRG-VSARVQKGLVVRDAGGAGMVLSNTAAN  431

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P A V   +G  I+ YV +A  PTA +   GT +G  PS P VAAFS R
Sbjct  432   GQELVADAHLLPAAGVGETEGTAIKSYVASAPNPTATVVVAGTEVGVRPS-PVVAAFSSR  490

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA+WTG               FN+ISGTSM+CPHVSGLA
Sbjct  491   GPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRVGFNIISGTSMSCPHVSGLA  550

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+L+  +P WSPAA++SALMTTAY    SG  +L+D  T    TP  YG+GHVDP  A+D
Sbjct  551   ALLRSAHPEWSPAAVRSALMTTAY-ASYSGGSSLLDAATGGMATPFDYGAGHVDPARALD  609

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYD G  DYVDFLC + Y S  IA   R+       N+   + G+LNYPSFSV +  
Sbjct  610   PGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTY-SVGALNYPSFSVAYST  668

Query  2033  ------NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                    +  TV + RT+ NV          ++     V V V P  L FT   +  SY 
Sbjct  669   ANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYT  728

Query  2195  VTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2293
             V F S  Q + +  FG L WSDG H V SPIA +W
Sbjct  729   VRFTSKSQPSGTAGFGRLVWSDGKHSVASPIAFTW  763



>ref|XP_010240288.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=778

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/758 (47%), Positives = 479/758 (63%), Gaps = 45/758 (6%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE------LLYTYEHVAHGF  274
             PK++IV M  SE P  F  HH+WY+S + ++S     + + +      ++Y YE   HGF
Sbjct  31    PKTYIVQMAASEMPSSFDYHHEWYASTVKSVSSAQLEAEAGDDDAYTRIVYNYETAFHGF  90

Query  275   SARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL---ISGSSNLGPSSDYGADI  445
             +ARL   +A  +A   GV++VLP+ +++L TTRSP FLG+   IS S      +D+  D+
Sbjct  91    AARLDEDEAERMAEAAGVLAVLPETVLQLHTTRSPDFLGIGPEISNSIWAAGLADH--DV  148

Query  446   IIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE  625
             ++GVLD+GIWPE  SFSD+GL P+P  W+  C+ G  F    CNRKIIGAR +Y GYEA 
Sbjct  149   VVGVLDTGIWPESPSFSDKGLGPVPAKWKGLCQTGRGFTTKDCNRKIIGARIFYNGYEAS  208

Query  626   IGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKV  799
              G PI    E KS RD +GHGTH A+ AAGS+V +A + G+ARG ARG+A  AR+A YKV
Sbjct  209   SG-PINETTELKSPRDQDGHGTHTAATAAGSSVQDAGLFGYARGVARGMAPRARVAAYKV  267

Query  800   CWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVI  979
             CW G C ++DIL+ +D+AV+DGV VLS+SL      G A PY  D ++I +FGA+Q GV 
Sbjct  268   CWAGGCFSSDILAAVDRAVSDGVDVLSISLG-----GGASPYYRDSLSIASFGAMQMGVF  322

Query  980   VSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PS  1153
             ++C+AGN GPDP +  NL+PWI TVGAST+DR+FPA VTLGN  + TG SLY G Q    
Sbjct  323   IACSAGNAGPDPISLTNLSPWITTVGASTMDRDFPAKVTLGNGANITGVSLYKGRQNLSP  382

Query  1154  RIQVPVVYGGSANSF-----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGV  1318
             R Q PVVY G  +S       C  G L+   V G+IV C++G     V KG  V +AGG+
Sbjct  383   RQQYPVVYMGGNSSIPDPRSMCLEGTLEPRDVAGKIVICDRGISPR-VQKGQVVKEAGGI  441

Query  1319  GMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPS  1498
             GMI+ N    G +L  ++  +P   V  ++G   ++Y +TA  PTA + F GT +G  PS
Sbjct  442   GMILTNTAANGEELVADSHLLPAVAVGESEGTAAKKYSKTAPKPTATLSFAGTKLGIRPS  501

Query  1499  APRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTG-----SLTE------FNMISGTS  1645
              P VAAFS RGPN+LT EILKPD+IAPGVNILAAW+G     SL+       FN++SGTS
Sbjct  502   -PVVAAFSSRGPNYLTLEILKPDLIAPGVNILAAWSGDASPSSLSSDRRRVGFNILSGTS  560

Query  1646  MACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGS  1825
             M+CPHV+G+AA+LK  +P WSPA IKSALMTTAY  DN+    L D  T + +TP  +G+
Sbjct  561   MSCPHVAGVAALLKASHPDWSPAQIKSALMTTAYVHDNT-YSLLKDAATGKASTPFQHGA  619

Query  1826  GHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLN  2005
             GH+ P  A+ PGLVYD G  DY++FLCT      ++  F +NS +  C++ +L +PG LN
Sbjct  620   GHIHPLRALSPGLVYDIGQGDYLEFLCTQDLTPMQLKAFTKNSNMT-CKH-SLSSPGDLN  677

Query  2006  YPSFSVLFKNNLQT-VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDT  2182
             YP+ S +F +     +   RTV NV    +  Y V V       V V PN L F+     
Sbjct  678   YPAISAVFTDQPSVPLTVHRTVTNVGPPSST-YHVKVTKFKGADVVVEPNTLHFSSSNQK  736

Query  2183  LSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             L+Y+VT ++   Q    FG+L WSDG H+V SP+ ++W
Sbjct  737   LAYKVTLRTKAAQKTPEFGALSWSDGVHIVRSPLVLTW  774



>ref|XP_008792659.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/752 (48%), Positives = 472/752 (63%), Gaps = 39/752 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ +++IV M KS  P  F+ H  WY + + ++S       S E+LY+Y  VAHGFSA L
Sbjct  30    DKRRTYIVHMAKSRMPATFAEHGHWYDASVRSVS------DSVEILYSYNTVAHGFSAHL  83

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP++A+ L +  GV+SVL +   +L TTR+P+FLGL   S ++ P  +  +D+++GVLD+
Sbjct  84    TPAEAAALESRDGVLSVLQEVRYKLHTTRTPEFLGL-DKSDDIFPQGNTASDVVVGVLDT  142

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPER SF D G   +P+ W+  CE G +F  T+CNRK+IGAR + +GYEA  G PI  
Sbjct  143   GVWPERKSFDDTGFGAVPSWWKGACEEGKDFKGTACNRKLIGARFFSKGYEASAG-PIND  201

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD  GHGTH A+ AAGSAV + ++NG A G ARG+AT AR+A YKVCW G C 
Sbjct  202   TRESRSPRDNEGHGTHTATTAAGSAVTDVSLNGFAAGTARGMATRARVAAYKVCWAGGCF  261

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ MD+AV DG  VLSLSL      G  + Y +D++AIGAF A++KGV+ S +AGN
Sbjct  262   SSDILAAMDRAVEDGCQVLSLSLG-----GGMVDYYKDIVAIGAFNAMEKGVLTSFSAGN  316

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APW+ TVGA TIDR+FPA V LGN ++++G SLYSG       +P VY 
Sbjct  317   AGPFASSLSNVAPWMTTVGAGTIDRDFPAYVVLGNGKNYSGVSLYSGKPLPSSPLPFVYA  376

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C PG L   KV G+I+ C++G   + V KG  V +AGG GM++ N    
Sbjct  377   GNASNASNGNLCMPGTLMPKKVAGKIILCDRGI-IARVQKGYVVREAGGAGMVLANTDAN  435

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P A V    G+ +R Y+R+   PTA I F GT IG  PS P VAAFS R
Sbjct  436   GEELVADAHLLPAAGVGQKVGDAVRAYLRSDKSPTATIVFGGTKIGVRPS-PVVAAFSSR  494

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTG-----------SLTEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA WTG              EFN+ISGTSM+CPHVSGLA
Sbjct  495   GPNAVTPEILKPDLIAPGVNILAGWTGVAGPTGLSVDSRRVEFNIISGTSMSCPHVSGLA  554

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAA++SALMTTAY+    G G L+D+ T +   P  YG+GHVDP  A D
Sbjct  555   ALLKGAHPDWSPAAVRSALMTTAYSAYPGGDGGLLDVATGKAANPFDYGAGHVDPLRAAD  614

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD    DY+DFLC + Y S +IA   + +    C +        LNYPSF+V+F+ 
Sbjct  615   PGLVYDLTAEDYIDFLCALNYTSLQIAAVAKRTNYT-CDSTRTYAVSELNYPSFAVVFET  673

Query  2036  NLQTVIYKRTVKNVAKVRNVA----YQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
                T     TVK+   V NV     Y+ T      V+V V P  L F D+ +  S+ V+F
Sbjct  674   ASGTGGSVATVKHTRTVTNVGGPGTYKSTAVAGGAVKVVVEPVELSFADKGEKRSFTVSF  733

Query  2204  Q--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                SL      FG L WSDG H+V SP+A +W
Sbjct  734   SSPSLPSRWSGFGRLEWSDGKHVVASPMAFTW  765



>dbj|BAJ88205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/757 (47%), Positives = 477/757 (63%), Gaps = 40/757 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+  ++IV M KS  P  ++ H +WY + + ++S  +  + ++++LY Y+ V HGFSARL
Sbjct  27    EQRATYIVHMAKSAMPAEYADHGEWYGASLRSVS--AGGAPAAKMLYAYDTVLHGFSARL  84

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +AS++A + GV++V P+   EL TTR+P+FLGL +G+  L P S    D+++GVLD+
Sbjct  85    TEQEASDMAGMEGVLAVNPETRYELHTTRTPEFLGL-AGNEGLFPQSGTAGDVVVGVLDT  143

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG-KPIV  643
             G+WPE  S+ D GL  +P+SW+  C  G +F +++CNRK+IGAR + RGYEA +G     
Sbjct  144   GVWPESKSYDDAGLGEVPSSWKGTCMAGADFNSSACNRKLIGARFFNRGYEAAMGPMDTS  203

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAG+AVA+A++ G A G ARG+A  AR+AVYKVCWLG C +
Sbjct  204   RESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGTARGMAPKARVAVYKVCWLGGCFS  263

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+GMD AVADG  VLSLSL      G +  Y  D +AIGAF A+++ V+VSC+AGN 
Sbjct  264   SDILAGMDAAVADGCGVLSLSLG-----GGSADYARDSVAIGAFAAMEQNVLVSCSAGNA  318

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   T  N+APWI TVGA T+DR+FPA V LGN +++TG SLY+G  P     P++Y G
Sbjct  319   GPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYTGVSLYAGKAPPTTPTPLIYAG  378

Query  1184  SANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C PG L   KV+G+IV C++G  ++ V KG  V  AGG GM++ N    G
Sbjct  379   NASNSTSGNLCMPGTLSPEKVQGKIVVCDRG-ISARVQKGFVVRDAGGAGMVLANTAANG  437

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P A V   +G  I+ Y+ +A+ PTA I   GT +   PS P VAAFS RG
Sbjct  438   QELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIAGTQVNVRPS-PLVAAFSSRG  496

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPEILKPD+I PGVNILAAWTG               FN+ISGTSM+CPHVSGLAA
Sbjct  497   PNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRVSFNIISGTSMSCPHVSGLAA  556

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGT-LIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             +L+  +P WSPAA++SALMTTAY+    G G+ ++D  T    TP  YG+GHVDPT AV+
Sbjct  557   LLRSAHPEWSPAAVRSALMTTAYSTYTGGAGSPILDAATGAAATPFDYGAGHVDPTRAVE  616

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYD G  DYVDFLC + Y    IA   R S    C      +  +LNYPSFSV +  
Sbjct  617   PGLVYDLGTGDYVDFLCALKYTPNMIAALAR-SKAYGCAANKTYSVSNLNYPSFSVAYST  675

Query  2033  -------NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
                    +   TV + RT+ NV          +V   S V V V P  L FT   +  SY
Sbjct  676   ANGEAGDSGATTVTHTRTLTNVGAAGTYKVDASVSM-SGVTVDVKPTELEFTAIGEKKSY  734

Query  2192  EVTFQSLRQS---ADSFGSLRWSDGTHLVTSPIAVSW  2293
              V+F + +        FG L WS G H V SPIA++W
Sbjct  735   TVSFTAAKSQPSGTAGFGRLVWSGGKHTVASPIALTW  771



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/751 (47%), Positives = 475/751 (63%), Gaps = 47/751 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M   +KP  ++TH DWY+  + +L+  +  S    LLYTY+   HG++A L P 
Sbjct  27    KTYIVHMKHHQKPASYATHSDWYTDHLQSLTSGAGDS----LLYTYDVAYHGYAAALIPE  82

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYG--------ADIII  451
             +   L     V+ V  D +  L TTR+P+FLGL SG   LGP + +          D+II
Sbjct  83    EVESLRQSESVVGVYEDTIYSLHTTRTPEFLGLDSG---LGPWAGHSLQELNQASQDVII  139

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNF-PATSCNRKIIGARAYYRGYEAEI  628
             GVLD+G+WPE  SF D  +  +P  WR +CE   +F P   CN+K+IGAR + RGY    
Sbjct  140   GVLDTGVWPESKSFIDADMPDVPARWRGECEAAHDFNPKIHCNKKLIGARFFSRGYSVAS  199

Query  629   GKPIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             G+    E  S RD +GHGTH AS AAGS V NA++ G+ARG ARG+AT+AR+A Y+VCW 
Sbjct  200   GEK---EAHSPRDTDGHGTHTASTAAGSQVVNASLLGYARGTARGMATHARLATYRVCWK  256

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C  +DIL+ M++A+ DGV VLS+SL      G + PY  D IAIGAF A++KG++VSC
Sbjct  257   TGCLGSDILAAMERAILDGVDVLSMSLG-----GGSAPYFRDTIAIGAFAAMEKGILVSC  311

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP   +  N+APWI+TVGA TIDR+FPA   LGN + +TG SLYSG    R  V 
Sbjct  312   SAGNSGPTKESLANVAPWIMTVGAGTIDRDFPAFAILGNGKKYTGVSLYSGKGIGRRMVE  371

Query  1169  VVY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             +VY  G +++S  C  G LD + VRG++V C++G     V+KG  V +AGGVGMI+ N  
Sbjct  372   LVYNKGSNSSSNMCLAGSLDPATVRGKVVVCDRGISPR-VEKGAVVREAGGVGMILANTA  430

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G +L  ++  +P   V    G++IRQYV+TA  PT  + F GTV+   PS P VAAFS
Sbjct  431   ASGEELVADSHLLPAVAVGRKAGDMIRQYVKTAKNPTVMMGFAGTVVNVKPS-PVVAAFS  489

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN +TP+ILKPDVI PGVNILAAW+ +L           T+FN++SGTSM+CPH+SG
Sbjct  490   SRGPNMVTPQILKPDVIGPGVNILAAWSRALGPSGLDKDTRKTQFNIMSGTSMSCPHISG  549

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             LAA+LK  +P+WSP+AIKSALMTTAYT+DN+    L D      +TP A+G+GHV+P  A
Sbjct  550   LAALLKAAHPNWSPSAIKSALMTTAYTLDNA-NSPLRDAADYSLSTPWAHGAGHVNPHKA  608

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             + PGLVYDA   DYV FLC++ Y    I    +  P + C  R   +PG LNYPSFSVLF
Sbjct  609   LSPGLVYDATPEDYVAFLCSLRYTVEMIQAIAKR-PNITCA-RKFRDPGQLNYPSFSVLF  666

Query  2030  KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--  2203
               + + V Y R + NV    +V Y V+V+ P  V V+V P++LVF +  D   Y VTF  
Sbjct  667   GKS-RIVKYSRELTNVGAAGSV-YLVSVEAPPTVAVSVKPSKLVFKNVGDKQRYTVTFTS  724

Query  2204  -QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              +S+   + +FGS+ W +    V SP+A SW
Sbjct  725   KKSVNPVSHAFGSITWKNAQDQVKSPVAFSW  755



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/749 (47%), Positives = 475/749 (63%), Gaps = 41/749 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  +  H  WY S + ++S       S++LLYTY +  HGFS RLT
Sbjct  31    QQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVS------ESAQLLYTYNNAIHGFSTRLT  84

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLIS-GSSNLGPSSDYGADIIIGVLDS  466
             P +A  L   PGVISVLP+   EL TTRSP FLGL    +++L P +   +D+++GVLD+
Sbjct  85    PEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASSDVVVGVLDT  144

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SFSD G  P+P++W+  CE G NF A+ CNRK+IGAR + RGYEA +G P+  
Sbjct  145   GVWPESKSFSDNGFGPVPSTWKGGCEAGTNFTASLCNRKLIGARFFARGYEATMG-PVDE  203

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAGS V  A++ G A G ARG+   AR+AVYKVCWLG C 
Sbjct  204   SKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGTARGMDPRARVAVYKVCWLGGCF  263

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ +DQA+ D V+VLS+SL      G    Y  D +AIGAF A+++G+ VSC+AGN
Sbjct  264   SSDILAAIDQAIEDNVNVLSMSLG-----GGMSDYYRDGVAIGAFAAMERGIFVSCSAGN  318

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PY+  N+APWI TVGA T+DR+FPA+  LGN ++++G SL+ G       +P +Y 
Sbjct  319   AGPSPYSLSNVAPWITTVGAGTLDRDFPAIAILGNGKNYSGVSLFKGDALPDKLLPFIYA  378

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    
Sbjct  379   GNASNATNGNLCMTGSLIPEKVKGKIVMCDRGVNAR-VQKGDVVKAAGGVGMILANTAAN  437

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+IIR+YV T   PTA +  +GTV+   PS P VAAFS R
Sbjct  438   GEELVADAHMLPATTVGEKAGDIIRRYVLTDPNPTASVLIQGTVVNVQPS-PVVAAFSSR  496

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP ILKPD+IAPGVNILAAWTG+              FN+ISGTSM+CPHVSGLA
Sbjct  497   GPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRVGFNIISGTSMSCPHVSGLA  556

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY     G+  ++D+ T +P+T   +G+G+V PT A +
Sbjct  557   ALLKSAHPEWSPAAIRSALMTTAYRSYKDGK-PILDIATGKPSTAFDHGAGYVSPTIATN  615

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V    
Sbjct  616   PGLVYDLTTVDYLGFLCALNYTSSQIRSVSRRN--FTCDPSKTHSVADLNYPSFAVNVDG  673

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTF--Q  2206
             +     Y RTV +V      +Y+V V + S  V+++V+P  L F +  +  SY VTF   
Sbjct  674   S-GAYKYTRTVTSVGGAG--SYKVKVISESTAVKISVAPAVLNFKEVNEKKSYTVTFTVD  730

Query  2207  SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             S + S  SFG++ WSDG H+V SP+A++W
Sbjct  731   SSKASGSSFGNIEWSDGKHVVGSPVAITW  759



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/749 (47%), Positives = 475/749 (63%), Gaps = 41/749 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  +  H  WY S + ++S       S++LLYTY +  HGFS RLT
Sbjct  31    QQSTYIVHMAKSQMPSSYDLHSLWYDSSLRSVS------ESAQLLYTYNNAIHGFSTRLT  84

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLIS-GSSNLGPSSDYGADIIIGVLDS  466
             P +A  L   PGVISVLP+   EL TTRSP FLGL    +++L P +   +D+++GVLD+
Sbjct  85    PEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASSDVVVGVLDT  144

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             G+WPE  SFSD G  P+P++W+  CE G NF A+ CNRK+IGAR + RGYEA +G P+  
Sbjct  145   GVWPESKSFSDNGFGPVPSTWKGGCEAGTNFTASLCNRKLIGARFFARGYEATMG-PVDE  203

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAGS V  A++ G A G ARG+   AR+AVYKVCWLG C 
Sbjct  204   SKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGTARGMDPRARVAVYKVCWLGGCF  263

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+ +DQA+ D V+VLS+SL      G    Y  D +AIGAF A+++G+ VSC+AGN
Sbjct  264   SSDILAAIDQAIEDNVNVLSMSLG-----GGMSDYYRDGVAIGAFAAMERGIFVSCSAGN  318

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP PY+  N+APWI TVGA T+DR+FPA+  LGN ++++G SL+ G       +P +Y 
Sbjct  319   AGPSPYSLSNVAPWITTVGAGTLDRDFPAIAILGNGKNYSGVSLFKGDALPDKLLPFIYA  378

Query  1181  GSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G+A    N   C  G L   KV+G+IV C++G +   V KG  V  AGGVGMI+ N    
Sbjct  379   GNASNATNGNLCMTGSLIPEKVKGKIVMCDRGVNAR-VQKGDVVKAAGGVGMILANTAAN  437

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+IIR+YV T   PTA +  +GTV+   PS P VAAFS R
Sbjct  438   GEELVADAHMLPATTVGEKAGDIIRRYVLTDPNPTASVLIQGTVVNVQPS-PVVAAFSSR  496

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP ILKPD+IAPGVNILAAWTG+              FN+ISGTSM+CPHVSGLA
Sbjct  497   GPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRVGFNIISGTSMSCPHVSGLA  556

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAI+SALMTTAY     G+  ++D+ T +P+T   +G+G+V PT A +
Sbjct  557   ALLKSAHPEWSPAAIRSALMTTAYRSYKDGK-PILDIATGKPSTAFDHGAGYVSPTIATN  615

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD    DY+ FLC + Y S +I    R +    C      +   LNYPSF+V    
Sbjct  616   PGLVYDLTTVDYLGFLCALNYTSSQIRSVSRRN--FTCDPSKTHSVADLNYPSFAVNVDG  673

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTF--Q  2206
             +     Y RTV +V      +Y+V V + S  V+++V+P  L F +  +  SY VTF   
Sbjct  674   S-GAYKYTRTVTSVGGAG--SYKVKVISESTAVKISVAPAVLNFKEVNEKKSYTVTFTVD  730

Query  2207  SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             S + S  SFG++ WSDG H+V SP+A++W
Sbjct  731   SSKASGSSFGNIEWSDGKHVVGSPVAITW  759



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/756 (47%), Positives = 469/756 (62%), Gaps = 45/756 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + K++I+ M K   P  F  H  WY S + ++S      +S+ +LYTY  V HG+S +LT
Sbjct  27    QKKTYIIHMDKFNMPADFDDHTQWYDSSLKSVS------KSANVLYTYNSVIHGYSTQLT  80

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS-NLGPSSDYGADIIIGVLDS  466
               +A  L   PG++SV  + + EL TTRSP FLGL    S +  P ++  +++IIGVLD+
Sbjct  81    ADEAKALEQQPGILSVHEEVIYELHTTRSPTFLGLEGHESRSFFPQTEARSEVIIGVLDT  140

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIV  643
             G+WPE  SF D GL P+P SW+ KC+ G NF A+SCNRK+IGAR + +GYEA  G     
Sbjct  141   GVWPESKSFDDTGLGPVPASWKGKCQTGKNFDASSCNRKLIGARFFSQGYEAAFGAIDET  200

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD  GHGTH A+ AAGS V  A++ G+A G ARG+A++AR+A YKVCW G C +
Sbjct  201   IESKSPRDDEGHGTHTATTAAGSVVTGASLLGYATGTARGMASHARVAAYKVCWTGGCFS  260

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+GMDQAV DGV+VLSLSL      G    Y  D++AIGAF A  +G+ VSC+AGN 
Sbjct  261   SDILAGMDQAVIDGVNVLSLSLG-----GTISDYHRDIVAIGAFSAASQGIFVSCSAGNG  315

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   T  N+APWI TVGA T+DREFPA + +GN     G SLYSG       +P+VY G
Sbjct  316   GPSSGTLSNVAPWITTVGAGTMDREFPAYIGIGNGEKLNGVSLYSGKALLSSVMPLVYAG  375

Query  1184  ----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
                 S+N   C  G L   KV G+IV C++G +     KG+ V  AGG+GMI+ N    G
Sbjct  376   NVSQSSNGNLCTSGSLIPEKVAGKIVVCDRGMNAR-AQKGLVVKDAGGIGMILANTDTYG  434

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  IPTA V    G +I+QY+ + S PTA I F GT +G  PS P VAAFS RG
Sbjct  435   DELVADAHLIPTAAVGQTAGNLIKQYIASNSNPTATIAFGGTKLGVQPS-PVVAAFSSRG  493

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGS-----LTE------FNMISGTSMACPHVSGLAA  1678
             PN +TP+ILKPD+IAPGVNILA WTG      L E      FN+ISGTSM+CPHVSGLAA
Sbjct  494   PNPITPDILKPDLIAPGVNILAGWTGKVGPTGLQEDTRNVGFNIISGTSMSCPHVSGLAA  553

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTT+Y+   +G+ T+ D+ T   +TP  YG+GHV+PT AV+P
Sbjct  554   LLKAAHPEWSPAAIRSALMTTSYSTYKNGK-TIEDVATGMSSTPFDYGAGHVNPTAAVNP  612

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK--  2032
             GLVYD  V+DY++FLC + Y    I +  +    + C          LNYPSFS+  +  
Sbjct  613   GLVYDLTVDDYINFLCALDYSPSMIKVIAKRD--ISCDKNKEYRVADLNYPSFSIPMETA  670

Query  2033  ------NNLQTVI-YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
                   ++  TV  Y RT+ NV         V+ +T   V++ V P  L F+ + +  +Y
Sbjct  671   WGEHADSSTPTVTRYTRTLTNVGNPATYKASVSSET-QEVKILVEPQTLTFSRKNEKKTY  729

Query  2192  EVTFQSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
              VTF +  +     SF  L WSDG H+V SPIA SW
Sbjct  730   TVTFTASSKPSGTTSFARLEWSDGQHVVASPIAFSW  765



>ref|NP_001050634.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|AAR87229.1| putaive subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|AAT78773.1| putative serine protease [Oryza sativa Japonica Group]
 gb|ABF97524.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12548.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|EAZ27735.1| hypothetical protein OsJ_11683 [Oryza sativa Japonica Group]
Length=765

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/762 (47%), Positives = 472/762 (62%), Gaps = 51/762 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
             EE  ++IV M KS  P  +   H +WY + + ++S       + ++LY Y+ V HGFSAR
Sbjct  21    EERATYIVHMAKSAMPAEYGDDHGEWYGASLRSVS------GAGKMLYAYDTVLHGFSAR  74

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LT  +A ++A + GV++V P+   EL TTR+P+FLG I+G+  L P S    D+++GVLD
Sbjct  75    LTAREARDMAAMDGVLAVNPEARYELHTTRTPEFLG-IAGNDGLFPQSGTAGDVVVGVLD  133

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG-KPI  640
             +G+WPE  S+ D GL  +P+ W+ +C  G  F +++CNRK++GAR + RGYEA +G    
Sbjct  134   TGVWPESRSYDDAGLGEVPSWWKGECMAGTGFNSSACNRKLVGARFFNRGYEAAMGPMDT  193

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S RD +GHGTH +S AAG+AV+ A++ G A G ARG+A  AR+AVYKVCWLG C 
Sbjct  194   TRESRSPRDDDGHGTHTSSTAAGAAVSGASLLGFASGTARGMAPRARVAVYKVCWLGGCF  253

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+GMD AVADG  VLSLSL      G A  Y  D +AIGAF A+++ V+VSC+AGN
Sbjct  254   SSDILAGMDAAVADGCGVLSLSLG-----GGAADYARDSVAIGAFAAMEQNVLVSCSAGN  308

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA T+DR+FPA V+LGN +++TG SLY+G       +P+VY 
Sbjct  309   AGPGTSTLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNYTGVSLYAGKALPSTPLPIVYA  368

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
              +A++      C PG L   KV G+IV C++G  ++ V KG  V  AGG GM++ N    
Sbjct  369   ANASNSTAGNLCMPGTLTPEKVAGKIVVCDRG-VSARVQKGFVVRDAGGAGMVLSNTATN  427

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P A V   +G  I+ YV +   PTA I   GT +   PS P VAAFS R
Sbjct  428   GEELVADAHLLPAAGVGAKEGAAIKAYVASDPSPTATIVVAGTQVDVRPS-PVVAAFSSR  486

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTPEILKPD+IAPGVNILAAWTG               FN+ISGTSM+CPHVSGLA
Sbjct  487   GPNMLTPEILKPDIIAPGVNILAAWTGKAGPTGIAADTRRVAFNIISGTSMSCPHVSGLA  546

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGT---LIDLYTRQPTTPHAYGSGHVDPTH  1846
             A+L+  +P WSPAA++SALMTTAY+   +G G    L+D  T  P TP  YG+GHVDP  
Sbjct  547   ALLRSAHPEWSPAAVRSALMTTAYST-YAGAGDANPLLDAATGAPATPFDYGAGHVDPAS  605

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             AVDPGLVYD G  DYVDFLC + Y S  IA   R S    C      +  +LNYPSF+V 
Sbjct  606   AVDPGLVYDLGTADYVDFLCALNYTSTMIAAVAR-SKSYGCTEGKAYSVYNLNYPSFAVA  664

Query  2027  FKN-----------NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2173
             +                TV ++RT+ NV       Y+V+      V V V P  L FT  
Sbjct  665   YSTASSQAAESSGAAATTVTHRRTLTNVGAAGT--YKVSAAAMPGVAVAVEPTELAFTSA  722

Query  2174  IDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2293
              +  SY V+F +  Q + +  FG L WSDG H V SP+A +W
Sbjct  723   GEKKSYTVSFTAKSQPSGTAGFGRLVWSDGKHSVASPMAFTW  764



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/756 (47%), Positives = 476/756 (63%), Gaps = 42/756 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTL--SPL------SNHSRSSELLYTYEHVAHG  271
             +++I+ M KSE PQ+F+    WY+S I ++  SP            +  ++Y+YE+  HG
Sbjct  66    RTYIIHMAKSEMPQIFTHRLQWYASTIKSVTSSPKLEAVAEEEEDPAERIIYSYENAFHG  125

Query  272   FSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIII  451
             F+A+LT  +A +L ++PGV +VLP+ +  L TTRSP+FLG+   S+++  ++    D+I+
Sbjct  126   FAAKLTEDEAEKLESIPGVATVLPETIYRLHTTRSPEFLGITGESNSMWSAALSDHDVIV  185

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             G+LD+GIWPE  SFSD G+  +P  WR  CE G  F A +CN+K++GAR +YRGYEA  G
Sbjct  186   GILDTGIWPESPSFSDGGMTAVPPRWRGACETGRGFTAKNCNQKLVGARIFYRGYEASSG  245

Query  632   K-PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
                   E KS RD +GHGTH A+  AG+ V  AN+ G+ARG ARG+A  AR+AVYKVCW 
Sbjct  246   AIDERSEFKSPRDQDGHGTHTAATVAGAPVRGANLLGYARGTARGMAPRARVAVYKVCWT  305

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
             G C ++DIL+ +D+AVADGV V      S S  G    Y  D +++ AFGA++ GV V+C
Sbjct  306   GGCFSSDILAAVDRAVADGVDV-----LSISLGGGISTYYRDSLSVAAFGAMEMGVFVAC  360

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG---VQPSRI  1159
             +AGN GP+P +  N++PWI TVGAST+DR+FPA V LGN  + TG SLY G   + P R 
Sbjct  361   SAGNGGPEPISLTNVSPWIATVGASTMDRDFPAPVRLGNGMNLTGVSLYKGRRNLSPRR-  419

Query  1160  QVPVVYGGSANSF-----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGM  1324
             Q P+VY G   S       C  G LD   V G+IV C++G     V KG  V  AGG+GM
Sbjct  420   QYPLVYMGGNTSIPDPRSLCLEGTLDPHVVAGKIVVCDRGISPR-VQKGQVVKDAGGLGM  478

Query  1325  IVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAP  1504
             I+ N    G +L  ++  +P   V  A G+ I+QY    S PTA + F+GT +G  PS P
Sbjct  479   ILANTDANGEELVADSHLLPAVAVGEAAGKAIKQYSNVGSHPTATMTFEGTKVGIRPS-P  537

Query  1505  RVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMA  1651
              VAAFS RGPN LT EILKPDV+APGVNILAAW+G  +            FN++SGTSM+
Sbjct  538   VVAAFSSRGPNILTLEILKPDVVAPGVNILAAWSGDASPSSLLADHRRVRFNILSGTSMS  597

Query  1652  CPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGH  1831
             CPHV G+AA+LK  +P WSP+AIKSALMTTAYT DN+ R  L D  T  P+TP+ +G+GH
Sbjct  598   CPHVGGVAALLKASHPDWSPSAIKSALMTTAYTHDNTFR-PLKDAATGAPSTPYDHGAGH  656

Query  1832  VDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYP  2011
             + P  AVDPGL+YD   +DY +FLCT      ++ +F ++S    C++R L +PG LNYP
Sbjct  657   IRPAKAVDPGLIYDISPDDYFEFLCTQKLTPLQLKVFSKSSNRT-CKHR-LASPGDLNYP  714

Query  2012  SFSVLFKNN-LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
             + S +F+      +   RTV NV    +  Y V V     V V V P  L FT +   LS
Sbjct  715   AISAVFREQPAPALTLHRTVTNVGPPVST-YHVRVTPFRGVDVAVEPKTLHFTHQNQKLS  773

Query  2189  YEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y+VTF++   Q    FG+L WSDG HLV SP+AV+W
Sbjct  774   YKVTFRTKSPQPMPGFGALIWSDGIHLVRSPVAVTW  809



>ref|XP_004954113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=776

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/736 (48%), Positives = 480/736 (65%), Gaps = 31/736 (4%)
 Frame = +2

Query  140   KSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANV  319
             +S +P++ S+    Y S +    P     R   LLY+Y H A GF+ARLT  QA+ LA+ 
Sbjct  45    RSSRPRVLSSA---YRSFLRGHLPAGPAPR---LLYSYAHAATGFAARLTERQAAHLASQ  98

Query  320   PGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP-ERSSFS  496
               V++V+PD   +L TT +P FLGL S SS L P+S    D++IG++D+G++P +R+SF+
Sbjct  99    DSVLAVVPDATHQLHTTLTPSFLGL-SASSGLLPASGGATDVVIGIIDTGVYPKDRASFA  157

Query  497   -DRGLNPIPNSWRNKCEVGPNFPATS-CNRKIIGARAYYRGYEAEIGKPIV-GEPKSARD  667
              D  L P P+++R +C   P F A++ CN K++GA+ +  GYEA  G  I   E +S  D
Sbjct  158   ADPSLPPPPSTFRGRCVSTPAFNASAYCNNKLVGAKFFNLGYEAAHGGVIEETESRSPLD  217

Query  668   VNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMD  847
              NGHGTH +S AAGSAVA+A    +A+G+A G+A  ARIA YK CW   C+ +DIL   D
Sbjct  218   TNGHGTHTSSTAAGSAVADAAFFDYAKGKAVGMAPGARIAAYKACWTRGCTYSDILMAFD  277

Query  848   QAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPYTAV  1027
             +A+ DGV+V+S+SL +    G A  +  D  A+GAF AV+KG++VS +AGN GP  +TAV
Sbjct  278   EAIKDGVNVISVSLGAV---GRAPQFYSDTTAVGAFSAVRKGIVVSASAGNAGPGEFTAV  334

Query  1028  NLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANSFYCF  1207
             N+APWILTVGASTI+R+FPA + LGN  +FTGTSLY+G+     ++ +VYGG   S  C 
Sbjct  335   NVAPWILTVGASTINRQFPANIVLGNGETFTGTSLYAGMPLGPSKIALVYGGDVGSSVCE  394

Query  1208  PGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADRIPT  1387
              G+L+ S V G+IV C+ G +     KG AV  A G G I+ +    G Q    A  +P 
Sbjct  395   SGKLNTSTVAGKIVVCDPGVNGRAA-KGEAVKLARGAGAILVSSKAFGEQALATAHVLPA  453

Query  1388  AVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEILKPD  1567
               VT A  E I+ Y+RT + P A I F+GTVIG +PS+PR+A+FS RGPNF+ PEI KPD
Sbjct  454   TAVTFAAAEKIKNYIRTNASPVATIVFQGTVIGRTPSSPRMASFSSRGPNFIAPEIFKPD  513

Query  1568  VIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSGLAAMLKKIYPSWSPA  1714
             V APGV+ILAAWTG              +FN+ISGTSM+CPHVSG+AA+L++ +P WSPA
Sbjct  514   VTAPGVDILAAWTGENSPSELDSDTRRVKFNIISGTSMSCPHVSGIAALLRQAHPEWSPA  573

Query  1715  AIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYV  1894
             AIKSALMTTAY VDN+G   + D+ T + +TP   G+GHVDP  AVDPGLVYDAG +DY+
Sbjct  574   AIKSALMTTAYNVDNAGD-IIKDMSTGEASTPFVRGAGHVDPNCAVDPGLVYDAGTDDYI  632

Query  1895  DFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIYKRTVKN  2074
              FLC +GY +++IA+  R+  + DC  R+ G+ G  NYP+FSV+F +    V  +R V+N
Sbjct  633   SFLCALGYTAKQIAVLTRDGSVTDCSKRS-GSVGDHNYPAFSVVFSSGDGKVTQRRVVRN  691

Query  2075  VAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD---SFGSLR  2245
             V       Y  +V +P+ VRVTV P  L F+    T  Y +TF + + S     +FGS+ 
Sbjct  692   VGSNAMATYTASVTSPAGVRVTVEPPTLQFSATQKTQEYAITFAAQQGSVTEKYTFGSIV  751

Query  2246  WSDGTHLVTSPIAVSW  2293
             WSDG H VTSPIA++W
Sbjct  752   WSDGKHKVTSPIAITW  767



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/714 (47%), Positives = 461/714 (65%), Gaps = 27/714 (4%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +S+IV+M KS KP+ FS H  WY+S+I  +S   ++S  + +LYTY+ V HGF+A+LT +
Sbjct  43    QSYIVYMDKSMKPEHFSLHQHWYTSLIDEVS--GSNSDPAAMLYTYDTVTHGFAAKLTST  100

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A  + N  G ++V PD +  L TTR+P FLGL S S  L P S Y  DII+GVLD+GIW
Sbjct  101   EAQAMENTDGCLAVFPDSVYRLHTTRTPDFLGL-SSSHGLWPLSHYADDIIVGVLDTGIW  159

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGEP-  652
             PE  SFSD+GL  +P  W+ +CE+G  F A+ CN K+IGAR + +GYEA+ G     E  
Sbjct  160   PESKSFSDQGLTQVPARWKGECEMGTEFNASHCNNKLIGARFFLKGYEAKYGHVDEMENY  219

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD  GHGTH +S AAG+ V  +++ G A G ARGIAT AR+AVYKVCW   C ++D+
Sbjct  220   RSPRDEGGHGTHTSSTAAGAEVPGSSLLGFAAGTARGIATKARLAVYKVCWPEECLSSDL  279

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+GM+ A++DGV +LSLS++        LPY +D IAIGA GA++KGV VSCAAGN GP 
Sbjct  280   LAGMEAAISDGVDLLSLSISDNRN----LPYYKDAIAIGALGAIEKGVFVSCAAGNAGPI  335

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
             P    N APWI TVGASTIDREFPA V LGN +++ G+SLY G      Q+P++YG SA+
Sbjct  336   PSKIFNTAPWITTVGASTIDREFPAPVVLGNGKNYRGSSLYKGKTLGNGQLPLIYGKSAS  395

Query  1193  S----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             S     +C PG LD+++V G+IV C+ G      + G+ V QAGG GMI  N   +G  L
Sbjct  396   SNETAKFCLPGSLDSNRVSGKIVLCDLGGGEGTAEMGLVVRQAGGAGMIQANRLVDGEDL  455

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +   +P   V    G  I+ Y+     PTA I+ +G  +     AP VA+FS RGPN 
Sbjct  456   WTDCHFLPATKVDFKSGIEIKAYINRTKNPTATIKAEGATVVGKTRAPVVASFSSRGPNP  515

Query  1541  LTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAMLK  1687
             L PEILKPD+IAPGVN+LAAW+G ++           ++N+ISGTSMACPHV+G+AA++ 
Sbjct  516   LVPEILKPDLIAPGVNVLAAWSGHVSPTGLTSDKRRVDYNIISGTSMACPHVTGIAALIL  575

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
              ++ +W+PAAIKSALMT++   D+S R  + +  T  P    A G+GHV+P+ A+DPGLV
Sbjct  576   AVHSAWTPAAIKSALMTSSVPFDHSKR-LISESVTALPADAFAIGAGHVNPSAALDPGLV  634

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT  2047
             YDA  +DYV FLC++ Y   +I +  R +    C   +   PG LNYPSFSV+FK     
Sbjct  635   YDADFDDYVSFLCSLNYTRSQIHILTRKAS--SCTRIHSQQPGDLNYPSFSVVFKPLNLV  692

Query  2048  VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS  2209
                +RTV NV     V Y+V++++P  V + V P  LVF ++ +  SY V F+S
Sbjct  693   RALRRTVTNVGGAPCV-YEVSMESPPGVNIIVEPRTLVFKEQNEKASYTVRFES  745



>gb|KHN45156.1| Subtilisin-like protease [Glycine soja]
Length=722

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/742 (48%), Positives = 471/742 (63%), Gaps = 50/742 (7%)
 Frame = +2

Query  152   PQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVI  331
             P+ F+ H  WY S + ++S       S+E LYTY+ VAHGFS RLT  +A  L+  PGV+
Sbjct  2     PESFNDHLHWYDSSLKSVS------DSAERLYTYKKVAHGFSTRLTTQEAELLSKQPGVL  55

Query  332   SVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLN  511
             SV+P+   EL TTR+P+FLGL +  + L  +S   +D+I+GVLD+G+WPE  SF D GL 
Sbjct  56    SVIPEVRYELHTTRTPEFLGL-AKYTTLSLASGKQSDVIVGVLDTGVWPELKSFDDTGLE  114

Query  512   PIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEPKSARDVNGHGT  685
             P+P+SW+ +CE G NF  ++CN+K++GAR + RGYEA  G PI    E KS RD +GHG+
Sbjct  115   PVPSSWKGECERGKNFKPSNCNKKLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGS  173

Query  686   hvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADG  865
             H ++ AAGSAV  A++ G A G ARG+AT AR+A YKVCWLG C  +DI +G+D+A+ DG
Sbjct  174   HTSTTAAGSAVFGASLFGFANGTARGMATQARVATYKVCWLGGCFTSDIAAGIDKAIEDG  233

Query  866   VHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPYTAVNLAPWI  1045
             V++LS+S+      G  + Y +D IAIG F A   G++VS +AGN GP   T  N+APW+
Sbjct  234   VNILSMSIG-----GGLMDYYKDTIAIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWL  288

Query  1046  LTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANSF---YCFPGQ  1216
              TVGA TIDR+FPA +TLGN + +TG SLY+G  P    +P+VY G+A+      C  G 
Sbjct  289   TTVGAGTIDRDFPAYITLGNGKIYTGVSLYNGKLPLNSPLPIVYAGNASEESQNLCTRGS  348

Query  1217  LDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVV  1396
             L A KV G+IV C++G +   V+KG+ V  AGG+GMI+ N  + G +L  ++  +P A +
Sbjct  349   LIAKKVAGKIVICDRGGNAR-VEKGLVVKSAGGIGMILSNNEDYGEELVADSYLLPAAAL  407

Query  1397  TVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIA  1576
                    +++YV +   PTA++ F GT +G  PS P VAAFS RGPN LTP+ILKPD+IA
Sbjct  408   GQKSSNELKKYVFSFPNPTAKLGFGGTQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIA  466

Query  1577  PGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYPSWSPAAIK  1723
             PGVNILA WTG++            +FN+ISGTSM+CPHV+GLAA+LK I+P WSPAAI+
Sbjct  467   PGVNILAGWTGAVGPTGLAEDTRHVDFNIISGTSMSCPHVTGLAALLKGIHPEWSPAAIR  526

Query  1724  SALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFL  1903
             SALMTTAY    +G+ T+ D+ T  P TP  YG+GHVDP  A DPGLVYD  V+DY+ F 
Sbjct  527   SALMTTAYRTYKNGQ-TIKDVATGLPATPFDYGAGHVDPVAAFDPGLVYDTTVDDYLSFF  585

Query  1904  CTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNL---------QTVIY  2056
             C + Y   +I L  R      C  R       LNYPSF+V F              TV Y
Sbjct  586   CALNYSPYQIKLVARRD--FTCSKRKKYRVEDLNYPSFAVPFNTAYGVKGGSSKPATVQY  643

Query  2057  KRTVKNVAKVRNVAYQVTV-QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQ--SAD  2227
              RT+ NV       Y+V+V Q+P  V++ V P  L F    +  +Y VTF S  +     
Sbjct  644   TRTLTNVGAAGT--YKVSVSQSP--VKIVVQPQTLSFRGLNEKKNYTVTFMSSSKPSGTT  699

Query  2228  SFGSLRWSDGTHLVTSPIAVSW  2293
             SF  L WSDG H VTSPIA SW
Sbjct  700   SFAYLEWSDGKHKVTSPIAFSW  721



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/759 (48%), Positives = 477/759 (63%), Gaps = 52/759 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS  P  F+ H  WY + + ++S       S+E+LY Y+ VAHGFSARLTP++
Sbjct  28    TYIVHMAKSRMPPSFAEHRHWYDASLRSVS------GSAEVLYFYDTVAHGFSARLTPAE  81

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  LA   GV+SV P+   EL TTR+P+FLGL  G   +  SSD   D+++GVLD+G+WP
Sbjct  82    ARALARRYGVLSVEPETRYELHTTRTPEFLGLDRGGGFV-TSSDSDGDVVVGVLDTGVWP  140

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNF-PATSCNRKIIGARAYYRGYEAEIGKPI--VGE  649
             ER SF D G  P+P SW+  CE G +F PA +CNRK++GAR++YRGYEA +G P+    E
Sbjct  141   ERKSFDDAGFGPVPASWKGGCEEGKDFVPAAACNRKLVGARSFYRGYEASMG-PMDESKE  199

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              +S RD +GHGTH ++  AGSAV +A++ G+A G ARG+++ AR+AVYKVCW+G C ++D
Sbjct  200   ARSPRDNDGHGTHTSTTVAGSAVPDASLLGYAAGTARGMSSRARVAVYKVCWVGGCFSSD  259

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             IL+GMD+AV DG  VLSLSL      G    Y  D IAIGAF A++KGV VSC+AGN GP
Sbjct  260   ILAGMDKAVEDGCGVLSLSLG-----GRVADYYRDGIAIGAFTAMEKGVFVSCSAGNAGP  314

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG--  1183
              P +  N+APWI TVGA T+DR+FPA V LGN  ++TG +LY G       + +VY G  
Sbjct  315   VPTSLSNVAPWITTVGAGTLDRDFPAYVVLGNGENYTGATLYGGDPLPSSPLELVYAGNV  374

Query  1184  --SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
               + N   C  G L   KV G+IV C++G + S V KG  VS+AGG GM++ N    G +
Sbjct  375   TNTTNGNLCMLGTLLPEKVAGKIVLCDRGIN-SRVQKGYVVSEAGGAGMVLANSAGNGEE  433

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  +A  +P   V    G  IR Y+ +   PTA I F+GT +G  PS P VAAFS RGPN
Sbjct  434   LVADAHLLPATGVGEKAGNAIRSYLFSDPSPTATIVFRGTKVGVRPS-PVVAAFSSRGPN  492

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              +T  ILKPD+IAPGVNILA WTG++           TEFN+ISGTSM+CPHVSGLAA+L
Sbjct  493   TITRAILKPDLIAPGVNILAGWTGAVGPTGLGMDARRTEFNVISGTSMSCPHVSGLAALL  552

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAAI+SALMTTAY    SG  ++ID  T +  TP   G+GHVDP  A+DPGL
Sbjct  553   KGAHPEWSPAAIRSALMTTAYAAYPSGD-SIIDAATGRAATPFDLGAGHVDPPRAMDPGL  611

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK----  2032
             +YD  V+DY+DFLC   Y   +IA   + S    C          LNYPSF+V F     
Sbjct  612   IYDLTVDDYLDFLCASNYTPFRIASLTKRSNFT-CDATRTYAVSDLNYPSFAVAFPATTN  670

Query  2033  ----NNLQTVIYKRTVKNVAKVRNVAYQVTVQT-----PSNVRVTVSPNRLVFTDRIDTL  2185
                  +  TV ++RT+ NV       Y+ TV+         V+V V P+ L FT+  +  
Sbjct  671   DVVVGDATTVKHRRTLTNVGGPGT--YKATVRAWAGTEAGGVKVAVEPSELSFTEVGERR  728

Query  2186  SYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSWE  2296
              Y V F +  Q + +  FG L WSDG H+V SP+A +W+
Sbjct  729   GYTVRFSAAGQPSGTTGFGRLEWSDGEHVVASPLAFTWK  767



>ref|XP_006280041.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
 gb|EOA12939.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
Length=779

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/756 (47%), Positives = 474/756 (63%), Gaps = 40/756 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE-----LLYTYEHVAHGF  274
             + K+++V M +S  P  ++ H  WYSS I++++   + S+  E     +LYTY+   HG 
Sbjct  32    QKKTYVVHMDRSAMPSPYTNHLQWYSSKINSVT--QHKSQQGEQGDDRILYTYQTAFHGL  89

Query  275   SARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIII  451
             +A+LT  +A  L    GV++V+P+   EL TTRSP FLGL    S  +        D+I+
Sbjct  90    AAQLTEEEAERLEEEDGVVAVIPETRYELHTTRSPTFLGLERQESERVWAERVTDHDVIV  149

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+GIWPE  SF+D G++P+P++WR  CE G  F   SCNRKI+GAR +Y+GYEA  G
Sbjct  150   GVLDTGIWPESESFNDTGMSPVPSNWRGACETGKRFLKRSCNRKIVGARVFYKGYEAATG  209

Query  632   K-PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             K     E KS RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+
Sbjct  210   KIEEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARGMAPKARVAAYKVCWV  269

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
             G C ++DILS +DQAVADGVHV      S S  G    Y  D ++I  FGA++ GV VSC
Sbjct  270   GGCFSSDILSAVDQAVADGVHV-----LSISLGGGISTYSRDSLSIATFGAMEMGVFVSC  324

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQ  1162
             +AGN GPDP +  N++PWI TVGAST+DR+FPA V LG  R+F G SLY G  V     Q
Sbjct  325   SAGNGGPDPLSLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGVSLYKGRAVLSKNKQ  384

Query  1163  VPVVYGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI  1327
              P+VY G   S      +C  G LD S V G+IV C++G  T  V KG  V +AGG+GMI
Sbjct  385   YPLVYLGRNASSPDPTSFCLDGALDRSHVVGKIVICDRG-VTPRVQKGQVVKKAGGIGMI  443

Query  1328  VPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPR  1507
             + N    G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P 
Sbjct  444   LTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSKKATATLEILGTRIGIKPS-PV  502

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMAC  1654
             VAAFS RGPNFL+ EILKPD++APGVNILAAWTG L            +FN++SGTSM+C
Sbjct  503   VAAFSSRGPNFLSLEILKPDLVAPGVNILAAWTGDLAPSSLSSDPRRVKFNILSGTSMSC  562

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PHVSG+AA+++  +P WSPAA+KSALMTTAY  DN+ +  L D     P++P+ +G+GH+
Sbjct  563   PHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNTLK-PLSDASGAAPSSPYDHGAGHI  621

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
             DP  A+DPGLVYD G  DY +FLCT      ++ +F ++S    C++    NPG+LNYP+
Sbjct  622   DPLKAMDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRT-CKHTLAKNPGNLNYPA  680

Query  2015  FSVLFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLS  2188
              S LF  N  ++++  +RTV NV      +Y+V V       VTV P  L FT +   LS
Sbjct  681   ISALFPENTRVKSMTLRRTVINVGP-HISSYKVFVSPFKGASVTVQPKTLNFTSKHQKLS  739

Query  2189  YEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             Y VTF++ +R +   FG L W   TH V SP+ ++W
Sbjct  740   YTVTFRTRMRMNRPEFGGLVWKSTTHKVRSPVIITW  775



>gb|EYU25500.1| hypothetical protein MIMGU_mgv1a001697mg [Erythranthe guttata]
Length=771

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/760 (47%), Positives = 486/760 (64%), Gaps = 50/760 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
              + KS++V M KS  P  F   H  WYSS +       + S S++++YTY++V HG+S R
Sbjct  30    HKKKSYLVHMDKSNIPASFEDDHTSWYSSSL------KSVSESADIIYTYKNVIHGYSVR  83

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LT  +A  L + PGV+ +  D + +L TTRSP+FLG+++  + L P S   +++IIGVLD
Sbjct  84    LTAEEAKSLEDKPGVLLIQEDVVYKLHTTRSPEFLGILNSDALLLPESATTSNVIIGVLD  143

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +G+WPE SSF D+GL P+P+ W+ +CE+   F ++SCNRK+IGAR + +GYEA  G PI 
Sbjct  144   TGVWPESSSFDDKGLEPVPSGWKGECELSKTFNSSSCNRKLIGARFFSQGYEAAFG-PID  202

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD +GHGTH ++ A GSAV  AN+ G A G ARG+A +AR+A YKVCW G C
Sbjct  203   ETVESKSPRDDDGHGTHTSTTAGGSAVVGANLFGFAAGTARGMARHARLAAYKVCWRGGC  262

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DIL+ M++A+ DGV +LSLSL           Y  D +AIGAF A  KG++VSC+AG
Sbjct  263   ISSDILAAMEKAIEDGVDILSLSLGGSLSD-----YFRDTVAIGAFAATAKGILVSCSAG  317

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP P +  N+APWI TVGA T+DREFP+ V+LGN + F G SLY+G       +P+VY
Sbjct  318   NSGPSPESLSNVAPWITTVGAGTLDREFPSTVSLGNGKKFVGASLYNGKPLPGSLIPLVY  377

Query  1178  GGSA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
               +A    N   C  G L   KV+G+IV C++G  +   +KG+ V +AGGVG+I+ N   
Sbjct  378   ARNASSASNGNLCLTGSLIPEKVKGKIVICDRG-LSPRAEKGLVVREAGGVGVILSNTYT  436

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  +A  IP+A V    G+ I++YV +   PTA I   GT +G  PS P VA+FS 
Sbjct  437   YGEELVADAHFIPSAAVGQTAGDEIKKYVSSDPNPTATIASGGTQLGVQPS-PVVASFSS  495

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TPEILKPD+IAPGVNILAAWTG++            +FN+ISGTSM+CPHVSGL
Sbjct  496   RGPNTITPEILKPDLIAPGVNILAAWTGNVGPTGLPEDTRRVDFNIISGTSMSCPHVSGL  555

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA++K  +P WSPAAI+SALMTTAY+   +G+ T+ DL T  P+TP  YG+GHVDP  A+
Sbjct  556   AALVKAAHPEWSPAAIRSALMTTAYSRYKNGK-TIQDLATGNPSTPFCYGAGHVDPVSAL  614

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             DPGLVYDA V++YVDFLC I Y S  I +  +      C+     +  +LNYPSF+V F+
Sbjct  615   DPGLVYDASVDNYVDFLCAIKYSSSMIKILTKQD--YTCKADKEYSVANLNYPSFAVPFQ  672

Query  2033  ---------NNLQTVI-YKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRID  2179
                       N  TV+ + RT+KNV      +Y+ +V   S+ V++ V P  L F    +
Sbjct  673   TASGPNGGSTNASTVVKHTRTLKNVGS--PASYKASVSQESDAVKIAVVPEVLDFGSSNE  730

Query  2180  TLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               SY VTF   S+     SF  L WSDG H+V SPI +SW
Sbjct  731   EKSYTVTFTASSMPSGTTSFAHLEWSDGKHVVGSPIVISW  770



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/756 (47%), Positives = 469/756 (62%), Gaps = 45/756 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + K++I+ M K   P  F  H  WY S + ++S      +S+ +LYTY  V HG+S +LT
Sbjct  27    QKKTYIIHMDKFNMPADFDDHTQWYDSSLKSVS------KSANMLYTYNSVIHGYSTQLT  80

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS-NLGPSSDYGADIIIGVLDS  466
               +A  LA  PG++ V  + + EL TTRSP FLGL    S +  P ++  +++IIGVLD+
Sbjct  81    ADEAKALAQQPGILLVHEEVIYELHTTRSPTFLGLEGRESRSFFPQTEARSEVIIGVLDT  140

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIV  643
             G+WPE  SF D GL  +P SW+ KC+ G NF A+SCNRK+IGAR + +GYEA  G     
Sbjct  141   GVWPESKSFDDTGLGQVPASWKGKCQTGKNFDASSCNRKLIGARFFSQGYEAAFGAIDET  200

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD  GHGTH A+ AAGS V  A++ G+A G ARG+A++AR+A YKVCW G C +
Sbjct  201   IESKSPRDDEGHGTHTATTAAGSVVTGASLLGYATGTARGMASHARVAAYKVCWTGGCFS  260

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+GMDQAV DGV+VLSLSL      G    Y  D++AIGAF A  +G+ VSC+AGN 
Sbjct  261   SDILAGMDQAVIDGVNVLSLSLG-----GTISDYHRDIVAIGAFSAASQGIFVSCSAGNG  315

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   T  N+APWI TVGA T+DREFPA + +GN +   G SLYSG       +P+VY G
Sbjct  316   GPSSGTLSNVAPWITTVGAGTMDREFPAYIGIGNGKKLNGVSLYSGKALPSSVMPLVYAG  375

Query  1184  ----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
                 S+N   C  G L   KV G+IV C++G +     KG+ V  AGG+GMI+ N    G
Sbjct  376   NVSQSSNGNLCTSGSLIPEKVAGKIVVCDRGMNAR-AQKGLVVKDAGGIGMILANTDTYG  434

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  IPTA V    G +I+QY+ + S PTA I F GT +G  PS P VAAFS RG
Sbjct  435   DELVADAHLIPTAAVGQTAGNLIKQYIASNSNPTATIAFGGTKLGVQPS-PVVAAFSSRG  493

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGS-----LTE------FNMISGTSMACPHVSGLAA  1678
             PN +TP++LKPD+IAPGVNILA WTG      L E      FN+ISGTSM+CPHVSGLAA
Sbjct  494   PNPITPDVLKPDLIAPGVNILAGWTGKVGPTGLQEDTRNVGFNIISGTSMSCPHVSGLAA  553

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTT+Y+   +G+ T+ D+ T   +TP  YG+GHV+PT AV P
Sbjct  554   LLKAAHPEWSPAAIRSALMTTSYSTYKNGK-TIEDVATGMSSTPFDYGAGHVNPTAAVSP  612

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK--  2032
             GLVYD  V+DY++FLC + Y    I +  +    + C          LNYPSFS+  +  
Sbjct  613   GLVYDLTVDDYINFLCALDYSPSMIKVIAKRD--ISCDENKEYRVADLNYPSFSIPMETA  670

Query  2033  ------NNLQTVI-YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
                   ++  TV  Y RT+ NV         V+ +T  +V++ V P  L F+ + +  +Y
Sbjct  671   WGEHADSSTPTVTRYTRTLTNVGNPATYKASVSSET-QDVKILVEPQTLTFSRKNEKKTY  729

Query  2192  EVTFQSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
              VTF +  +     SF  L WSDG H+V SPIA SW
Sbjct  730   TVTFTATSKPSGTTSFARLEWSDGQHVVASPIAFSW  765



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/756 (47%), Positives = 478/756 (63%), Gaps = 50/756 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M   +KP  ++TH DWYS+ + ++S     S S +LLYTY    HGF+A L P 
Sbjct  23    RTYIVQMNHRQKPLSYATHDDWYSASLQSIS-----SNSDDLLYTYSTAYHGFAASLDPE  77

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISG--------SSNLGPSSDYGADIII  451
             QA  L     V+ V  D +  L TTRSP+FLGL +         + +L  +S    D+II
Sbjct  78    QAEALRKSDSVMGVYEDEVYSLHTTRSPEFLGLDTELGLWAGHRTQDLNQASQ---DVII  134

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+G+WP+  SF D G+  +P  WR KCE GP+F A+SCN+K+IGA+++ +GY    G
Sbjct  135   GVLDTGVWPDSRSFDDSGMTEVPARWRGKCEEGPDFQASSCNKKLIGAQSFSKGYRMASG  194

Query  632   KPIVG---EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
                V    E +S RDV+GHGTH AS AAG+ V+NA++ G+A G ARG+AT+AR+A YKVC
Sbjct  195   GNFVKKSKEKESPRDVDGHGTHTASTAAGAHVSNASLLGYASGTARGMATHARVAAYKVC  254

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W   C  +DIL+GMD+A+ DGV VLSLSL        + PY  D IAIGAF A++ G+ V
Sbjct  255   WSTGCFGSDILAGMDRAIVDGVDVLSLSLGGG-----SGPYYRDTIAIGAFTAMEMGIFV  309

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             SC+AGN GP   +  N+APWI+TVGA T+DR+FPA   LGN +  TG SLYSG    +  
Sbjct  310   SCSAGNSGPSKASLANVAPWIMTVGAGTLDRDFPAYALLGNGKKITGVSLYSGRGMGKKP  369

Query  1163  VPVVYG-GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             V +VY  G++ S  C PG L  + VRG++V C++G +   V+KG+ V  AGGVGMI+ N 
Sbjct  370   VSLVYSKGNSTSNLCLPGSLQPAYVRGKVVICDRGINAR-VEKGLVVRDAGGVGMILANT  428

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   V    G+++R YV++ + PTA + F GTV+   PS P VAAF
Sbjct  429   AVSGEELVADSHLLPAVAVGRKVGDVLRAYVKSVANPTALLSFGGTVLNVRPS-PVVAAF  487

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPN +TP+ILKPD+I PGVNILAAW+ +L           T+FN++SGTSM+CPH+S
Sbjct  488   SSRGPNLVTPQILKPDLIGPGVNILAAWSEALGPTGLEKDTRKTQFNIMSGTSMSCPHIS  547

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA++K  +P WSP+A+KSALMTTAYT DN+ +  L D      +TP A+GSGHVDP  
Sbjct  548   GVAALIKAAHPEWSPSAVKSALMTTAYTRDNT-KSPLRDAADGGLSTPLAHGSGHVDPQK  606

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+ PGLVYD    DYV FLC++ Y    +   ++   +  C +R   +PG LNYPSFSVL
Sbjct  607   ALSPGLVYDISTQDYVAFLCSLDYTIEHVRAIVKRQNIT-C-SRKFSDPGELNYPSFSVL  664

Query  2027  FKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             F +    V Y R + NV    +V YQV V  P +V V V P+ LVF +  +   Y VTF 
Sbjct  665   FGSK-GFVRYTRELTNVGAADSV-YQVAVTGPPSVGVVVRPSTLVFKNVGEKKRYTVTFV  722

Query  2207  SL-------RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +        R +  +FGS+ WS+  H V SP+A +W
Sbjct  723   AKKGKKVQNRMTRSAFGSIVWSNTQHQVKSPVAYAW  758



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/755 (47%), Positives = 475/755 (63%), Gaps = 42/755 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS-----ELLYTYEHVAHGFSA  280
             K++I+ M K  KP +F  H  WYSS++ ++ P +     +      +LY+Y+   HG +A
Sbjct  30    KTYIIQMDKWAKPDVFVDHVQWYSSLVKSVLPSTTEVEKTGDGEERILYSYQTAFHGVAA  89

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGV  457
             +L+  +  +L    GV++V P+   +L TTRSP FLGL    SS L        ++I+GV
Sbjct  90    QLSEEEVKKLQERNGVLAVFPEIKYQLHTTRSPLFLGLDREDSSKLWADRLSDHNVIVGV  149

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-  634
             LD+GIWPE  SF+D G+  +P+ W+  CE G  F    C++KI+GAR ++RGYEA  GK 
Sbjct  150   LDTGIWPESPSFNDSGMTSVPSHWKGVCETGRGFEKHHCSKKIVGARVFFRGYEAASGKI  209

Query  635   PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                GE KSARD +GHGTH A   AGS V  AN+ G+A G ARG+A  AR+A YKVCW+G 
Sbjct  210   NERGEFKSARDQDGHGTHTAGTVAGSVVRGANLLGYAYGTARGMAPGARVAAYKVCWVGG  269

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DILS +DQAVADGV++LS+SL      G    Y+ D ++I AFGA++KGV VSC+A
Sbjct  270   CFSSDILSAVDQAVADGVNILSISLG-----GGVSSYNRDSLSIAAFGAMEKGVFVSCSA  324

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQVP  1168
             GN GPDP +  N++PWI TVGAST+DR+FPA V LG  +  TG SLY G     ++ Q P
Sbjct  325   GNGGPDPISLTNVSPWITTVGASTMDRDFPATVELGTGKIVTGASLYKGRMNLSTQKQYP  384

Query  1169  VVYGGSAN-----SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVP  1333
             ++Y GS +     S  C  G LD + V G+IV C++G     V KG  V +AGGVGMI+ 
Sbjct  385   LIYLGSNSSNLMPSSLCLDGTLDKASVAGKIVICDRGISPR-VQKGQVVKEAGGVGMILT  443

Query  1334  NLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVA  1513
             N    G +L  ++  +P   V   +G  I+ Y    S  TA + F GT +G  PS P VA
Sbjct  444   NTAANGEELVADSHLLPAVAVGEREGRAIKLYAAGRS-ATATLRFLGTKLGIRPS-PVVA  501

Query  1514  AFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPH  1660
             AFS RGPNFL+ EILKPD++APGVNILA WTG+L           T FN++SGTSM+CPH
Sbjct  502   AFSSRGPNFLSLEILKPDMVAPGVNILAGWTGALGPSSLPIDQRRTNFNILSGTSMSCPH  561

Query  1661  VSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDP  1840
             VSG+AA+LK  +P WSPAAIKSALMTTAY  DN+ + +L D  +  P+TP+ +G+GHV+P
Sbjct  562   VSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTYK-SLKDASSVTPSTPYDHGAGHVNP  620

Query  1841  THAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFS  2020
               AVDPGL+YD G  DY +FLCT      ++ +F + S    C + +L NPG LNYP+ S
Sbjct  621   RKAVDPGLIYDIGAQDYFEFLCTQELSPSQLMVFGKFSNRT-C-HHSLANPGDLNYPAIS  678

Query  2021  VLF--KNNLQTVIYKRTVKNVAK-VRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
              +F  K  L  +   RTV NV   + N  Y V V       V V P RL FT +   LSY
Sbjct  679   AVFPEKTKLSMLTLHRTVTNVGSPISN--YHVVVSAFKGAVVKVEPERLNFTSKNQKLSY  736

Query  2192  EVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +VTF+++ RQ A  FGSL W DGTH V SPIA++W
Sbjct  737   KVTFKTVSRQKAPEFGSLIWKDGTHKVRSPIAITW  771



>ref|XP_006828664.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
 gb|ERM96080.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
Length=799

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/776 (46%), Positives = 487/776 (63%), Gaps = 58/776 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTL-------------SPLSNHSRSSELLY  247
             E+P SFI+      KP +F TH  WY S + +L             +P    S S  L++
Sbjct  33    EKPLSFIIRAKHDAKPSIFPTHKHWYQSTLQSLFSSDSSPENQVSGNPSLASSFSGTLIH  92

Query  248   TYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS-NLGPS  424
             TY  V HGFSA++TPS A +L  + G++SV+PD+  +LQTTRSPQFLGL    +  L   
Sbjct  93    TYSTVFHGFSAKITPSMAKKLEKMAGILSVIPDKARQLQTTRSPQFLGLKRKDTMGLLAE  152

Query  425   SDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAY  604
             SD+G+++IIGVLD+GIWPER SFSDRGL P+P+SW+ +C  G  F A+SCNRK++GAR +
Sbjct  153   SDFGSNLIIGVLDTGIWPERRSFSDRGLGPVPSSWKGECVEGRGFSASSCNRKLVGARYF  212

Query  605   YRGYEAEIGKPI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNA  778
               GYEA  G P+    E +S RD +GHGTH ASIAAG  V  A++ G+A G A G+A  A
Sbjct  213   SGGYEAMSG-PMNETAEYRSPRDSDGHGTHTASIAAGRYVYPADMLGYAHGVAAGMAPKA  271

Query  779   RIAVYKVCWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFG  958
             R+A YKVCW   C ++DIL+  D+AV DGV+V+SLS+      G  +P+  D IAIGAF 
Sbjct  272   RLAAYKVCWTSGCFDSDILAAFDRAVLDGVNVISLSVG-----GGVVPFYLDSIAIGAFA  326

Query  959   AVQKGVIVSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYS  1138
             A Q  + VS +AGN GP   T  N+APWI TVGA T+DR FPA ++LGN   F+G SLYS
Sbjct  327   AAQHNIFVSASAGNEGPAESTVTNVAPWITTVGAGTLDRNFPAEISLGNGVKFSGVSLYS  386

Query  1139  GVQPS-RIQVPVVYGGSA--------NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKG  1291
             G   S + ++P+VY G+A        +S  C    LD   VRG+IV C++G +   V+KG
Sbjct  387   GPHLSQKPEIPLVYAGNAPATGGDGYSSSLCMENSLDPEMVRGKIVLCDRGSNAR-VNKG  445

Query  1292  VAVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFK  1471
             + V +AGGVGMI+ N   +G  L  ++  +P A +    G+++R YV +   PTA I F+
Sbjct  446   IVVKEAGGVGMILANGAGDGEGLVADSHVLPAAAIGANAGDLVRSYVNSVKNPTATIRFQ  505

Query  1472  GTVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------T  1618
             GT +G  P AP VA+FS RGPN + PEILKPDVIAPGVNILAAWT  +           T
Sbjct  506   GTQLGVRP-APVVASFSARGPNPVAPEILKPDVIAPGVNILAAWTDDVGPAGVTSDRRKT  564

Query  1619  EFNMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQ  1798
             EFN++SGTSMACPHVSGLAA+L   +P W+P+ I+SALMTTAY  DN G   ++D  T  
Sbjct  565   EFNILSGTSMACPHVSGLAALLMGAHPDWTPSMIRSALMTTAYVRDNRGGPHMLDEATWN  624

Query  1799  PTTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNR  1978
              ++P  YG+GHVDP  A+ PGLVYD  + D+VDFLC+  Y ++ I +  R      C ++
Sbjct  625   ASSPLDYGAGHVDPNRAMVPGLVYDLTIQDHVDFLCSSNYSAKNIEIITRKPE--KC-SQ  681

Query  1979  NLGNPGSLNYPSFSVLFK----NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVS  2146
              + + G+LNYP+ S +F+        +  + RTV NV    +V Y+VTV+ P    V+V 
Sbjct  682   KVTHAGNLNYPAISAVFERVPGRAKMSTHFIRTVTNVGDGPSV-YKVTVKAPLGSVVSVE  740

Query  2147  PNRLVFTDRIDTLSY--EVTFQSLRQSAD----SFGSLRWSDGTHLVTSPIAVSWE  2296
             P +LVFT     LS+   V  ++++  A     S G + W+DG H+V SPI V+ +
Sbjct  741   PGKLVFTKVKQRLSFVVRVEVRAVKLVAGGSRVSTGYVTWTDGKHVVNSPIVVTLQ  796



>ref|XP_004954112.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/751 (49%), Positives = 481/751 (64%), Gaps = 37/751 (5%)
 Frame = +2

Query  140   KSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANV  319
             +S  P+L +     Y+S++    P S    +  LLY+Y H A GF+ARLT  QA+ LA+ 
Sbjct  42    RSSHPRLLAR---GYTSLLRDSLPASISRPAPRLLYSYAHAATGFAARLTERQAAHLASQ  98

Query  320   PGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPE-RSSFS  496
             P V++V  D + +L TT +P FL L S SS L P+S+   D++IGVLD+GI+PE R+SF+
Sbjct  99    PSVLAVAADGIRQLHTTLTPSFLRL-STSSGLLPASNGATDVVIGVLDTGIYPEDRASFA  157

Query  497   -DRGLNPIPNSWRNKCEVGPNFPATS-CNRKIIGARAYYRGYEAEIGKPI--VGEPKSAR  664
              D  + P P  +R  C   P+F A++ CN K++GA+ ++ GYEA  G  +    +P+S  
Sbjct  158   ADPSMPPPPRRFRGSCVSTPSFNASAYCNNKLVGAKFFHEGYEAAYGNRLDETEDPRSPL  217

Query  665   DVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGM  844
             D NGHGTH AS AAGSAVA A    +A+G+A G+A  ARIA YKVCW   C+++DIL   
Sbjct  218   DSNGHGTHTASTAAGSAVAGAAFYNYAKGKAVGMAPGARIAAYKVCWTNGCADSDILKAF  277

Query  845   DQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPYTA  1024
             D+A+ DGV V+SLSL +    G    + ED IAIGAF AV+KG++VS +AGN GP  YTA
Sbjct  278   DEAIKDGVDVISLSLGAV---GEPPNFHEDQIAIGAFNAVRKGIVVSASAGNSGPGEYTA  334

Query  1025  VNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSANSFYC  1204
              N+APW +TVGASTI+R FPA V LGN  +FTG SLY+G   S  ++P+VYGG   S  C
Sbjct  335   KNIAPWFITVGASTINRRFPATVVLGNGETFTGFSLYAGAPLSEAKIPLVYGGDVGSEVC  394

Query  1205  FPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNADRIP  1384
               G+L+AS V G+IV C+ G +   V+KG  V  AGG G I+      G Q+  +   +P
Sbjct  395   EAGKLNASLVAGKIVVCDPGVNGR-VEKGEVVRLAGGAGAILVGNEVFGEQVITSPHILP  453

Query  1385  TAVVTVADGEIIRQYVRTA-SFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPEILK  1561
                VT A  E I++Y+RT  + P A I F+GTV+G  PS+PR+A+FS RGPNF  P ILK
Sbjct  454   ATAVTFAAAEKIKKYMRTKNASPVATIVFQGTVVGRKPSSPRMASFSSRGPNFRAPVILK  513

Query  1562  PDVIAPGVNILAAWTG--SLTE---------FNMISGTSMACPHVSGLAAMLKKIYPSWS  1708
             PDV APGV+ILAAWTG  S TE         FN+ISGTSM+CPHVSG+AA+L++ +P WS
Sbjct  514   PDVTAPGVDILAAWTGANSPTELDSDKRRVHFNIISGTSMSCPHVSGIAALLRQAHPDWS  573

Query  1709  PAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAGVND  1888
             PAAIKSALMTTAY VDN+G   + D+ T Q +TP   G+GHVDP  A DPGLVYDAG +D
Sbjct  574   PAAIKSALMTTAYNVDNAG-DIIRDMSTGQASTPFVRGAGHVDPNRAADPGLVYDAGADD  632

Query  1889  YVDFLCTIGYDSRKIALF-LRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQT-VIYKR  2062
             Y+ FLC IGY   +IA F  +  P V+C  R     G LNYP+FSV+F N+ +  V  +R
Sbjct  633   YMSFLCAIGYTDEQIAKFTTKGDPAVNCSTRR-ATAGDLNYPAFSVVFVNSTKNEVTQRR  691

Query  2063  TVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL------RQSA  2224
              V+NV       Y+V V  P+ VRVTV P  L F  R  T  Y VTF  L       +  
Sbjct  692   VVRNVGSNVRAKYRVAVTRPAGVRVTVKPRILRFNRRQRTQEYAVTFMPLVGANVTEKYT  751

Query  2225  DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             D  GS+ WSDG H VTSP+A++W    V+ +
Sbjct  752   D--GSIVWSDGKHRVTSPLAITWPVSQVAAM  780



>ref|XP_010679580.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/759 (46%), Positives = 481/759 (63%), Gaps = 50/759 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV M KS+ P  F  H  WY S       L + S ++E++YTY + AHG++ RLT
Sbjct  28    EKNTYIVHMAKSQMPATFDHHTKWYES------SLRHVSDTAEMIYTYSNAAHGYATRLT  81

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
              S+A  L+++PG+++VLP+   EL TTR+P FLGL     +    S+  +D+IIGVLD+G
Sbjct  82    ESEAESLSSLPGILAVLPETRYELHTTRTPSFLGLDRTRDSF-TESESASDVIIGVLDTG  140

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVG  646
             +WPE  SF D+G+ P+P++WR  C  G NF A+SCN K+IGA+ + +GYEA +G      
Sbjct  141   VWPESKSFDDKGMGPVPSTWRGACMTGNNFSASSCNLKLIGAQYFSQGYEAVVGSFDESR  200

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E KS RD +GHGTH AS AAGS V  A++ G+A G ARG+A  AR+AVYKVCW G C ++
Sbjct  201   ESKSPRDDDGHGTHTASTAAGSPVEGASLFGYAPGTARGMAPRARVAVYKVCWTGGCFSS  260

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL  +D+A+ D V+VLSLSL      G    Y  D +AIGAF A++ G++VSC+AGN G
Sbjct  261   DILKAIDKAIEDNVNVLSLSLG-----GGTSEYYRDSVAIGAFAAMEHGILVSCSAGNAG  315

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P  ++  N+APWI TVGA T+DR+FPAV ++ N + + G SL+ G       +P VY G+
Sbjct  316   PTAFSLSNVAPWITTVGAGTLDRDFPAVASVSNGKKYAGVSLFRGESLPHGMLPAVYAGN  375

Query  1187  ANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGY  1354
             A++      C  G L   KV+G+IV C++G +   V KG  V  AGG+GMI+ N    G 
Sbjct  376   ASNATSGSLCMTGTLIPEKVKGKIVLCDRGVNPR-VQKGAVVKAAGGLGMILANTEANGE  434

Query  1355  QLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGP  1534
             +L  +A  +P   V    G+ IR YV + S PTA I F+GT +G  PS P VAAFS RGP
Sbjct  435   ELVADAHLLPATAVGQKSGDAIRDYVISDSNPTATILFEGTKVGVQPS-PVVAAFSSRGP  493

Query  1535  NFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAM  1681
             N +TPEILKPD+IAPGVNILA W+G+L            EFN+ISGTSM+CPHVSGLA +
Sbjct  494   NAITPEILKPDMIAPGVNILAGWSGALGPTAVATDMRRVEFNIISGTSMSCPHVSGLAGL  553

Query  1682  LKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPG  1861
             +K  +P WSPAAIKSALMTTAY    +G+  L D+ T +P+TP  +G+GHVDP  A++PG
Sbjct  554   VKGAHPDWSPAAIKSALMTTAYVTYKNGQ-RLQDVATGKPSTPLDHGAGHVDPISALNPG  612

Query  1862  LVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDC-RNRNLGNPGSLNYPSFSVLFK--  2032
             LVYD   +DY+ FLC + Y   +I L  R   + D  +N +L +    NYPSF+V FK  
Sbjct  613   LVYDLTTDDYLAFLCALKYTPSQINLVARRKFICDSDKNYSLSD---FNYPSFAVSFKTV  669

Query  2033  ---------NNLQTVI-YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDT  2182
                      ++  TV+ Y RT+ NV    +    +T Q P  V+++V P  L F+   + 
Sbjct  670   PSTKAAGGPSHEPTVMKYTRTLTNVGPPGSYKVTLTSQAP-EVKISVDPEVLSFSKVNEK  728

Query  2183  LSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2293
              SY VTF + + ++D+  F  + WSDG H+V+SPIA SW
Sbjct  729   KSYTVTFTAEQMASDTNKFARIEWSDGKHVVSSPIAFSW  767



>ref|XP_010690381.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=774

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/759 (47%), Positives = 472/759 (62%), Gaps = 47/759 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E  K++I+ +  + KP +F TH +WY+S   T S        S++L+TY+ V HGFSA L
Sbjct  27    ETRKTYIIRVDSTAKPTIFPTHTNWYTSEFTTTS--------SQILHTYDTVFHGFSAVL  78

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TPSQA  L N P +++VL DR   L TTRSPQFLGL      L   SDYG+D+IIGVLD+
Sbjct  79    TPSQADNLNNNPSILAVLEDRRRYLHTTRSPQFLGL-RIQRGLWSESDYGSDVIIGVLDT  137

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             GIWPER SFSD+ L PIP  W+  C+VG  F + +CNRKIIGAR + +G+EA      VG
Sbjct  138   GIWPERRSFSDQNLGPIPKRWKGVCQVGERFSSKNCNRKIIGARFFSKGHEAAFPGIGVG  197

Query  647   ------EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
                   E KS RD +GHGTH AS AAG    NAN+ G+A G A+G+A  AR+AVYKVCW 
Sbjct  198   NTTSVTEFKSPRDADGHGTHTASTAAGRYSFNANMTGYAPGVAKGVAPKARLAVYKVCWE  257

Query  809   GT-CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVS  985
              + C ++DIL+  D AV DGV V+S+S+      G + PY  D IAIG++GAV +GV VS
Sbjct  258   NSGCFDSDILAAFDAAVNDGVDVISISIGGGD--GISSPYYLDPIAIGSYGAVSRGVFVS  315

Query  986   CAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQV  1165
              +AGN GP+  +  NLAPWI TVGA TIDR FPA + LGN +   G SLY+G    +   
Sbjct  316   SSAGNDGPNTMSVTNLAPWITTVGAGTIDRNFPAEIVLGNGKIINGVSLYAGKPLRKKMY  375

Query  1166  PVVYGGSANSF---YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
             P+VY G   +     C    LD  +V+G+IV C++G +  +  KGV V +AGGVGMI+ N
Sbjct  376   PIVYPGKTGTLSVSLCMENSLDPKEVKGKIVICDRGSNPRVA-KGVVVQKAGGVGMILAN  434

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
               + G  L  +A  IP A V   + ++I+ Y  +   P   I FKGTV+G  P AP VA+
Sbjct  435   GASNGEGLVGDAHLIPAASVGSNEADVIKSYASSTKLPMGTIHFKGTVVGIKP-APVVAS  493

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGP+ L PEILKPD+IAPGVNILA WT ++           TEFN++SGTSMA PHV
Sbjct  494   FSGRGPSGLNPEILKPDLIAPGVNILAGWTDAVGPTGLDIDSRRTEFNILSGTSMAAPHV  553

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SG AA+LK  YP W+PA IKSA+MTTA   DN       +    +P+TP+ +GSGH++  
Sbjct  554   SGAAALLKSAYPDWTPAMIKSAIMTTASVTDNKLSLMKDEATPGKPSTPYDFGSGHLNLD  613

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+DPGLVYD    DYVDFLC IGY  + I +  R     +C  +   +P +LNYPS +V
Sbjct  614   QALDPGLVYDLADEDYVDFLCAIGYGPKTIQVITRTPE--NCNMKRKASPENLNYPSIAV  671

Query  2024  LFKNN---LQTVIYKRTVKNVAKVRNVAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSY  2191
             LF ++   + + ++ RTV NV  V +V Y+V V+ P   V V V P+ LVF +++  +S+
Sbjct  672   LFPSSDAGVTSKVFVRTVTNVGGVNSV-YKVKVEVPGKGVTVKVKPSTLVFNEKVKKVSF  730

Query  2192  EVTFQ------SLRQSADSFGSLRWSDGTHLVTSPIAVS  2290
              VT        +L  S   FG+  W DG H+V SPI V+
Sbjct  731   TVTVTVDSRKLNLGDSGAGFGAFSWVDGKHVVRSPIVVT  769



>dbj|BAJ87780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=778

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/755 (46%), Positives = 475/755 (63%), Gaps = 41/755 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE------LLYTYEHVAHGFS  277
             +++IV M  SEKP  F  HH+WY+S + ++S     +   E      ++Y YE   HGF+
Sbjct  32    QTYIVQMAASEKPSAFDFHHEWYASTVKSVSSAQVEAEQQEEDGYARIVYNYETAFHGFA  91

Query  278   ARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN-LGPSSDYGADIIIG  454
             ARL   +A  +A   GV++VLP+ +++L TTRSP FLG+    SN +  +     D+++G
Sbjct  92    ARLDEDEAERMAEAAGVLAVLPETVLQLHTTRSPDFLGIGPEVSNRIWAAGLADHDVVVG  151

Query  455   VLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK  634
             VLD+GIWPE  SFSD+GL P+P  W+  C+ G  F    CNRKIIGAR +Y GYEA  G 
Sbjct  152   VLDTGIWPESPSFSDKGLGPVPARWKGLCQTGRGFTTADCNRKIIGARIFYNGYEASSG-  210

Query  635   PI--VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             PI    E KS RD +GHGTH A+ AAGS V +A + G+ARG ARG+A  AR+A YKVCW 
Sbjct  211   PINETTELKSPRDQDGHGTHTAATAAGSPVPDAGLFGYARGVARGMAPRARVAAYKVCWT  270

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
             G C ++DIL+ +D+AV+DGV VLS+SL      G A PY  D ++I +FGA+Q GV ++C
Sbjct  271   GGCFSSDILAAVDRAVSDGVDVLSISLG-----GGASPYYRDSLSIASFGAMQMGVFIAC  325

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQ  1162
             +AGN GPDP +  N++PWI TVGAST+DR+FPA VTLGN  + TG SLY G Q    R Q
Sbjct  326   SAGNAGPDPISLTNMSPWITTVGASTMDRDFPATVTLGNGANITGVSLYKGRQNLSPRQQ  385

Query  1163  VPVVYGGSANSF-----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI  1327
              PVVY G  +S       C  G L+ + V G+IV C++G     V KG  V +AGG+GMI
Sbjct  386   YPVVYMGGNSSVPNPRSMCLEGTLEPNAVTGKIVICDRGISPR-VQKGQVVKEAGGIGMI  444

Query  1328  VPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPR  1507
             + N    G +L  ++  +P   V  ++G   ++Y RTA  PTA + F GT +G  PS P 
Sbjct  445   LANTAANGEELVADSHLLPAVAVGESEGVAAKKYTRTAPKPTATLSFAGTKLGIRPS-PV  503

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLTE-----------FNMISGTSMAC  1654
             VAAFS RGPN+LT EILKPD+IAPGVNILAAW+G  +            FN++SGTSM+C
Sbjct  504   VAAFSSRGPNYLTLEILKPDLIAPGVNILAAWSGDASPSSLASDRRRVGFNILSGTSMSC  563

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PHV+G+AA+LK  +P WSPA IKSALMTTAY  DN+    L D  T + +TP  +G+GH+
Sbjct  564   PHVAGVAALLKASHPDWSPAQIKSALMTTAYVHDNTYH-VLKDAATGEASTPFEHGAGHI  622

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
              P  A+ PGLVYD G N+Y++FLCT      ++  F +NS +  C+  +  +PG LNYP+
Sbjct  623   HPVRALSPGLVYDIGQNEYLEFLCTQNLTPTQLKGFTKNSNMT-CKG-SFSSPGDLNYPA  680

Query  2015  FSVLFKNNLQT-VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
              S +F +   T +  +RTV NV    +  Y V V       V V P+ L F+     L+Y
Sbjct  681   ISAVFTDQPATPLTVRRTVTNVGPPSST-YNVKVTKFKGADVVVEPSTLHFSSTNQKLAY  739

Query  2192  EVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +VT ++   Q    +G+L WSDG H+V SP+ ++W
Sbjct  740   KVTVRTKAAQKTPEYGALSWSDGVHVVRSPLVLTW  774



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/750 (48%), Positives = 471/750 (63%), Gaps = 40/750 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++I+ + K  KP +F  H  WYSS++ + +      R   +LY+Y+   HG +A+L+  
Sbjct  34    KTYIIQIDKWAKPDVFIDHVKWYSSLVKSATAGEEEER---ILYSYQTAFHGVAAQLSEE  90

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLDSGI  472
             + ++L    GV++V P+   +L TTRSP FLGL    SS L        ++I+GVLD+GI
Sbjct  91    EINKLRAQHGVLAVFPETKYQLHTTRSPLFLGLDREDSSKLWSDKLADHNVIVGVLDTGI  150

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIVGE  649
             WPE  SF+D G+ PIP  W+  CE G  F    C++KI+GAR +YRGYEA  GK    GE
Sbjct  151   WPESPSFNDTGMTPIPAHWKGACETGRGFEKHHCSKKIVGARVFYRGYEAASGKINERGE  210

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KSARD +GHGTH A   AGS V  AN+ G+A G ARG+A  ARIA YKVCW+G C ++D
Sbjct  211   YKSARDQDGHGTHTAGTVAGSVVRGANLLGYAYGTARGMAPGARIAAYKVCWVGGCFSSD  270

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             ILS +DQAVADGV+VLS+SL      G    Y+ D ++I AFGA++KGV VSC+AGN GP
Sbjct  271   ILSAVDQAVADGVNVLSISLG-----GGVSSYNRDSLSIAAFGAMEKGVFVSCSAGNGGP  325

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQVPVVYGG  1183
             DP +  N++PWI TVGAST+DR+FPA V  G  +  TG SLY G +   +  Q  ++Y G
Sbjct  326   DPISLTNVSPWITTVGASTMDRDFPATVKFGTGKVITGASLYKGKRNLSTEKQYSLIYLG  385

Query  1184  -----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
                     S  C  G LD S+V G+IV C++G     V KG  V  AGG+GMI+ N    
Sbjct  386   NNSSSPMPSSLCLEGSLDGSEVAGKIVICDRGISPR-VQKGQVVKDAGGIGMILTNTAAN  444

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  IP   V   +G++I+ Y  +    TA ++F GT +G  PS P VAAFS R
Sbjct  445   GEELVADSHLIPAVAVGETEGKLIKHYA-SGRNATATLKFLGTKLGIRPS-PVVAAFSSR  502

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPNFLT EILKPD++APGVNILAAWTG+L           T FN++SGTSM+CPHVSG+A
Sbjct  503   GPNFLTLEILKPDMVAPGVNILAAWTGALGPSSLPTDQRRTNFNILSGTSMSCPHVSGIA  562

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  +P WSPAAIKSALMTTAY  DN+   +L D  T  P+TP+ +G+GH++P  AVD
Sbjct  563   ALLKARHPDWSPAAIKSALMTTAYVHDNT-YNSLKDSSTATPSTPYDHGAGHINPRKAVD  621

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD G  DY +FLCT      ++ +F R S    C + +L NPG LNYP+ S +F  
Sbjct  622   PGLVYDIGAQDYFEFLCTQQLSPSQLMVFARFSNRT-C-HHSLANPGDLNYPAISAVFPE  679

Query  2036  N--LQTVIYKRTVKNVAK-VRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             +  + T+   RT  NV   + N  Y V V +     V V P+RL FT +   LSY+V F+
Sbjct  680   DAKVSTLTLHRTATNVGSPISN--YHVRVSSFKGAVVKVEPSRLNFTSKHQKLSYKVIFE  737

Query  2207  SL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +  RQ A  FGSL W DG H V SPI ++W
Sbjct  738   TKSRQKAPEFGSLIWKDGAHKVRSPIVITW  767



>ref|XP_006579930.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006579931.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006579932.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
Length=755

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/749 (46%), Positives = 481/749 (64%), Gaps = 42/749 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E  ++IV + KSE P+ F  H  WY S + T+S       S+E++YTY++  HG++ RLT
Sbjct  27    EKSTYIVHVAKSEMPESFEHHALWYESSLKTVS------DSAEIMYTYDNAIHGYATRLT  80

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L    G+++VLP+   EL TTR+P FLGL   S+++ P S  G+D+IIGVLD+G
Sbjct  81    AEEARLLETQAGILAVLPETRYELHTTRTPMFLGL-DKSADMFPESSSGSDVIIGVLDTG  139

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D GL P+P++W+  CE G NF A++CNRK+IGAR + +G EA +G PI   
Sbjct  140   VWPESKSFDDTGLGPVPSTWKGACETGTNFTASNCNRKLIGARFFSKGVEAILG-PINET  198

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +SARD +GHGTH AS AAGS V++A++ G+A G ARG+AT AR+A YKVCW G C +
Sbjct  199   EESRSARDDDGHGTHTASTAAGSVVSDASLFGYASGTARGMATRARVAAYKVCWKGGCFS  258

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ +++A+ D V+VLSLSL      G    Y  D +AIGAF A++ G++VSC+AGN 
Sbjct  259   SDILAAIERAILDNVNVLSLSLG-----GGMSDYYRDSVAIGAFSAMENGILVSCSAGNA  313

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG-  1180
             GP PY+  N+APWI TVGA T+DR+FPA V LGN  +F+G SLY G       +P VY  
Sbjct  314   GPSPYSLSNVAPWITTVGAGTLDRDFPAYVALGNGLNFSGVSLYRGNAVPDSPLPFVYAG  373

Query  1181  ----GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
                 G+ N   C  G L   KV G+IV C++G  T+ V KG  V  AG +GM++ N    
Sbjct  374   NVSNGAMNGNLCITGTLSPEKVAGKIVLCDRG-LTARVQKGSVVKSAGALGMVLSNTAAN  432

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P   V    G+ I++Y+ + + PT +I F+GT +G  PS P VAAFS R
Sbjct  433   GEELVADAHLLPATAVGQKAGDAIKKYLFSDAKPTVKILFEGTKLGIQPS-PVVAAFSSR  491

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TP+ILKPD+IAPGVNILA W+ ++            +FN+ISGTSM+CPHVSGLA
Sbjct  492   GPNSITPQILKPDLIAPGVNILAGWSKAVGPTGLPVDNRRVDFNIISGTSMSCPHVSGLA  551

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  +P WSPAA++SALMTTAYTV  +G   L D  T +P+TP  +GSGHVDP  A++
Sbjct  552   ALIKSAHPDWSPAAVRSALMTTAYTVYKTGE-KLQDSATGKPSTPFDHGSGHVDPVAALN  610

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN  2035
             PGLVYD  V+DY+ FLC + Y + +I    +      C      +   LNYPSF+VLF++
Sbjct  611   PGLVYDLTVDDYLGFLCALNYSASEINTLAKRK--FQCDAGKQYSVTDLNYPSFAVLFES  668

Query  2036  NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL-  2212
                 V + RT+ NV         VT    S V+++V P  L F +  +  S+ VTF S  
Sbjct  669   G-GVVKHTRTLTNVGPAGTYKASVTSDMAS-VKISVEPQVLSFKEN-EKKSFTVTFSSSG  725

Query  2213  --RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               +Q  ++FG + WSDG H+V +PI+++W
Sbjct  726   SPQQRVNAFGRVEWSDGKHVVGTPISINW  754



>dbj|BAJ97136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/761 (47%), Positives = 480/761 (63%), Gaps = 36/761 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQL-----FSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHG  271
             E   S+IV +     P+L      +T    Y S +    P+   S +  +LY+Y H A G
Sbjct  31    EAQSSYIVHVAAEHAPRLPRRGLLTTRA--YGSFLRDHIPVEMSSPAPAVLYSYAHAATG  88

Query  272   FSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIII  451
             F+ARLT  QA  LA+   V++V+PD + EL TT +P FLGL S SS L  +S+   D++I
Sbjct  89    FAARLTERQAELLASSSSVLAVVPDTMQELHTTLTPSFLGL-SPSSGLLKASNGATDVVI  147

Query  452   GVLDSGIWPE-RSSFS-DRGLNPIPNSWRNKCEVGPNFPATS-CNRKIIGARAYYRGYEA  622
             GV+D+G++PE R SF+ D  L P P+ +R +C  GP+F  ++ CN K++GA+ + RG EA
Sbjct  148   GVIDTGVYPEGRPSFAADPSLPPPPSKFRGRCVSGPSFNGSALCNNKLVGAKFFQRGQEA  207

Query  623   EIGKPIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
               G+ +  + KSA D NGHGTH +S A GSAVA+A    +ARG+A G+A  ARIAVYK C
Sbjct  208   LRGRALGADSKSALDTNGHGTHTSSTAGGSAVADAGFFDYARGKAVGMAPGARIAVYKAC  267

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W G C+++DIL+  D+A+ADGV V+S+SL +    G A  +  D  A+GAF AV++G++V
Sbjct  268   WEG-CASSDILAAFDEAIADGVDVISVSLGAV---GSAPDFYSDTTAVGAFRAVRRGIVV  323

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             S +AGN GP   TA N+APW LTVGAST++R+FP  V LGN  +FTGT+LY+G      +
Sbjct  324   SASAGNSGPGDSTACNIAPWFLTVGASTLNRQFPGDVVLGNGETFTGTTLYAGEPLGPTK  383

Query  1163  VPVVYGGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             +P+VYGG   S  C  G+L+A+ V G+IV CE G +     K +AV  AGG G I+ +  
Sbjct  384   IPLVYGGDVGSKACEEGKLNATMVAGKIVLCEPGVNARAA-KPLAVKLAGGAGAILASTQ  442

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G Q        P   V   DG  I +Y+R  + PTA I F+GTV+G++P +PR+AAFS
Sbjct  443   PFGEQALTTPHVHPATAVAFVDGAKIFKYIRAQASPTATIIFRGTVVGSTPPSPRMAAFS  502

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMACPHVSG  1669
              RGPN   PEI KPDV APGV+ILAAWTG+             ++N+ISGTSM+CPHVSG
Sbjct  503   SRGPNLRAPEIFKPDVTAPGVDILAAWTGANSPTELDSDTRRVKYNIISGTSMSCPHVSG  562

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             +AA+L++  P WSPAAIKSALMTTAY VDN+G G + D+ +   +TP A G+GH+DP  A
Sbjct  563   IAALLRQARPEWSPAAIKSALMTTAYNVDNTG-GVIGDMSSGDASTPFARGAGHIDPNSA  621

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             VDPGLVYDAG  DY+ FLC +GY +R++A+F  +   + C  R     G  NYP+FSV+F
Sbjct  622   VDPGLVYDAGTEDYITFLCALGYTARQVAVFGSS---ISCSTRAGSAVGDHNYPAFSVVF  678

Query  2030  -KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF-  2203
               N L  V  +R V+NV       Y   V  P  VRV VSP  L F+    T  Y +TF 
Sbjct  679   TSNKLAVVTQRRVVRNVGSDAEATYTAKVTAPDGVRVRVSPETLRFSTTQKTQEYVLTFA  738

Query  2204  QSLRQSAD---SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2317
             Q    SA    +FGS+ WSDG H VTSPIAV+W    V+E+
Sbjct  739   QGSPGSATAKYTFGSIEWSDGEHSVTSPIAVTWPASKVAEM  779



>ref|NP_568765.1| subtilase 1.3 [Arabidopsis thaliana]
 dbj|BAB11244.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL87307.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AED96122.1| subtilase 1.3 [Arabidopsis thaliana]
Length=780

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/752 (46%), Positives = 466/752 (62%), Gaps = 36/752 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSR---SSELLYTYEHVAHGFSARL  286
             K++++ M KS  P  ++ H  WYSS I++++   +      ++ +LYTY+   HG +A+L
Sbjct  35    KTYVIHMDKSAMPLPYTNHLQWYSSKINSVTQHKSQEEEGNNNRILYTYQTAFHGLAAQL  94

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             T  +A  L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GVLD
Sbjct  95    TQEEAERLEEEDGVVAVIPETRYELHTTRSPTFLGLERQESERVWAERVTDHDVVVGVLD  154

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV  643
             +GIWPE  SF+D G++P+P +WR  CE G  F   +CNRKI+GAR +YRGYEA  GK   
Sbjct  155   TGIWPESESFNDTGMSPVPATWRGACETGKRFLKRNCNRKIVGARVFYRGYEAATGKIDE  214

Query  644   G-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+G C 
Sbjct  215   ELEYKSPRDRDGHGTHTAATVAGSPVKGANLFGFAYGTARGMAQKARVAAYKVCWVGGCF  274

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DILS +DQAVADGV V      S S  G    Y  D ++I  FGA++ GV VSC+AGN
Sbjct  275   SSDILSAVDQAVADGVQV-----LSISLGGGVSTYSRDSLSIATFGAMEMGVFVSCSAGN  329

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V +G  R+F G SLY G  V P   Q P+V
Sbjct  330   GGPDPISLTNVSPWITTVGASTMDRDFPATVKIGTMRTFKGVSLYKGRTVLPKNKQYPLV  389

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G   S      +C  G LD   V G+IV C++G  T  V KG  V +AGG+GM++ N 
Sbjct  390   YLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRG-VTPRVQKGQVVKRAGGIGMVLTNT  448

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P VAAF
Sbjct  449   ATNGEELVADSHMLPAVAVGEKEGKLIKQYAMTSKKATASLEILGTRIGIKPS-PVVAAF  507

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAWTG +            +FN++SGTSM+CPHVS
Sbjct  508   SSRGPNFLSLEILKPDLLAPGVNILAAWTGDMAPSSLSSDPRRVKFNILSGTSMSCPHVS  567

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA++K  +P WSPAAIKSALMTTAY  DN  +  L D     P++P+ +G+GH+DP  
Sbjct  568   GVAALIKSRHPDWSPAAIKSALMTTAYVHDNMFK-PLTDASGAAPSSPYDHGAGHIDPLR  626

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A DPGLVYD G  +Y +FLCT      ++ +F ++S    C++    NPG+LNYP+ S L
Sbjct  627   ATDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRT-CKHTLAKNPGNLNYPAISAL  685

Query  2027  FKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
             F  N  ++ +  +RTV NV      +Y+V+V       VTV P  L FT +   LSY VT
Sbjct  686   FPENTHVKAMTLRRTVTNVGP-HISSYKVSVSPFKGASVTVQPKTLNFTSKHQKLSYTVT  744

Query  2201  FQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F++  R     FG L W   TH V SP+ ++W
Sbjct  745   FRTRFRMKRPEFGGLVWKSTTHKVRSPVIITW  776



>ref|XP_009401756.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=782

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/759 (47%), Positives = 486/759 (64%), Gaps = 44/759 (6%)
 Frame = +2

Query  113   PKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS--------ELLYTYEHVAH  268
             PK++IV + KSEKP  F+TH DWY S I++++  S+   +S         ++Y+YE   H
Sbjct  32    PKTYIVHVAKSEKPDSFATHVDWYLSTINSVAATSSELDASTEADDPADRIVYSYETAFH  91

Query  269   GFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNL-GPSSDYGAD  442
             GF+ +L   +A  L +VPGV++VLP+ +  L TTRSP+FLG+    SSN+   ++    D
Sbjct  92    GFATKLGADEAERLESVPGVLAVLPETVYRLHTTRSPEFLGIGPEDSSNIFTTAASANHD  151

Query  443   IIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEA  622
             + +GVLD+GIWPE  SFSD+G+  +P  W+  CE G NF  ++CNRKI+GAR ++RGYEA
Sbjct  152   VFVGVLDTGIWPESPSFSDKGMPAVPARWKGACEAGRNFTHSNCNRKIVGARIFHRGYEA  211

Query  623   EIGK-PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKV  799
               G      E KS RD +GHGTH A+  AGS V  AN+ G+A G A+G+A +AR+AVYKV
Sbjct  212   SAGAIDEKSELKSPRDQDGHGTHTAATVAGSPVRGANLFGYATGTAQGMAPHARVAVYKV  271

Query  800   CWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVI  979
             CW G C ++DIL+ +D+AVADGV VLS+SL      G    Y  D ++I  FGA++ GV 
Sbjct  272   CWTGGCFSSDILAAVDRAVADGVDVLSISLG-----GGVSAYYRDSLSIATFGAMEMGVF  326

Query  980   VSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ---P  1150
             V+C+AGN GPDP +  N++PWI TVGAST+DR+FPA V LGN  + TG SLY G Q   P
Sbjct  327   VACSAGNAGPDPISLTNVSPWITTVGASTMDRDFPAKVGLGNGMNITGVSLYKGRQNLLP  386

Query  1151  SRIQVPVVY-GGSANS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGG  1315
             S+ Q P+VY GG+ +S      C  G LD   V G++V C++G  +  V KG  V  AGG
Sbjct  387   SQ-QYPLVYMGGNLSSPNPKSLCLEGSLDPRVVAGKVVMCDRG-VSPRVQKGQVVKDAGG  444

Query  1316  VGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSP  1495
             +GMI+ N    G +L  ++  +P   V    GE I++Y + ++ PTA + F+GT +G  P
Sbjct  445   IGMILANTAANGDELVADSHLLPAVAVGETAGEEIKRYSKASARPTATLTFEGTKVGIRP  504

Query  1496  SAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLTE-----------FNMISGT  1642
             S P VAAFS RGPN LT EILKPDV+APGVNILAAWTG  +            FN++SGT
Sbjct  505   S-PVVAAFSSRGPNILTLEILKPDVVAPGVNILAAWTGDASPSSLAADHRRVGFNILSGT  563

Query  1643  SMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYG  1822
             SM+CPHV G+AA+LK  +P WSPAAIKSALMTTAY  DN+    L D  T QP++ + +G
Sbjct  564   SMSCPHVGGVAALLKASHPDWSPAAIKSALMTTAYVHDNT-HHPLKDAATGQPSSTYDHG  622

Query  1823  SGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSL  2002
             +GH+ P  AVDPGLVYD    +Y +FLC+    S ++ +F ++S    C++ +L +PG L
Sbjct  623   AGHIQPLKAVDPGLVYDITPEEYFEFLCSQKLTSVQMKVFTKHSNRT-CKH-SLASPGDL  680

Query  2003  NYPSFSVLFKNN-LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRID  2179
             NYP+ S +F+     T+  +R V NV    +  Y V V       V V P  L FT    
Sbjct  681   NYPAMSAVFRQQPATTLTLQRVVTNVGPPVST-YSVKVSAFKGADVVVEPKTLHFTRHNQ  739

Query  2180  TLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSW  2293
              LSY+VTF+++  QS+  FG L WSDGTH+V SP+ V+W
Sbjct  740   KLSYKVTFRTISPQSSPEFGGLTWSDGTHVVRSPVVVTW  778



>gb|KEH35793.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/753 (46%), Positives = 471/753 (63%), Gaps = 46/753 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++I+ M K   P  F  H  WY S + ++S       ++E +YTY+HVAHGFS RLT  
Sbjct  23    RTYIIHMDKFNMPASFDDHLQWYDSSLKSVS------DTAETMYTYKHVAHGFSTRLTTQ  76

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
             +A  L   PG++SV+PD   EL TTR+P+FLGL   +  L PSS   +++I+GV+D+G+W
Sbjct  77    EADLLTKQPGILSVIPDVRYELHTTRTPEFLGL-EKTITLLPSSGKQSEVIVGVIDTGVW  135

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV--GE  649
             PE  SF D GL P+P SW+ +CE G  F +++CN+K++GAR + +GYEA  G PI    E
Sbjct  136   PELKSFDDTGLGPVPKSWKGECETGKTFNSSNCNKKLVGARFFAKGYEAAFG-PIDENTE  194

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              KS RD +GHG+H ++ AAGSAVA A++ G A G A+G+AT AR+A YKVCWLG C  +D
Sbjct  195   SKSPRDDDGHGSHTSTTAAGSAVAGASLFGFASGTAKGMATQARVAAYKVCWLGGCFTSD  254

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             I + +D+A+ DGV+VLS+S+      G    Y +D +A+G F A++ G++VS +AGN GP
Sbjct  255   IAAAIDKAIEDGVNVLSMSIG-----GGLTDYYKDTVAMGTFAAIEHGILVSSSAGNGGP  309

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS-  1186
                +  N+APWI TVGA TIDR+FPA +TLGN   + G SLY+G  P    +P+VY  + 
Sbjct  310   SKASLANVAPWITTVGAGTIDRDFPAYITLGNGNRYNGVSLYNGKLPPNSPLPLVYAANV  369

Query  1187  ---ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
                ++   C    L  SKV G+IV C++G +    +K + V +AGG+GMI+ N  + G +
Sbjct  370   SQDSSDNLCSTDSLIPSKVSGKIVICDRGGNPR-AEKSLVVKRAGGIGMILANNQDYGEE  428

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  ++  +P A +       I++Y  +A  PTA+I F GT  G  PS P VAAFS RGPN
Sbjct  429   LVADSFLLPAAALGEKASNEIKKYASSAPNPTAKIAFGGTRFGVQPS-PVVAAFSSRGPN  487

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAML  1684
              LTP+ILKPD+IAPGVNILA W+G +             FN+ISGTSM+CPHVSGLAA+L
Sbjct  488   ILTPKILKPDLIAPGVNILAGWSGKVGPTGLSVDTRHVSFNIISGTSMSCPHVSGLAALL  547

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             K  +P WSPAAI+SALMTT+Y    +G+ T+ D+ T  P TP  YGSGHVDP  A+DPGL
Sbjct  548   KGAHPEWSPAAIRSALMTTSYGTYKNGQ-TIKDVATGIPATPLDYGSGHVDPVAALDPGL  606

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF-----  2029
             VYDA  +DY++FLC + Y+S +I L  R      C  R       LNYPSFSV F     
Sbjct  607   VYDATTDDYLNFLCALNYNSFQIKLVARRE--FTCDKRIKYRVEDLNYPSFSVPFDTASG  664

Query  2030  ---KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
                 +N   V YKR + NV         V+ Q+P + ++ V P  L F +  +  SY VT
Sbjct  665   RGSSHNPSIVQYKRILTNVGAPSTYKVSVSSQSPLD-KIVVEPQTLSFKELNEKKSYTVT  723

Query  2201  F--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F   S+     SF  L WSDG H VTSPIA SW
Sbjct  724   FTSHSMPSGTTSFAHLEWSDGKHKVTSPIAFSW  756



>ref|XP_004501532.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/758 (46%), Positives = 474/758 (63%), Gaps = 48/758 (6%)
 Frame = +2

Query  107   EEPK-SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
             + PK ++I+ M K   P  F+ H  WY S + ++S       S+E+LYTY+HVAHGFS R
Sbjct  38    QHPKRTYIIHMDKFNMPTSFNDHLQWYDSSLKSVS------ESAEMLYTYKHVAHGFSTR  91

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLD  463
             LT  +A  L   PG++SV+P+   EL TTR+P+FLGL   ++ L  S    +++I+GV+D
Sbjct  92    LTTQEAELLTKQPGILSVIPEVRYELHTTRTPEFLGL-EKTTTLLVSYGKQSEVIVGVID  150

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI-  640
             +G+WPE  SF D  L P+P+SW+ +CE G NF +++CN+K++GAR + +GYEA  G PI 
Sbjct  151   TGVWPELKSFDDTKLGPVPSSWKGECETGKNFNSSNCNKKLVGARFFAKGYEAAFG-PID  209

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD +GHG+H ++ AAGSAVA A++ G A G ++G+AT AR+A YK CWLG C
Sbjct  210   ETAESKSPRDDDGHGSHTSTTAAGSAVAGASLFGFASGTSKGMATQARVATYKACWLGGC  269

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
               +DI++G+D+A+ DGV++LS+S+      G  + Y ED +A+G F A++ G++VS +AG
Sbjct  270   FTSDIVAGIDKAIEDGVNILSMSIG-----GNLMDYYEDTVAMGTFAAMEHGILVSSSAG  324

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP   T  N+APWI TVGA T+DR+FPA +TLGN + + G SLY G  P    +P+VY
Sbjct  325   NGGPSQATLANVAPWITTVGAGTLDRDFPAYITLGNGKRYNGVSLYDGKLPPDSPLPLVY  384

Query  1178  GGS----ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
               +    ++   C    L  SKV G+IV C++G +   V+K + V  AGG+GMI+ N  +
Sbjct  385   AANVSQDSSGNLCTTDSLIPSKVSGKIVICDRGGNPR-VEKSLVVKLAGGIGMILANNQD  443

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  ++  +P   +       +++YV +A  PTA+I F GT +G  PS P VAAFS 
Sbjct  444   YGEELVADSYLLPAGALGEKASNEVKKYVFSAPNPTAKIVFGGTELGVQPS-PVVAAFSS  502

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN LTP+ILKPD+IAPGVNILA WTG +             FN+ISGTSM+CPHVSGL
Sbjct  503   RGPNTLTPKILKPDLIAPGVNILAGWTGKVGPTGLSVDTRHVSFNIISGTSMSCPHVSGL  562

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             +A+LK  +P W+PAAI+SALMTT+Y     G+ T+ D+ T  P TP  YG+GHVDP  A+
Sbjct  563   SALLKGAHPEWTPAAIRSALMTTSYRTYKDGQ-TIKDVATGTPATPFDYGAGHVDPVAAL  621

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF-  2029
             DPGLVYDA V+DY+ FLC + Y S +I L  R      C  R       LNYPSF+V F 
Sbjct  622   DPGLVYDASVDDYLSFLCALKYTSFQIKLVARRE--FTCDKRIKYRVEDLNYPSFAVPFD  679

Query  2030  --------KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTL  2185
                          TV YKR + NV         V+ Q+P  V++ V P  L F +  +  
Sbjct  680   TASGIRGGSQKTSTVQYKRVLTNVGTPSTYKVSVSSQSPL-VKIMVEPQTLSFKELYEKK  738

Query  2186  SYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              Y VTF   S+     SF  L WSDG H VTSPIA SW
Sbjct  739   GYTVTFTSHSMPSGTTSFAHLEWSDGKHKVTSPIAFSW  776



>ref|XP_007225532.1| hypothetical protein PRUPE_ppa025871mg [Prunus persica]
 gb|EMJ26731.1| hypothetical protein PRUPE_ppa025871mg [Prunus persica]
Length=765

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/759 (47%), Positives = 476/759 (63%), Gaps = 46/759 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSAR  283
             +  K++I+ M KS+ P  F+  H  WY S + ++S       S+++LYTY++V HGFS R
Sbjct  22    QTKKTYIIQMDKSKMPASFADDHFQWYGSSLKSVS------NSADMLYTYKNVIHGFSTR  75

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG-SSNLGPSSDYGADIIIGVL  460
             LT  +A  L    G++SV+P+   EL TTR+PQFLG++ G +  + P+S+    +IIGV+
Sbjct  76    LTAEEAELLERQSGILSVMPELRYELHTTRTPQFLGMLGGINEAVFPASEKLGKVIIGVV  135

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+G+WPE  S+ D+GL P+P SWR +CE G NF ++SCNRK+IGAR + +GYEA    PI
Sbjct  136   DTGVWPEIKSYDDKGLGPVPRSWRGQCEEGKNFNSSSCNRKLIGARFFPKGYEASNLGPI  195

Query  641   VG--EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E +S RDV+GHGT  ++IAAGSAV  A++ G+A G ARG+AT AR+A YK CW G 
Sbjct  196   DEKVESRSPRDVDGHGTQASTIAAGSAVPGASLYGYASGTARGMATQARVATYKACWSGW  255

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DIL+ MD+AV DGVH+LS+S+       F      D IAIGAF A+ KGV VSC+A
Sbjct  256   CLSSDILAAMDKAVEDGVHILSVSIGRSQYEDFY----TDFIAIGAFSAMAKGVFVSCSA  311

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVV  1174
             GN GP+  +  N APWI TVGA TIDR+FPA V+LGN + + G S+YSG   S    P+V
Sbjct  312   GNRGPEADSTSNNAPWITTVGAGTIDRDFPAHVSLGNGKKYRGASIYSGTHLSSGLHPLV  371

Query  1175  YGGSANSFY-------CFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVP  1333
             Y  +A++         C P  L   KV G+IV C+QG   S VDK + V +AGG+GMI+ 
Sbjct  372   YARNASNSTSDSTSDPCAPDSLIPEKVFGKIVVCDQGGTYSRVDKSMVVKKAGGMGMILA  431

Query  1334  NLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVA  1513
             ++   G +L  ++  +P  VV   +G+ I++Y+ +   P A      T +G  PS P VA
Sbjct  432   DIEGYGEELVVDSYVLPVVVVGQKEGDAIKRYIVSHDNPKATFSGGKTELGVEPS-PVVA  490

Query  1514  AFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPH  1660
             AFS RGPN +   +LKPD+IAPGVNILA WTG+L             FN+ SGTSM+CPH
Sbjct  491   AFSSRGPNPVALTVLKPDLIAPGVNILAGWTGALGPARRAEDTRRVSFNIFSGTSMSCPH  550

Query  1661  VSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDP  1840
             VSGLAA+LK  +P WSPAAIKSALMTT+Y    +G   + D+ T +P TP  YG+GHVDP
Sbjct  551   VSGLAAVLKAAHPKWSPAAIKSALMTTSYATYKNG-APIKDVATGKPATPFDYGAGHVDP  609

Query  1841  THAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFS  2020
               A+DPGLVYD GV DY++FLC   Y S  I +         C +    + G LNYPSF+
Sbjct  610   VAALDPGLVYDLGVKDYLNFLCAYRYTSSDIKILTHID--FTCDSSKNYSAGDLNYPSFA  667

Query  2021  VLFKNN-----LQTVIYKRTVKNVAKVRNVAYQVTVQTPS-NVRVTVSPNRLVFTDRIDT  2182
             V    N       T IY RT+ NV       Y+V+V TPS  V++ V P  L FT   + 
Sbjct  668   VSLNTNSGNWGAGTKIYTRTLTNVGTPGT--YKVSVSTPSPAVKILVEPKSLSFTRAYEK  725

Query  2183  LSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              +Y VTF   ++    ++F  L WSDG H+V+SPIAVSW
Sbjct  726   KTYTVTFVVSAMPSGTNNFTRLEWSDGKHIVSSPIAVSW  764



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/755 (47%), Positives = 471/755 (62%), Gaps = 40/755 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHT-LSPLSNHSRSSE--LLYTYEHVAHGFSARL  286
             K++++ M KS  P+ F  H +WYSS + + LS L      SE  ++YTY++  HG +A+L
Sbjct  33    KTYLIQMDKSAMPKAFPNHLEWYSSKVKSALSTLPEADADSEKRIIYTYQNAFHGVAAKL  92

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSNLGPSSDYGADIIIGVLD  463
             T  +A +L    GV+++ PD   EL TTRSP FLGL    + N+      G D+I+GVLD
Sbjct  93    TEGEAKKLETEEGVVAIFPDTKYELHTTRSPTFLGLEPEKAPNMWSEKLAGHDVIVGVLD  152

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPE  SF D  + P+P  W+  CE+G  F  + CN+K++GAR +Y GYEA IG+   
Sbjct  153   TGIWPESESFKDVSMGPVPAHWKGACEIGTGFTKSHCNKKVVGARVFYHGYEAAIGRINE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KSARD +GHGTH A+   GS V  AN+ G+A G ARG+A  ARIA YKVCW+G C 
Sbjct  213   QKEFKSARDQDGHGTHTAATVGGSPVLGANLLGYANGTARGMAPGARIAAYKVCWIGGCF  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DI+S +D+AVADGV+VLS+SL      G    Y  D +++ AFGA+++GV VSC+AGN
Sbjct  273   SSDIVSAIDKAVADGVNVLSISLG-----GGVSSYYRDSLSVAAFGAMERGVFVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI--QVPVV  1174
              GPDP +  N++PWI TVGASTIDR+FPA V LGN +  +G SLY G        Q P+V
Sbjct  328   AGPDPASLTNVSPWITTVGASTIDRDFPAQVKLGNGKIVSGVSLYKGQSALSFEKQYPLV  387

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y GS +S       C  G LD   V G+IV C++G     V KG  V  AGGVGMI+ N 
Sbjct  388   YLGSNSSRVDPRSMCLEGTLDPKVVSGKIVVCDRGLSPR-VQKGHVVRSAGGVGMILTNT  446

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                  +L  +   +P   +   +G+ I+ YV+++   TA + FKGT +G  PS P VAAF
Sbjct  447   EANREELVADCHLLPAVAIGEKEGKDIKSYVQSSQSATATLAFKGTTLGIRPS-PVVAAF  505

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAW+ ++            +FN++SGTSM+CPHVS
Sbjct  506   SSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKVDNRREKFNILSGTSMSCPHVS  565

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA LK  +P WSPAAIKSALMTTAY +DN+ + TL D  T +P++P+ +GSGH+DP  
Sbjct  566   GIAAFLKSRHPEWSPAAIKSALMTTAYVLDNT-KKTLRDASTAKPSSPYDHGSGHIDPIR  624

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+DPGLVYD    DY +FLCT      ++ +F + S    C   +L +PG LNYP+ S +
Sbjct  625   ALDPGLVYDIEPQDYFEFLCTQKLSPTQLRVFSKYSNR-SC-THSLVSPGDLNYPAISSI  682

Query  2027  FKNNLQT-----VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
             F     T     VI  RTV NV    +  YQV V       V V P  L FT     LSY
Sbjct  683   FTQKTATSFSDPVIVHRTVTNVGP-PDSNYQVVVSPFEGSSVKVEPETLNFTKTHQNLSY  741

Query  2192  EVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             ++TF   +RQ++  FGSL W DG H V SPI ++W
Sbjct  742   KITFTPRVRQTSPEFGSLVWKDGLHTVRSPIVITW  776



>emb|CDY22001.1| BnaC09g01070D [Brassica napus]
Length=734

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/748 (46%), Positives = 465/748 (62%), Gaps = 64/748 (9%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY S + ++S       S+ELLYTY    HGFS RLT
Sbjct  29    QQSTYIVHMAKSQMPSSFDQHSLWYESSLRSVS------ESAELLYTYNSAIHGFSTRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGP-SSDYGADIIIGVLDS  466
             P +A  L   PGVISVLP++  EL TTR+P FLGL   ++ L P ++   +DI++GV DS
Sbjct  83    PEEADSLMTHPGVISVLPEKRYELDTTRTPHFLGLDVHNAGLFPETTGASSDIVVGVFDS  142

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG  646
             G+WPE  SF+D G  PIP +W+  C+ G NF A+ CNRK++GAR + RGYE EI  P+  
Sbjct  143   GVWPESKSFADEGYGPIPPTWKGGCDTGTNFTASLCNRKLVGARFFARGYE-EINGPV--  199

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCW-LGTCSN  823
                 + D+ G                        G ARG+A+ AR+A+YKVCW  G C +
Sbjct  200   --DESIDLLGFA---------------------NGTARGVASRARVAIYKVCWRYGGCLS  236

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+GMD+A+ D V+V+S+S++       A+ Y  D++AIGAF A+++G+ VSC+AGN 
Sbjct  237   SDILAGMDKAIEDNVNVMSISISE-----IAVDYYGDIMAIGAFAAMERGIFVSCSAGNR  291

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  Y+  N+APWI TVGA TIDR+FPA+V LGN +++TG SL+ G       +  VY G
Sbjct  292   GPSSYSVRNVAPWITTVGAGTIDRDFPALVILGNGQNYTGASLFKGDALPPKLLSFVYAG  351

Query  1184  SANS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C+P  L   KV+G+IV CE G + S V KG  V  AGG+GMI+PN  ++G
Sbjct  352   NASNNDTGNLCYPETLIPEKVKGKIVMCEDGGN-SRVHKGEVVKAAGGLGMILPNTADDG  410

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L+  A  +P A V    G++IR YV T   PTARI  +GTV+   PS P +AAFS RG
Sbjct  411   EELQAVAYLLPAATVGQKAGDVIRNYVLTDPNPTARIVIQGTVVNVQPS-PVLAAFSSRG  469

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAA  1678
             PN +TP ILKPD+IAPGVNILA WTG  +           EFN++SGTSM+CPHVSGLAA
Sbjct  470   PNPVTPNILKPDLIAPGVNILAGWTGVASPTRLDSDTRRVEFNILSGTSMSCPHVSGLAA  529

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY     G+  +ID+ T  P+TP  +G+GHV PT A +P
Sbjct  530   LLKSVHPQWSPAAIRSALMTTAYKSYKDGK-QIIDIATVTPSTPLGHGAGHVSPTTATNP  588

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GL+YD    DY+DFLC + Y +  I +  R +    C      +   LNYPSF+V + + 
Sbjct  589   GLIYDLTAVDYLDFLCAMDYTASDIEIVSRRN--YTCDPSKAYSVADLNYPSFAV-YVDV  645

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---S  2209
                  Y RTV +V      + +VT +T + V++ V P  L F +  +  SY VTF    S
Sbjct  646   AGEYKYTRTVTSVGGAGTYSVKVTSETRA-VKILVEPAVLNFKEVNEKKSYAVTFTVDLS  704

Query  2210  LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 ++SFGS+ WSDG H+V+SP+AVSW
Sbjct  705   KPSGSNSFGSIEWSDGKHVVSSPVAVSW  732



>ref|XP_002533857.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF28521.1| Cucumisin precursor, putative [Ricinus communis]
Length=753

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/757 (47%), Positives = 470/757 (62%), Gaps = 51/757 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K+FI  +    KP +F TH+ WY+S      PL       ++L+ Y+ V HGFSA +TP 
Sbjct  11    KTFIFLVNSESKPSIFPTHYHWYTS--EFADPL-------QILHVYDAVFHGFSASITPD  61

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIW  475
              AS L+  P +++VL D   +L TTRSPQFLGL      L   SDYG+D+IIGV D+G+W
Sbjct  62    HASTLSQHPSILTVLEDHRRQLHTTRSPQFLGL-RNQRGLWSESDYGSDVIIGVFDTGVW  120

Query  476   PERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI--GKPIVG-  646
             PER SFSD  L P+P  W+  CE G  F A +CN+K+IGAR + +G+EA      PI G 
Sbjct  121   PERRSFSDVNLGPVPTRWKGVCESGVKFTAKNCNKKLIGARFFIKGHEAAARSAGPISGI  180

Query  647   ----EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E KS RD +GHGTH AS AAG     A++ G+A G A+G+A  AR+AVYKVCW  +
Sbjct  181   NETVEFKSPRDADGHGTHTASTAAGRHSFRASMAGYAAGIAKGVAPKARLAVYKVCWKNS  240

Query  815   -CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C ++DIL+  D AVADGV V+S+S+      G + PY  D IAIGA+ A  +GV VS +
Sbjct  241   GCFDSDILAAFDAAVADGVDVISISIGGGD--GISSPYYLDPIAIGAYAAASRGVFVSSS  298

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPV  1171
             AGN GP+  +  NLAPW++TVGA TIDR FPA V LGN R  +G SLYSG+  +    P+
Sbjct  299   AGNDGPNLMSVTNLAPWVVTVGAGTIDRNFPADVILGNGRRLSGVSLYSGLPLNGKMYPL  358

Query  1172  VYGGSANSF---YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             VY G +       C    LD + VRG+IV C++G       KG+ V +AGGVGMI+ N  
Sbjct  359   VYPGKSGMLSASLCMENSLDPAIVRGKIVICDRGSSPRAA-KGLVVKKAGGVGMILANAI  417

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
             + G  L  +A  IP   V   + + ++ YV    +PTA I+FKGTV+G  P AP VA+FS
Sbjct  418   SNGEGLVGDAHLIPACAVGSDEADAVKAYVSNTRYPTATIDFKGTVLGIKP-APVVASFS  476

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN L PEILKPD+IAPGVNILAAWT ++           TEFN++SGTSMACPHVSG
Sbjct  477   GRGPNGLNPEILKPDLIAPGVNILAAWTDAVGPTGLDSDSRKTEFNILSGTSMACPHVSG  536

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
              AA+LK  +P+WS AAI+SA+MTTA T+DN  R ++ D  T +  +P+ +G+GH++   A
Sbjct  537   AAALLKSAHPNWSAAAIRSAMMTTANTLDNLNR-SMTDEATGKACSPYDFGAGHLNLDRA  595

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDC-RNRNLGNPGSLNYPSFSVL  2026
             +DPGLVYD   NDYV+FLC IGY  + I +  R    V+C   R L  PG+LNYPS + L
Sbjct  596   MDPGLVYDITNNDYVNFLCGIGYSPKAIQVITRTP--VNCPMKRPL--PGNLNYPSIAAL  651

Query  2027  FKNNLQTVIYK---RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             F  + + V  K   RT  NV  V N  Y+  ++ P  V VTV P++LVF   +   S+ V
Sbjct  652   FPTSAKGVTSKAFIRTATNVGPVVNAVYRAIIEAPKGVTVTVKPSKLVFNQAVKKRSFVV  711

Query  2198  TFQS------LRQSADSFGSLRWSDGTHLVTSPIAVS  2290
             T  +      +  S   FGS+ WS+G H+V SPI V+
Sbjct  712   TLTADTRNLMVDDSGALFGSVTWSEGMHVVRSPIVVT  748



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/761 (46%), Positives = 482/761 (63%), Gaps = 52/761 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSE-------LLYTYEHVAH  268
             E +++I+ M K++     S H  +Y ++I +++ LS+     E       LLY YE    
Sbjct  23    EEQTYIIHMDKTKMTD--SDHQQYYQAVIDSITKLSSQEEEKENKTPTPQLLYIYETAIS  80

Query  269   GFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADII  448
             GF+A+L+ +Q   L  V G +  +PD L+ L TT +PQFLGL +G   L  +S+  +D+I
Sbjct  81    GFAAKLSTNQLKSLNQVDGFLFAIPDELLSLHTTHTPQFLGLQNGK-GLWSASNSASDVI  139

Query  449   IGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI  628
             +G++D+GIWPE  SF D G++P+P+ W+  CE G  F  ++CN+K+IGARA+ +GYEA +
Sbjct  140   VGLVDTGIWPEHVSFQDSGMSPVPSRWKGTCEEGTKFSFSNCNKKLIGARAFVQGYEAIV  199

Query  629   GKPIVGEP---KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKV  799
             G+  V E    +S RD NGHGTH AS AAG+ V  A++ G A+G A G+   ARIA YK 
Sbjct  200   GR--VNETVDYRSPRDSNGHGTHTASTAAGNFVNQASLFGLAKGSASGMKYTARIAAYKA  257

Query  800   CWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVI  979
             CW   C+N+D+++ +D AVADGV +LSLSL      G + PY +D IAI +FGA+Q GV 
Sbjct  258   CWTSGCANSDVMAAIDSAVADGVDILSLSLG-----GVSKPYYKDNIAIASFGAIQHGVS  312

Query  980   VSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI  1159
             VSC+AGN GP   +  N APWI+TV AS  DR FP  V LG+ + F G+SLYSG +  R+
Sbjct  313   VSCSAGNSGPSRSSVSNAAPWIMTVAASYSDRSFPTAVKLGDGQIFEGSSLYSGKKTKRL  372

Query  1160  QVPVVY---GGSANSFYCFPGQLDASKVRGRIVFCEQG--DDTSIVDKGVAVSQAGGVGM  1324
               P+VY    GS  + YCF G L    V+G+IV CE+G    T + DK   V +AGG GM
Sbjct  373   --PLVYNRTAGSQGAEYCFEGSLVKKLVKGKIVVCEEGIYSRTEVGDK---VKKAGGAGM  427

Query  1325  IVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAP  1504
             ++ N  +EG +L  +A  +P   +  +  + IR+YV +A  P+A I F+GTV GN  +AP
Sbjct  428   LLLNSEDEGEELLADAHILPATSLGASAAKAIRKYVGSAKKPSALIVFQGTVYGN--TAP  485

Query  1505  RVAAFSCRGPNFLTPEILKPDVIAPGVNILAAW----TGSLTE-------FNMISGTSMA  1651
              +AA S RGPN   P+++KPDV APGV+ILAAW    + S+ E       FN+ISGTSM+
Sbjct  486   VMAALSSRGPNSAGPDVIKPDVTAPGVDILAAWPPNISPSMLESDNRSVLFNIISGTSMS  545

Query  1652  CPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGR--GTLIDLYTRQPTTPHAYGS  1825
             CPHVSGLA++LK ++  WSPAAIKSALMTTAYT++N G     +    T +  TP A+GS
Sbjct  546   CPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKGAPIADIGSTSTSKSATPFAFGS  605

Query  1826  GHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLN  2005
             GHVDP +A DPGLVYD    DY+ +LC++ Y+S +IALF        C    +  PG LN
Sbjct  606   GHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFT-CPKNAVLQPGDLN  664

Query  2006  YPSFSVLFKNNLQ--TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRID  2179
             YPSFSVLF  + +  +V YKRTVKNV K+ +  Y V V+ P+ V VTV P  L F    +
Sbjct  665   YPSFSVLFSKDARNMSVTYKRTVKNVGKIPST-YAVQVKEPTGVSVTVEPRSLGFKKMGE  723

Query  2180  TLSYEVTFQSLRQSA---DSFGSLRWSDGTHLVTSPIAVSW  2293
              LSY+V+F +L   A    SFG+L W  G + V SPIAV+W
Sbjct  724   KLSYKVSFVALGGPALTNSSFGTLTWVSGKYRVGSPIAVTW  764



>emb|CDY18651.1| BnaA09g07440D [Brassica napus]
Length=751

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/749 (47%), Positives = 458/749 (61%), Gaps = 54/749 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KS+ P  F  H  WY S       L + S S+E+LYTY    HGF+ RLTP +
Sbjct  32    TYIVHMAKSQMPSSFDQHSLWYES------SLKSASESAEMLYTYNSAIHGFATRLTPEE  85

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PGVISV P++  EL TTR+P FLGL   ++ L P +   +D++IGVLDSG+WP
Sbjct  86    ADSLMTQPGVISVQPEQQYELHTTRTPLFLGLDVHNAGLFPETGAASDVVIGVLDSGVWP  145

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGEPKS  658
             E  SFSD G  P+P +W+ +CE G NF A+ CNRK+IGAR +Y   +         E +S
Sbjct  146   ESKSFSDEGYGPVPTTWKGECEAGTNFTASHCNRKLIGARFFYGPVDES------KESRS  199

Query  659   ARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILS  838
              RD +GHGTH AS AAGS V  AN+ G A G ARG+A  AR+AVYKVCW   C ++D+L+
Sbjct  200   PRDDDGHGTHTASTAAGSIVEGANLLGFANGTARGMAYRARVAVYKVCWKPKCFSSDVLA  259

Query  839   GMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPY  1018
             G+D+A+ D V+V           G       + IA+GAF A++KG+ VSC+AGN GP P 
Sbjct  260   GIDKAIEDNVNV------LSLSLGKRKRDYTNHIAMGAFSAMEKGIFVSCSAGNDGPSPS  313

Query  1019  TAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYS--GVQPSRIQVPVVYGGSAN  1192
             +  N+APWI TVGA TIDR+FP +VTLGN +S+ G SL+    + P        YG S  
Sbjct  314   SLSNVAPWITTVGAGTIDRDFPTLVTLGNGKSYIGASLFKKDALPPKLASNNATYGKS--  371

Query  1193  SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEPNA  1372
                C  G L   KV G+IV CE+G++    +KG  V  AGG+GMI+ N  + G +L   A
Sbjct  372   ---CLSGTLIPEKVYGKIVMCEKGENGR-AEKGEVVKAAGGIGMILANRASRGEELAAYA  427

Query  1373  DRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLTPE  1552
               +P   V    G+IIR+YV T   PT  I  +GTV+   PS P +AAFS RGPN +TP 
Sbjct  428   HVLPATNVGQKAGDIIRRYVMTDPNPTVSIVIQGTVVNVKPS-PVLAAFSSRGPNPITPN  486

Query  1553  ILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKIYP  1699
             ILKPD+IAPGVNILAAWTG+L            EFN+ISGTSM+CPHVSGLAA+LK ++P
Sbjct  487   ILKPDLIAPGVNILAAWTGALGPSGLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHP  546

Query  1700  SWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYDAG  1879
              WSPAAI+SALMTTAY+    G+  L+D+ T +P+TP  +G+GHV P  A+ PGL+YD  
Sbjct  547   EWSPAAIRSALMTTAYSTYKDGQ-PLLDIATVKPSTPFGHGAGHVSPAMAISPGLIYDLT  605

Query  1880  VNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNNLQTVIYK  2059
               DY+DFLC + Y+  +I    R      C      +   LNYPSF+V    +  T  Y 
Sbjct  606   TEDYIDFLCALKYNQSQIIKVSRGD--YTCDPSKTYSVADLNYPSFAVNVDKS-DTYKYT  662

Query  2060  RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT----------FQS  2209
             RTV NV    + + +V  +T + V+++V P  L F +  +  SYEVT          F S
Sbjct  663   RTVTNVGGAGSYSVKVISET-TEVKISVEPAVLTFKEVNEKKSYEVTFTVNSSKPPRFSS  721

Query  2210  LRQSA-DSFGSLRWSDGTHLVTSPIAVSW  2293
              R S  +SFGS+ WSDG H+V SP+A+SW
Sbjct  722   FRPSGFNSFGSIEWSDGKHVVASPVAISW  750



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/755 (47%), Positives = 468/755 (62%), Gaps = 40/755 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E+ +++IV M KS  P   + H +WY + + ++S  ++ ++   +LY Y+ V HGFSARL
Sbjct  23    EKRRTYIVHMAKSAMPAECAXHAEWYGASLRSVSASASAAK---MLYAYDTVLHGFSARL  79

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             TP +AS+LA+  GV++V P+   EL TTR+P+FLG+      L P S    D+++GVLD+
Sbjct  80    TPQEASDLASAEGVLAVNPEARYELHTTRTPEFLGIAG--QGLSPQSGTAGDVVVGVLDT  137

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPA-TSCNRKIIGARAYYRGYEAEIGKPIV  643
             G+WPE  S+ D GL  +P  W+ +C  GP F A T+CNRK++GAR + +GYEA +G    
Sbjct  138   GVWPESKSYDDXGLAEVPAWWKGQCXXGPGFDASTACNRKLVGARFFNKGYEAAMGPMDT  197

Query  644   G-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +S  D +GHGTH +S AAG+AV  A++ G A G ARG+A  AR+A YKVCWLG C 
Sbjct  198   DRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGTARGMAPRARVAAYKVCWLGGCF  257

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+GMD AVADG  VLSLSL      G A  Y  D +AIGAF A ++ V+VSC+AGN
Sbjct  258   SSDILAGMDAAVADGCGVLSLSLG-----GGAADYSRDSVAIGAFAATEQNVLVSCSAGN  312

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   T  N+APWI TVGA T+DR+FPA V LG+ +++TG SLY+G       +P+VY 
Sbjct  313   AGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYTGVSLYAGKPLPSAPIPIVYA  372

Query  1181  GSANSF----YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
              +A++      C PG L   KV G+IV C++G  ++ V KG+ V  A G GM++ N    
Sbjct  373   ANASNSTAGNLCMPGTLVPEKVAGKIVVCDRG-VSARVQKGLVVRXAXGAGMVLSNTAAN  431

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  +A  +P A V   +G  I+ YV +A+ PT  +   GT +G  PS P VAAFS R
Sbjct  432   GQELVADAHLLPAAGVGEREGTAIKSYVASATNPTTTVVVAGTEVGVRPS-PVVAAFSSR  490

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN +TPEILKPD+IAPGVNILA+WTG               FN+ISGTSM+CPHVSGLA
Sbjct  491   GPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRVGFNIISGTSMSCPHVSGLA  550

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+L+  +P WSPAA++SALMTTAY    SG  +L+D  T    TP  YG+GHVDP  A+D
Sbjct  551   ALLRSAHPEWSPAAVRSALMTTAY-ASYSGGSSLLDAATGGMATPFDYGAGHVDPARALD  609

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYD G  DYVDFLC + Y S  IA   R+       N+   + G+LNYPSFSV +  
Sbjct  610   PGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTY-SVGALNYPSFSVAYST  668

Query  2033  ------NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                    +  TV + RT+ NV          ++     V V V P  L FT   +  SY 
Sbjct  669   ANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYT  728

Query  2195  VTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2293
             V F S  Q + +  FG L WSDG H V SPIA +W
Sbjct  729   VRFTSKSQPSGTAGFGRLVWSDGKHSVASPIAFTW  763



>gb|ABD33266.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
Length=765

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/759 (46%), Positives = 477/759 (63%), Gaps = 48/759 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +   ++I+ M KS  P+ F+ H +W+ + + ++S       ++E+LYTY+H+AHG+S RL
Sbjct  24    QTKNTYIIHMDKSTMPETFTDHLNWFDTSLKSVS------ETAEILYTYKHIAHGYSTRL  77

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L+  PG++ V+P+   +L TTR+PQFLGL   ++ L P S   + +IIG+LD+
Sbjct  78    TNQEAETLSKQPGILDVIPELRYQLHTTRTPQFLGL-PKTNTLLPHSRQQSQVIIGILDT  136

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPE  S  D GL PIP++W+  CE G N  ++ CN+K+IGAR + +GYEA +G PI  
Sbjct  137   GIWPELKSLDDTGLGPIPSNWKGVCETGNNMNSSHCNKKLIGARFFLKGYEAALG-PIDE  195

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KSARD +GHG+H  + AAGS VA A++ G A G ARG+AT AR+A YKVCWL  C 
Sbjct  196   TTESKSARDDDGHGSHTLTTAAGSVVAEASLFGLASGTARGMATEARVAAYKVCWLSGCF  255

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DI +GMD+A+ DGV++LS+S+      G  + Y  D+IAIGAF A+  G++VS +AGN
Sbjct  256   TSDIAAGMDKAIEDGVNILSMSIG-----GSIMDYYRDIIAIGAFTAMSHGILVSSSAGN  310

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP   +  N+APWI TVGA TIDR+FP+ +TLGN +++TG SLY+G   S   +PVVY 
Sbjct  311   GGPSAESLSNVAPWITTVGAGTIDRDFPSYITLGNGKTYTGASLYNGKPSSDSLLPVVYA  370

Query  1181  G----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G    S+  + C P  L +SKV G+IV CE+G + S V+KG+ V  AGGVGMI+ N    
Sbjct  371   GNVSESSVGYLCIPDSLTSSKVLGKIVICERGGN-SRVEKGLVVKNAGGVGMILVNNEAY  429

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  +P A +      +++ YV T   P A++ F GT +   PS P VAAFS R
Sbjct  430   GEELIADSHLLPAAALGQKSSTVLKDYVFTTKNPRAKLVFGGTHLQVQPS-PVVAAFSSR  488

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTP+ILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPH SGLA
Sbjct  489   GPNSLTPKILKPDLIAPGVNILAGWTGAVGPTGLALDKRHVNFNIISGTSMSCPHASGLA  548

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A++K  YP WSPAAI+SALMTTAYT   +G+ T++D+ T +P TP  +GSGHVDP  A+D
Sbjct  549   AIVKGAYPEWSPAAIRSALMTTAYTSYKNGQ-TIVDVATGKPATPFDFGSGHVDPVSALD  607

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYD  V+DY+ F C + Y S +I L  R     D R +        NYPSF+V  + 
Sbjct  608   PGLVYDINVDDYLGFFCALNYTSYQIKLAARREFTCDARKKY--RVEDFNYPSFAVALET  665

Query  2033  --------NNLQTVIYKRTVKNVAK--VRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDT  2182
                     N    V Y R + NV      N    ++    S+V+V V P  + F +  + 
Sbjct  666   ASGIGGGSNKPIIVEYNRVLTNVGAPGTYNATVVLSSVDSSSVKVVVEPETISFKEVYEK  725

Query  2183  LSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               Y+V F   S+     SFG L W+DG H V SPIA SW
Sbjct  726   KGYKVRFICGSMPSGTKSFGYLEWNDGKHKVGSPIAFSW  764



>ref|XP_011076276.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/757 (47%), Positives = 471/757 (62%), Gaps = 44/757 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS------ELLYTYEHVAHGFS  277
             K++IV+M K  KPQ FS H  WYSS+I +++      R         ++Y Y+   HG +
Sbjct  34    KTYIVYMDKWAKPQEFSDHRQWYSSMIKSVASSRTEKRDDADENDDRIIYNYQTAFHGVA  93

Query  278   ARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI---SGSSNLGPSSDYGADII  448
             A+L+  +  +L    GV++V P+ +  L TTRSP FLGL    S S+     SDY  D++
Sbjct  94    AQLSEEEVEKLLEQDGVMAVFPETVYHLHTTRSPLFLGLEREDSTSAFTDKLSDY--DVV  151

Query  449   IGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI  628
             +GVLD+GIWPE  SF+D G++ IP  W+  CE G  F   +CNRKI+GAR +YRGYEA  
Sbjct  152   VGVLDTGIWPESPSFNDTGMSRIPPHWKGTCETGRGFSRHNCNRKIVGARVFYRGYEAAS  211

Query  629   GKPIVGEP-KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCW  805
             GK    E  KS RD +GHGTH A+  AGS V  AN+ G+A G ARG+A  ARIA YKVCW
Sbjct  212   GKINEQEEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYAYGTARGMAPGARIAAYKVCW  271

Query  806   LGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVS  985
              G C ++DILS MDQAVADGV+VLS+SL      G    Y  D ++IGAFGA+++GV++S
Sbjct  272   TGGCFSSDILSAMDQAVADGVNVLSISLG-----GGVSSYYRDSLSIGAFGAMERGVLIS  326

Query  986   CAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI--  1159
             C+AGN GPDP +  N++PW+ TVGAST+DR+FPA + LG  + FTG SLY G +   +  
Sbjct  327   CSAGNGGPDPISLTNVSPWVTTVGASTMDRDFPATIKLGTGKFFTGASLYKGKRNLAVNK  386

Query  1160  QVPVVYGGSAN-----SFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGM  1324
             Q P+VY GS +     S  C  G LD   V G+IV C++G     V KG  V  AGGVGM
Sbjct  387   QYPLVYHGSNSSNLTPSSMCLEGTLDRHSVAGKIVICDRGISPR-VQKGQVVKDAGGVGM  445

Query  1325  IVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAP  1504
             I+ N    G +L  +   +P   V    G++I+ Y  +    TA + F GT +   PS P
Sbjct  446   ILSNTAVNGEELVADCHLLPAVAVGETMGKMIKHYAASNHNATATLAFLGTKLRIRPS-P  504

Query  1505  RVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMA  1651
              VAAFS RGPN L+ EILKPD+IAPGVNILAAWTG L           T+FN++SGTSM+
Sbjct  505   VVAAFSSRGPNILSLEILKPDMIAPGVNILAAWTGELGPSSLPSDHRRTKFNILSGTSMS  564

Query  1652  CPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGH  1831
             CPHVSG+AA++K  +P WSPAAIKSALMTTAY  DN+    L D  T  P+TP+ +G+GH
Sbjct  565   CPHVSGVAALIKSRHPDWSPAAIKSALMTTAYVHDNT-HSPLTDASTAAPSTPYDHGAGH  623

Query  1832  VDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYP  2011
             ++P  A+DPGLVYD G  +Y +FLC  G  + ++ +F + S    CR+  L N   LNYP
Sbjct  624   INPLKALDPGLVYDIGAQEYFEFLCAQGLTASELQVFSKFSNRT-CRHA-LANSRDLNYP  681

Query  2012  SFSVLFKNNLQTVI--YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTL  2185
             + S +F  N  T +    RTV NV    + +Y V + T     V V P++L FT     +
Sbjct  682   AISAVFPENTNTTVLTLHRTVTNVGPPVS-SYHVVISTFKGASVKVEPSKLDFTGNRKKM  740

Query  2186  SYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +Y++TF +  RQSA  FGS+ W DG H V SP+ ++W
Sbjct  741   TYKITFTTKSRQSAPEFGSIIWKDGVHRVRSPVVITW  777



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/751 (47%), Positives = 468/751 (62%), Gaps = 42/751 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M   +KP  F THHDWYSS +  LS   +      LLY+Y    +GF+A L P 
Sbjct  23    KTYIVHMKHHDKPLSFETHHDWYSSSLQALSAAPD-----SLLYSYTTAFNGFAASLDPE  77

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGL-----ISGSSNLGPSSDYGADIIIGVL  460
             Q   L     V+ V  D L  L TTR+PQFLGL     +    N         D+IIGVL
Sbjct  78    QVELLRKSDSVLGVYEDTLYTLHTTRTPQFLGLDTEFGLWAGHNTQQLEQASRDVIIGVL  137

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYE-AEIGKP  637
             D+G+WPE  SF D  +  +P+ WR +CE  P+F    CN+K+IGAR++ +GY  A  G  
Sbjct  138   DTGVWPESKSFDDSDMPDLPSKWRGECESAPDFSPKFCNKKLIGARSFSKGYHMATGGGG  197

Query  638   IVGEPK---SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
             I  +P+   S RD +GHGTH AS AAG+ VANA++ G+A G ARG+AT+AR+A YKVCW 
Sbjct  198   IYQKPREVESPRDKDGHGTHTASTAAGAHVANASLLGYASGTARGMATHARVASYKVCWE  257

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C  ADIL+GMD+A+ DGV VLSLSL      G + PY  D IAIGAF A++KG+ VSC
Sbjct  258   TGCFGADILAGMDRAIQDGVDVLSLSLG-----GGSAPYYRDTIAIGAFAAMEKGIFVSC  312

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP   T  N+APWI+TVGA T+DR+FPA   LGN   + G SLYSG       V 
Sbjct  313   SAGNSGPTKATLANVAPWIMTVGAGTLDRDFPAYAVLGNKIRYNGVSLYSGQGMGNKPVG  372

Query  1169  VVYG-GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
             +VY  G+ +S  C PG LD + VRG++V C++G +   V+KG  V  AGGVGMI+ N P 
Sbjct  373   LVYNKGNMSSNLCLPGSLDPAFVRGKVVICDRGTNAR-VEKGAVVRDAGGVGMILANTPV  431

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G +L  ++  +P   V    G++IR+Y R+   PTA + F GTV+   PS P VAAFS 
Sbjct  432   SGEELVADSHLLPAVAVGRKVGDLIREYARSDPKPTAVLVFGGTVLNVRPS-PVVAAFSS  490

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TP+ILKPDVI PGVNILAAW+ ++           T+FN++SGTSM+CPH+SGL
Sbjct  491   RGPNMVTPQILKPDVIGPGVNILAAWSEAIGPTGLAKDTRKTKFNIMSGTSMSCPHISGL  550

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK  +P WS +AIKSALMTTAYT DN+   +L D      + P A+G+GHVDP  A+
Sbjct  551   AALLKAAHPEWSTSAIKSALMTTAYTEDNT-NSSLRDAADGSLSNPWAHGAGHVDPQKAL  609

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
              PGLVYD    +Y+ FLC++GY    +   ++  P V C  +   +PG LNYPSFSVLF 
Sbjct  610   SPGLVYDISTEEYISFLCSLGYTIDHVKTIVKR-PNVTCSTK-FKDPGELNYPSFSVLFG  667

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
             +  + V Y R + NV   R++ Y+VTV  PS V ++V P  L+F    +   Y VTF + 
Sbjct  668   DK-RVVRYTRELTNVGPSRSI-YKVTVNGPSTVGISVRPTTLIFRSAGEKKRYTVTFVAK  725

Query  2213  RQSA----DSFGSLRWSDGTHLVTSPIAVSW  2293
             R ++      FGS+ WS+  + V SP++ SW
Sbjct  726   RGTSPMARSEFGSIVWSNAQNQVKSPVSFSW  756



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/748 (48%), Positives = 480/748 (64%), Gaps = 52/748 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV M KS+ P  F  H  WY S       L + S S+E+LYTY +  HGF+ RLT
Sbjct  29    QQSTYIVHMAKSQMPSSFDQHSLWYES------SLKSASESAEMLYTYNNAIHGFATRLT  82

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P +A  L   PGVISV  ++  EL TTR+P FLGL   ++ L P +   +D++IGVLD+G
Sbjct  83    PEEADSLMVQPGVISVQSEQQYELHTTRTPLFLGLEVHNAGLFPETGAASDVVIGVLDTG  142

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVGE  649
             +WPE  SFSD G  P+P++W+ +CE G NF A+ CNRK+IGAR +            V E
Sbjct  143   VWPESKSFSDEGYGPVPSTWKGECETGTNFTASLCNRKLIGARFF------------VTE  190

Query  650   PKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNAD  829
              +S RD +GHGTH AS AAGS V  AN+ G A G ARG+A  AR+AVYKVCW  TC  +D
Sbjct  191   SRSPRDDDGHGTHTASTAAGSVVEGANLLGFANGTARGMAYRARVAVYKVCWKPTCFGSD  250

Query  830   ILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGP  1009
             +L+G+D+A+ D V+VLS+SL  + +      Y+ + IAIGAF A+++G+ VSC+AGN GP
Sbjct  251   VLAGIDKAIEDNVNVLSISLGRRRRD-----YNNE-IAIGAFSAMERGIFVSCSAGNDGP  304

Query  1010  DPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ-PSRIQVPVVYGGS  1186
              P++  N+APWI TVGA T+DR+FPA+VTLGN +++TG SL+     PS++ +P VY G+
Sbjct  305   SPFSLSNVAPWITTVGAGTLDRDFPALVTLGNGKNYTGVSLFKEDDLPSKL-LPFVYAGN  363

Query  1187  ANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             A++      +CFPG L   KV+G+IV CE+G +   V+KG  V  AGG+GMI+ N   EG
Sbjct  364   ASNNATYGNFCFPGTLIPEKVKGKIVMCEKGVNVR-VEKGEVVKAAGGLGMILANTAYEG  422

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +   NA  +P   V     +IIR Y  T   PTA I F+GTV+   PS P +AAFS RG
Sbjct  423   EERTANAFLLPATTVGEKASDIIRHYALTDPNPTASIVFQGTVVNVQPS-PVLAAFSSRG  481

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP ILKPD+IAPGVNILAAWTG++            EFN+ISGTSM+CPHVSGLAA
Sbjct  482   PNPITPNILKPDLIAPGVNILAAWTGAVGPSGLASDTRRVEFNIISGTSMSCPHVSGLAA  541

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK ++P WSPAAI+SALMTTAY+    G+  +ID+ T  P+TP  +G+GHV PT  V+P
Sbjct  542   LLKSVHPEWSPAAIRSALMTTAYSTYKDGQ-PIIDIATVTPSTPFGHGAGHVSPTTTVNP  600

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GL+YD    DY+ FLC + Y+S  I +  R +    C      +   LNYPSF+V    +
Sbjct  601   GLIYDLTTVDYLGFLCALKYNSSLIRIISRGN--YACDPSKTYSVADLNYPSFAVNVDGS  658

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---S  2209
               T  Y RTV NV    + + +VT +T + V+++V P  L F +  +  SY VTF    S
Sbjct  659   -DTYKYTRTVTNVGGAGSYSVKVTSETTA-VKISVEPAILNFKEVNEKKSYSVTFTVDSS  716

Query  2210  LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 + SFGS+ WSDG H+V SP+A+SW
Sbjct  717   KPSGSSSFGSIEWSDGKHVVASPVAISW  744



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/753 (47%), Positives = 469/753 (62%), Gaps = 38/753 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTL--SPLSNHSRSSE-LLYTYEHVAHGFSARL  286
             K++IV M KS  P+ F+ H +WYSS + ++  +P S    +SE ++Y+YE   HGF+ARL
Sbjct  37    KTYIVHMDKSVLPESFADHLEWYSSTVKSVMATPQSEDEDASERIIYSYETAFHGFAARL  96

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDY--GADIIIGVL  460
                +A  L    GV++V P+ +  L TTRSP FLGL +  S     SD     D+++GVL
Sbjct  97    IEEEAQRLEEGYGVLAVYPETVYHLHTTRSPMFLGLETEDSTSTVWSDTLSDHDVVVGVL  156

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-P  637
             D+GIWPE +SF+D G+ P+P  W+  CE G  F   +CN+KIIGAR +YRGYEA  GK  
Sbjct  157   DTGIWPESASFNDTGMKPVPAQWKGACETGRGFTTDNCNKKIIGARIFYRGYEAASGKIN  216

Query  638   IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E KS RD +GHGTH A+  AGS V  AN+ G+ARG ARG+A  AR+A YKVCWL  C
Sbjct  217   EQDEYKSPRDQDGHGTHTAATVAGSPVEGANLLGYARGTARGMAPRARVAAYKVCWLDGC  276

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DILS +D+AVADGV+V      S S  G    Y  D ++I  F A++KGV VSC+AG
Sbjct  277   FSSDILSAVDRAVADGVNV-----LSISLGGGVSSYYRDSLSIATFVAMEKGVFVSCSAG  331

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQVPV  1171
             N GPDP +  N++PW++TVGAST+DR+FP+ V LGN    +G SLY G +   ++ Q P+
Sbjct  332   NGGPDPISLTNVSPWVITVGASTMDRDFPSTVKLGNGHLSSGVSLYKGRRNLSAKKQYPL  391

Query  1172  VYGG-----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
              Y G        S  C  G LD   V G+IV C++G +   V+KG  V  AGGVGMI+ N
Sbjct  392   AYMGSNSSSPDPSSLCLEGTLDPRTVAGKIVICDRGVNPR-VEKGQVVKSAGGVGMILSN  450

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  ++  +P   V    G+ I++Y  T S PTA +   GT +   PS P VAA
Sbjct  451   TAANGEELVADSHLLPAVAVGAEAGKAIKRYALTNSRPTATLAILGTKLSIRPS-PVVAA  509

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGPNFLT EILKPDV+APGVNILAAWTG               FN++SGTSM+CPHV
Sbjct  510   FSSRGPNFLTLEILKPDVVAPGVNILAAWTGKAGPSGLPTDRRRVRFNILSGTSMSCPHV  569

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SG+AA+LK  +P WSPAAIKS+LMTTAY  DN+ R  L D  T +P+ P  +G+GH++P 
Sbjct  570   SGVAALLKAKHPEWSPAAIKSSLMTTAYIHDNT-RNPLKDASTGKPSNPFGHGAGHLNPL  628

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+DPGL+YD GV DY +FLCT      ++ +F ++S    C +  L NPG LNYP+ S 
Sbjct  629   KALDPGLIYDMGVQDYFEFLCTQKLTPMQLKVFTKSSNR-SC-HHTLANPGDLNYPAISA  686

Query  2024  LF--KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             +F  ++++  +   RTV NV    +  Y   V       V+V P  L FT +   L+Y++
Sbjct  687   VFPEQHSISLLTLHRTVTNVGSPVST-YHARVSQFKGASVSVEPKTLQFTSKHRKLAYKI  745

Query  2198  TFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             TF +  RQS   FG+L WSDG H V SPI ++W
Sbjct  746   TFTTKSRQSMPEFGNLIWSDGIHKVRSPIVITW  778



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/757 (46%), Positives = 484/757 (64%), Gaps = 48/757 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + K++IV M K + P+ F  H  WY S + ++S       S+E++Y Y +V HGFS RLT
Sbjct  23    DKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVS------DSAEMIYAYNNVVHGFSTRLT  76

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PG+++V+P+ + EL TTRSP+FLGL   ++NL P S+  +++IIGVLD+G
Sbjct  77    AEEAQRLEAQPGILAVVPEMIYELHTTRSPEFLGL-DKNANLYPESNSVSEVIIGVLDTG  135

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             I PE  SF D GL P+P+SW+ +CE G NF A++CNRK++GAR + +GYEA +G PI   
Sbjct  136   ISPESKSFDDTGLGPVPSSWKGECESGTNFSASNCNRKLVGARFFSKGYEATLG-PIDES  194

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH AS AAGS V NA++ G+A G ARG+A  AR+A YKVCW G C +
Sbjct  195   KESRSPRDDDGHGTHTASTAAGSVVENASLFGYASGTARGMAARARVAAYKVCWAGGCFS  254

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DI++ +D+AV D V+VLS+SL      G    Y +D +A GAF A++KG++VSC+AGN 
Sbjct  255   SDIVAAIDKAVDDNVNVLSMSLG-----GGVSDYYKDSVATGAFAAMEKGILVSCSAGNA  309

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP P++  N +PWI TVGA T+DR+FPA V+LG++++F+G SLY G       +P +Y  
Sbjct  310   GPSPFSLSNTSPWITTVGAGTLDRDFPAYVSLGDAKNFSGVSLYRGKSLPGTLLPFIYAA  369

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV G++VFC++G +   V KG  V  AGG+GM++ N    G
Sbjct  370   NASNSGNGNLCMTGTLIPEKVAGKVVFCDRGVNPR-VQKGAVVKAAGGIGMVLANTAANG  428

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  ++  +P   V    G+ IR+Y+ +   PT  I F+GT +G  PS P VAAFS RG
Sbjct  429   EELVADSHLLPATAVGQKSGDTIRKYLVSDPSPTVTILFEGTKLGIEPS-PVVAAFSSRG  487

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP++LKPD+IAPGVNILA W+ S+            +FN+ISGTSM+CPHVSGLAA
Sbjct  488   PNSITPQLLKPDIIAPGVNILAGWSKSVGPSGLAIDDRRVDFNIISGTSMSCPHVSGLAA  547

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K  +P WSPAAI+SALMTTAYT   +G+  + D+ T +P+TP  +G+GHVDP  A++P
Sbjct  548   LIKGAHPDWSPAAIRSALMTTAYTAYKNGQ-KIQDIATGKPSTPFDHGAGHVDPVSALNP  606

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD  V+DY++FLC + Y   +I    R     D + +   N   LNYPSF+V+F+  
Sbjct  607   GLVYDLTVDDYLNFLCALNYTPSQINSLARKDFTCDSKKKYSVN--DLNYPSFAVVFEGV  664

Query  2039  LQTVI-------YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY--  2191
             L           + RT+ NV         +T +T S V+++V P  L FT   D  SY  
Sbjct  665   LGGGGSGSSVVKHTRTLTNVGSPGTYKVSITSETKS-VKISVEPESLSFTGANDKKSYTV  723

Query  2192  ---EVTFQSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                  T  +   SA++FG + WSDG H+V SPIA SW
Sbjct  724   TFTTTTSSAAPTSAEAFGRIEWSDGKHVVGSPIAFSW  760



>ref|XP_002533167.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF29226.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=760

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/746 (47%), Positives = 474/746 (64%), Gaps = 40/746 (5%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P  F  H  WY S + ++S       S++++YTYE+  HGFS RLT  +
Sbjct  33    TYIVHMSKSEMPASFQHHTHWYDSSLKSVS------DSAQMIYTYENAIHGFSTRLTSEE  86

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PG++SVLP+   EL TTR+P+FLGL   S++  P SD   D+++GVLD+G+WP
Sbjct  87    AELLQAQPGILSVLPELRYELHTTRTPEFLGL-DKSADFFPESDSVGDVVVGVLDTGVWP  145

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF+D G+ PIP++W+ +CE G NF   +CNRK+IGAR +  GYEA +G P+    E 
Sbjct  146   ESKSFADTGMGPIPSTWKGQCETGTNFTTANCNRKLIGARFFANGYEATLG-PVDESKES  204

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH AS AAGS V  A++ G+A G ARG+AT AR+AVYKVCW+G C ++DI
Sbjct  205   KSPRDDDGHGTHTASTAAGSLVEGASLLGYASGTARGMATRARVAVYKVCWIGGCFSSDI  264

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L  MD+A+ DGV+VLS+SL      G    Y +D +AIGAF A++KG++VSC+AGN GP 
Sbjct  265   LKAMDKAIEDGVNVLSMSLG-----GGMSDYFKDSVAIGAFAAMEKGILVSCSAGNAGPT  319

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
              Y+  N+APWI TVGA T+DR+FPA V+LGN R+++G SL+ G       +P +Y G+A 
Sbjct  320   SYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGRNYSGVSLFKGSSLPGKLLPFIYAGNAS  379

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C    L   KV G+IV C++G +   V KG  V +AGG+GM++ N P  G +L
Sbjct  380   NSTNGNLCMMDSLIPEKVAGKIVLCDRGVNAR-VQKGAVVKEAGGLGMVLANTPANGEEL  438

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P   V   +G  I+ Y+ +   PT  I F+GT +G  PS P VAAFS RGPN 
Sbjct  439   VADAHLLPATSVGEKNGNAIKSYLSSDPNPTVTILFEGTKVGIQPS-PVVAAFSSRGPNS  497

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP++LKPD+IAPGVNILA W+G++            +FN+ISGTSM+CPHVSGLAA+LK
Sbjct  498   ITPQVLKPDMIAPGVNILAGWSGAVGPTGLSTDTRRVDFNIISGTSMSCPHVSGLAALLK  557

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P W+PAAI+SALMTTAY    +GR  L D  + + +TP  +G+GHVDP  A++PGLV
Sbjct  558   AAHPDWTPAAIRSALMTTAYVSYKNGR-NLQDSASGKDSTPFDHGAGHVDPVSALNPGLV  616

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN--NL  2041
             YD   +DY+ FLC + Y + +I    R     D   +   N   LNYPSF+V F +    
Sbjct  617   YDLTADDYLSFLCALNYTAAEITSLARKRFTCDSSKKYSLN--DLNYPSFAVNFDSIGGA  674

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLR  2215
                 Y RT+ NV         ++ Q    V+++V P  L F    +  SY VTF   S+ 
Sbjct  675   SVAKYTRTLTNVGTAGTYKASISGQAL-GVKISVEPETLSFIQANEKKSYTVTFTGSSMP  733

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW  2293
              + ++F  L WSDG H+V SPIAVSW
Sbjct  734   TNTNAFARLEWSDGKHVVGSPIAVSW  759



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/752 (47%), Positives = 467/752 (62%), Gaps = 38/752 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ +++IV M  S  P  F+ H DWY+S + ++S       S+ +LYTY+ + HG+SARL
Sbjct  29    DDLRTYIVHMSHSAMPDGFAEHGDWYASSLQSVS------DSAAVLYTYDTLLHGYSARL  82

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T ++A  L   PGV+ V P+   EL TTR+P+FLGL   +  L P S   +D+++GVLD+
Sbjct  83    TRAEAEALEAQPGVLLVNPETRYELHTTRTPEFLGLDGRTDALFPQSGTASDVVVGVLDT  142

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIV  643
             G+WPER+S+ D G  P+P  W+ KCE G +F A++CN+K+IGAR +  GYEA  G   + 
Sbjct  143   GVWPERASYDDAGFGPVPTGWKGKCEEGNDFNASACNKKLIGARFFLTGYEASKGPVDVS  202

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH +S AAGSAV  A++ G+A G A+G+A  AR+A YKVCW+G C +
Sbjct  203   KESRSPRDNDGHGTHTSSTAAGSAVRGADLLGYASGTAKGMAPRARVATYKVCWVGGCFS  262

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL GM+ AVADGV V      S S  G    Y  D IA+GAF A++KG+ VSC+AGN 
Sbjct  263   SDILKGMEVAVADGVDV-----LSLSLGGGTSDYYRDSIAVGAFSAMEKGIFVSCSAGNA  317

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   +  N APWI TVGA T+DR+FPA VTLGN +++TG SLYSG Q     VP VY G
Sbjct  318   GPGAASLTNGAPWITTVGAGTLDRDFPAHVTLGNGKNYTGVSLYSGKQLPTTPVPFVYAG  377

Query  1184  SANS----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A++      C  G L   KV G+IV C++G +   V KG  V  AGG GM++ N    G
Sbjct  378   NASNSSMGALCMTGSLIPEKVAGKIVLCDRGTNAR-VQKGFVVKDAGGAGMVLANTAANG  436

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +P + V    G  +R Y  +   PTA I F GT +G  PS P VAAFS RG
Sbjct  437   EELVADAHILPGSGVGEKAGNAMRTYASSDPNPTANIVFAGTKVGIQPS-PVVAAFSSRG  495

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP +LKPD+IAPGVNILAAW+GS+           + FN+ISGTSM+CPHVSGLAA
Sbjct  496   PNTVTPGVLKPDLIAPGVNILAAWSGSIGPSGIAGDNRRSSFNIISGTSMSCPHVSGLAA  555

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSG--RGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             +L+  +  W+PAAI+SALMTTAYTV  +G     ++D+ T +P TP   G+GHVDP+ AV
Sbjct  556   LLRSAHQDWTPAAIRSALMTTAYTVYPNGNYNNGILDVATGRPATPLDIGAGHVDPSKAV  615

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
             DPGLVYD    DYVDFLC I Y   ++A   ++S    C         +LNYPSFSV   
Sbjct  616   DPGLVYDITAADYVDFLCAINYGPAQVAALAKHSTADRCSANRTYAVTALNYPSFSVTLP  675

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSN---VRVTVSPNRLVFTDRIDTLSYEVTF  2203
                    + RTV NV +     Y+VT    +    V V+V P+ L FT   +  SY V+F
Sbjct  676   AAGGAEKHTRTVTNVGQPGT--YKVTASAAAGGTPVSVSVEPSTLSFTKAGEKKSYTVSF  733

Query  2204  QSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2293
              +  +    + FG L WS   H+V SPI V+W
Sbjct  734   AAGGKPSGTNGFGRLVWSSDHHVVASPIVVTW  765



>ref|XP_010059854.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66296.1| hypothetical protein EUGRSUZ_F00121 [Eucalyptus grandis]
Length=765

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/755 (47%), Positives = 476/755 (63%), Gaps = 52/755 (7%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++I+ M KS  P  F+ H +WY S + ++S        +++LYTY  V HGFS RLT  +
Sbjct  32    TYIIHMDKSNMPTTFAGHLEWYDSSLKSVS------DGADMLYTYNSVLHGFSVRLTAKE  85

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L   PG++SVLP+   EL TTR+P+FLGL    + L P S+  +++I+ VLD+G WP
Sbjct  86    AELLEKQPGILSVLPEVRYELHTTRTPEFLGLEKNEA-LYPESNLASEVIVAVLDTGAWP  144

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  S+ D GL+P+P++W+  CEVG  F ++SCN K+IGAR + RGYEA +G PI    E 
Sbjct  145   ELKSYDDAGLSPVPSTWKGTCEVGKTFNSSSCNNKLIGARFFSRGYEAALG-PIDESKES  203

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             +S RD +GHGTH ++ AAGS V  AN+ G A G ARG+AT AR+A+YKVCWL  C  +DI
Sbjct  204   RSPRDDDGHGTHTSTTAAGSVVPEANLFGFASGIARGMATKARLAIYKVCWLSGCFGSDI  263

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             ++ MD+AV DGV+V+S+S+      G    Y  D I++GAF A+  G++VSC+AGN GP 
Sbjct  264   MAAMDKAVEDGVNVISMSIG-----GGITDYYRDTISMGAFNAMAHGILVSCSAGNSGPS  318

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
               +  N+APWI TVGAST+DR+FPA VTLGN + + G SLY+G   S   VP+V+ G+A+
Sbjct  319   SMSVANIAPWITTVGASTLDRDFPAYVTLGNGKKYRGVSLYNGKSLSG-PVPLVFAGNAS  377

Query  1193  SFY----CFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             S      CF G L ASKV G+IV C++G + S   K + V  AGGVGMI+ N  + G +L
Sbjct  378   SSSSGEVCFTGSLVASKVAGKIVICDRGGN-SRAQKSMVVKNAGGVGMILTNTESYGEEL  436

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P+A +    G  I++Y+ +   PTA I   GT +   PS P VA+FS RGPN 
Sbjct  437   VADAYLLPSAALGQKAGIEIKKYISSDPTPTATIASGGTELDVQPS-PVVASFSSRGPNP  495

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             L  +ILKPD+IAPGVN+LA WTG++             FN+ISGTSM+CPHVSGLAA+LK
Sbjct  496   LNQQILKPDLIAPGVNVLAGWTGAVGPTGLDKDKRQVNFNIISGTSMSCPHVSGLAALLK  555

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +  WSPAAI+SALMTTAYT   +G  T+ D+ T   +TP  YG+GHVDP  A+DPGLV
Sbjct  556   AAHQDWSPAAIRSALMTTAYTKYKNGE-TIKDVATGSSSTPFDYGAGHVDPMAALDPGLV  614

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD--CRNRNLGNPGSLNYPSFSVLFKN--  2035
             YDA V DY+ FLC + Y S +I    ++S   D  C +    N   LNYPSF+V  ++  
Sbjct  615   YDAAVEDYLRFLCALNYTSAQI----KSSTNRDYSCDSSTKYNVEDLNYPSFAVPLESAS  670

Query  2036  -------NLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
                       TV Y RT+ NV         V+ Q PS V++ V P  L F +  +  SY 
Sbjct  671   SISGGAGASSTVKYTRTLTNVGSPGTYTVSVSSQIPS-VKILVEPESLTFGNMGEKKSYT  729

Query  2195  VTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF   S+     SF SL+WSDG H V SPIA+SW
Sbjct  730   VTFTAGSMPSGTTSFASLKWSDGKHSVGSPIAISW  764



>ref|XP_010482516.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010482517.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=779

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/752 (46%), Positives = 465/752 (62%), Gaps = 36/752 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS---ELLYTYEHVAHGFSARL  286
             K++++ M +S  P  ++    WYSS I++++   +         +LYTY+   HG +A+L
Sbjct  34    KTYVIHMDRSAMPSPYTNQLQWYSSKINSVTQRKSQEGEEGNDRILYTYQTAFHGLAAQL  93

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             T  +A  L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GVLD
Sbjct  94    TEEEAERLKEEDGVVAVIPETRYELHTTRSPTFLGLERQESEKVWAERVTDHDVVVGVLD  153

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV  643
             +GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK   
Sbjct  154   TGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVGARVFYRGYEAATGKIDE  213

Query  644   G-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+  AGS V  AN+ G A G ARG++  AR+A YKVCW+G C 
Sbjct  214   ELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARGMSPKARVAAYKVCWVGGCF  273

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DILS +DQAVADGV V      S S  G    Y  D ++I  FGA++ GV VSC+AGN
Sbjct  274   SSDILSAVDQAVADGVQV-----LSISLGGGISTYSRDSLSIATFGAMEMGVFVSCSAGN  328

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V LG  R+F G SLY G  V     Q P+V
Sbjct  329   GGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGVSLYKGRAVLSKNKQYPLV  388

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G   S      +C  G LD   V G+IV C++G     V KG  V +AGG+GMI+ N 
Sbjct  389   YLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPR-VQKGQVVKRAGGIGMILTNT  447

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P VAAF
Sbjct  448   ATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEVLGTRIGIKPS-PVVAAF  506

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAWTG L            +FN++SGTSM+CPHVS
Sbjct  507   SSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRVKFNILSGTSMSCPHVS  566

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA+++  +P WSPAAIKSALMTTAY  DN+ +  L D     P++P+ +G+GH+DP  
Sbjct  567   GVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLK-PLTDASGAAPSSPYDHGAGHIDPLK  625

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+DPGLVYD G  DY +FLCT      ++ +F ++S    C++    NPG+LNYP+ S L
Sbjct  626   AIDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNR-SCKHTLAKNPGNLNYPAISAL  684

Query  2027  FKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
             F  N  ++++  +RTV NV      +Y+V+V       VTV P  L FT +   LSY VT
Sbjct  685   FPENTRVKSITLRRTVTNVGP-HIASYKVSVSPFKGASVTVQPKTLSFTSKHQKLSYTVT  743

Query  2201  FQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F + +R     FG L W   TH V SP+ ++W
Sbjct  744   FTTRMRMKRPEFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_008377981.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=767

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/750 (46%), Positives = 473/750 (63%), Gaps = 41/750 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTP  292
             K++I+ M KS  P  F   H  WY S +  +S       S+++LYTY +V HGFSARLT 
Sbjct  34    KTYIIHMDKSNMPASFEDDHFRWYGSSLKLVS------DSADMLYTYTNVIHGFSARLTL  87

Query  293   SQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGI  472
             ++A  L   PG +SVLP+   ELQTTR+P+FLG+    + + P S   +D++IGV+DSG+
Sbjct  88    AEAVLLEKQPGTVSVLPELRYELQTTRTPEFLGISGKHAAVFPGSVKVSDVVIGVVDSGV  147

Query  473   WPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VG  646
             WPE  S+ D+ L P+P SW+ KCE G NF ++SCNRK+IGAR + RGYEA +G P+    
Sbjct  148   WPESKSYDDKSLGPVPRSWKGKCEEGKNFNSSSCNRKLIGARFFSRGYEAGLGHPMNETK  207

Query  647   EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNA  826
             E +S RD +GHGTH ++ AA S V  A++ G+A G A+G+AT AR+A YKVCWL  C ++
Sbjct  208   ESRSPRDDDGHGTHTSTTAAWSPVPGASLFGYASGTAKGMATQARVATYKVCWLSGCFSS  267

Query  827   DILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYG  1006
             DIL+ MD+AV DGV +      S  + G+   Y  D I IGAF  V KG+ VSCAAGN G
Sbjct  268   DILAAMDKAVEDGVDI---LSLSIGRKGYE-DYYXDGIDIGAFSVVAKGIFVSCAAGNQG  323

Query  1007  PDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGS  1186
             P   ++ N APWI TVGA T+DR+FPA V+LGN R + G S+Y G       +P++YG +
Sbjct  324   PFKVSSSNNAPWITTVGAGTLDRDFPAYVSLGNRRKYRGISVYGGTSLPSGLLPLIYGSN  383

Query  1187  ANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQLEP  1366
              ++  C P  L  +KV G+IV C+QG++   V+K   V +AGGVGMI+ +    G +L  
Sbjct  384   GSNL-CIPDSLVPAKVAGKIVVCDQGENPE-VEKXAVVKRAGGVGMILADAEINGEELIA  441

Query  1367  NADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNFLT  1546
             +   + T +V    G+ I++Y+ + + P A   F  T +G  PS P VAAFS RGPN ++
Sbjct  442   DVHLLATIMVGHKAGKAIKRYIASQADPKAHFAFGKTQLGVEPS-PVVAAFSSRGPNPVS  500

Query  1547  PEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLKKI  1693
             P +LKPD+IAPGVNILA WTG++             FN++SGTSM+CPHVSGLAA+LK  
Sbjct  501   PSVLKPDLIAPGVNILAGWTGAVGPTRLDDDTMRVSFNILSGTSMSCPHVSGLAAILKAA  560

Query  1694  YPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLVYD  1873
             +P WSPAAIKSALMTT+YT   +G+ T+ D+ T    TP+ YG+GHVDP  A+DPGLVYD
Sbjct  561   HPKWSPAAIKSALMTTSYTTYKNGK-TIKDIATGNAATPYDYGAGHVDPVAAIDPGLVYD  619

Query  1874  AGVNDYVDFLCTIGYDSRKI-ALFLRNSPLVDCRNRNLGNPGSLNYPSFSV-LFKNN---  2038
               V DY+ FLC + Y +  I  L  R+      +N ++G+   LNYPSFSV L+ N+   
Sbjct  620   LAVKDYLSFLCALHYTTTDIKKLTHRDFTCDSSKNYSVGD---LNYPSFSVDLYTNSNNG  676

Query  2039  -LQTVIYKRTVKNVA--KVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--  2203
                T  Y RT+ NV      NV+  +     ++V++ V P  L F+   +  +Y VTF  
Sbjct  677   GAGTEKYTRTLTNVGPPARYNVSVSIDSTLAASVKILVEPKSLSFSQAYEKKTYTVTFVT  736

Query  2204  QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
              S+    D F  L WSDG H+V+SPIA+SW
Sbjct  737   SSMPSGTDIFARLVWSDGKHIVSSPIAISW  766



>gb|EPS59495.1| hypothetical protein M569_15309, partial [Genlisea aurea]
Length=736

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/753 (46%), Positives = 459/753 (61%), Gaps = 47/753 (6%)
 Frame = +2

Query  122   FIVFMMKSEKPQLFSTHH-DWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             FIV M  S+ P+ F  +H DWY S + ++S       S+ ++Y Y  V HG+SAR+T ++
Sbjct  1     FIVHMDHSDMPEAFIDNHLDWYGSSLRSVS------ESANMIYAYTSVVHGYSARMTAAE  54

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A+ L   PGV+ V  D + ++ TTRSP+FLGL+    +   S     D+++GVLD+G+WP
Sbjct  55    ANLLEKQPGVLLVQEDMVYDVHTTRSPEFLGLLGNEGSTAVSGSPIGDVVVGVLDTGVWP  114

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  S+ D GL PIP SW+  CE+  +F ++SCNRK+IGAR + +GYE+  G PI    E 
Sbjct  115   ESKSYDDAGLGPIPASWKGGCELSRSFNSSSCNRKLIGARFFSQGYESAFG-PIDETVES  173

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD  GHGTH +S AAGS V  A++ G A G ARG+AT+AR+AVYKVCWLG C  +DI
Sbjct  174   KSPRDDKGHGTHTSSTAAGSPVVGASLFGFAAGTARGMATHARVAVYKVCWLGGCLTSDI  233

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +++A+ADGVHV      S S  G    Y  D IAIGAF A  +G++VSC+AGN GP 
Sbjct  234   LAAIEKAIADGVHV-----LSMSLGGSVFDYYLDTIAIGAFAAASRGILVSCSAGNAGPT  288

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSAN  1192
             P +  N+APWI T GA T+DR+FP+ VTLGN    TG SL+SG    +  +P+VY G A+
Sbjct  289   PGSLSNVAPWITTTGAGTLDRKFPSYVTLGNGDKLTGVSLFSGSPLPKSLIPIVYAGDAS  348

Query  1193  S----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
             +    + C  G L   KV+G+IV CE+G +     KG  V  AGG GM++ N  + G +L
Sbjct  349   NSSYGYLCTKGSLIPEKVKGKIVLCERGINAR-TQKGSVVRLAGGAGMVLANTASYGEEL  407

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +A  +P+A V +  G+ I++Y+ +   P A I   GT +G  PS P VAAFS RGPN 
Sbjct  408   VADAHFLPSAAVGLTAGDAIKKYILSEKNPIATITSGGTQLGIQPS-PVVAAFSSRGPNT  466

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP +LKPD IAPGVNILA WTG               FN++SGTSM+CPHVSGLAAM+K
Sbjct  467   ITPGVLKPDFIAPGVNILAGWTGKAGPTGLPEDTRHVSFNIVSGTSMSCPHVSGLAAMIK  526

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P WSPAAIKSALMTTAY    +G   + DL T +  T   YG+GHVDP  A+DPGLV
Sbjct  527   GAHPEWSPAAIKSALMTTAYKKYKTGE-IIKDLATGRAATSLDYGAGHVDPVLALDPGLV  585

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF------  2029
             YD  +NDYVDFLC IGY +  + +  + +    C+         LNYPSFSV        
Sbjct  586   YDLSINDYVDFLCAIGYSASTMKIVTKQN--YTCKPGRKYKVSDLNYPSFSVPLPTASGP  643

Query  2030  ---KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
                 N    + Y+RTV NV         VT Q   +V+V V P  L F    +  SY VT
Sbjct  644   KGGSNAPIVLTYRRTVTNVGTPGTYKVSVT-QDTKDVKVVVQPQVLNFVSLNEKQSYTVT  702

Query  2201  F--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F   SL     +FG+L W+DG H+V SPI  SW
Sbjct  703   FTASSLPSGTTNFGNLEWTDGKHVVNSPIVFSW  735



>ref|XP_006365833.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=798

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/777 (46%), Positives = 484/777 (62%), Gaps = 57/777 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTL---SPLSNHSRSSELLYTYEHVAHGFSA  280
             E +S+I+ +    KP +FS    WYSS + +L   +PL +  +  E L+ Y+ V HGFSA
Sbjct  28    EKQSYIIRVQNDLKPSVFSDVEHWYSSTLSSLIRYNPLKSTDQDEEFLHVYKTVFHGFSA  87

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGS--SNLGPSSDYGADIIIG  454
             +LT  +A +LA   GV+SVLPDRL +L TTRSP F+GL S S  SNL   SD G++++IG
Sbjct  88    KLTAQEAQQLATFDGVLSVLPDRLRQLHTTRSPHFMGLDSASTMSNLVTESDSGSNVVIG  147

Query  455   VLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK  634
             VLD+GIWPER SF D+G+ PIP+ W+ +C VG NF   +CN+KIIGAR +  GY A++G 
Sbjct  148   VLDTGIWPERPSFHDQGMGPIPSFWKGECTVGENFTKANCNKKIIGARYFTSGYLAKMGS  207

Query  635   PIVG-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLG  811
                  + KSARD  GHGTH AS AAG AV +A+  G A+G A GIA  ARIA YKVCW  
Sbjct  208   MNSSTDIKSARDTEGHGTHTASTAAGRAVGDASFLGFAKGVAVGIAPKARIAAYKVCWKR  267

Query  812   TCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C ++DIL+G D+AV DGV+++S+S+      G A+PY+ D IAIG+FGA++KGV +S +
Sbjct  268   GCMDSDILAGFDKAVEDGVNIISISIG-----GSAVPYNLDPIAIGSFGAMEKGVFISAS  322

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQP-----SR  1156
             AGN GP   +  N+APWI TVGASTIDR+FPA + LGN +  TG+S+Y G  P     + 
Sbjct  323   AGNEGPRSMSVTNVAPWITTVGASTIDRKFPADLVLGNGKRITGSSIYRGDDPLHDINNF  382

Query  1157  IQVPVVYGGSA--------------NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGV  1294
               +P++YGG+A              +S  C P  LD  +VRG+IV C++G  T  V KG 
Sbjct  383   QHLPLIYGGNASVGLRNGARHSSSFSSATCMPDSLDKERVRGKIVVCDRG-GTPRVSKGE  441

Query  1295  AVSQAGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKG  1474
              V  AGGVG++V N+   G  L  +A  IP   VT + G +IR Y+ + + PTA + F  
Sbjct  442   IVKDAGGVGVVVANIFPMGEGLVADAHLIPGLGVTESAGNLIRDYINSNANPTATMTFSE  501

Query  1475  TVIGNSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TE  1621
             T +G  P AP VA+FS RGP+  +  +LKPDVIAPGVNILAAW   +           T+
Sbjct  502   TQVGVKP-APVVASFSSRGPSAESIFVLKPDVIAPGVNILAAWPDGVAPTELSSDQRRTQ  560

Query  1622  FNMISGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQP  1801
             FN+ SGTSM+CPHVSGLAA+LK  +P WSPA I+SALMTTAYT D  G   L+D  +   
Sbjct  561   FNIASGTSMSCPHVSGLAALLKGAHPYWSPAMIRSALMTTAYTQDQQGN-PLLDETSYNI  619

Query  1802  TTPHAYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRN  1981
             +T    G+GHVDP  AVDPGLVYD   +DY++FLC   Y  R I    + S    CR ++
Sbjct  620   STTMDMGAGHVDPEKAVDPGLVYDITADDYLNFLCASNYSGRDIKQITKRSG--KCRGKH  677

Query  1982  LGNPGSLNYPSFSV-LFKNNLQT---VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSP  2149
                P +LNYP+ SV ++   LQ    V   RTV +V +  +  Y V+V  P  V VTV+P
Sbjct  678   DHKPWNLNYPAISVAIYTTQLQEPAIVQVTRTVTHVGETPST-YTVSVTNPKGVNVTVTP  736

Query  2150  NRLVFTDRIDTLSYEVTFQSLRQSADSF------GSLRWSDGTHLVTSPIAVSWEGR  2302
             + + F ++ +  SY V  ++ +++  S       G L WS+G   V SP+ V W+ R
Sbjct  737   SSMNFREKGEKQSYVVRIKAEKKAVTSLNSVIEVGKLSWSNGKQHVVSPLVVVWKQR  793



>ref|XP_010442681.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=779

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/752 (46%), Positives = 465/752 (62%), Gaps = 36/752 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS---ELLYTYEHVAHGFSARL  286
             K+F++ M +S  P  ++    WYSS I++++   +         +LYTY+   HG +A+L
Sbjct  34    KTFVIHMDRSAMPSPYTNQLQWYSSKINSVTQRKSQEGEEGNDRILYTYQTAFHGLAAQL  93

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLD  463
             T  +A  L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GVLD
Sbjct  94    TEEEAERLKEEDGVVAVIPETRYELHTTRSPTFLGLERQESEKVWAERVTDHDVVVGVLD  153

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIV  643
             +GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK   
Sbjct  154   TGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVGARVFYRGYEAATGKIDE  213

Query  644   G-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+  AGS V  AN+ G A G ARG++  AR+A YKVCW+G C 
Sbjct  214   ELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARGMSPKARVAAYKVCWVGGCF  273

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DILS +DQAVADGV V      S S  G    Y  D ++I  FGA++ GV VSC+AGN
Sbjct  274   SSDILSAVDQAVADGVQV-----LSISLGGGISTYSRDSLSIATFGAMEMGVFVSCSAGN  328

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FPA V LG  R+F G SLY G  V     Q P+V
Sbjct  329   GGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGVSLYKGRAVLSKNKQYPLV  388

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G   S      +C  G LD   V G+IV C++G     V KG  V +AGG+GMI+ N 
Sbjct  389   YLGRNASSPDPTSFCLDGALDQRHVAGKIVICDRGVSPR-VQKGQVVKRAGGIGMILTNT  447

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT+IG  PS P VAAF
Sbjct  448   ATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEVLGTIIGIKPS-PVVAAF  506

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAWTG L            +FN++SGTSM+CPHVS
Sbjct  507   SSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRVKFNILSGTSMSCPHVS  566

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA+++  +P WSPAAIKSALMTTAY  DN+ +  L D     P++P+ +G+GH+DP  
Sbjct  567   GVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLK-PLTDASGAAPSSPYDHGAGHIDPLK  625

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+DPGLVYD G  DY  FLCT      ++ +F ++S    C++    NPG+LNYP+ S L
Sbjct  626   AIDPGLVYDIGPQDYFYFLCTQDLSPSQLKVFTKHSNR-SCKHTLAKNPGNLNYPAISAL  684

Query  2027  FKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVT  2200
             F  N  ++++  +RT+ NV      +Y+V+V       VTV P  L FT +   LSY VT
Sbjct  685   FPENTRVKSMTLRRTLTNVGP-HIASYKVSVSPFKGASVTVQPKTLNFTTKHQKLSYTVT  743

Query  2201  FQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             F + +R     FG L W   TH V SPI ++W
Sbjct  744   FTTRMRMKRPEFGGLVWKSTTHKVRSPIIITW  775



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/749 (47%), Positives = 464/749 (62%), Gaps = 40/749 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M    KP ++ TH DWYS+ + + +     + S  LLYTY    +GF+A L   
Sbjct  27    KTYIVHMKHRNKPAIYPTHTDWYSANLQSFT-----TDSDPLLYTYTDAYNGFAASLAED  81

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGL--ISGSSNLGPSSDYGA---DIIIGVL  460
             QA EL     V+ V  + + +L TTR+PQFLGL   +G      + D      D+I+GVL
Sbjct  82    QAQELLRSEDVLGVYEETVYQLHTTRTPQFLGLDRETGLWEGHTTQDLNLASHDVIVGVL  141

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+G+WPE  SF+D  +  IP  WR +CE GP+F  + CN+K+IGAR++ RG+    G   
Sbjct  142   DTGVWPESPSFADAEMPEIPARWRGECEAGPDFSPSVCNKKLIGARSFSRGFHMASGSGT  201

Query  641   -VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                EP S RD +GHGTH AS AAGS V NA++ G+A G ARG+A  AR+AVYKVCW   C
Sbjct  202   REKEPASPRDKDGHGTHTASTAAGSHVGNASLLGYASGTARGMAPTARVAVYKVCWTDGC  261

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
               +DIL+GMD A+ DGV VLSLSL      G + PY  D IA+GAF AV +G+ VSC+AG
Sbjct  262   FASDILAGMDNAIQDGVDVLSLSLG-----GGSAPYFHDTIAVGAFAAVARGIFVSCSAG  316

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVY  1177
             N GP+  T  N+APWI+TVGA T+DR+FPA   LGN + ++G SLYSG       V +VY
Sbjct  317   NSGPEKATLANVAPWIMTVGAGTLDRDFPAFALLGNKKRYSGVSLYSGTGMGNKPVGLVY  376

Query  1178  GGSANS--FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
                 N     C PG LD   VRG++V C++G +   V+KG  V  AGGVGMI+ N    G
Sbjct  377   NKGLNQSGSICMPGSLDPGLVRGKVVVCDRGINAR-VEKGKVVRDAGGVGMILANTEASG  435

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  ++  +P   V    G+ IR+Y  +   PTA + F+GTV+   PS P VAAFS RG
Sbjct  436   EELAADSHLLPALAVGRIVGDEIRKYASSDPNPTAVLGFRGTVLNVRPS-PVVAAFSSRG  494

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +T +ILKPDVI PGVNILA W+ S+           T+FN++SGTSM+CPH+SGLAA
Sbjct  495   PNMVTRQILKPDVIGPGVNILAGWSESIGPSGLPDDTRKTQFNIVSGTSMSCPHISGLAA  554

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSP+AIKSALMTTAY  DN+ +  L D      +TP A+G+GHV+P  A+ P
Sbjct  555   LLKAAHPEWSPSAIKSALMTTAYVHDNT-KSPLRDAAGGAFSTPWAHGAGHVNPHRALSP  613

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYDA + DY+ FLC++ Y    I L ++    V+C  R   +PG LNYPSFS+ F   
Sbjct  614   GLVYDASITDYIKFLCSLDYTPEHIQLIVKRHA-VNC-TRKFSDPGQLNYPSFSIHFGGK  671

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQ  2218
              + V Y RT+ NV +  +V Y VTV  PS V VTV P RLVF    +   Y VTF S + 
Sbjct  672   -RVVRYTRTLTNVGEAGSV-YDVTVDAPSTVEVTVRPARLVFGKLGERKRYTVTFVSKKS  729

Query  2219  SADS----FGSLRWSDGTHLVTSPIAVSW  2293
               DS    FGS+ WS+  H V SP+A SW
Sbjct  730   GGDSGRYGFGSIMWSNAQHQVRSPVAFSW  758



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/755 (47%), Positives = 470/755 (62%), Gaps = 50/755 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M    KP  ++THHDWYS+ + +LS     S    LLYTY    HGF+A L   
Sbjct  25    QTYIVQMNHHSKPSSYATHHDWYSAHLQSLS-----STEDSLLYTYTTAYHGFAASLDSE  79

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLI--------SGSSNLGPSSDYGADIII  451
             QA  L     V+ V  D L  L TTR+P+FLGL           + +L  +S+   D+I+
Sbjct  80    QAELLRQSDSVLGVYEDTLYTLHTTRTPEFLGLEIESGLWAGHSTQDLNQASN---DVIV  136

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+G+WPE  SF D G+  IP  WR +CE G +F  + CN+K+IGAR++ +G+    G
Sbjct  137   GVLDTGVWPESKSFDDAGMPEIPTRWRGQCESGSDFTPSFCNKKLIGARSFSKGFHMASG  196

Query  632   KPIVGEPKSA---RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
                + + K A   RD +GHGTH +S AAGS VANA++ G+A G ARG+A +AR+A YKVC
Sbjct  197   GSFMRKSKEAESPRDRDGHGTHTSSTAAGSHVANASLLGYATGTARGMAPHARVAAYKVC  256

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W   C  +DIL+GMD+A+ DGV VLSLSL      G A PY  D IAIGAF A+++G+ V
Sbjct  257   WSTGCFGSDILAGMDRAIVDGVDVLSLSLG-----GGASPYYRDTIAIGAFTAMERGIFV  311

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             SC+AGN GP   +  N APWI+TVGA T+DR+FPA   LGN + FTG SLYSG       
Sbjct  312   SCSAGNSGPSKASLANTAPWIMTVGAGTLDRDFPAYALLGNKKRFTGVSLYSGTGMGNKP  371

Query  1163  VPVVY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
             V +VY  G +++S  C P  L    VRG++V C++G +   V+KG  V  AGG+GMI+ N
Sbjct  372   VQLVYNKGSNSSSNLCLPASLQPEHVRGKVVVCDRGINAR-VEKGGVVRAAGGIGMILAN  430

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  ++  +P   V +  G++IR+Y +  S PTA I F GTV+   PS P VAA
Sbjct  431   TAASGEELVADSHLLPAVAVGMRVGDLIREYAQHDSNPTALISFGGTVLNVRPS-PVVAA  489

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGPN +TP+ILKPDVI PGVNILA W+ S+           ++FN++SGTSM+CPH+
Sbjct  490   FSSRGPNLVTPQILKPDVIGPGVNILAGWSESIGPTGLQEDTRKSQFNIMSGTSMSCPHI  549

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SGLAA+LK  +P WSP+AIKSALMTTAYT DN+ +  L D      + P A+GSGHV+P 
Sbjct  550   SGLAALLKAAHPDWSPSAIKSALMTTAYTQDNT-KSPLRDAADGSFSNPWAHGSGHVEPQ  608

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+ PGLVYD   +DYV FLC++ Y    +   ++  P V C +R   +PG LNYPSFSV
Sbjct  609   KALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKK-PNVTC-SRKYSDPGQLNYPSFSV  666

Query  2024  LFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
             +F N  + V Y R + NV    ++ Y+V V  P  VR+ V P RLVF +  +   Y VTF
Sbjct  667   VFGNK-RVVRYSRELTNVGAAGSI-YRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTVTF  724

Query  2204  QSLRQSAD-----SFGSLRWSDGTHLVTSPIAVSW  2293
              +  + AD      FGS+ W++  H V SPIA +W
Sbjct  725   VA-NKGADKTARSEFGSIVWANPQHQVKSPIAFAW  758



>ref|XP_004509085.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/748 (46%), Positives = 477/748 (64%), Gaps = 42/748 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P+ F  H  WY S + ++S       S+E+LYTYE+  HG+S RLT  +
Sbjct  31    TYIVHMAKSEMPESFDHHTMWYESSLQSVS------ESAEMLYTYENAIHGYSTRLTAEE  84

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L +  G+++V+P+   EL TTR+P FLGL   S+++ P S+ G++++IGVLD+G+WP
Sbjct  85    ARLLESQTGILAVVPEVKYELHTTRTPLFLGL-DKSADMFPESNSGSEVVIGVLDTGVWP  143

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF D G  P+P SW+  CE G NF  ++CN+K+IGAR + +G EA +G PI    E 
Sbjct  144   ESKSFDDTGFGPVPASWKGACETGTNFTTSNCNKKLIGARYFSKGVEAMLG-PIDETTES  202

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH +S AAGS V  A++ G+A G ARG+AT AR+AVYKVCW G C ++DI
Sbjct  203   KSPRDDDGHGTHTSSTAAGSVVTGASLFGYASGTARGMATRARVAVYKVCWKGGCFSSDI  262

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A++D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN GP 
Sbjct  263   LAAIDKAISDNVNVLSLSLG-----GGMSDYYRDSVAIGAFAAMEKGILVSCSAGNAGPS  317

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
              Y+  N+APWI TVGA T+DR+FPA V+LGN  +++G SLY G       +P +Y G+A 
Sbjct  318   AYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGLNYSGVSLYRGNALPDSPLPFIYAGNAT  377

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L    V G+IV C++G  ++ V KG  V  AGG+GM++ N    G +L
Sbjct  378   NATNGNLCMTGSLSPDMVAGKIVLCDRG-MSARVQKGAVVKAAGGLGMVLSNTAANGEEL  436

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +   +P   V    G+ I++YV + + PT +I F+GT +G  PS P VAAFS RGPN 
Sbjct  437   VADTHLLPATAVGEKAGDAIKKYVFSDAKPTVKILFEGTKVGVQPS-PVVAAFSSRGPNS  495

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP ILKPD+IAPGVNILA W+ ++            +FN+ISGTSM+CPHVSGLAA +K
Sbjct  496   ITPSILKPDLIAPGVNILAGWSKAVGPTGLSVDERRVDFNIISGTSMSCPHVSGLAAFIK  555

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P WSPAA++SALMTTAYT   +G   L D  T + +TP  +GSGHVDP  A++PGLV
Sbjct  556   SAHPEWSPAAVRSALMTTAYTAYKNGL-KLQDSATGKYSTPFDHGSGHVDPVAALNPGLV  614

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN--NL  2041
             YD  V+DY+ FLC + Y + +I    R     D   +   +   LNYPSF+V+F +    
Sbjct  615   YDLTVDDYLGFLCALNYTASEITALARRKFQCDAGKKY--SVADLNYPSFAVVFDSMGGA  672

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---SL  2212
               V ++R + NV    N    VT  TPS V+++V P  L F +  +  ++ VTF    S 
Sbjct  673   NVVKHRRILTNVGPAGNYKASVTSDTPS-VKISVDPEVLNFKEN-EKKAFTVTFTSSGST  730

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSWE  2296
              Q  +SFG L W++G  +V SPI++SW+
Sbjct  731   PQRVNSFGRLEWTNGKSVVGSPISISWD  758



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/751 (47%), Positives = 473/751 (63%), Gaps = 39/751 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M    KP  F+TH DWYS+ +  +S  S     + LLYTY+   HGF+A L P 
Sbjct  26    QTYIVQMKHHSKPSSFATHSDWYSANLQAVSSDSYSDSDA-LLYTYDTAYHGFAASLDPD  84

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS-----NLGPSSDYGADIIIGVL  460
             QA  L     VI V  D +  L TTR+P+FLGL + +      +L   +    D+I+GVL
Sbjct  85    QAETLRQSESVIGVYEDTVYNLHTTRTPEFLGLETANGFWAGHSLQDLNQASNDVIVGVL  144

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI  640
             D+G+WPE  SF+D G+  IP+ WR +CE G +F    CN+K+IGAR++ +GY    G   
Sbjct  145   DTGVWPESKSFNDAGMPEIPSRWRGECESGVDFSPKLCNKKLIGARSFSKGYRMASGGGF  204

Query  641   VGEPKSA---RDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLG  811
             + +P+ A   RD +GHGTH +S AAGS VANA++ G+A G ARG+A +AR+A YKVCW  
Sbjct  205   MKKPREAESPRDQDGHGTHTSSTAAGSLVANASLLGYASGTARGMAPHARVATYKVCWTS  264

Query  812   TCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCA  991
              C  +DIL+GMD+A+ DGV V+SLSL      G + PY  D IAIGAF A+++G+ VSC+
Sbjct  265   GCFGSDILAGMDRAILDGVDVMSLSLG-----GGSAPYFRDTIAIGAFTAMERGIFVSCS  319

Query  992   AGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPV  1171
             AGN GP   +  N APW++TVGA T+DR+FPA   LGN   FTG SLYSG       V +
Sbjct  320   AGNSGPSRASLANTAPWVMTVGAGTLDRDFPAYAVLGNQNKFTGVSLYSGTGMGTKPVGL  379

Query  1172  VY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPN  1345
              Y  G +++S  C PG L    VRG++V C++G +   V+KG  V  AGGVGMI+ N   
Sbjct  380   FYNKGSNSSSNLCLPGSLRPEAVRGKVVVCDRGVNAR-VEKGGVVRAAGGVGMILANTAA  438

Query  1346  EGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSC  1525
              G ++  ++  +P   V    G++IR+Y +T   PTA I F GTV+   PS P VAAFS 
Sbjct  439   SGEEMVADSHLLPAVAVGRKVGDMIREYAQTDPNPTAVISFGGTVLNVRPS-PVVAAFSS  497

Query  1526  RGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGL  1672
             RGPN +TP+ILKPDVI PGVNILAAW+ ++           ++FN++SGTSM+CPH+SGL
Sbjct  498   RGPNLVTPQILKPDVIGPGVNILAAWSEAIGPTGLEEDTRKSQFNIMSGTSMSCPHISGL  557

Query  1673  AAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAV  1852
             AA+LK  +P+WSP+AIKSALMTTAYT DN+ +  L D    Q + P A+GSGHVDP+ AV
Sbjct  558   AALLKAAHPNWSPSAIKSALMTTAYTHDNT-KAPLSDAAGGQFSNPWAHGSGHVDPSRAV  616

Query  1853  DPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK  2032
              PGLVYD    +YV FLC++GY  +++    +++  V C  R   +PG LNYPSFSV+F 
Sbjct  617   SPGLVYDISSVEYVAFLCSLGYTIQQVQSIAKSN--VTCA-RKYSDPGQLNYPSFSVVFG  673

Query  2033  NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL  2212
             N  + V Y R + NV   R++ Y+V V  P  VR  V P+ L F    +   Y VTF S 
Sbjct  674   NK-RVVRYTRELTNVGTARSL-YKVIVSGPPGVRTIVKPSSLFFATVGEKKKYTVTFVSA  731

Query  2213  ----RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                 R S   FGS+ W++  HLV SP+A +W
Sbjct  732   KSGSRTSRAEFGSIVWANTLHLVKSPVAFAW  762



>ref|XP_004167070.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=761

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/757 (46%), Positives = 483/757 (64%), Gaps = 48/757 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             + K++IV M K + P+ F  H  WY S + ++S       S+E++Y Y +V HGFS RLT
Sbjct  23    DKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVS------DSAEMIYAYNNVVHGFSTRLT  76

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +A  L   PG+++V+P+   EL TTRSP+FLGL   ++NL P S+  +++IIGVLD+G
Sbjct  77    AEEAQRLEAQPGILAVVPEMRYELHTTRSPEFLGL-DKNANLYPESNSVSEVIIGVLDTG  135

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             I PE  SF D GL P+P+SW+ +CE G NF A++CNRK++GAR + +GYEA +G PI   
Sbjct  136   ISPESKSFDDTGLGPVPSSWKGECESGTNFSASNCNRKLVGARFFSKGYEATLG-PIDES  194

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E +S RD +GHGTH AS AAGS V NA++ G+A G ARG+A  AR+A YKVCW G C +
Sbjct  195   KESRSPRDDDGHGTHTASTAAGSVVENASLFGYASGTARGMAARARVAAYKVCWAGGCFS  254

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DI++ +D+AV D V+VLS+SL      G    Y +D +A GAF A++KG++VSC+AGN 
Sbjct  255   SDIVAAIDKAVDDNVNVLSMSLG-----GGVSDYYKDSVATGAFAAMEKGILVSCSAGNA  309

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP P++  N +PWI TVGA T+DR+FPA V+LG++++F+G SLY G       +P +Y  
Sbjct  310   GPSPFSLSNTSPWITTVGAGTLDRDFPAYVSLGDAKNFSGVSLYRGKSLPGTLLPFIYAA  369

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A    N   C  G L   KV G++VFC++G +   V KG  V  AGG+GM++ N    G
Sbjct  370   NASNSGNGNLCMTGTLIPEKVAGKVVFCDRGVNPR-VQKGAVVKAAGGIGMVLANTAANG  428

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  ++  +P   V    G+ IR+Y+ +   PT  I F+GT +G  PS P VAAFS RG
Sbjct  429   EELVADSHLLPATAVGQKSGDTIRKYLVSDPSPTVTILFEGTKLGIEPS-PVVAAFSSRG  487

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP++LKPD+IAPGVNILA W+ S+            +FN+ISGTSM+CPHVSGLAA
Sbjct  488   PNSITPQLLKPDIIAPGVNILAGWSKSVGPSGLAIDDRRVDFNIISGTSMSCPHVSGLAA  547

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K  +P WSPAAI+SALMTTAYT   +G+  + D+ T +P+TP  +G+GHVDP  A++P
Sbjct  548   LIKGAHPDWSPAAIRSALMTTAYTAYKNGQ-KIQDIATGKPSTPFDHGAGHVDPVSALNP  606

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN  2038
             GLVYD  V+DY++FLC + Y   +I    R     D + +   N   LNYPSF+V+F+  
Sbjct  607   GLVYDLTVDDYLNFLCALNYTPSQINSLARKDFTCDSKKKYSVN--DLNYPSFAVVFEGV  664

Query  2039  LQTVI-------YKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY--  2191
             L           + RT+ NV         +T +T S V+++V P  L FT   D  SY  
Sbjct  665   LGGGGSGSSVVKHTRTLTNVGSPGTYKVSITSETKS-VKISVEPESLSFTGANDKKSYTV  723

Query  2192  ---EVTFQSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
                  T  +   SA++FG + WSDG H+V SPIA SW
Sbjct  724   TFTTTTSSAAPTSAEAFGRIEWSDGKHVVGSPIAFSW  760



>ref|XP_010070627.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59522.1| hypothetical protein EUGRSUZ_H02274 [Eucalyptus grandis]
Length=768

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/751 (47%), Positives = 477/751 (64%), Gaps = 40/751 (5%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             ++ +++IV + KS+ P  F  H  WY SI+ ++S L++      ++Y+Y+  AHGF+ARL
Sbjct  35    QQRRTYIVHVAKSQMPAAFQHHAHWYDSILKSVSGLAH------MVYSYDTAAHGFAARL  88

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L  +P V++VL +   +L TTR+P+FLGL   S+ L P SD   ++++GVLD+
Sbjct  89    TAEEAILLDALPWVVAVLKELRYKLSTTRTPEFLGLDKISALL-PESDSVNEVVVGVLDT  147

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PIV  643
             G+WPE  SF D GL P+P+ WR  CE G NF A +CNRK+IGAR + +GYEA +G   + 
Sbjct  148   GVWPESKSFDDTGLGPVPSGWRGACESGTNFTAANCNRKLIGARFFSKGYEATMGPIDVS  207

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              E KS RD +GHGTH AS AAGSAV  A++ G+A G ARG+AT AR+A YKVCW G C +
Sbjct  208   KESKSPRDDDGHGTHTASTAAGSAVEGASLFGYAPGTARGMATRARVAAYKVCWSGGCFS  267

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ M++AV DGV+VLS+SL  + +T F      D +AIGAF A +KG+ VSC+AGN 
Sbjct  268   SDILAAMEKAVDDGVNVLSVSLDGEMETHFY----GDSVAIGAFAAAEKGIFVSCSAGND  323

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP  Y+  N+APWI TVGA T+DR+FPA VTLGN ++F G SLY G     + +P VY G
Sbjct  324   GPSSYSLSNVAPWIATVGAGTLDRDFPAYVTLGNGKNFPGVSLYGGNSKGTL-LPFVYAG  382

Query  1184  ----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
                 + N   C  G LD +KV+G+IV C++G +   V KG  V  AGG GM++ N   +G
Sbjct  383   NVSNTTNGNLCRKGTLDPAKVKGKIVLCDRGKNAR-VQKGSVVKLAGGAGMVLANTAADG  441

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L P A  +P   V    G+ I+ Y+ +   PTA I F+GT +G  PS P VAAFS RG
Sbjct  442   DELVPEAHLLPATAVGKKSGDAIKSYLFSDPNPTATILFEGTKVGIQPS-PVVAAFSSRG  500

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TPEILKPD+IAPGVNILA WTG++             FN+ISGTSM+CPHVSGLAA
Sbjct  501   PNSITPEILKPDIIAPGVNILAGWTGAVGPTGLPVDDRRVAFNIISGTSMSCPHVSGLAA  560

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             +LK  +P WSPAAI+SALMTTAY    +G G L D+ T + +TP   G+GHVDP  A++P
Sbjct  561   LLKAAHPDWSPAAIRSALMTTAYVAYKNG-GKLQDVATGKDSTPFDRGAGHVDPVSALNP  619

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVD-CRNRNLGNPGSLNYPSFSVLFKN  2035
             GLVYD  V DY+ FLC + Y S +I    R +   D  ++ +L +   LNYPSF+  F +
Sbjct  620   GLVYDLTVEDYLGFLCGLNYTSSQINTLARRNYTCDPSKSYSLYD---LNYPSFAASFDS  676

Query  2036  NL---QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF-  2203
                   T+ Y RT+ NV               + +++ V P+ L F+   +  S+ VT  
Sbjct  677   TSGRPTTIKYTRTLTNVGAATGTYKASASSDSAALKIAVVPDTLSFSKAGEKKSFTVTVT  736

Query  2204  -QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               ++  S ++FG L WSDG   V SP+A SW
Sbjct  737   GSAMPASTNAFGQLEWSDGKQTVRSPMAFSW  767



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/769 (47%), Positives = 485/769 (63%), Gaps = 50/769 (7%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLS------NHSRSSELLYTYEHVAH  268
             E+ K+FI+ +    KP +F TH+ WY S + +LS +S      + + +S ++++Y +V H
Sbjct  32    EQRKTFIIHVQHDAKPSIFPTHNHWYESSLRSLSTVSVNAASPDSADASRIIHSYNNVFH  91

Query  269   GFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG-SSNLGPSSDYGADI  445
             GFSA+L+ S+A +L ++ G+I+V+P+++ ++ TTRSP+FLGL +G ++ L   SD+G+D+
Sbjct  92    GFSAKLSASEAQKLESLSGIIAVIPEQVRQVHTTRSPEFLGLKTGDNAGLLKESDFGSDL  151

Query  446   IIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAE  625
             +IGV+D+GIWPER SF+DR L P P  W+ +C  G NFPA+ CNRK+IGAR +  GYEA 
Sbjct  152   VIGVIDTGIWPERESFNDRNLGPAPAKWKGECVAGENFPASLCNRKLIGARYFCNGYEAT  211

Query  626   IGK-PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
              GK     E +S RD +GHGTH ASIAAG  V  A+  G+ARG A G+A  AR+A YKVC
Sbjct  212   NGKMNETNEFRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGVAAGMAPKARLAAYKVC  271

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W   C ++DIL+  D AVADGV V      S S  G  +PY  D IAIGAFGA   GV V
Sbjct  272   WNAGCYDSDILAAFDAAVADGVDV-----ISLSVGGVVVPYYLDAIAIGAFGAFDAGVFV  326

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             S +AGN GP   T  N+APW+ TVGA TIDR+FPA V LGN R   G S+Y G   +  +
Sbjct  327   SASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGRIIPGVSVYGGPALAHDK  386

Query  1163  V-PVVYGGSA-----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGM  1324
             + P++Y GS      +S  C  G LD + VRG+IV C++G + S   KG  V +AGG+ M
Sbjct  387   LYPLIYAGSEGSDGYSSSLCLEGSLDPNAVRGKIVLCDRGIN-SRAAKGEVVKKAGGIAM  445

Query  1325  IVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTA----SFPTARIEFKGTVIGNS  1492
             I+ N   +G  L  +   +P   V    G+ IR+Y+++A    S P A I F+GT +  +
Sbjct  446   ILANGVFDGEGLVADCHVLPATAVGATSGDEIRRYIQSAMKSKSPPVATIIFRGTRLHVA  505

Query  1493  PSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISG  1639
             P AP VA+FS RGPN  TPEILKPD+IAPG+NILAAW  ++           TEFN++SG
Sbjct  506   P-APVVASFSARGPNPETPEILKPDLIAPGLNILAAWPDNVGPSGIPSDKRRTEFNILSG  564

Query  1640  TSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAY  1819
             TSMACPHVSGLAA+LK  +P WSPAAI+SALMTTAY+ D  G  T++D  T   +T   Y
Sbjct  565   TSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYSHDTRGE-TMLDESTGNSSTVMDY  623

Query  1820  GSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRN-RNLGNPG  1996
             G+GHV P  A+DPGLVYD    DYVDFLC   Y ++ I +  R +   DC   +  G+ G
Sbjct  624   GAGHVHPQKAMDPGLVYDLNSYDYVDFLCNSNYTTKNIQVVTRKA--ADCSGAKRAGHVG  681

Query  1997  SLNYPSFSVLFK---NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFT  2167
             +LNYP+ + +F+   N+  +  + RTV NV    +V Y V +  PS   VTV P RL F 
Sbjct  682   NLNYPTLTAVFQQYGNHKLSTHFIRTVTNVGNPESV-YTVKIHPPSGALVTVEPERLAFR  740

Query  2168  DRIDTLSYEVTFQ--SLRQSADS----FGSLRWSDGTHLVTSPIAVSWE  2296
                  L++ V  Q  +L+ S  S     GS+ WSDG H VTSPI V+ +
Sbjct  741   RVGQKLNFLVRVQAEALKLSPGSSVVKSGSIVWSDGKHFVTSPIVVTMQ  789



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/754 (48%), Positives = 478/754 (63%), Gaps = 46/754 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M     P  + THHDWYS+    L  LS+ S S  LLYTY    HGF+A L   
Sbjct  25    KTYIVHMKHHALPSQYLTHHDWYSA---NLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSQ  81

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISG--------SSNLGPSSDYGADIII  451
             +   L     V+ V  D +  L TTR+P FLGL S         + +L  +S    D+II
Sbjct  82    EVELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGHTTQDLNQASH---DVII  138

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+GIWPE  SF D G+  IP+ WR +CE GP+F  + CN+K+IGAR++ +GY+   G
Sbjct  139   GVLDTGIWPESKSFDDTGMPEIPSRWRGECEAGPDFSPSLCNKKLIGARSFSKGYQMASG  198

Query  632   KPIVGEPK---SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
                  +P+   SARD +GHGTH AS AAGS VANA++ G+ARG ARG+A  AR+A YK C
Sbjct  199   GGYFRKPRENESARDQDGHGTHTASTAAGSHVANASLLGYARGIARGMAPQARVAAYKTC  258

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W   C  +DIL+GMD+A+ DGV VLSLSL      G + PY  D IAIGAF A++KGV V
Sbjct  259   WPTGCFGSDILAGMDRAIMDGVDVLSLSLG-----GGSAPYYRDTIAIGAFAAMEKGVFV  313

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             SC+AGN GP+  +  N+APWI+TVGA T+DR+FPA V LGN + FTG SLYSG       
Sbjct  314   SCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGKRFTGVSLYSGQGMGNKA  373

Query  1163  VPVVY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
             V +VY  G + +S  C PG L+ + VRG++V C++G +   V+KG  V  AGG+GMI+ N
Sbjct  374   VALVYNKGSNTSSNMCLPGSLEPAVVRGKVVVCDRGINAR-VEKGGVVRDAGGIGMILAN  432

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  ++  +P   V    G++IRQYVR+ S PTA + F GT++   PS P VAA
Sbjct  433   TAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLSFGGTILNVRPS-PVVAA  491

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGPN +TP+ILKPDVI PGVNILAAW+ S+           T+FN++SGTSM+CPH+
Sbjct  492   FSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKRKTQFNIMSGTSMSCPHI  551

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SGLAA+LK  +P WSP+AIKSALMTTAYT DN+   +L D      + P A+G+GHVDP 
Sbjct  552   SGLAALLKAAHPQWSPSAIKSALMTTAYTQDNT-NSSLRDAAGGGFSNPWAHGAGHVDPH  610

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+ PGL+YD   NDYV FLC++ Y    +   ++ S +  C +R   +PG LNYPSFSV
Sbjct  611   KALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNIT-C-SRKFADPGQLNYPSFSV  668

Query  2024  LFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
             +F +  + V Y R V NV    +V Y V    P  V+VTV P++LVFT   +   Y VTF
Sbjct  669   VFGSK-RVVRYTRIVTNVGAAGSV-YDVATTAPPVVKVTVKPSKLVFTKVGERKRYTVTF  726

Query  2204  QSLRQSADS----FGSLRWSDGTHLVTSPIAVSW  2293
              + R +A +    FGS+ WS+  H V SP++ +W
Sbjct  727   VASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAW  760



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/757 (48%), Positives = 474/757 (63%), Gaps = 53/757 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M    KP  FSTH+DWY+S + +LS     S +  LLYTY    +GF+A L P 
Sbjct  26    QTYIVHMKHQAKPSTFSTHNDWYASSVQSLS-----SSTDSLLYTYNTAYNGFAASLDPD  80

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGA--------DIII  451
             QA  L     V+ V  D L  L TTRSPQFLG+   SS+ G S+ Y          D+II
Sbjct  81    QAQALRQSDAVLGVYEDTLYTLHTTRSPQFLGI---SSDFGLSAGYSKLDFDKASLDVII  137

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+G+WPE  SF D  +  +P  WR +CE GP+F    CN+K+IGAR + +GY    G
Sbjct  138   GVLDTGVWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKLCNKKLIGARFFSKGYHMAGG  197

Query  632   ----KPIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKV  799
                 KP   EP+S RD +GHGTH AS AAG  VANA++ G+A G ARG+AT+AR+A YKV
Sbjct  198   SFSKKP--NEPESPRDYDGHGTHTASTAAGVPVANASLLGYASGVARGMATHARVATYKV  255

Query  800   CWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVI  979
             CW   C  +DIL+G+D+A+ DGV VLS+SL      G + PY  D IA+GAF A++KG++
Sbjct  256   CWKTGCFGSDILAGIDRAIQDGVDVLSMSLG-----GGSAPYYRDTIAVGAFAAMEKGIV  310

Query  980   VSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI  1159
             VSC+AGN GP   +  N+APWILTVGA T+DR+FPA V LGN +  TG SLYSG      
Sbjct  311   VSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNKKKATGVSLYSGNGMGNK  370

Query  1160  QVPVVYG----GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI  1327
              V +VY     GS++S  C PG L    VRG++V C++G +   V+KG  V  AGGVGMI
Sbjct  371   PVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINAR-VEKGAVVRDAGGVGMI  429

Query  1328  VPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPR  1507
             + N    G +L  ++  +P   +    G+I+R+Y +T   PTA + F GTV+   PS P 
Sbjct  430   LANTAASGEELVADSHLLPAVAIGRKMGDIVREYAKTVPNPTALLTFGGTVLNVRPS-PV  488

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMAC  1654
             VAAFS RGPN +TP+ILKPDVI PGVNILAAWT +            T+FN++SGTSM+C
Sbjct  489   VAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEKDTRRTKFNIMSGTSMSC  548

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PH+SG+AA+LK  +P WSP+AIKSALMTTAY VDN+ +  L D    + +TP A+GSGHV
Sbjct  549   PHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNT-KSPLHDAADGRLSTPWAHGSGHV  607

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
             +P  A+ PGLVYDA   DYV FLC++GY    +   ++  P + C  R    PG LNYPS
Sbjct  608   NPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKR-PNITC-TRKFNTPGELNYPS  665

Query  2015  FSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
             FSVLF +  + V Y R + NV   R++ Y VT   PS V ++V P RL+F    +   Y 
Sbjct  666   FSVLFGDQ-RVVRYTRELTNVGPARSL-YNVTADGPSTVGISVRPKRLLFRTVGEKKRYT  723

Query  2195  VTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF +     +    +FGS+ W +  H V SP+A SW
Sbjct  724   VTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSW  760



>ref|XP_006401917.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
 gb|ESQ43370.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
Length=779

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/754 (46%), Positives = 469/754 (62%), Gaps = 36/754 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLS-PLSNHSRS-SELLYTYEHVAHGFSAR  283
             + K+++V M KS  P  ++ H  WYSS I +++ P S      + +LYTY+   HG +AR
Sbjct  32    QKKTYVVHMDKSAMPLPYTNHLQWYSSKIDSVTGPKSQEEEEGNRILYTYQTAFHGLAAR  91

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVL  460
             L+  +A  L    GV+SV+P+   EL TTRSP FLGL    S  +        D+++GVL
Sbjct  92    LSEEEAERLEEEAGVVSVIPETRYELHTTRSPTFLGLERQESERVLAERVTDHDVVVGVL  151

Query  461   DSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-P  637
             D+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +Y+GYEA  GK  
Sbjct  152   DTGIWPESESFNDTGMSPVPSTWRGACETGKRFLRRNCNRKIVGARVFYKGYEAATGKID  211

Query  638   IVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTC  817
                E +S RD +GHGTH A+  AGS V  AN+ G A G ARG+A  AR+A YKVCW+G C
Sbjct  212   EEVEYRSPRDKDGHGTHTAATVAGSPVRGANLFGFAYGTARGMAPRARVAAYKVCWVGGC  271

Query  818   SNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAG  997
              ++DILS +DQAVADGV V      S S  G    Y  D +AI  FGA++ GV VSC+AG
Sbjct  272   FSSDILSAVDQAVADGVQV-----LSISLGGGISTYSRDSLAIATFGAMEMGVFVSCSAG  326

Query  998   NYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPV  1171
             N GPDP +  N++PWI TVGAST+DR+FPA + LG  R F G SLY G        Q P+
Sbjct  327   NGGPDPISLTNVSPWITTVGASTMDRDFPATMKLGTKRIFKGVSLYKGRTALSRNKQYPL  386

Query  1172  VYGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
             VY G   S      +C  G LD   V G+IV C++G  T  V KG  V +AGG+GM++ N
Sbjct  387   VYLGRNASSPDPTSFCLDGSLDRHNVAGKIVICDRG-VTPRVQKGQVVKRAGGIGMVLTN  445

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P VAA
Sbjct  446   TATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSKKATATLEILGTRIGIKPS-PVVAA  504

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHV  1663
             FS RGPNFL+ EILKPD++APGVNILAAW+G +            +FN++SGTSM+CPHV
Sbjct  505   FSSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDPRRVKFNILSGTSMSCPHV  564

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SG+AA+++  +P WSPAAIKSALMTTAY  DN+ +  L D     P++P+ +G+GH++P 
Sbjct  565   SGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTFK-PLTDASGAAPSSPYDHGAGHINPL  623

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLG-NPGSLNYPSFS  2020
              A+DPGL+YD G  DY DFLCT      ++ +F ++S    C++   G NPG+LNYP+ S
Sbjct  624   KAIDPGLIYDIGPQDYFDFLCTQELSPSQLKVFTKHSNR-SCKHSLAGNNPGNLNYPAIS  682

Query  2021  VLFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
              LF  N  ++++  +RTV NV      +Y+V+V       VTV P  L FT +   LSY 
Sbjct  683   ALFPENTHVKSMTLRRTVTNVGP-HIASYKVSVSPFKGASVTVQPKTLNFTRKHQKLSYT  741

Query  2195  VTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF++ LR     FG L W   TH V SP+ ++W
Sbjct  742   VTFRTKLRLKRPEFGGLLWKSATHRVRSPVIITW  775



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/753 (48%), Positives = 471/753 (63%), Gaps = 43/753 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M    KP+ FSTHHDWYSS + +LS  S+    S LLYTY    HGF+A L P 
Sbjct  33    RTYIVRMNHHAKPESFSTHHDWYSSHLQSLSSSSDSGEYS-LLYTYTSAFHGFAAVLNPD  91

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGAD--------III  451
             +A  L     V+ V  + +  L TTR+P+FLGL   +   G    Y A         ++I
Sbjct  92    EAEALRRSDPVLDVFEETVYSLHTTRTPEFLGL---NPEFGSWVGYSAHDLDQASNGVVI  148

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+G+WPE  SF D G+  IP  WR +CE GP+F    CN+K+IGAR++ +G++   G
Sbjct  149   GVLDTGVWPESRSFDDTGMPEIPEKWRGECESGPDFDPKLCNKKLIGARSFSKGFQMASG  208

Query  632   KPIVG--EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCW  805
                    E  S RDV+GHGTH +S AAGSAV NA+  G+A G ARG+AT AR+A YKVCW
Sbjct  209   GGFSNKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYATGTARGMATRARVATYKVCW  268

Query  806   LGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVS  985
                C  +DIL+GMD+A+ DGV VLSLSL      G + PY  D IAIGAF A++KG+ VS
Sbjct  269   STGCFGSDILAGMDRAILDGVDVLSLSLG-----GGSAPYYRDTIAIGAFSAMEKGIFVS  323

Query  986   CAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQV  1165
             C+AGN GP   +  N+APWI+TVGA T+DR+FPA   LGN   FTG SLYSG       +
Sbjct  324   CSAGNSGPTKASIANVAPWIMTVGAGTLDRDFPAYAALGNGDRFTGVSLYSGEGMGTKPL  383

Query  1166  PVVY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
              +VY  G S++S  C PG LD + VRG+IV C++G +   V+KG  V  AGG GMI+ N 
Sbjct  384   ALVYNKGNSSSSNLCLPGSLDPAIVRGKIVVCDRGVNAR-VEKGAVVRDAGGAGMILANT  442

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   V    G++IR+YV++   PTA + F+GTV+G  PS P VAAF
Sbjct  443   AASGEELVADSHMLPAMAVGRKTGDLIREYVKSDKNPTAVLVFRGTVLGVRPS-PVVAAF  501

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPN +TP+ILKPDVI PGVNILA W+ ++           T+FN++SGTSM+CPH+S
Sbjct  502   SSRGPNTVTPQILKPDVIGPGVNILAGWSEAVGPTGLEKDPRRTQFNIMSGTSMSCPHIS  561

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             GLAA+LK  +P WSP+AIKSALMTTAY VDN+    L D      + P  +GSGHVDP  
Sbjct  562   GLAALLKAAHPEWSPSAIKSALMTTAYNVDNTNL-PLRDAADNSLSNPWTHGSGHVDPQK  620

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+ PGLVYD    +Y+ FLC++ Y    I   ++  P V+C +R   +PG LNYPSFSVL
Sbjct  621   AMSPGLVYDISTEEYIRFLCSLDYTVDHIQAIVKR-PSVNC-SRKFSDPGQLNYPSFSVL  678

Query  2027  FKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             F +  +   Y R + NV    ++ Y+V V  P++V VTV P RLVF    +   Y VTF 
Sbjct  679   FGDK-RVARYTRELTNVGTPGSI-YKVAVDGPASVAVTVKPTRLVFGAVGEKKRYTVTFS  736

Query  2207  SLR----QSADSFGSLRWSDGTHLVTSPIAVSW  2293
             + R     ++  FGS+ WS+  H V SP+  SW
Sbjct  737   AKRGMSLATSSEFGSITWSNSEHSVRSPVVFSW  769



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/753 (46%), Positives = 475/753 (63%), Gaps = 45/753 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M  + KP  F THHDWY++ + +++     S    LLYTY +   GF+A L+  
Sbjct  31    QTYIVHMKHNTKPDSFPTHHDWYTASLQSVT-----STPDSLLYTYTNAFDGFAASLSDE  85

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGL------ISGSSNLGPSSDYGADIIIGV  457
             +   L     V+ V  D L  L TTR+P FLGL      + G   +G +     D+I+GV
Sbjct  86    EVELLKQSQSVVDVYEDTLYSLHTTRTPAFLGLNTDLGLLDGHHAMGINQSSN-DVIVGV  144

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYE-AEIGK  634
             LD+GIWPE  SF D G+  IP  W+ +CE GP+F    CN+K+IGAR + +GY  A  G+
Sbjct  145   LDTGIWPESKSFYDSGMPEIPTRWKGECESGPDFSPKLCNKKLIGARYFSKGYHMASGGR  204

Query  635   PIVGEPK---SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCW  805
               + +PK   S RD +GHGTH AS AAGS V NA++ G+A G ARG+AT+A +A YKVCW
Sbjct  205   GFLKKPKETESPRDQDGHGTHTASTAAGSQVVNASLLGYASGTARGMATSALVASYKVCW  264

Query  806   LGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVS  985
             +  C  +DIL+GMD+A+ DGV V+SLSL      G + PY  D IAIGAF A+++G+ VS
Sbjct  265   VSGCFGSDILAGMDRAIEDGVDVMSLSLG-----GGSAPYYRDTIAIGAFTAMERGIFVS  319

Query  986   CAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQV  1165
             C+AGN GP+  +  N+APWI+TVGA T+DR+FPA   +GN + F G SLYSG    +  V
Sbjct  320   CSAGNSGPNIASLANVAPWIMTVGAGTLDRDFPAYAVMGNKKRFAGVSLYSGAGMGKKPV  379

Query  1166  PVVYGGSANSF--YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
              +VY   +NS    C PG L+   VRG++V C++G +   V+KG  V  AGGVGMI+ N 
Sbjct  380   GLVYKKGSNSTCNLCMPGSLEPQLVRGKVVICDRGINPR-VEKGAVVRDAGGVGMILANT  438

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   V    G++IR+YV++   PTA + F GTV+   PS P VAAF
Sbjct  439   AESGEELVADSHLLPAVAVGRKVGDVIREYVKSDPNPTAVLSFGGTVLDVRPS-PVVAAF  497

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPN +T EILKPD+I PGVNILAAW+ ++           T+FN++SGTSM+CPH+S
Sbjct  498   SSRGPNLVTREILKPDLIGPGVNILAAWSETIGPTGLETDTRKTQFNIMSGTSMSCPHIS  557

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA+LK  +P+WSP+AIKSALMTTAY  DN+    L D      + P A+GSGHVDP  
Sbjct  558   GVAALLKAAHPTWSPSAIKSALMTTAYVSDNT-NSPLQDAAGGALSNPWAHGSGHVDPQK  616

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+ PGLVYD   ++YV FLC++ Y    +   ++  P + C +R   NPG+LNYPSFSV+
Sbjct  617   ALSPGLVYDISADEYVAFLCSLDYTIEHVQAIVKR-PNITC-SRKFNNPGNLNYPSFSVV  674

Query  2027  FKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ  2206
             F NN + V Y R + NV    ++ Y+V V  P  V+VTV P++LVF +  D L Y VTF 
Sbjct  675   FTNN-RVVRYTRELTNVGAAGSI-YEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTVTFV  732

Query  2207  SLRQSA----DSFGSLRWSDGTHLVTSPIAVSW  2293
             + + ++      FG++ W +  H V SP+A SW
Sbjct  733   ARKGASLTGRSEFGAIVWRNAQHQVRSPVAFSW  765



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/754 (48%), Positives = 479/754 (64%), Gaps = 46/754 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV M     P  + THHDWYS+   +L  LS+ S S  LLYTY    HGF+A L   
Sbjct  27    KTYIVHMKHHALPSEYLTHHDWYSA---SLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSE  83

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISG--------SSNLGPSSDYGADIII  451
             +   L     V+ V  D +  L TTR+P FLGL S         + +L  +S    D+II
Sbjct  84    EVELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGHTTQDLNQASH---DVII  140

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+GIWPE  SF D G+  IP+ WR  CE GP+F  + CN+K+IGAR++ +GY+   G
Sbjct  141   GVLDTGIWPESKSFDDTGMPEIPSRWRGGCEAGPDFSPSLCNKKLIGARSFSKGYQMASG  200

Query  632   KPIVGEPK---SARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  802
                  +P+   SARD +GHGTH AS AAGS V NA++ G+ARG ARG+A  AR+A YK C
Sbjct  201   GGYFRKPRENQSARDQDGHGTHTASTAAGSHVPNASLLGYARGIARGMAPQARVAAYKTC  260

Query  803   WLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIV  982
             W   C  +DIL+GMD+A++DGV VLSLSL      G + PY  D IAIGAF A++KGV V
Sbjct  261   WPTGCFGSDILAGMDRAISDGVDVLSLSLG-----GGSAPYYRDTIAIGAFAAMEKGVFV  315

Query  983   SCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQ  1162
             SC+AGN GP+  +  N+APWI+TVGA T+DR+FPA V LGN + FTG SLYSG       
Sbjct  316   SCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGKRFTGVSLYSGQGMGNKA  375

Query  1163  VPVVY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPN  1336
             V +VY  G + +S  C PG LD + VRG++V C++G +   V+KG  V  AGG+GMI+ N
Sbjct  376   VALVYNKGSNTSSNMCLPGSLDPAVVRGKVVVCDRGINAR-VEKGGVVRDAGGIGMILAN  434

Query  1337  LPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAA  1516
                 G +L  ++  +P   V    G++IRQYVR+ S PTA + F GT++   PS P VAA
Sbjct  435   TAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLSFGGTILNVRPS-PVVAA  493

Query  1517  FSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHV  1663
             FS RGPN +TP+ILKPDVI PGVNILAAW+ S+           T+FN++SGTSM+CPH+
Sbjct  494   FSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKRKTQFNIMSGTSMSCPHI  553

Query  1664  SGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPT  1843
             SGLAA+LK  +P WSP+AIKSALMTTAYT DN+   +L D      + P A+G+GHVDP 
Sbjct  554   SGLAALLKAAHPQWSPSAIKSALMTTAYTQDNT-NSSLRDAAGGGFSNPWAHGAGHVDPH  612

Query  1844  HAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSV  2023
              A+ PGL+YD   NDY+ FLC++ Y    +   ++ S +  C +R   +PG LNYPSFSV
Sbjct  613   KALSPGLLYDISTNDYIAFLCSLDYGIDHVQAIVKRSNIT-C-SRKFADPGQLNYPSFSV  670

Query  2024  LFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF  2203
             +F +  + V Y R V NV    +V Y V    PS V+VTV P++LVFT   +   Y VTF
Sbjct  671   VFGSK-RVVRYTRIVTNVGAAGSV-YDVATTAPSVVKVTVKPSKLVFTKVGERKRYTVTF  728

Query  2204  QSLRQSADS----FGSLRWSDGTHLVTSPIAVSW  2293
              + R +A +    FGS+ WS+  H V SP++ +W
Sbjct  729   VASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAW  762



>ref|XP_004499011.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/759 (46%), Positives = 472/759 (62%), Gaps = 48/759 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             +   ++I+   KS  PQ F+ H +W+ S + ++S       ++E+LYTY+HVAHGFS RL
Sbjct  28    QTKNTYIIHTDKSTMPQTFTDHLNWFDSSLKSVS------ETAEILYTYKHVAHGFSTRL  81

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDS  466
             T  +A  L+  PG++SV P+    L TTR+PQFLGL   ++ L P+S+  + +IIGVLD+
Sbjct  82    TLQEADTLSKQPGILSVTPELRYHLHTTRTPQFLGL-PKTNTLLPNSNQQSQVIIGVLDT  140

Query  467   GIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--  640
             GIWPE  S  D GL PIP++W+ +CE G N  +++CN+K+IGAR + +GYEA +G PI  
Sbjct  141   GIWPELKSLDDTGLGPIPSNWKGECETGNNMNSSNCNKKLIGARFFSKGYEAALG-PIDK  199

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E +SARD +GHG+H  + AAGS VA A++ G A G ARG+AT AR+A YKVCWLG C 
Sbjct  200   TTESRSARDDDGHGSHTLTTAAGSEVAEASLFGLASGTARGMATQARVAAYKVCWLGGCF  259

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
              +DI +G+D+A+ DGV++LS+S+      G  + Y  D+IAIG+F A   G++VS +AG 
Sbjct  260   TSDIAAGIDKAIEDGVNILSMSIG-----GSTMDYFRDIIAIGSFTATSHGILVSASAGX  314

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
                 P    N+APWI TVGA TIDR+FPA +TLGN +++TG SLY+G   +   +P+VY 
Sbjct  315   XXXSPENLSNVAPWITTVGAGTIDRDFPAYITLGNGKTYTGASLYNGKPLTDTLLPLVYA  374

Query  1181  G----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNE  1348
             G    S+  + C P  L  S V G++V CE+G + S V+KG+ V  AGG+GMI+ N    
Sbjct  375   GNVSNSSVGYLCIPDSLTPSNVLGKVVVCERGGN-SRVEKGLVVKSAGGIGMILANNEEY  433

Query  1349  GYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCR  1528
             G +L  ++  +P A +      I++ YV  +  P A+I F GT +   PS P VAAFS R
Sbjct  434   GEELIADSHLLPAASLGQKSSTILKDYVFNSPNPKAKIVFGGTHLQVQPS-PVVAAFSSR  492

Query  1529  GPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLA  1675
             GPN LTP+ILKPD+IAPGVNILA WTGS+             FN+ISGTSM+CPHVSGLA
Sbjct  493   GPNALTPKILKPDLIAPGVNILAGWTGSVGPTGLTLDKRHVSFNIISGTSMSCPHVSGLA  552

Query  1676  AMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVD  1855
             A+LK  YP WSPA+I+SALMTTAYT   +G+ T+ D+ T +  TP  +GSGH DP  A+D
Sbjct  553   AILKGAYPDWSPASIRSALMTTAYTSYKNGQ-TIEDVATGKSATPFDFGSGHADPVSALD  611

Query  1856  PGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK-  2032
             PGLVYDA V+DY+ F C + Y S +I L  R     D + +        NYPSFSV F+ 
Sbjct  612   PGLVYDANVDDYLGFFCALNYTSFQIKLAARREYTCDPKKKF--RVEDFNYPSFSVPFET  669

Query  2033  --------NNLQTVIYKRTVKNVAKVRNVAYQVTVQ--TPSNVRVTVSPNRLVFTDRIDT  2182
                     +   +V Y R + NV         V V     S V+V V P  + F +  + 
Sbjct  670   ASGIGGGSSEPVSVEYNRVLTNVGTPGTYKASVVVLPVGSSPVKVVVEPETISFKELYEK  729

Query  2183  LSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
               Y V F   S+     SFG L W+DG H V SPIA SW
Sbjct  730   KGYTVRFTCSSMPSGTTSFGYLEWNDGKHRVVSPIAFSW  768



>ref|XP_009789180.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=779

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/755 (48%), Positives = 473/755 (63%), Gaps = 42/755 (6%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS-----ELLYTYEHVAHGFSA  280
             K++I+ M K  KP +F  H  WYSS++ ++        ++      +LY+Y+   HG +A
Sbjct  34    KTYIIQMDKWAKPDVFIDHVKWYSSLVKSVLSSRTEKETAGDEQERILYSYQTAFHGVAA  93

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGV  457
              L+  + S+L   PGV++V P+   +L TTRSP FLGL    SS L        ++I+GV
Sbjct  94    HLSEEEVSKLQKQPGVLAVFPETKYQLHTTRSPLFLGLDREDSSKLWSDKLADHNVIVGV  153

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-  634
             LD+GIWPE  SF+D G+ PIP  W+  CE G  F    C++KIIGAR +YRGYEA  GK 
Sbjct  154   LDTGIWPESPSFNDTGMTPIPAHWKGACETGRGFEKHHCSKKIIGARIFYRGYEAASGKI  213

Query  635   PIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                GE KSARD +GHGTH A   AGS V  AN+ G+A G ARG+A  AR+A YKVCW+G 
Sbjct  214   NERGEYKSARDQDGHGTHTAGTVAGSVVRGANLLGYAYGTARGMAPGARVAAYKVCWVGG  273

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DILS +DQAVADGV+VLS+SL      G    Y+ D ++I AFGA++KGV VSC+A
Sbjct  274   CFSSDILSAVDQAVADGVNVLSISLG-----GGVSSYNRDSLSIAAFGAMEKGVFVSCSA  328

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQ--PSRIQVP  1168
             GN GPDP +  N++PWI TVGAST+DR+FPA V LG  +  TG SLY G +   +  Q  
Sbjct  329   GNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTGKVITGASLYKGRRNLSTEKQYS  388

Query  1169  VVYGG-----SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVP  1333
             ++Y G        S  C  G LD ++V G+IV C++G     V KG  V  AGGVGMI+ 
Sbjct  389   LIYLGNNSSSPMPSSLCLEGTLDGAEVAGKIVICDRGISPR-VQKGQVVKDAGGVGMILT  447

Query  1334  NLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVA  1513
             N    G +L  ++  +P   V   +G  I+ Y  +A   TA ++F GT +G  PS P VA
Sbjct  448   NTAANGEELVADSHLLPAVAVGEREGRAIKHYA-SARNATATLKFLGTKLGIRPS-PVVA  505

Query  1514  AFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPH  1660
             AFS RGPNFLT EILKPD++APGVNILAAWTG+L           T FN++SGTSM+CPH
Sbjct  506   AFSSRGPNFLTLEILKPDMVAPGVNILAAWTGALGPSSLPTDQRRTNFNILSGTSMSCPH  565

Query  1661  VSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDP  1840
             VSG+AA+LK  +P WSPAAIKSALMTTAY  DN+   +L D  T  P+TP+ +G+GH++P
Sbjct  566   VSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTCN-SLKDSSTATPSTPYDHGAGHINP  624

Query  1841  THAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFS  2020
               AVDPGLVYD G  DY +FLCT      ++ +F + S    C + +L NPG LNYP+ S
Sbjct  625   RKAVDPGLVYDIGAQDYFEFLCTQQLSPSQLMVFGKFSNRT-C-HHSLANPGDLNYPAIS  682

Query  2021  VLFKNN--LQTVIYKRTVKNVAK-VRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
              +F  +  + T+   RTV NVA  + N  Y V V +     V V P+RL FT +   LSY
Sbjct  683   AVFPEDAKVSTLTLHRTVTNVASPISN--YHVRVSSFEGAVVKVEPSRLNFTSKHQKLSY  740

Query  2192  EVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             +V F++  R  A  FGSL W DGTH V S I ++W
Sbjct  741   KVIFETKSRLKAPEFGSLIWKDGTHKVRSTIVITW  775



>ref|XP_010443674.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
 ref|XP_010443682.1| PREDICTED: subtilisin-like protease isoform X3 [Camelina sativa]
Length=779

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/754 (46%), Positives = 467/754 (62%), Gaps = 36/754 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSR---SSELLYTYEHVAHGFSA  280
             + K+++V M +S  P  ++    WYSS I++++   +      S  +LYTY+   HG +A
Sbjct  32    DKKTYVVHMDRSAMPSPYTNQLQWYSSKINSVTQRKSQEGEEGSDRILYTYQTAFHGLAA  91

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGV  457
             +LT  +A +L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GV
Sbjct  92    QLTEEEAEKLEEEDGVVAVIPETRYELHTTRSPTFLGLERQESERVWAERVTDHDVVVGV  151

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKP  637
             LD+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK 
Sbjct  152   LDTGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVGARVFYRGYEAATGKI  211

Query  638   IVG-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E KS RD +GHGTH A+  AGS V  AN+ G A G ARG++  AR+A YKVCW+G 
Sbjct  212   DEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARGMSPKARVAAYKVCWVGG  271

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DILS +DQAVADGV V      S S  G    Y  D ++I  FGA++ GV VSC+A
Sbjct  272   CFSSDILSAVDQAVADGVQV-----LSISLGGGISTYSRDSLSIATFGAMEMGVFVSCSA  326

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVP  1168
             GN GPDP +  N++PWI TVGAST+DR+FPA V LG  R+F G SLY G  V     Q P
Sbjct  327   GNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGVSLYKGRAVLSKNKQYP  386

Query  1169  VVYGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVP  1333
             ++Y G   S      +C  G LD   V G+IV C++G     V KG  V +AGG+GMI+ 
Sbjct  387   LIYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPR-VQKGQVVKRAGGIGMILT  445

Query  1334  NLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVA  1513
             N    G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P VA
Sbjct  446   NTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEVLGTRIGIKPS-PVVA  504

Query  1514  AFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPH  1660
             AFS RGPNFL+ EILKPD++APGVNILAAWTG L            +FN++SGTSM+CPH
Sbjct  505   AFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRVKFNILSGTSMSCPH  564

Query  1661  VSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDP  1840
             VSG+AA+++  +P WSPAAIKSALMTTAY  DN+ +  L D     P++P+ +G+GH+DP
Sbjct  565   VSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLK-PLTDASGAAPSSPYDHGAGHIDP  623

Query  1841  THAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFS  2020
               A+DPG VYD G  DY +FLCT      ++ +F ++S    C++    NPG+LNYP+ S
Sbjct  624   LKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNR-SCKHTLAKNPGNLNYPAIS  682

Query  2021  VLFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
              LF  N  ++++  +RTV NV      +Y+V+V       VTV P  L FT +   LSY 
Sbjct  683   ALFPENTRVKSMTLRRTVTNVGP-HIASYKVSVSPFKGASVTVLPKTLNFTTKHQKLSYT  741

Query  2195  VTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF + +R     FG L W   TH V SP+ ++W
Sbjct  742   VTFTTRMRMKRPEFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/748 (46%), Positives = 474/748 (63%), Gaps = 42/748 (6%)
 Frame = +2

Query  119   SFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPSQ  298
             ++IV M KSE P+ F  H  WY S + ++S       S+E++YTYE+  HGFS RLTP +
Sbjct  30    TYIVHMAKSEMPESFEHHTLWYESSLQSVS------DSAEMMYTYENAIHGFSTRLTPEE  83

Query  299   ASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWP  478
             A  L +  G+++VLP+   EL TTR+PQFLGL   S+++ P S  G ++++GVLD+G+WP
Sbjct  84    ARLLESQTGILAVLPEVKYELHTTRTPQFLGL-DKSADMFPESSSGNEVVVGVLDTGVWP  142

Query  479   ERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--VGEP  652
             E  SF+D G  PIP +W+  CE G NF A +CN+K+IGAR + +G EA +G PI    E 
Sbjct  143   ESKSFNDAGFGPIPTTWKGACESGTNFTAANCNKKLIGARFFSKGVEAMLG-PIDETTES  201

Query  653   KSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADI  832
             KS RD +GHGTH +S AAGS V +A++ G+A G ARG+AT AR+AVYKVCW G C ++DI
Sbjct  202   KSPRDDDGHGTHTSSTAAGSVVPDASLFGYASGTARGMATRARVAVYKVCWKGGCFSSDI  261

Query  833   LSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPD  1012
             L+ +D+A++D V+VLSLSL      G    Y  D +AIGAF A++KG++VSC+AGN GP 
Sbjct  262   LAAIDKAISDNVNVLSLSLG-----GGMSDYFRDSVAIGAFSAMEKGILVSCSAGNAGPS  316

Query  1013  PYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGGSA-  1189
              Y+  N+APWI TVGA T+DR+FPA V+LGN  +++G SLY G       +P++Y G+A 
Sbjct  317   AYSLSNVAPWITTVGAGTLDRDFPASVSLGNGLNYSGVSLYRGNALPESPLPLIYAGNAT  376

Query  1190  ---NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQL  1360
                N   C  G L    V G+IV C++G +   V KG  V  AGG+GM++ N    G +L
Sbjct  377   NATNGNLCMTGTLSPELVAGKIVLCDRGMNAR-VQKGAVVKAAGGLGMVLSNTAANGEEL  435

Query  1361  EPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPNF  1540
               +   +P   V   +G  I++Y+ + + PT +I F+GT +G  PS P VAAFS RGPN 
Sbjct  436   VADTHLLPATAVGEREGNAIKKYLFSEAKPTVKIVFQGTKVGVEPS-PVVAAFSSRGPNS  494

Query  1541  LTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAAMLK  1687
             +TP+ILKPD+IAPGVNILA W+ ++            +FN+ISGTSM+CPHVSGLAA++K
Sbjct  495   ITPQILKPDLIAPGVNILAGWSKAVGPTGLAVDERRVDFNIISGTSMSCPHVSGLAALIK  554

Query  1688  KIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGLV  1867
               +P WSPAA++SALMTTAY    +G   L D  T + +TP  +GSGHVDP  A++PGLV
Sbjct  555   SAHPDWSPAAVRSALMTTAYIAYKNGN-KLQDSATGKSSTPFDHGSGHVDPVAALNPGLV  613

Query  1868  YDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKN--NL  2041
             YD   +DY+ FLC + Y + +I    R     D   +   +   LNYPSF+V+F      
Sbjct  614   YDLTADDYLGFLCALNYTATQITSLARRKFQCDAGKKY--SVSDLNYPSFAVVFDTMGGA  671

Query  2042  QTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---SL  2212
               V + R + NV         VT  +  NV++TV P  L F    +  S+ VTF    S 
Sbjct  672   NVVKHTRILTNVGPAGTYKASVTSDS-KNVKITVEPEELSFKAN-EKKSFTVTFTSSGST  729

Query  2213  RQSADSFGSLRWSDGTHLVTSPIAVSWE  2296
              Q  + FG L W++G ++V SPI++SW+
Sbjct  730   PQKLNGFGRLEWTNGKNVVGSPISISWD  757



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/757 (48%), Positives = 473/757 (62%), Gaps = 53/757 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M    KP  FSTH+DWY+S + +LS     S +  LLYTY     GF+A L P 
Sbjct  45    QTYIVHMKHQAKPSTFSTHYDWYASSVQSLS-----SSTDSLLYTYNTAYDGFAASLDPD  99

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGA--------DIII  451
             QA  L     V+ V  D L  L TTRSPQFLG+   SS+ G S+ Y          D+II
Sbjct  100   QAQALRQSDAVLGVYEDTLYTLHTTRSPQFLGI---SSDFGLSAGYSKLDFDKASLDVII  156

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+G+WPE  SF D  +  +P  WR +CE GP+F    CN+K+IGAR + +GY    G
Sbjct  157   GVLDTGVWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKLCNKKLIGARFFSKGYHMAGG  216

Query  632   ----KPIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKV  799
                 KP   EP+S RD +GHGTH AS AAG  VANA++ G+A G ARG+AT+AR+A YKV
Sbjct  217   SFSKKP--NEPESPRDYDGHGTHTASTAAGVPVANASLLGYASGVARGMATHARVATYKV  274

Query  800   CWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVI  979
             CW   C  +DIL+G+D+A+ DGV VLS+SL      G + PY  D IA+GAF A++KG++
Sbjct  275   CWKTGCFGSDILAGIDRAIQDGVDVLSMSLG-----GGSAPYYRDTIAVGAFAAMEKGIV  329

Query  980   VSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI  1159
             VSC+AGN GP   +  N+APWILTVGA T+DR+FPA V LGN +  TG SLYSG      
Sbjct  330   VSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNKKKATGVSLYSGNGMGNK  389

Query  1160  QVPVVYG----GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI  1327
              V +VY     GS++S  C PG L    VRG++V C++G +   V+KG  V  AGGVGMI
Sbjct  390   PVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINAR-VEKGAVVRDAGGVGMI  448

Query  1328  VPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPR  1507
             + N    G +L  ++  +P   +    G+I+R+Y +T   PTA + F GTV+   PS P 
Sbjct  449   LANTAASGEELVADSHLLPAVAIGRKMGDIVREYAKTVPNPTALLTFGGTVLNVRPS-PV  507

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMAC  1654
             VAAFS RGPN +TP+ILKPDVI PGVNILAAWT +            T+FN++SGTSM+C
Sbjct  508   VAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEKDTRRTKFNIMSGTSMSC  567

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PH+SG+AA+LK  +P WSP+AIKSALMTTAY VDN+ +  L D    + +TP A+GSGHV
Sbjct  568   PHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNT-KSPLHDAADGRLSTPWAHGSGHV  626

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
             +P  A+ PGLVYDA   DYV FLC++GY    +   ++  P + C  R    PG LNYPS
Sbjct  627   NPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKR-PNITC-TRKFNTPGELNYPS  684

Query  2015  FSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
             FSVLF +  + V Y R + NV   R++ Y VT   PS V ++V P RL+F    +   Y 
Sbjct  685   FSVLFGDQ-RVVRYTRELTNVGPARSL-YNVTADGPSTVGISVRPKRLLFRTVGEKKRYT  742

Query  2195  VTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF +     +    +FGS+ W +  H V SP+A SW
Sbjct  743   VTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSW  779



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/752 (47%), Positives = 473/752 (63%), Gaps = 50/752 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             K++IV +  S+KP+ F +HHDWYSS +++          S LLYTY    HGFSA LT S
Sbjct  27    KTYIVRVKHSDKPESFQSHHDWYSSQLNS---------ESSLLYTYTTSFHGFSAYLTSS  77

Query  296   QA-SELANVPGVISVLPDRLVELQTTRSPQFLGL-----ISGSSNLGPSSDYGADIIIGV  457
             +A S L +   ++ V  D L  L TTR+P+FLGL     +  + +L  +S+    +IIGV
Sbjct  78    EAESLLRDSDSILDVFEDPLYTLHTTRTPEFLGLNSEFGVYTNQDLVSASN---GVIIGV  134

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKP  637
             LD+G+WPE  SF D  +  IP+ WR +CE G +F +  CN+K+IGAR++ +G++   G  
Sbjct  135   LDTGVWPESKSFDDTDMPEIPSKWRGECESGSDFDSKLCNKKLIGARSFSKGFQMASGGG  194

Query  638   IVG---EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
                   E  S RDV+GHGTH ++ AAGSAV NA+  G+A G ARG+AT AR+A YKVCW 
Sbjct  195   GFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAGTARGMATRARVATYKVCWS  254

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C  +DIL+ MD+A+ DGV VLSLSL      G + PY  D IAIG+F A++KGV VSC
Sbjct  255   TGCFGSDILAAMDRAILDGVDVLSLSLG-----GGSAPYYRDTIAIGSFSAMEKGVFVSC  309

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP   +  N+APW++TVGA T+DR+FPA   LGN +  TG SLYSGV      + 
Sbjct  310   SAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLTGVSLYSGVGMGTKPLE  369

Query  1169  VVY--GGSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLP  1342
             +VY  G S++S  C PG LD+S VRG+IV C++G +   V+KG  V  AGG+GMI+ N  
Sbjct  370   LVYNQGNSSSSNLCLPGSLDSSIVRGKIVVCDRGVNAR-VEKGAVVRDAGGLGMIMANTA  428

Query  1343  NEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFS  1522
               G +L  ++  +P   V    G+++R+YV++ S PTA + FKGTV+   PS P VAAFS
Sbjct  429   ASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTAVLVFKGTVLDVKPS-PVVAAFS  487

Query  1523  CRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSG  1669
              RGPN +TPEILKPDVI PGVNILA W+ ++           T+FN++SGTSM+CPH+SG
Sbjct  488   SRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQFNIMSGTSMSCPHISG  547

Query  1670  LAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHA  1849
             LA +LK  +P WSP+AIKSALMTTAY +DN+    L D      + PHA+GSGHVDP  A
Sbjct  548   LAGLLKAAHPEWSPSAIKSALMTTAYVLDNT-NSPLHDAADNSLSNPHAHGSGHVDPQKA  606

Query  1850  VDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLF  2029
             + PGLVYD    +Y+ FLC++ Y    I   ++ S  V+C  +   +PG LNYPSFSVLF
Sbjct  607   LSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRSS-VNC-TKKFSDPGQLNYPSFSVLF  664

Query  2030  KNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS  2209
                 + V Y R V NV    +V Y+V V     V ++V P++L F    +   Y VTF S
Sbjct  665   GGK-RVVRYTREVTNVGAANSV-YKVMVNGAPTVEISVKPSKLTFKRVGEKKRYTVTFVS  722

Query  2210  LR----QSADSFGSLRWSDGTHLVTSPIAVSW  2293
              +     +   FGS+ W +  H V SP+A SW
Sbjct  723   KKGVSMTNKAEFGSITWINPQHEVRSPVAFSW  754



>ref|XP_009590448.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=794

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/771 (47%), Positives = 479/771 (62%), Gaps = 55/771 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLS--PLSNHSRSSEL--LYTYEHVAHGFSAR  283
             +S+I+ +    KP  FS    WY S + +LS  PLS    +++L  L+ Y+ V HGFSAR
Sbjct  32    QSYIIRVQNDMKPSAFSDVEHWYGSTLRSLSSNPLSIQVETTDLEFLHVYKTVFHGFSAR  91

Query  284   LTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS---NLGPSSDYGADIIIG  454
             LT  +A ELA+  GV+SVLPDRL +L TTRSP FLGL S +S   NL   SD G++++IG
Sbjct  92    LTAEEAQELASRRGVLSVLPDRLRQLHTTRSPHFLGLDSSASAPANLVSESDSGSNVVIG  151

Query  455   VLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK  634
             VLD+GIWPER SF D+G+ P+P+ W+ +C  G +F   +CN+KIIGAR    GYEA IG+
Sbjct  152   VLDTGIWPERQSFHDKGMGPVPSFWKGECTQGQDFTTANCNKKIIGARYLTAGYEARIGR  211

Query  635   PIVG--EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWL  808
              +    + KSARD +GHGTH AS AAG AV +A++ G A+G A GIA  ARIA YKVCW 
Sbjct  212   IMNSSTDIKSARDSDGHGTHTASTAAGRAVEDASLLGFAKGVAVGIAPKARIASYKVCWK  271

Query  809   GTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSC  988
               C ++DIL+  D+AV DGV+V+S+S+      G A+PY+ D IAIG+FGA++KG++VS 
Sbjct  272   RGCMDSDILAAFDKAVDDGVNVISISIG-----GGAVPYNLDPIAIGSFGAMEKGILVSA  326

Query  989   AAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVP  1168
             +AGN GP P T  N+APWI TVGASTIDR+FPA + LGN +  TG SLYSG      Q+P
Sbjct  327   SAGNEGPRPMTVTNVAPWITTVGASTIDRKFPADIVLGNGKRITGASLYSGDPLPDKQLP  386

Query  1169  VVYGGS-----------ANSF---YCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQ  1306
             +VYGG+           ++SF    C P  LD  +V G+IV C +G  T  V KG  V++
Sbjct  387   LVYGGNVSVGIRNGARHSSSFSAATCMPDSLDKERVHGKIVVCNRG-GTPRVAKGEVVNE  445

Query  1307  AGGVGMIVPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIG  1486
             AGG G+IV N+   G  L  +A  IP   VT + G IIR Y+ + + PTA I F GT +G
Sbjct  446   AGGAGVIVANVAPMGEGLIADAHLIPGLGVTESAGNIIRDYINSNNNPTATIAFYGTQLG  505

Query  1487  NSPSAPRVAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMI  1633
               P AP VA+FS RGPN  +  +LKPDVIAPGVNILAAW   +           T+FN+ 
Sbjct  506   VKP-APVVASFSSRGPNAESIFVLKPDVIAPGVNILAAWPDGVAPTELSSDTRRTQFNIE  564

Query  1634  SGTSMACPHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPH  1813
             SGTSM+CPHVSGLAA+LK  +P WSPA I+SALMTTAYT D  G+  L+D  +   +T  
Sbjct  565   SGTSMSCPHVSGLAALLKGAHPDWSPAMIRSALMTTAYTQDQQGK-MLLDEKSYNVSTVS  623

Query  1814  AYGSGHVDPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNP  1993
               G+GHVDP  AVDPGLVYD  V+DY++FLC   Y  R I    R      C   +   P
Sbjct  624   DMGAGHVDPEKAVDPGLVYDIIVDDYLNFLCASNYSGRDIRQIARRP--WRCMGEHDLKP  681

Query  1994  GSLNYPSFSVLFK----NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLV  2161
              + NYP+ SV+        ++ V   RTV ++ +  +  Y V V  P    VTV+P +L 
Sbjct  682   WNFNYPAISVVIDWTTAPGMRIVQVTRTVTHIGEAPST-YTVLVTNPKGATVTVTPTKLD  740

Query  2162  FTDRIDTLSYEVTFQSLRQSADSF------GSLRWSDGTHLVTSPIAVSWE  2296
             F +R    SY V  ++   +  +       G L WSDG H V SP+ V W+
Sbjct  741   FRERGQRQSYVVRIKAENLAVTTLSSLVEVGMLNWSDGKHQVVSPLVVVWK  791



>ref|XP_002864127.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40386.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/746 (47%), Positives = 465/746 (62%), Gaps = 36/746 (5%)
 Frame = +2

Query  134   MMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSR---SSELLYTYEHVAHGFSARLTPSQAS  304
             M KS  P  ++ H  WYSS I++++   +      ++ +LYTY+   HG +ARLT  +A 
Sbjct  1     MDKSAMPLPYTNHIQWYSSKINSVTQGKSQEEEGNNNRILYTYQTAFHGLAARLTDEEAE  60

Query  305   ELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGVLDSGIWPE  481
              L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GVLD+GIWPE
Sbjct  61    RLEEEDGVVAVIPETRYELHTTRSPTFLGLERQESERVWAERVTDHDVVVGVLDTGIWPE  120

Query  482   RSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPIVG-EPKS  658
               SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK     E KS
Sbjct  121   SESFNDTGMSPVPSTWRGACETGKRFLKRNCNRKIVGARVFYRGYEAATGKIDEELEYKS  180

Query  659   ARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSNADILS  838
              RD +GHGTH A+  AGS+V  AN+ G A G ARG+A  AR+A YKVCW+G C ++DILS
Sbjct  181   PRDRDGHGTHTAATVAGSSVKGANLFGFAYGTARGMAPKARVAAYKVCWVGGCFSSDILS  240

Query  839   GMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNYGPDPY  1018
              +DQAVADGV V      S S  G    Y  D ++I  FGA++ GV VSC+AGN GPDP 
Sbjct  241   AVDQAVADGVQV-----LSISLGGGISTYSRDSLSIATFGAMEMGVFVSCSAGNGGPDPI  295

Query  1019  TAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVVYGGSAN  1192
             +  N++PWI TVGAST+DR+FPA V +G  R+F G SLY G  V     Q P+VY G   
Sbjct  296   SLTNVSPWITTVGASTMDRDFPATVKIGTLRTFKGVSLYKGRTVLSKNKQYPLVYLGRNA  355

Query  1193  S-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEGYQ  1357
             S      +C  G LD   V G+IV C++G  T  V KG  V +AGG+GMI+ N    G +
Sbjct  356   SSPDPTSFCLDGALDRRHVAGKIVICDRG-VTPRVQKGQVVKRAGGIGMILTNTATNGEE  414

Query  1358  LEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRGPN  1537
             L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P VAAFS RGPN
Sbjct  415   LVADSHLLPAVAVGENEGKLIKQYAMTSKKATASLEILGTRIGIKPS-PVVAAFSSRGPN  473

Query  1538  FLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPHVSGLAAML  1684
             FL+ EILKPD++APGVNILAAWTG +            +FN++SGTSM+CPHVSG+AA++
Sbjct  474   FLSLEILKPDLLAPGVNILAAWTGDMAPSSLSSDPRRVKFNILSGTSMSCPHVSGVAALI  533

Query  1685  KKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDPGL  1864
             +  +P WSPAAIKSALMTTAY  DN+ +  L D     P++P+ +G+GH+DP  A+DPGL
Sbjct  534   RSRHPDWSPAAIKSALMTTAYVHDNTLK-PLTDASGAAPSSPYDHGAGHIDPLKAIDPGL  592

Query  1865  VYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFKNN--  2038
             VYD G  +Y +FLCT      ++ +F ++S    C++    NPG+LNYP+ S LF  N  
Sbjct  593   VYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRT-CKHTLAKNPGNLNYPAISALFPENTH  651

Query  2039  LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-LR  2215
             ++ +  +RTV NV      +Y+V+V       VTV P  L FT +   LSY VTF++ +R
Sbjct  652   VKAMTLRRTVTNVGP-HISSYKVSVSPFKGASVTVQPKTLNFTSKHQKLSYTVTFRTRMR  710

Query  2216  QSADSFGSLRWSDGTHLVTSPIAVSW  2293
                  FG L W   TH V SP+ ++W
Sbjct  711   LKRPEFGGLVWKSSTHKVRSPVIITW  736



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/764 (48%), Positives = 481/764 (63%), Gaps = 48/764 (6%)
 Frame = +2

Query  107   EEPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARL  286
             E  K+FIV +    KP +F TH  WY S + +LS  +  +  + +L+TY  V HGFSA+L
Sbjct  28    EAAKTFIVQVQPDAKPSVFPTHAHWYDSTLSSLSSSAGPT--ARVLHTYSTVFHGFSAKL  85

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG-SSNLGPSSDYGADIIIGVLD  463
             +PSQA +L ++P V++++P+++  L TTRSPQFLGL +G S+ L   SD+G+D++IGV+D
Sbjct  86    SPSQALKLWSLPHVLALIPEQVRRLHTTRSPQFLGLKTGDSAGLLKESDFGSDLVIGVVD  145

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPER SF+DR L P+P+ W+ +C  G  FP+TSCNRK+IGAR +Y GYEA  GK   
Sbjct  146   TGIWPERQSFNDRDLGPVPSKWKGECVAGKAFPSTSCNRKLIGARFFYNGYEAANGKMNE  205

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               + +S RD +GHGTH ASIAAG  V  A+  G+A+G A G+A  AR+A YKVCW   C 
Sbjct  206   TTQFRSPRDSDGHGTHTASIAAGRYVFPASTLGYAKGMAAGMAPKARLAAYKVCWDAGCY  265

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+  D AV DGV V      S S  G  +PY  D IAIGAFGA + GV VS +AGN
Sbjct  266   DSDILAAFDAAVGDGVDV-----ISLSVGGVVVPYHLDAIAIGAFGAEEAGVFVSASAGN  320

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYS--GVQPSRIQVPVV  1174
              GP   T  N+APW+ TVGA TIDR+FPA V LGN +   G SLY   G+ P R+  P++
Sbjct  321   GGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGKMIPGVSLYGGPGLTPGRMY-PLI  379

Query  1175  YGGSA-----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y G+      ++  C  G LD S V+ +IV C++G + S   KG  V +AGGVGMI+ N 
Sbjct  380   YAGTEGGDGYSASLCMEGSLDQSLVKDKIVLCDRGIN-SRAAKGEVVKKAGGVGMILANG  438

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASF----PTARIEFKGTVIGNSPSAPR  1507
               +G  L  +   +P   V  A G+ IR+Y+  AS      TA + FKGT +   P AP 
Sbjct  439   VFDGEGLVADCHVLPATAVGAASGDEIRKYIEVASKSKSPATATVIFKGTRLRVRP-APV  497

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMAC  1654
             VA+FS RGPN ++PEILKPDVIAPG+NILAAW  ++           TEFN++SGTSMAC
Sbjct  498   VASFSARGPNPVSPEILKPDVIAPGLNILAAWPDNIGPSGVASDKRKTEFNILSGTSMAC  557

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PHVSGLAA+LK  +P WSPAAI+SALMTTAYTVDN G  T++D  T   +T   YG+GHV
Sbjct  558   PHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGE-TMLDESTGNTSTVMDYGAGHV  616

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRN-RNLGNPGSLNYP  2011
              P  A+DPGL+YD    DYVDFLC   Y +  I +  R     DC   +  G+ G+LNYP
Sbjct  617   HPQKAMDPGLIYDLTPYDYVDFLCNSNYTTANIQVVTRKK--ADCSGAKRAGHSGNLNYP  674

Query  2012  SFSVLFKNNLQ---TVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDT  2182
             S SV F+   +   +  + R+V NV    +V Y+V+V+ P  V VTV P +L F      
Sbjct  675   SLSVTFQQYGKPKMSTHFIRSVTNVGDAESV-YRVSVRPPKGVSVTVRPEKLAFRRIGQK  733

Query  2183  LSY----EVTFQSLRQSADSF--GSLRWSDGTHLVTSPIAVSWE  2296
             L++    EV    L     S   GS+ WSDG H VTSP+ V+ +
Sbjct  734   LNFLVRVEVRAAKLSPGGSSLRSGSVIWSDGKHTVTSPLVVTLQ  777



>ref|XP_006587373.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/755 (45%), Positives = 475/755 (63%), Gaps = 40/755 (5%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHT---LSPLSNHSRSSELLYTYEHVAHGFSARL  286
             K++++ M KS  P+ F  H +WYSS + +    SP ++      ++YTY++  HG +A+L
Sbjct  33    KTYLIQMDKSAMPKAFPNHLEWYSSKVKSALSTSPEADMDNEERIIYTYQNAFHGVAAKL  92

Query  287   TPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSNLGPSSDYGADIIIGVLD  463
             T  +A +L    GV+++ P++  EL TTRSP FLGL    S+N+      G D+I+GVLD
Sbjct  93    TEEEAEKLEAEEGVVTIFPEKKYELHTTRSPTFLGLEPEKSTNMWSEKLAGHDVIVGVLD  152

Query  464   SGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGK-PI  640
             +GIWPE  SF D GL P+P+ W+  CE+G  F  + CN+K++GAR +Y GYEA IG+   
Sbjct  153   TGIWPESESFKDVGLRPVPSHWKGTCEIGTGFTNSHCNKKVVGARVFYHGYEAAIGRINE  212

Query  641   VGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCS  820
               E KS RD +GHGTH A+   GS V  AN+ G+A G ARG+A   RIA YKVCW+G C 
Sbjct  213   QKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGTARGMAPGTRIAAYKVCWIGGCF  272

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DI+S +D+AVADGV+V      S S  G    Y  D +++ AFGA+++GV VSC+AGN
Sbjct  273   SSDIVSAIDKAVADGVNV-----LSISLGGGVSSYYRDSLSVAAFGAMERGVFVSCSAGN  327

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVPVV  1174
              GPDP +  N++PWI TVGAST+DR+FP+ V LGN +   G SLY G  V   + Q P+V
Sbjct  328   SGPDPASLTNVSPWITTVGASTMDRDFPSDVKLGNGKKIIGVSLYKGKNVLSIKKQYPLV  387

Query  1175  YGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             Y GS +S       C  G LD   V G+IV C++G    ++ KG  V  AGGVGMI+ N 
Sbjct  388   YLGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRVL-KGHVVRSAGGVGMILTNT  446

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
                G +L  ++  +P   +   +G+ ++ YV ++   TA + FKGT++G  PS P VAAF
Sbjct  447   EANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKTATAALAFKGTILGIKPS-PVVAAF  505

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPNFL+ EILKPD++APGVNILAAW+ ++            +FN++SGTSM+CPHVS
Sbjct  506   SSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKIDNRRVKFNIVSGTSMSCPHVS  565

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G+AA++K  +P WSPAAIKSALMTT+Y +DN+ + TL D  T +P++P+ +G+GH+DP  
Sbjct  566   GVAALVKSRHPEWSPAAIKSALMTTSYVLDNT-KKTLRDSSTAKPSSPYDHGAGHIDPIR  624

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+DPGLVYD    DY +FLCT      ++ +F + S    CR+ +L + G LNYP+ S +
Sbjct  625   ALDPGLVYDMVPQDYFEFLCTQNLTPTQLKVFAKYSNR-SCRH-SLASSGDLNYPAISSV  682

Query  2027  FKNNLQT-----VIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2191
             F     T     VI  R V NV    +  Y V V       + V P  L FT +   LSY
Sbjct  683   FTQKTTTSFPSPVILHRIVTNVGP-PDSKYHVVVSPFKGASIKVEPETLNFTRKHQKLSY  741

Query  2192  EVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             ++TF+  +RQ++  FG+L W DG H V SPI ++W
Sbjct  742   KITFKPKVRQTSPEFGTLVWKDGFHTVRSPIVITW  776



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/757 (48%), Positives = 474/757 (63%), Gaps = 53/757 (7%)
 Frame = +2

Query  116   KSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLTPS  295
             +++IV M    KP  FSTH+DWY+S + +LS     S +  LLYTY    +GF+A L P 
Sbjct  26    QTYIVHMKHQAKPSTFSTHNDWYASSVQSLS-----SSTDSLLYTYNTAYNGFAASLDPD  80

Query  296   QASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGA--------DIII  451
             QA  L     V+ V  D L  L TTRSPQFLG+   SS+ G  + Y          D+II
Sbjct  81    QAQALRQSDAVLGVYEDTLYTLHTTRSPQFLGI---SSDFGLLAGYSKLDFDKASLDVII  137

Query  452   GVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIG  631
             GVLD+G+WPE  SF D  +  +P  WR +CE GP+F    CN+K+IGAR + +GY    G
Sbjct  138   GVLDTGVWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKLCNKKLIGARFFSKGYHMAGG  197

Query  632   ----KPIVGEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKV  799
                 KP   EP+S RD +GHGTH AS AAG  VANA++ G+A G ARG+AT+AR+A YKV
Sbjct  198   SFSKKP--NEPESPRDYDGHGTHTASTAAGVPVANASLLGYASGVARGMATHARVATYKV  255

Query  800   CWLGTCSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVI  979
             CW   C  +DIL+G+D+A+ DGV VLS+SL      G + PY  D IA+GAF A++KG++
Sbjct  256   CWKTGCFGSDILAGIDRAIQDGVDVLSMSLG-----GGSAPYYRDTIAVGAFAAMEKGIV  310

Query  980   VSCAAGNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRI  1159
             VSC+AGN GP   +  N+APWILTVGA T+DR+FPA V LGN +  TG SLYSG      
Sbjct  311   VSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNKKKATGVSLYSGNGMGNK  370

Query  1160  QVPVVYG----GSANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMI  1327
              V +VY     GS++S  C PG L    VRG++V C++G +   V+KG  V  AGGVGMI
Sbjct  371   PVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINAR-VEKGAVVRDAGGVGMI  429

Query  1328  VPNLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPR  1507
             + N    G +L  ++  +P   +    G+I+R+Y +T   PTA + F GTV+   PS P 
Sbjct  430   LANTAASGEELVADSHLLPAVAIGRRMGDIVREYAKTVPNPTALLTFGGTVLNVRPS-PV  488

Query  1508  VAAFSCRGPNFLTPEILKPDVIAPGVNILAAWTGS-----------LTEFNMISGTSMAC  1654
             VAAFS RGPN +TP+ILKPDVI PGVNILAAWT +            T+FN++SGTSM+C
Sbjct  489   VAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEKDTRRTKFNIMSGTSMSC  548

Query  1655  PHVSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHV  1834
             PH+SG+AA+LK  +P WSP+AIKSALMTTAY VDN+ +  L D    + +TP A+GSGHV
Sbjct  549   PHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNT-KSPLHDAADGRLSTPWAHGSGHV  607

Query  1835  DPTHAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPS  2014
             +P  A+ PGLVYDA   DY+ FLC++GY    +   ++  P + C  R    PG LNYPS
Sbjct  608   NPQKAISPGLVYDASTEDYIAFLCSLGYTIEHVKAIVKR-PNITC-TRKFNTPGELNYPS  665

Query  2015  FSVLFKNNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
             FSVLF +  + V Y R + NV   R++ Y VTV  PS V ++V P RL+F    +   Y 
Sbjct  666   FSVLFGDQ-RVVRYTRELTNVGPARSL-YNVTVDGPSTVGISVRPKRLLFRTVGEKKRYT  723

Query  2195  VTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF +     +    +FGS+ W +  H V SP+A SW
Sbjct  724   VTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSW  760



>ref|XP_010443668.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=779

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/754 (46%), Positives = 465/754 (62%), Gaps = 36/754 (5%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSS---ELLYTYEHVAHGFSA  280
             + K+++V M +S  P  ++    WYSS I++++   +         +LYTY+   HG +A
Sbjct  32    DKKTYVVHMDRSAMPSPYTNQLQWYSSKINSVTQRKSQEGEEGNDRILYTYQTAFHGLAA  91

Query  281   RLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSNLGPSSDYGADIIIGV  457
             +LT  +A  L    GV++V+P+   EL TTRSP FLGL    S  +        D+++GV
Sbjct  92    QLTEEEAERLKEEDGVVAVIPETRYELHTTRSPTFLGLERQESEKVWAERVTDHDVVVGV  151

Query  458   LDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKP  637
             LD+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+GAR +YRGYEA  GK 
Sbjct  152   LDTGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVGARVFYRGYEAATGKI  211

Query  638   IVG-EPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT  814
                 E KS RD +GHGTH A+  AGS V  AN+ G A G ARG++  AR+A YKVCW+G 
Sbjct  212   DEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARGMSPKARVAAYKVCWVGG  271

Query  815   CSNADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAA  994
             C ++DILS +DQAVADGV V      S S  G    Y  D ++I  FGA++ GV VSC+A
Sbjct  272   CFSSDILSAVDQAVADGVQV-----LSISLGGGISTYSRDSLSIATFGAMEMGVFVSCSA  326

Query  995   GNYGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSG--VQPSRIQVP  1168
             GN GPDP +  N++PWI TVGAST+DR+FPA V LG  R+F G SLY G  V     Q P
Sbjct  327   GNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGVSLYKGRAVLSKNKQYP  386

Query  1169  VVYGGSANS-----FYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVP  1333
             ++Y G   S      +C  G LD   V G+IV C++G     V KG  V +AGG+GMI+ 
Sbjct  387   LIYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPR-VQKGQVVKRAGGIGMILT  445

Query  1334  NLPNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVA  1513
             N    G +L  ++  +P   V   +G++I+QY  T+   TA +E  GT IG  PS P VA
Sbjct  446   NTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEVLGTRIGIKPS-PVVA  504

Query  1514  AFSCRGPNFLTPEILKPDVIAPGVNILAAWTGSLT-----------EFNMISGTSMACPH  1660
             AFS RGPNFL+ EILKPD++APGVNILAAWTG L            +FN++SGTSM+CPH
Sbjct  505   AFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRVKFNILSGTSMSCPH  564

Query  1661  VSGLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDP  1840
             VSG+AA+++  +P WSPAAIKSALMTTAY  DN+ +  L D     P++P+ +G+GH+DP
Sbjct  565   VSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLK-PLTDASGAAPSSPYDHGAGHIDP  623

Query  1841  THAVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFS  2020
               A+DPG VYD G  DY +FLCT      ++ +F ++S    C++    NPG+LNYP+ S
Sbjct  624   LKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNR-SCKHTLAKNPGNLNYPAIS  682

Query  2021  VLFKNN--LQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYE  2194
              LF  N  ++++  +RTV NV      +Y+V+V       VTV P  L FT +   LSY 
Sbjct  683   ALFPENTRVKSMTLRRTVTNVGP-HIASYKVSVSPFKGASVTVLPKTLNFTTKHQKLSYT  741

Query  2195  VTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2293
             VTF + +R     FG L W   TH V SP+ ++W
Sbjct  742   VTFTTRMRMKRPEFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_007156742.1| hypothetical protein PHAVU_002G013500g [Phaseolus vulgaris]
 gb|ESW28736.1| hypothetical protein PHAVU_002G013500g [Phaseolus vulgaris]
Length=728

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/707 (47%), Positives = 472/707 (67%), Gaps = 41/707 (6%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             +  ++IV + KSE P + + H  WY SI+ ++S       S+E+LYTY++  HGFSARLT
Sbjct  34    QKSTYIVHVAKSEMPTILNHHSIWYRSILKSIS------NSAEILYTYDNAIHGFSARLT  87

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
               +   L +  G++ VLP+++ +  TTR+PQFLGL    +++ P+S+  +DIIIG+LD+G
Sbjct  88    LEETQLLKSQIGILKVLPEKIYKPLTTRTPQFLGL-DKITDMFPASNATSDIIIGLLDTG  146

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEIGKPI--V  643
             +WPE  SF D  L P+P SW+ KCE G NF A +CN+K+IGAR + +G EA +G P+   
Sbjct  147   VWPESKSFDDAELGPVPTSWKGKCESGQNFTAANCNKKLIGARFFLKGLEASVG-PLNAT  205

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGTCSN  823
              + +S RD +GHGTH AS AAGSAV  A++ G+A G ARG+A +AR+A+YKVCW   C  
Sbjct  206   KQFRSPRDSDGHGTHTASTAAGSAVKGASLFGYASGVARGMAPHARVAIYKVCWEDNCVG  265

Query  824   ADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGNY  1003
             +DIL+ MD A+AD V+V+S SL      G A+ YDE+ +AIGAF A++KG++V+CAAGN 
Sbjct  266   SDILAAMDAAIADNVNVISASLG-----GQAVDYDEENLAIGAFAAMEKGIVVACAAGND  320

Query  1004  GPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYGG  1183
             GP   T  N+APW++TVGA TIDR+FP  V LGN ++++G S++ G    R  VP++Y G
Sbjct  321   GPTDSTLQNVAPWMITVGAGTIDRDFPVYVKLGNGKNYSGVSIHDGSLTPRTFVPLIYAG  380

Query  1184  SA----NSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNLPNEG  1351
             +A     +  C  G LD  KV+G+IVFC++G + S V+KG+ V  AGGVGM++ N   +G
Sbjct  381   NAGVKTGAELCLTGSLDPEKVKGKIVFCDRG-NISRVEKGLVVKSAGGVGMVLANGKIDG  439

Query  1352  YQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAFSCRG  1531
              +L  +A  +PTA V  +  + I+ Y++ A  PTA + F+GTV+G  PS P V+AFS RG
Sbjct  440   EELVADAHLLPTAAVGFSASKAIKMYLQQAQNPTATLVFQGTVVGIQPS-PIVSAFSSRG  498

Query  1532  PNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVSGLAA  1678
             PN +TP+ILKPD IAPGVNILAA+T +             +FN+I+GTSMACPH SG+AA
Sbjct  499   PNPITPDILKPDFIAPGVNILAAFTKAAGPTNLDQDDRRVDFNIITGTSMACPHASGIAA  558

Query  1679  MLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTHAVDP  1858
             ++K +YP+WSPAAI+SALMTTAY   N+G+  L+D  T  P+TP A G+GHV+P  A++P
Sbjct  559   LIKSVYPNWSPAAIRSALMTTAYVSYNNGK-KLLDSATNGPSTPFAVGAGHVNPIAALNP  617

Query  1859  GLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVLFK--  2032
             GLVYD   +DY++FLC + Y +++I    R    V C  +   +  +LNYPSF V+FK  
Sbjct  618   GLVYDLTADDYLNFLCALNYTAKRIEAVARRK--VSCDAQKHYSVTNLNYPSFGVVFKQV  675

Query  2033  ---NNLQTVIYKRTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVF  2164
                ++   V ++RT+ NV         VT+  PS V +TV PN L F
Sbjct  676   ARSSSATVVKHERTLTNVGVAGTYKASVTLDNPS-VNITVEPNVLSF  721



>ref|XP_010467397.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=769

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/758 (48%), Positives = 470/758 (62%), Gaps = 50/758 (7%)
 Frame = +2

Query  110   EPKSFIVFMMKSEKPQLFSTHHDWYSSIIHTLSPLSNHSRSSELLYTYEHVAHGFSARLT  289
             E K++I  +    KP +FSTH+ WY+S           +    +L+ Y+ V HGFSA +T
Sbjct  26    EKKTYIFRIDSGLKPSVFSTHYHWYTS---------EFTEGPRILHLYDTVFHGFSASVT  76

Query  290   PSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPSSDYGADIIIGVLDSG  469
             P  A  L N P V++V  DR  EL TTRSPQFLGL      L  +SDYG+D+IIGVLD+G
Sbjct  77    PDDAQTLRNHPAVLAVFEDRRRELHTTRSPQFLGL-RNQKGLWSNSDYGSDVIIGVLDTG  135

Query  470   IWPERSSFSDRGLNPIPNSWRNKCEVGPNFPATSCNRKIIGARAYYRGYEAEI--GKPIV  643
             IWPER SFSD  L P+P  WR  C+ G  F A +CN+KIIGAR + +G +A +  G    
Sbjct  136   IWPERRSFSDLNLGPVPKRWRGVCQTGVRFDARNCNKKIIGARYFAKGQQAAMFGGINKT  195

Query  644   GEPKSARDVNGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVCWLGT-CS  820
              E  S RD +GHGTH AS AAG     AN+ G+A G A+G+A  ARIA YKVCW  + C 
Sbjct  196   VEFLSPRDADGHGTHTASTAAGRQAFRANMAGYASGVAKGVAPKARIAAYKVCWKDSGCL  255

Query  821   NADILSGMDQAVADGVHVlslsltsksktGFALPYDEDLIAIGAFGAVQKGVIVSCAAGN  1000
             ++DIL+  D AV+DGV V+S+S+      G   PY  D IAIG++GA   GV VS +AGN
Sbjct  256   DSDILAAFDAAVSDGVDVISISIGGGD--GIPSPYYLDPIAIGSYGAASMGVFVSSSAGN  313

Query  1001  YGPDPYTAVNLAPWILTVGASTIDREFPAVVTLGNSRSFTGTSLYSGVQPSRIQVPVVYG  1180
              GP+  +  NLAPWI TVGA TIDR+FPA V LG+     G SLYSGV       PVVY 
Sbjct  314   DGPNGMSVTNLAPWITTVGAGTIDRDFPADVVLGDGHRLRGVSLYSGVPLKGQMFPVVYP  373

Query  1181  G-------SANSFYCFPGQLDASKVRGRIVFCEQGDDTSIVDKGVAVSQAGGVGMIVPNL  1339
             G       S ++  C    LD   VRG+IV C++G +  +  KG+ V +AGGVGMI+ N 
Sbjct  374   GKNGMLAASLSASLCMENSLDPKLVRGKIVICDRGSNPRVA-KGLVVKKAGGVGMILANT  432

Query  1340  PNEGYQLEPNADRIPTAVVTVADGEIIRQYVRTASFPTARIEFKGTVIGNSPSAPRVAAF  1519
              + G  L  +A  IP + V  + G+ I+ Y  T   P A I F+GTVIG  P AP VA+F
Sbjct  433   VSNGEGLVGDAHLIPASNVGSSAGDRIKAYASTHLNPIATIGFRGTVIGVKP-APVVASF  491

Query  1520  SCRGPNFLTPEILKPDVIAPGVNILAAWTGSL-----------TEFNMISGTSMACPHVS  1666
             S RGPN L PEILKPD+IAPGVNILAAWT ++           TEFN++SGTSMACPHVS
Sbjct  492   SGRGPNGLNPEILKPDLIAPGVNILAAWTDAVGPTGIVSDRRKTEFNILSGTSMACPHVS  551

Query  1667  GLAAMLKKIYPSWSPAAIKSALMTTAYTVDNSGRGTLIDLYTRQPTTPHAYGSGHVDPTH  1846
             G AA+LK  +P WSPAAI+SA+MTTA  VDNS R +LID  T + +TP+ +GSGH++   
Sbjct  552   GAAALLKSAHPDWSPAAIRSAMMTTASLVDNSNR-SLIDESTGKRSTPYDFGSGHLNLGR  610

Query  1847  AVDPGLVYDAGVNDYVDFLCTIGYDSRKIALFLRNSPLVDCRNRNLGNPGSLNYPSFSVL  2026
             A+DPGLVYD   +DY+ FLC+IGY+ + I +  R    V C  R   +PG+LNYPS + L
Sbjct  611   AIDPGLVYDITNDDYIAFLCSIGYEMKTIQVITRTP--VRCPTRKP-SPGNLNYPSITAL  667

Query  2027  FKNNLQTVIYK---RTVKNVAKVRNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEV  2197
             F  + + ++ K   RTV NV +   V Y   +++P  V VTV P+RLVFT  +  LSY V
Sbjct  668   FPTSNRDLLSKTLFRTVTNVGQSEAV-YMARIESPRGVTVTVKPSRLVFTSAVKKLSYAV  726

Query  2198  TFQ------SLRQSADSFGSLRWSD-GTHLVTSPIAVS  2290
             T        +L  S  +FGS+ W D G H+V S + V+
Sbjct  727   TVTVDTKNLALGTSGAAFGSVTWFDGGKHVVRSAVVVT  764



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8096480025632