BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25055_g1_i1 len=2206 path=[206:0-347 5916:348-350 557:351-406
8331:407-466 673:467-664 5210:665-737 944:738-783 6172:784-848
1055:849-880 7688:881-935 7742:936-999 1206:1000-1035 7424:1036-1276
1483:1277-1316 5534:1317-1340 1547:1341-1369 5420:1370-1448
5499:1449-1460 1634:1461-1512 6348:1513-1518 1692:1519-1552
7970:1553-1644 1818:1645-1670 7020:1671-1787 1961:1788-1823
6057:1824-1915 2089:1916-2205]

Length=2206
                                                                      Score     E

ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                803   0.0     
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           802   0.0     
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                798   0.0     
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                798   0.0     
emb|CDP20511.1|  unnamed protein product                                796   0.0     
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                794   0.0     Vitis vinifera
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           790   0.0     
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     784   0.0     
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                784   0.0     
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                783   0.0     
ref|XP_007024651.1|  Subtilase family protein                           778   0.0     
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                775   0.0     
ref|XP_006369129.1|  subtilase family protein                           775   0.0     
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             775   0.0     
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                775   0.0     
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                774   0.0     
emb|CAN75239.1|  hypothetical protein VITISV_014205                     772   0.0     Vitis vinifera
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                771   0.0     
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                769   0.0     
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           768   0.0     
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                763   0.0     
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                761   0.0     
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                760   0.0     
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                758   0.0     
ref|XP_010111996.1|  Subtilisin-like protease                           759   0.0     
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             757   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           755   0.0     
emb|CDY33251.1|  BnaC01g37240D                                          755   0.0     
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                754   0.0     
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                749   0.0     
ref|NP_566473.2|  Subtilase family protein                              749   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY39093.1|  BnaA01g29630D                                          749   0.0     
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                750   0.0     
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             748   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           747   0.0     
ref|XP_002885009.1|  subtilase family protein                           746   0.0     
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                746   0.0     
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             745   0.0     
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    744   0.0     
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             743   0.0     
gb|KDP40686.1|  hypothetical protein JCGZ_24685                         742   0.0     
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                742   0.0     
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    741   0.0     
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                739   0.0     
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    739   0.0     
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                738   0.0     
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                737   0.0     
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                736   0.0     
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    733   0.0     
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    730   0.0     
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           725   0.0     
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             725   0.0     
gb|EPS74243.1|  subtilase family protein                                715   0.0     
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    712   0.0     
gb|ADW11233.1|  subtilisin-like protease 2                              708   0.0     
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             723   0.0     
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                702   0.0     
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           702   0.0     
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          700   0.0     
gb|AFW73751.1|  putative subtilase family protein                       699   0.0     
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                692   0.0     
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980          691   0.0     Sorghum bicolor [broomcorn]
emb|CDY52259.1|  BnaC05g52030D                                          685   0.0     
ref|NP_001048301.1|  Os02g0779200                                       679   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                669   0.0     
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           669   0.0     
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease                668   0.0     
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                665   0.0     
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   659   0.0     
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                664   0.0     
gb|AGN03879.1|  senescence-associated subtilisin protease               665   0.0     
dbj|BAJ93208.1|  predicted protein                                      664   0.0     
dbj|BAJ87876.1|  predicted protein                                      664   0.0     
ref|XP_010088794.1|  Subtilisin-like protease                           663   0.0     
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                662   0.0     
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                659   0.0     
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                658   0.0     
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           657   0.0     
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                652   0.0     
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                652   0.0     
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                650   0.0     
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                649   0.0     
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           649   0.0     
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                649   0.0     
emb|CDP15538.1|  unnamed protein product                                649   0.0     
ref|NP_569048.1|  subtilisin-like protease                              648   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDP02570.1|  unnamed protein product                                647   0.0     
ref|XP_010088796.1|  Subtilisin-like protease                           647   0.0     
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             646   0.0     
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                647   0.0     
emb|CDY67452.1|  BnaCnng55020D                                          645   0.0     
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                645   0.0     
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                645   0.0     
gb|AAM10321.1|  AT5g67360/K8K14_8                                       643   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97136.1|  predicted protein                                      644   0.0     
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           642   0.0     
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           643   0.0     
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             642   0.0     
emb|CDY00497.1|  BnaA10g07760D                                          642   0.0     
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                642   0.0     
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    640   0.0     
gb|ACN27710.1|  unknown                                                 638   0.0     Zea mays [maize]
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                640   0.0     
ref|XP_007047459.1|  Subtilase family protein                           640   0.0     
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                640   0.0     
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                639   0.0     
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          640   0.0     
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             639   0.0     
tpg|DAA50265.1|  TPA: putative subtilase family protein                 639   0.0     
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                639   0.0     
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         638   0.0     
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like           639   0.0     
emb|CDY12840.1|  BnaC07g15930D                                          638   0.0     
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         637   0.0     
ref|XP_010111995.1|  Subtilisin-like protease                           637   0.0     
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           637   0.0     
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                637   0.0     Vitis vinifera
emb|CDY63302.1|  BnaCnng41810D                                          637   0.0     
dbj|BAJ91400.1|  predicted protein                                      638   0.0     
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      637   0.0     Ricinus communis
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           637   0.0     
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             636   0.0     
emb|CAA59963.1|  subtilisin-like protease                               635   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   636   0.0     
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                636   0.0     
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                636   0.0     
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           636   0.0     
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             636   0.0     
emb|CDY29697.1|  BnaA04g17300D                                          635   0.0     
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                636   0.0     
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     636   0.0     
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             635   0.0     
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                635   0.0     
emb|CDX99895.1|  BnaC09g28100D                                          635   0.0     
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                635   0.0     
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    634   0.0     
ref|XP_010105479.1|  Subtilisin-like protease                           635   0.0     
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                634   0.0     
ref|NP_001050634.1|  Os03g0605300                                       634   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                634   0.0     
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           634   0.0     
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                633   0.0     
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             634   0.0     
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                633   0.0     
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             633   0.0     
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           633   0.0     
gb|KHN21060.1|  Subtilisin-like protease                                631   0.0     
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like           633   0.0     
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                632   0.0     
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             632   0.0     
ref|NP_001151549.1|  subtilisin-like protease precursor                 632   0.0     Zea mays [maize]
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     632   0.0     
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             632   0.0     
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           632   0.0     
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          631   0.0     
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g             631   0.0     
emb|CDY57437.1|  BnaAnng14520D                                          629   0.0     
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                630   0.0     
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like           630   0.0     
ref|NP_568765.1|  subtilase 1.3                                         630   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                630   0.0     
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                629   0.0     
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                629   0.0     
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             629   0.0     
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                629   0.0     
ref|XP_002864127.1|  subtilase family protein                           628   0.0     
gb|KHN45156.1|  Subtilisin-like protease                                627   0.0     
ref|XP_010105478.1|  Subtilisin-like protease                           629   0.0     
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           629   0.0     
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           628   0.0     
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     628   0.0     
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           627   0.0     
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                627   0.0     
ref|XP_010087293.1|  Subtilisin-like protease                           627   0.0     
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                627   0.0     Vitis vinifera
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             626   0.0     Musa acuminata [banana]
gb|KHN13888.1|  Subtilisin-like protease                                625   0.0     
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                627   0.0     
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                626   0.0     
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                627   0.0     
gb|KHN27220.1|  Subtilisin-like protease                                625   0.0     
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     626   0.0     
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    626   0.0     
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                626   0.0     
gb|EMT11726.1|  Subtilisin-like protease                                626   0.0     
gb|EPS65791.1|  hypothetical protein M569_08985                         624   0.0     
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             626   0.0     
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             626   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                624   0.0     
gb|KHN10472.1|  Subtilisin-like protease                                623   0.0     
ref|NP_001234288.1|  SBT2 protein precursor                             625   0.0     
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           624   0.0     
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     625   0.0     
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           625   0.0     
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                624   0.0     
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    624   0.0     
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                625   0.0     
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    624   0.0     
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             624   0.0     
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                624   0.0     
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     624   0.0     
dbj|BAH20348.1|  AT3G14067                                              617   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                623   0.0     
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     623   0.0     
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   623   0.0     
dbj|BAJ93872.1|  predicted protein                                      623   0.0     
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                622   0.0     
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             622   0.0     
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                622   0.0     
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     622   0.0     
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                622   0.0     
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     622   0.0     
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                622   0.0     
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                622   0.0     
emb|CAN75240.1|  hypothetical protein VITISV_014207                     615   0.0     Vitis vinifera
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             622   0.0     
tpg|DAA51518.1|  TPA: putative subtilase family protein                 621   0.0     
emb|CDY18654.1|  BnaA09g07410D                                          620   0.0     
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             622   0.0     
emb|CDY22001.1|  BnaC09g01070D                                          620   0.0     
gb|ABR17987.1|  unknown                                                 621   0.0     Picea sitchensis
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                621   0.0     
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          621   0.0     Sorghum bicolor [broomcorn]
dbj|BAJ96698.1|  predicted protein                                      621   0.0     
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    620   0.0     
dbj|BAJ86110.1|  predicted protein                                      620   0.0     
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                620   0.0     
emb|CDY18651.1|  BnaA09g07440D                                          620   0.0     
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                620   0.0     
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             620   0.0     
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease                620   0.0     
gb|KEH35793.1|  subtilisin-like serine protease                         619   0.0     
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                620   0.0     
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                621   0.0     
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                619   0.0     Vitis vinifera
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           619   0.0     
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           619   0.0     
ref|XP_002533857.1|  Cucumisin precursor, putative                      618   0.0     Ricinus communis
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           619   0.0     
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           619   0.0     
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           619   0.0     
gb|KHN12975.1|  Subtilisin-like protease                                618   0.0     
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         617   0.0     
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like           619   0.0     
ref|XP_003595292.1|  Subtilisin-like protease                           619   0.0     
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      618   0.0     Ricinus communis
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                618   0.0     
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             618   0.0     
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                619   0.0     
ref|XP_003608462.1|  Subtilisin-like protease                           617   0.0     
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    617   0.0     
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           617   0.0     
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                617   0.0     Vitis vinifera
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           617   0.0     
gb|ABR18065.1|  unknown                                                 618   0.0     Picea sitchensis
ref|XP_010090170.1|  Subtilisin-like protease                           617   0.0     
ref|XP_002885806.1|  predicted protein                                  616   0.0     
ref|NP_001151463.1|  LOC100285096 precursor                             617   0.0     Zea mays [maize]
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                617   0.0     
gb|EAZ24824.1|  hypothetical protein OsJ_08603                          615   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006381615.1|  subtilase family protein                           616   0.0     
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             616   0.0     
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     616   0.0     Zea mays [maize]
ref|XP_002320086.2|  subtilase family protein                           616   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             616   0.0     
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     619   0.0     
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                616   0.0     
gb|ACF79126.1|  unknown                                                 616   0.0     Zea mays [maize]
ref|NP_001234282.1|  SBT1 protein precursor                             616   0.0     
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             615   0.0     
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             616   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                616   0.0     
ref|NP_565330.1|  Subtilase-like protein                                615   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_001051353.1|  Os03g0761500                                       615   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                616   0.0     
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    615   0.0     
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                615   0.0     
dbj|BAJ88205.1|  predicted protein                                      617   0.0     
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             615   0.0     
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                615   0.0     
gb|ADD09584.1|  proteinase inhibitor                                    615   0.0     
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                614   0.0     
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      615   0.0     
emb|CDP05276.1|  unnamed protein product                                615   0.0     
gb|EAY87753.1|  hypothetical protein OsI_09169                          615   0.0     
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                614   0.0     
emb|CDO96926.1|  unnamed protein product                                615   0.0     
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                615   0.0     
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                614   0.0     
gb|AES59354.2|  subtilisin-like serine protease                         613   0.0     
ref|NP_001048303.1|  Os02g0780200                                       615   0.0     
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           614   0.0     
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           614   0.0     
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                614   0.0     
gb|KHG02130.1|  Subtilisin-like protease                                614   0.0     
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease-like           613   0.0     
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...    613   0.0     
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           613   0.0     
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      612   0.0     
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_009590448.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                613   0.0     
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                612   0.0     
gb|EPS61757.1|  hypothetical protein M569_13035                         611   0.0     
gb|AIX97848.1|  SBT1.5                                                  612   0.0     
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             612   0.0     
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             611   0.0     
ref|XP_004954114.1|  PREDICTED: subtilisin-like protease-like           612   0.0     
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                611   0.0     
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                611   0.0     
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             610   0.0     
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease                611   0.0     
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                611   0.0     
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          611   0.0     
ref|XP_007012625.1|  Subtilase family protein                           610   0.0     
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                610   0.0     
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             610   0.0     
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like           611   0.0     
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                610   0.0     
ref|XP_003570499.1|  PREDICTED: subtilisin-like protease                610   0.0     
gb|AFW73750.1|  putative subtilase family protein                       610   0.0     
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           610   0.0     
ref|XP_007051971.1|  Subtilase family protein                           610   0.0     
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                609   0.0     
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                610   0.0     
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                609   0.0     
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like           609   0.0     
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                612   0.0     
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             609   0.0     
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             608   0.0     
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          610   0.0     
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     609   0.0     
ref|XP_001755716.1|  predicted protein                                  607   0.0     
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           609   0.0     
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     608   0.0     
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            609   0.0     
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                609   0.0     
emb|CDY63219.1|  BnaAnng18730D                                          608   0.0     
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                608   0.0     
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                608   0.0     
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                608   0.0     
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     613   0.0     
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                608   0.0     
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           608   0.0     
gb|ACN40199.1|  unknown                                                 608   0.0     
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                608   0.0     
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           608   0.0     
gb|KHN15704.1|  Subtilisin-like protease                                607   0.0     
dbj|BAJ87780.1|  predicted protein                                      608   0.0     
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           607   0.0     
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           608   0.0     
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                608   0.0     
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           606   0.0     
gb|EPS59495.1|  hypothetical protein M569_15309                         606   0.0     
gb|AES80028.2|  subtilisin-like serine protease                         607   0.0     
ref|XP_002452918.1|  hypothetical protein SORBIDRAFT_04g034950          607   0.0     
ref|XP_003623810.1|  Subtilisin-like protease                           607   0.0     
gb|KHG16003.1|  Subtilisin-like protease                                606   0.0     
gb|EPS74284.1|  hypothetical protein M569_00464                         606   0.0     
ref|XP_010089708.1|  Subtilisin-like protease                           607   0.0     
ref|XP_003609994.1|  Subtilisin-like protease                           606   0.0     
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease                607   0.0     
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    606   0.0     
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           606   0.0     
gb|AES92191.2|  subtilisin-like serine protease                         605   0.0     
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                607   0.0     
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                606   0.0     
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor     607   0.0     
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         606   0.0     
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     605   0.0     
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       607   0.0     
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    605   0.0     
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     605   0.0     
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             604   0.0     
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         605   0.0     
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...    605   0.0     
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           605   0.0     
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                604   0.0     
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                605   0.0     
ref|NP_567972.1|  subtilisin-like serine protease 2                     603   0.0     
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                603   0.0     
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           604   0.0     
ref|XP_003589103.1|  Subtilisin-like protease                           607   0.0     
ref|XP_007051969.1|  Subtilase family protein isoform 1                 603   0.0     
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease                604   0.0     
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           603   0.0     
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           603   0.0     
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                603   0.0     
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           602   0.0     
ref|XP_009389184.1|  PREDICTED: subtilisin-like protease                604   0.0     
emb|CDY40653.1|  BnaA03g53100D                                          602   0.0     
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease                602   0.0     
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                602   0.0     
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                602   0.0     
ref|XP_007038510.1|  Subtilase 1.3                                      602   0.0     
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease                602   0.0     
dbj|BAJ87169.1|  predicted protein                                      602   0.0     
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           602   0.0     
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                602   0.0     
gb|KEH30495.1|  subtilisin-like serine protease                         602   0.0     
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                602   0.0     
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           602   0.0     
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                601   0.0     
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             602   0.0     
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                602   0.0     
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      601   0.0     
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             601   0.0     
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like           601   0.0     
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    600   0.0     
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           601   0.0     
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease                600   0.0     
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                600   0.0     
ref|XP_001757585.1|  predicted protein                                  600   0.0     
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  600   0.0     
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                600   0.0     
ref|XP_010109072.1|  Subtilisin-like protease                           600   0.0     
emb|CDX72509.1|  BnaC07g45310D                                          600   0.0     
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    600   0.0     
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             600   0.0     
gb|KHN04600.1|  Subtilisin-like protease                                598   0.0     
dbj|BAJ99493.1|  predicted protein                                      600   0.0     
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like           600   0.0     
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    599   0.0     
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                599   0.0     
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                600   0.0     
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease                599   0.0     
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                599   0.0     
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                599   0.0     
ref|XP_008363295.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    598   0.0     
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           599   0.0     
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g             597   0.0     
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                599   0.0     
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             598   0.0     
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          598   0.0     
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             598   0.0     
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    598   0.0     
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                597   0.0     
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                596   0.0     
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                597   0.0     
dbj|BAD36156.1|  putative serine protease                               597   0.0     
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                597   0.0     
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease                598   0.0     
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             597   0.0     
gb|KHN13887.1|  Subtilisin-like protease                                594   0.0     
ref|XP_008220304.1|  PREDICTED: subtilisin-like protease                597   0.0     
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                597   0.0     
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             597   0.0     
ref|XP_003597117.1|  Subtilisin-like protease                           596   0.0     
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    596   0.0     
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             596   0.0     
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                596   0.0     
ref|XP_003627424.1|  Subtilisin-like serine protease                    596   0.0     
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    596   0.0     
gb|AES62637.2|  subtilisin-like serine protease                         596   0.0     
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     596   0.0     
ref|XP_010661611.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like           595   0.0     
ref|XP_002886065.1|  predicted protein                                  595   0.0     
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                595   0.0     
ref|NP_566483.1|  Subtilase family protein                              595   0.0     
gb|AAM60964.1|  subtilisin-like serine protease                         595   0.0     
emb|CDX82491.1|  BnaA03g33300D                                          595   0.0     
dbj|BAD19523.1|  putative subtilisin-like proteinase                    592   0.0     
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease           595   0.0     
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           595   0.0     
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             595   0.0     
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                594   0.0     
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                594   0.0     
ref|XP_006369092.1|  subtilase family protein                           594   0.0     
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                594   0.0     
gb|EPS65938.1|  hypothetical protein M569_08836                         593   0.0     
ref|XP_003592386.1|  Subtilisin-like protease                           596   0.0     
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                594   0.0     
ref|XP_010090327.1|  Subtilisin-like protease                           593   0.0     
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    592   0.0     
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           593   0.0     
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          592   0.0     
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                593   0.0     
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    592   0.0     
emb|CDX97560.1|  BnaA05g25190D                                          592   0.0     
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    592   0.0     
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                592   0.0     
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                592   0.0     



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/718 (59%), Positives = 516/718 (72%), Gaps = 20/718 (3%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             S++LYTY   A GFSARLT +QA +L  +PGVISVLPD +  L TT +P FLGL + S  
Sbjct  65    SKILYTYSRAAVGFSARLTAAQADQLRRIPGVISVLPDEVRHLHTTHTPTFLGL-ADSFG  123

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D+IIGVLD+GIWPER SFSD GL+P+P+SW+ KC  GP FP TSCN+KIIG
Sbjct  124   LWPNSDYADDVIIGVLDTGIWPERPSFSDEGLSPVPSSWKGKCATGPDFPETSCNKKIIG  183

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             A+ +Y+GYEA  G P+ +  E KS  D  GHGTH AS AAGS VANA+   +A+GEARG+
Sbjct  184   AQMFYKGYEASHG-PMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGEARGM  242

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A  ARIA YK+CW   C N+DIL+ MDQAV DGVHV+SLS+G     G+A  Y  D IAI
Sbjct  243   AIKARIAAYKICWKNGCFNSDILAAMDQAVNDGVHVISLSVG---ANGYAPHYLLDSIAI  299

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP  YTA+NIAPWILTVGASTIDREFPA V LG+ R F G 
Sbjct  300   GAFGASEHGVLVSCSAGNSGPGAYTAVNIAPWILTVGASTIDREFPADVILGDNRIFGGV  359

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G   +  ++ +VY     S+YC PG+LD  KV GKIV C +  N   V++G AVKQ
Sbjct  360   SLYSGDPLTDAKLPVVYSGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNAR-VEKGSAVKQ  418

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVGMI+ N+   G ELVA++ ++P  +V    GD I  YVK+  S TA IVFRGTV G
Sbjct  419   AGGVGMILLNLADSGEELVADSHLLPATMVGQKAGDKIRHYVKSDPSPTATIVFRGTVIG  478

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP+APRVAAFSSRGPN LTPEILKPDVIAPGVNILA WTG++ P++   D RR EFNI+
Sbjct  479   KSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEFNII  538

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPH SGLAA+L++ +P W+PAA+KSALMTT Y LDNSG+    DL TG  STP 
Sbjct  539   SGTSMSCPHASGLAALLKRAHPKWTPAAVKSALMTTAYNLDNSGK-VFTDLATGQESTPF  597

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HGSGHVDP  A DPGLVYD   +DYV+FLC+IGYD   +A+F+R+S  V+C  +NL  P
Sbjct  598   VHGSGHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGDDVAVFVRDSSRVNCSEQNLATP  657

Query  1822  GALNYPSFAVVFKNNLQ-TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
             G LNYPSF+VVF       + YKR +KNVGK  +  Y+V V  PS+V V+VSP +LVF++
Sbjct  658   GDLNYPSFSVVFTGESNGVVKYKRVMKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSE  717

Query  1999  RIDTLSYEVTFQSLRQSAD---------SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                +LSYE++F+S + S D         +FGS+ WSDG H V SPIAV W   S + +
Sbjct  718   EKKSLSYEISFKS-KSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRWRHYSAASI  774



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/725 (59%), Positives = 517/725 (71%), Gaps = 19/725 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             SP S+H   S++LYTYE  A GFSARLT  QA +L  VPGVISV+PD++  L TT +P F
Sbjct  61    SPPSHHR--SKILYTYERAAVGFSARLTAGQADQLRRVPGVISVIPDQVRYLHTTHTPTF  118

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             L L + S  L P SDY  D+I+GVLD+GIWPER SFSD GL+P+P  W+ KC  GP FP 
Sbjct  119   LKL-ADSFGLWPDSDYADDVIVGVLDTGIWPERPSFSDEGLSPVPAGWKGKCVTGPGFPR  177

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRKIIGAR +Y+GYEA  G P+ +  E KS  D  GHGTH AS AAGS VANA+   
Sbjct  178   SSCNRKIIGARMFYKGYEASHG-PMDESKEAKSPRDTEGHGTHTASTAAGSLVANASFYQ  236

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A+GEARG+A  ARIA YK+CW   C ++DIL+ MDQAVADGVHV+SLS+G     G+A 
Sbjct  237   YAKGEARGMAIKARIAAYKICWKDGCFDSDILAAMDQAVADGVHVISLSVG---ANGYAP  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D IAIGAFGA + GV+VSC AGNSGP PYTA+NIAPWILTVGASTIDREFPA V L
Sbjct  294   HYLHDSIAIGAFGASEHGVLVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVIL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G+ R F G SLY G   + ++  +VY     S+YC PG+LD  KV GKIV C +  N   
Sbjct  354   GDDRVFGGVSLYSGNPLTDSKFPVVYSGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNAR-  412

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V++G AVK +GGVGMI++N+   G ELVA++ ++P  +V    GD I +YV +  S TA 
Sbjct  413   VEKGSAVKLAGGVGMILANLAESGEELVADSHLLPATMVGQKAGDKIREYVTSDTSPTAT  472

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             IVFRGTV GNSP+APRVAAFSSRGPN LTPEILKPDVIAPGVNILA WTG+  P++   D
Sbjct  473   IVFRGTVIGNSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSTGPTDLAID  532

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR EFNI+SGTSM+CPHVSGLAA+LR+ +  W+PAAIKSALMTT Y LDNSG+    DL
Sbjct  533   PRRVEFNIISGTSMSCPHVSGLAALLRRAHSKWTPAAIKSALMTTAYNLDNSGK-IFTDL  591

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              TG  STP  HGSGHVDP  A DPGLVYD   +DYV+FLCTIGYD   IA+F+R+S  V+
Sbjct  592   ATGEESTPFVHGSGHVDPNRALDPGLVYDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVN  651

Query  1795  CRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             C  R+L  PG LNYPSF+V F ++    + YKR VKNVG   N  Y+V V  PS V V+V
Sbjct  652   CSERSLATPGDLNYPSFSVDFTSDSNGVVKYKRVVKNVGGDSNAVYEVKVNAPSAVEVSV  711

Query  1972  SPNRLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGR  2130
             SP +LVF++  ++LSYE++F S R           +FGS+ WSDG H V SPIAV W  +
Sbjct  712   SPAKLVFSEENNSLSYEISFTSKRSEDIMVKGIQSAFGSIEWSDGIHSVRSPIAVRWRYQ  771

Query  2131  SVSEL  2145
             S   +
Sbjct  772   SAVSM  776



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/718 (58%), Positives = 515/718 (72%), Gaps = 20/718 (3%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             S++LYTY+  A GFSA LT +QA +L  +PGVISVLPD +  L TT +P FLGL + S  
Sbjct  65    SKILYTYKRAAVGFSAHLTAAQADQLRRIPGVISVLPDEVRHLHTTHTPTFLGL-ADSFG  123

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D+I+GVLD+GIWPER SFSD GL+P+P+SW+ KC  GP FP TSCN+KIIG
Sbjct  124   LWPNSDYADDVIVGVLDTGIWPERPSFSDEGLSPVPSSWKGKCVTGPDFPETSCNKKIIG  183

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             A+ +Y+GYEA  G P+ +  E KS  D  GHGTH AS AAGS VANA+   +A+GEARG+
Sbjct  184   AQMFYKGYEAKHG-PMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGEARGM  242

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A  ARIA YK+CW   C N+DIL+ MDQAV DGVHV+SLS+G     G+A  Y  D IAI
Sbjct  243   AIKARIAAYKICWKNGCFNSDILAAMDQAVDDGVHVISLSVG---ANGYAPHYLYDSIAI  299

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP  YTA+NIAPW+LTVGASTIDREFPA V LG+ R F G 
Sbjct  300   GAFGASEHGVLVSCSAGNSGPGAYTAVNIAPWMLTVGASTIDREFPADVILGDNRIFGGV  359

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G   +  ++ +VY     S+YC PG+LD  KV GKIV C +  N   V++G AVKQ
Sbjct  360   SLYSGNPLADAKLPVVYSGDCGSKYCYPGKLDPKKVAGKIVLCDRGGNAR-VEKGSAVKQ  418

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVGMI++N+   G ELVA++ ++P  +V    GD I  YVK+  + TA IVFRGTV G
Sbjct  419   AGGVGMILANLADSGEELVADSHLLPATMVGQKAGDKIRHYVKSDPAPTATIVFRGTVIG  478

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP+APRVAAFSSRGPN LTPEILKPDVIAPGVNILA WTG++ P++   D RR EFNI+
Sbjct  479   KSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEFNII  538

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSGLAA+LR+ +P W+PAA+KSALMTT Y LDNSG+    DL TG  STP 
Sbjct  539   SGTSMSCPHVSGLAALLRRAHPKWTPAAVKSALMTTAYNLDNSGK-VFTDLATGQESTPF  597

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HGSGHVDP  A DPGLVYD   +DYV+FLC+IGYD   +A+F R+S  V+C  R+L  P
Sbjct  598   VHGSGHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGTDVAVFARDSSRVNCSERSLATP  657

Query  1822  GALNYPSFAVVFKNNLQ-TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
             G LNYPSF+VVF       + YKR VKNVGK  +  Y+V V  PS+V V+VSP +LVF++
Sbjct  658   GDLNYPSFSVVFTGETNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSE  717

Query  1999  RIDTLSYEVTFQSLRQSAD---------SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                +LSYE++ +  + S D         +FGS+ WSDG H V SPIAV W   S + +
Sbjct  718   EKQSLSYEISLKG-KSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRWRHYSAASI  774



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/723 (58%), Positives = 517/723 (72%), Gaps = 22/723 (3%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS  204
             S+ +LY Y+H   GFSA LT SQ +EL  +PGV+S+LPDR  +L TTR+P FLGL + + 
Sbjct  67    STRILYVYDHAITGFSAHLTQSQVAELQRIPGVLSILPDRPHQLHTTRTPHFLGL-ADTF  125

Query  205   NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKII  384
              L P+SDY  D+IIGVLD+GIWPER SF D  L+ IP+ W+  CE GP FPA+SCN KII
Sbjct  126   GLWPNSDYADDVIIGVLDTGIWPERRSFYDSDLSEIPSGWKGTCETGPDFPASSCNGKII  185

Query  385   GARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             GARA+YRGYEA  GRP+ D  E KS  D  GHGTH AS AAG+AV  A     A GEARG
Sbjct  186   GARAFYRGYEAALGRPMNDTVESKSPRDTEGHGTHTASTAAGAAVREAGFYKFAVGEARG  245

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +AT ARIA YKVCW   C ++DIL+ MD A+ADGVH++SLS+G     G+A PY  D IA
Sbjct  246   MATRARIAAYKVCWKLGCFDSDILAAMDHAIADGVHIISLSVG---ATGYAPPYYHDSIA  302

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             IGAFGA+QKGV+VSC AGNSGP+PYTA+NIAPWI+TVGASTIDREFPA V LG+GR F G
Sbjct  303   IGAFGAIQKGVLVSCSAGNSGPEPYTAVNIAPWIITVGASTIDREFPADVVLGDGRVFNG  362

Query  919   TSLYFG--IQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              SLY G  +  S + + +VY     SR C PG+LD +KV GKIV C +  N   V++G A
Sbjct  363   VSLYSGDPLGDSGHLLPLVYAADCGSRLCYPGKLDPTKVAGKIVVCDRGGNAR-VEKGSA  421

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             +K SGG GMI++N    G EL+A++ ++P  +V    GD I DY+++  S TA IVFRGT
Sbjct  422   IKISGGAGMIMANTAESGEELIADSHLLPATMVGQTSGDKIRDYIRSDPSPTATIVFRGT  481

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G SPSAP+VA+FSSRGPN+ T EILKPDVIAPGVNILA WTG   P++   D RR EF
Sbjct  482   VIGASPSAPKVASFSSRGPNYQTAEILKPDVIAPGVNILAGWTGYNGPTDLDIDPRRVEF  541

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSMACPHVSGLAA+LRK YP W+PAA+KSALMTT Y LDN G++ + DL TG  S
Sbjct  542   NIISGTSMACPHVSGLAALLRKAYPKWTPAALKSALMTTAYNLDNGGKN-ISDLATGKES  600

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN-SPLVDCRNRN  1809
             TP  HG+GHVDP  A DPGLVYD  VNDYV+FLC+IGYD + IALF+R+ +  V+C  ++
Sbjct  601   TPFVHGAGHVDPNRALDPGLVYDISVNDYVEFLCSIGYDEKMIALFIRDGNTSVNCSAQS  660

Query  1810  LGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNR  1983
             L +PG LNYPSF+VVFK N     + Y+R V NVG   +  Y+  V  P +V ++VSP++
Sbjct  661   LPSPGDLNYPSFSVVFKLNGGKDVVKYRRVVTNVGDSVDAVYEAKVWGPDSVEISVSPSK  720

Query  1984  LVFTDRIDTLSYEVTFQSL---------RQSADSFGSLRWSDGTHLVTSPIAVSWEGRSV  2136
             LVF+   +  SYE+TF+S+           SA  FG + WSDG+H V SPIA  W+ + V
Sbjct  721   LVFSGEEERQSYEITFKSVVPPNETEERTASASKFGWIEWSDGSHRVRSPIAFWWQPKLV  780

Query  2137  SEL  2145
             S +
Sbjct  781   SSI  783



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/716 (58%), Positives = 508/716 (71%), Gaps = 13/716 (2%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             SPLS H   ++L+YTY+H  HGFSARLT SQA+EL     V+SV+PD + +L TTR+P F
Sbjct  59    SPLSAHHPPTKLIYTYDHAVHGFSARLTSSQAAELRRRRCVLSVVPDSVRQLHTTRTPHF  118

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL      + P+SDY  DII+ VLD+GIWPER SFSD GL+P+P+SW+  CE GP FP 
Sbjct  119   LGL-DDFFGIWPNSDYAEDIIVAVLDTGIWPERPSFSDEGLSPVPSSWKGVCETGPDFPP  177

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             TSCN+KIIGARAYY+GYEA  G  + +  E KS  D  GHGTH AS AAGS V NA++  
Sbjct  178   TSCNKKIIGARAYYKGYEANLGMSLQEAGESKSPRDSEGHGTHTASTAAGSVVKNASLYE  237

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +ARGEARG+A  AR+A YK+CW   C ++DIL+ MDQA+ DGVHV+SLS+G     G+A 
Sbjct  238   YARGEARGMAIKARVAAYKICWSAGCFDSDILAAMDQAIDDGVHVISLSVG---ANGYAP  294

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y+ D IAIGAFGA + G++ SC AGNSGP PYTA+NIAPWILTVGASTIDREFPA V L
Sbjct  295   QYDHDSIAIGAFGAAKYGIVTSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVVL  354

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G+G  + G SLY G      Q+ +VY     S YC  G+LD+SKV+GKIV C +      
Sbjct  355   GDGSIYGGVSLYAGEPLGDTQLPLVYAGDCGSSYCYEGRLDSSKVKGKIVICDRGGGNAR  414

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             + +G AVK +GG GMI++N+   G EL+A++ +IP   V    GD I  Y+++  S TA 
Sbjct  415   MAKGTAVKLAGGGGMILANLADSGEELIADSHLIPATNVGQKAGDKIKSYLRSEPSPTAT  474

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             IVFRGTV G+SPSAPRVAAFSSRGPN LTPEILKPDVIAPGVNILA WTG + PS+   D
Sbjct  475   IVFRGTVIGSSPSAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGLVGPSQLDID  534

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR EFNI SGTSM+CPHVSGLAA+LRK +P W+PAAIKSALMTT Y +DN G S + DL
Sbjct  535   PRRVEFNIASGTSMSCPHVSGLAALLRKAHPKWTPAAIKSALMTTAYNVDNIGES-IKDL  593

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL-V  1791
              TG  S P  HGSGHVDP  A +PGLVYD G +DYV FLC +GY   +IA+F+R+ P+ V
Sbjct  594   ATGEESNPFVHGSGHVDPNRALNPGLVYDLGTSDYVAFLCAVGYSPGRIAVFVRDGPVPV  653

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             DC  + +G PG LNYPSF+VVF      + Y R VKNVG      Y+V V  P +V VTV
Sbjct  654   DCGAQGMGTPGDLNYPSFSVVFSPGNSVVKYTRVVKNVGSNAEAVYEVKVNAPPSVEVTV  713

Query  1972  SPNRLVFTDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
             SP++LVF+   DTLSYEV+F +     +     +FGSL WSDG HLV SPIAV W 
Sbjct  714   SPSQLVFSQGNDTLSYEVSFTTASGILVGALKPAFGSLEWSDGEHLVRSPIAVVWR  769



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/722 (57%), Positives = 512/722 (71%), Gaps = 15/722 (2%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L++  + S++LY+YE  A+GFSARLT +QASEL  VPGV+SVLPDR  ++ TTR+P FLG
Sbjct  56    LASSGQPSKILYSYERAANGFSARLTAAQASELRRVPGVLSVLPDRAHQIHTTRTPHFLG  115

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L + +  L P+SDY  D+IIGVLD+GIWPE  SFSD GL+P+PNSW   C+ GP FPA++
Sbjct  116   L-ADNYGLWPNSDYADDVIIGVLDTGIWPEIRSFSDSGLSPVPNSWNGVCDTGPDFPASA  174

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRKIIGARA+++GYE   GRP+ +  E KS  D  GHGTH AS AAGS V +A++   A
Sbjct  175   CNRKIIGARAFFKGYEGALGRPMDESVESKSPRDTEGHGTHTASTAAGSVVQDASLFEFA  234

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
             +GEARG+A  ARIA YK+CW   C ++DIL+ MDQAVADGV ++SLS+G     G A  Y
Sbjct  235   KGEARGMAVKARIAAYKICWSLGCFDSDILAAMDQAVADGVDIISLSVG---ATGLAPRY  291

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             + D IAIGAFGA+  GV+VSC AGNSGPDP TA+NIAPWILTVGASTIDREFPA V LG+
Sbjct  292   DHDSIAIGAFGAMDHGVLVSCSAGNSGPDPLTAVNIAPWILTVGASTIDREFPADVVLGD  351

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             GR F G S+Y G       + +VY     SR+C  G+L+ S+V GKIV C +  N   V+
Sbjct  352   GRIFGGVSIYSGDPLKDTNLPLVYAGDCGSRFCFTGKLNPSQVSGKIVICDRGGNAR-VE  410

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVK + G GMI++N    G EL+A++ ++P  +V    GD I +YVK+    TA IV
Sbjct  411   KGTAVKMALGAGMILANTGDSGEELIADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIV  470

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             FRGTV G SP AP+VAAFSSRGPN LTPEILKPDVIAPGVNILA WTG+ AP++   D R
Sbjct  471   FRGTVIGTSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPR  530

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R EFNI+SGTSM+CPHVSGLAA+LRK YP W+PAAIKSALMTT Y LDNSG + + DL T
Sbjct  531   RVEFNIISGTSMSCPHVSGLAALLRKAYPKWTPAAIKSALMTTAYNLDNSG-NNIADLAT  589

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S+P  HG+GHVDP  A  PGLVYD   NDY+ FLC IGYD+++IA+F+R    VDC 
Sbjct  590   GNQSSPFIHGAGHVDPNRALYPGLVYDIDANDYISFLCAIGYDTERIAIFVRRHTTVDCN  649

Query  1801  NRNLGNPGALNYPSFAVVFK------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                L  PG LNYP+F+VVF       +    I  KR VKNVG   N  Y+V V  P  + 
Sbjct  650   TEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEIKLKRVVKNVGSSANAVYEVKVNPPEGIE  709

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS-FGSLRWSDGTHLVTSPIAVSWEGRSVS  2139
             V VSP +LVF+    T SYEV+F S+     S FGS+ WSDGTH+V SP+AV +   +VS
Sbjct  710   VDVSPKKLVFSKENQTASYEVSFTSVESYIGSRFGSIEWSDGTHIVRSPVAVRFHQDAVS  769

Query  2140  EL  2145
              +
Sbjct  770   SI  771



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/712 (57%), Positives = 515/712 (72%), Gaps = 16/712 (2%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             +S HS    +LY+Y+  A GFSARLT  QA +L+ VPGV+SV+PDR+ +L TT +P FLG
Sbjct  58    VSQHS--PNILYSYDRAARGFSARLTSGQADQLSRVPGVVSVIPDRVRQLHTTHTPTFLG  115

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   S  + P+SDY  ++I+GVLD+GIWPER SFSD+GL+P+P+ W+ KCE GP FPATS
Sbjct  116   L-EDSFGIWPNSDYADNVIVGVLDTGIWPERPSFSDKGLSPVPSGWKGKCESGPDFPATS  174

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRKIIGAR +Y+GYEA  G P+ +  E KS  D  GHGTH AS AAGS VANA+   +A
Sbjct  175   CNRKIIGARLFYKGYEADRGSPMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYA  234

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
             +GEARG+A  ARIA YK+CW   C ++DIL+ MDQAVADGVHV+SLS+G    +G++  Y
Sbjct  235   KGEARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVG---ADGYSPEY  291

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             + D IAIGAFGA + GV+VSC AGNSGP   TA+N+APWILTV ASTIDREFPA V LG+
Sbjct  292   DVDSIAIGAFGATEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPADVILGD  351

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             GR F G SLY G      ++ +VY     S+ C PG+LD SKV GKIV C +  N   V+
Sbjct  352   GRIFGGVSLYTGDPLGNAKLQLVYSADCGSQLCYPGKLDPSKVAGKIVLCDRGGNAR-VE  410

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVKQ+GG GM+++N+   G ELVA+A ++P  +V    G+ I DY+K+  S TA I 
Sbjct  411   KGSAVKQAGGAGMVLANLADSGEELVADAHLLPATMVGQKAGNKIRDYIKSVPSPTATIT  470

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F+GTV G SPSAPR+AAFS RGPN++TPEILKPDV APGVNILA WTGA+ P++   D R
Sbjct  471   FKGTVIGKSPSAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGAVGPTDLEIDKR  530

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R EFNI+SGTSM+CPHVSGLAA+LRK YP W+ AAIKSALMTT Y +DNSG+ T+ DL T
Sbjct  531   RVEFNIISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALMTTAYNVDNSGK-TITDLAT  589

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S+P   GSGHVDP  A  PGLVYD   +DYV FLC IGY   +I+ F +++  V+C 
Sbjct  590   GQESSPFVRGSGHVDPNRALHPGLVYDIESSDYVGFLCAIGYGPSRISPFTKDTSSVNCS  649

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
               +L +PG LNYPSF+VVF +    + YKR VKNVG+  NV Y+V V  PS+V V V+P+
Sbjct  650   EHSLASPGDLNYPSFSVVFMSE-NVVKYKRVVKNVGRNANVVYKVKVNAPSSVEVKVTPS  708

Query  1981  RLVFTDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +L F++  ++LSYE++F S     ++    +FGS+ WSDG H V SPIAV W
Sbjct  709   KLSFSEEKNSLSYEISFSSVGSERVKGLESAFGSIEWSDGIHSVRSPIAVRW  760



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/712 (58%), Positives = 502/712 (71%), Gaps = 14/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             S++LYTY   A GFSARLT  QA  L   PGV+SV+PDR+  L TTR+P+FLGL   S  
Sbjct  75    SQILYTYRAAAAGFSARLTAPQAEALRRAPGVLSVVPDRIRHLHTTRTPRFLGLTE-SFG  133

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  DIIIGVLD+GIWPER SFSD GL P+P +WR  CEVG  FPA++CNRKIIG
Sbjct  134   LWPNSDYADDIIIGVLDTGIWPERRSFSDSGLGPVPGAWRGTCEVGRDFPASACNRKIIG  193

Query  388   ARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARA+Y+GYEA   RPI    E KS  D  GHGTH +S A GS V+NA+   +A GEARG+
Sbjct  194   ARAFYKGYEAYLERPIDETKESKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVGEARGM  253

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIA YK+CW   C ++DIL+ MDQAV+DGVH++SLS+G     G+A  Y+ D IAI
Sbjct  254   ATKARIAAYKICWSLGCFDSDILAAMDQAVSDGVHIISLSVG---ANGYAPQYDHDSIAI  310

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGAV+ GV+VSC AGNSGP P+TA+NIAPWILTVGASTIDREFPA V LG+GR F G 
Sbjct  311   GAFGAVKHGVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFKGV  370

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +VY     SRYC    LD++KV GKIV C +  N  +  +G AVK 
Sbjct  371   SLYSGEPLGDAKLPLVYAGDCGSRYCYDDSLDSTKVAGKIVVCDRGGNARVA-KGSAVKL  429

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVGMI++N    G EL+A++ +IP  +V    GD I +Y  + +  TA I F GTV G
Sbjct  430   AGGVGMILANTEESGEELIADSHLIPANMVGETAGDKIREYASSDQFPTAAIKFIGTVIG  489

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP AP+VAAFSSRGPN LT EILKPDVIAPGVNILAAWTG   P++   D RR EFNI+
Sbjct  490   PSPPAPKVAAFSSRGPNHLTAEILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVEFNII  549

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPH SGLAA+LRK YP WSPAAIKSALMTT Y LDN GR+ + DL +G  S+P 
Sbjct  550   SGTSMSCPHASGLAALLRKAYPDWSPAAIKSALMTTAYNLDNGGRN-IKDLASGDESSPF  608

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD--CRNRNLG  1815
              HG+GHVDP  A +PGLVYD  V+DYV FLC IGY+ ++IA+FLR  P+    C NR + 
Sbjct  609   VHGAGHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLRE-PMSSTVCANR-MA  666

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
              PG LNYPSF+VV  +N   + Y+R VKNVG   +  Y+V V  P NV V+VSP++L F+
Sbjct  667   TPGELNYPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFS  726

Query  1996  DRIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                  LSYE+TF S  L  S   FGS+ W+DGTH V SPIAV W    V  +
Sbjct  727   AENQILSYEITFSSIALGSSTPKFGSIEWTDGTHRVRSPIAVKWHQELVESI  778



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/712 (59%), Positives = 508/712 (71%), Gaps = 18/712 (3%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++LYTYE  A GFSARLT  QA +L  VPGVISV+PD++    TT +P FL L + S  L
Sbjct  68    KILYTYERAAVGFSARLTAGQADQLRRVPGVISVIPDQVRYPHTTHTPTFLKL-ADSFGL  126

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
              P SDY  D+I+GVLD+GIWPER SFSD GL+P+P  W+ KC  GP FP +SCNRKIIGA
Sbjct  127   WPDSDYADDVIVGVLDTGIWPERPSFSDEGLSPVPAGWKGKCVTGPGFPRSSCNRKIIGA  186

Query  391   RAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             R +Y+GYEA  G P+ +  E KS  D  GHGTH AS AAGS VANA+   +A+GEARG+A
Sbjct  187   RMFYKGYEASQG-PMDESKEAKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGEARGMA  245

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               ARIA YK+CW   C ++DIL+ MDQAV DGVHV+SLS+G     G+A  Y  D IAIG
Sbjct  246   IKARIAAYKICWKTGCFDSDILAAMDQAVDDGVHVISLSVG---ANGYAPHYLHDSIAIG  302

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA + GV+VSC AGNSGP PYTA+NIAPWILTVGASTIDREFPA V LG+ R F G S
Sbjct  303   AFGASEHGVLVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFGGVS  362

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY G   + +++ +VY     S+YC PG+LD  KV GKIV C +  N   V++G AVK +
Sbjct  363   LYAGNPLNDSKLPVVYSGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNAR-VEKGSAVKLA  421

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GGVGMI++N+   G ELVA++ ++P  +V    GD I +YV +  S TA IVF+GTV GN
Sbjct  422   GGVGMILANLADSGEELVADSHLLPATMVGQKAGDEIREYVISDPSPTATIVFKGTVIGN  481

Query  1285  SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMS  1464
             SP+APRVAAFSSRGPN LTPEILKPDV APGVNILA WTGA  P++   D RR EFNI+S
Sbjct  482   SPAAPRVAAFSSRGPNHLTPEILKPDVTAPGVNILAGWTGANGPTDLEIDPRRVEFNIIS  541

Query  1465  GTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHA  1644
             GTSM+CPHVSGLAA+LR+ +  W+PAAIKSALMTT Y LDNSG+    DL TG  STP  
Sbjct  542   GTSMSCPHVSGLAALLRRAHSKWTPAAIKSALMTTAYNLDNSGK-IFTDLATGEESTPFV  600

Query  1645  HGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPG  1824
             HGSGHVDP  A +PGLVYD   +DYV+FLCTIGYD   IA+F+R+S  V+C  R+L  PG
Sbjct  601   HGSGHVDPNRALNPGLVYDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPG  660

Query  1825  ALNYPSFAVVFKNNLQ-TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
              LNYPSFAV F ++    + YKR VKNVG   N  Y+V V  P  V V+VSP +LVF++ 
Sbjct  661   DLNYPSFAVDFTSDSNGVVKYKRVVKNVGGNPNAVYEVKVNAPLGVEVSVSPAKLVFSEE  720

Query  2002  IDTLSYEVTFQSLRQSAD--------SFGSLRWSDGTHLVTSPIAVSWEGRS  2133
              ++LSYE++F S R   +        +FGS+ WSDG H V SPIAV W  +S
Sbjct  721   NNSLSYEISFTSKRSEDNIMVKGTPSAFGSIEWSDGIHSVRSPIAVRWRYQS  772



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/712 (58%), Positives = 502/712 (71%), Gaps = 14/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             S++LYTY   A GFSARLT  QA  L   PGV+SV+PDR+  L TTR+P+FLGL   S  
Sbjct  126   SQILYTYRAAAAGFSARLTAPQAEALRRAPGVLSVVPDRIRHLHTTRTPRFLGLTE-SFG  184

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  DIIIGVLD+GIWPER SFSD GL P+P +WR  CEVG  FPA++CNRKIIG
Sbjct  185   LWPNSDYADDIIIGVLDTGIWPERRSFSDSGLGPVPGAWRGTCEVGRDFPASACNRKIIG  244

Query  388   ARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARA+Y+GYEA   RPI    E KS  D  GHGTH +S A GS V+NA+   +A GEARG+
Sbjct  245   ARAFYKGYEAYLERPIDETKESKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVGEARGM  304

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIA YK+CW   C ++DIL+ MDQAV+DGVH++SLS+G     G+A  Y+ D IAI
Sbjct  305   ATKARIAAYKICWSLGCFDSDILAAMDQAVSDGVHIISLSVG---ANGYAPQYDHDSIAI  361

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGAV+ GV+VSC AGNSGP P+TA+NIAPWILTVGASTIDREFPA V LG+GR F G 
Sbjct  362   GAFGAVKHGVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFKGV  421

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +VY     SRYC    LD++KV GKIV C +  N  +  +G AVK 
Sbjct  422   SLYSGEPLGDAKLPLVYAGDCGSRYCYDDSLDSTKVAGKIVVCDRGGNARVA-KGSAVKL  480

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVGMI++N    G EL+A++ +IP  +V    GD I +Y  + +  TA I F GTV G
Sbjct  481   AGGVGMILANTEESGEELIADSHLIPANMVGETAGDKIREYASSDQFPTAAIKFIGTVIG  540

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP AP+VAAFSSRGPN LT EILKPDVIAPGVNILAAWTG   P++   D RR EFNI+
Sbjct  541   PSPPAPKVAAFSSRGPNHLTAEILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVEFNII  600

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPH SGLAA+LRK YP WSPAAIKSALMTT Y LDN GR+ + DL +G  S+P 
Sbjct  601   SGTSMSCPHASGLAALLRKAYPDWSPAAIKSALMTTAYNLDNGGRN-IKDLASGDESSPF  659

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD--CRNRNLG  1815
              HG+GHVDP  A +PGLVYD  V+DYV FLC IGY+ ++IA+FLR  P+    C NR + 
Sbjct  660   VHGAGHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLRE-PMSSTVCANR-MA  717

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
              PG LNYPSF+VV  +N   + Y+R VKNVG   +  Y+V V  P NV V+VSP++L F+
Sbjct  718   TPGELNYPSFSVVLTSNGDVVKYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFS  777

Query  1996  DRIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                  LSYE+TF S  L  S   FGS+ W+DGTH V SPIAV W    V  +
Sbjct  778   AENQILSYEITFSSIALGSSTPKFGSIEWTDGTHRVRSPIAVKWHQELVESI  829



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/705 (58%), Positives = 507/705 (72%), Gaps = 13/705 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLYTYE   +GFSARLT +QA +L  +PG++SV+PD++ ++ TTR+PQFLGL  G   
Sbjct  61    TKLLYTYERAINGFSARLTATQAEKLRELPGILSVIPDQVRQIHTTRTPQFLGLSDGV-G  119

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L  +S YG  +IIGVLD+GIWPER SF D GL+P+P+SW+  CE GP FPA++C+RKIIG
Sbjct  120   LWQNSYYGDGVIIGVLDTGIWPERPSFKDSGLSPVPDSWKGICETGPDFPASACSRKIIG  179

Query  388   ARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARA+Y+GYE+    P+    E KS  D  GHGTH AS AAGS V+NA++   A GEARG+
Sbjct  180   ARAFYKGYESYLEGPMDETKESKSPRDTEGHGTHTASTAAGSVVSNASLFEFAYGEARGM  239

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIA YK+CW   C ++D+L+ MDQA+ADGV+V+SLS+G     G+A  Y+ D IAI
Sbjct  240   ATKARIAAYKICWSLGCFDSDLLAAMDQAIADGVNVISLSVG---ATGYAPQYDHDSIAI  296

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA Q G++VSC AGNSGP PYTA+NIAPWILTVGASTIDREFPA   LG+GR F G 
Sbjct  297   GAFGAAQHGIVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADAILGDGRIFGGV  356

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +VY   + +RYC  G L  SKV+GKIV+C +  N   V++GFAVK 
Sbjct  357   SLYSGDPLVDIKLPLVYAGDSGNRYCYMGSLSPSKVQGKIVFCDRGGNAR-VEKGFAVKL  415

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG+GMI++N    G EL+A+A +IP   V    G+ I  Y+K ++  TA IVF GTV G
Sbjct  416   AGGLGMILANTAESGEELIADAHLIPATTVGEKAGNEIRQYIKISQFPTATIVFHGTVIG  475

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP AP+VAAFSSRGPN LTPEILKPDVIAPGVNILA WTG I PS+   D RR  FNI+
Sbjct  476   PSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGFIGPSQLNIDTRRVNFNII  535

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSGLAA+L K YP+WSPAAIKSALMTT Y+LDNSG +T+ DL TG  S+P 
Sbjct  536   SGTSMSCPHVSGLAALLIKAYPNWSPAAIKSALMTTAYSLDNSG-NTIKDLATGVESSPF  594

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              +G+GHVDP  A  PGLVYD    DYV FLC+IGYDS++IA+F+R     D     L  P
Sbjct  595   VYGAGHVDPNIALMPGLVYDIDDGDYVAFLCSIGYDSKRIAIFVREPTGPDVCEGKLATP  654

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF +N   + YKRTVKNVG   +  Y+  V  P  V ++VSP++L F+  
Sbjct  655   GNLNYPSFSVVFDSNDHVVKYKRTVKNVGPSVDAVYEAKVNAPPGVEISVSPSKLEFSAE  714

Query  2002  IDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               TLSYE+TF S        + ++FGS+ WSDG HLV SPIAV W
Sbjct  715   NQTLSYEITFASDGLALFAVALEAFGSIEWSDGVHLVRSPIAVRW  759



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/708 (57%), Positives = 509/708 (72%), Gaps = 17/708 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             +++LY+Y++ + GFSARLT  QA  +  VPGV+SV+ DR  +L TT +P FLGL + S  
Sbjct  70    AKILYSYDYASQGFSARLTSGQADRIRRVPGVVSVILDRARQLHTTHTPTFLGL-ADSFG  128

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D+I+GVLD+GIWPER SF+D GL+ +P+ W+ KCE GP FPATSCNRKIIG
Sbjct  129   LWPNSDYADDVIVGVLDTGIWPERPSFTDDGLSAVPSGWKGKCETGPDFPATSCNRKIIG  188

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR +Y+GYEA  G PI +  E KS  D  GHGTH AS AAGS VANA+   +A+GEARG+
Sbjct  189   ARLFYKGYEADRGSPIDESKESKSPRDTEGHGTHTASTAAGSVVANASFFQYAKGEARGM  248

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A  ARIA YK+CW   C ++DIL+ MDQAVADGVHV+SLS+G    +G+A  Y+ D IAI
Sbjct  249   AVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVG---ADGYAPEYDVDSIAI  305

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP   TA+N+APWILTV ASTIDREFPA V LG+GR F G 
Sbjct  306   GAFGASEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPADVILGDGRIFGGV  365

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G     +++ +VY     S+ C PG+LD SKV GKIV C +  N   V++G AVK 
Sbjct  366   SLYSGDPLGDSKLPLVYSGDCGSQLCYPGKLDPSKVAGKIVLCDRGGNAR-VEKGSAVKL  424

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG GM+++N+   G ELVA++ ++P  +V    GD I DYVK+  S TA IVF+GTV G
Sbjct  425   AGGAGMVLANLADSGEELVADSHLLPATMVGQKAGDKIRDYVKSDSSPTATIVFKGTVIG  484

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
               PSAPR+AAFS RGPN++TPEILKPDV APGVNILA WTG+I P++   D RR EFNI+
Sbjct  485   KPPSAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVEFNII  544

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSGLAA+LRK YP W+ AAIKSALMTT Y +DNSG+ T  DL TG  S+P 
Sbjct  545   SGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALMTTAYNIDNSGK-TFTDLATGQESSPF  603

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HGSGHVDP  A DPGLVYD    DYVDFLC IGYD ++I+ F++++  V+C  ++L +P
Sbjct  604   VHGSGHVDPNRALDPGLVYDIATRDYVDFLCAIGYDPKRISPFVKDTSSVNCSEKSLVSP  663

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPS   V  ++   + YKR VKNVG+  N AY+V +  P++V V V+P +L F++ 
Sbjct  664   GDLNYPS-FSVVFSSESVVKYKRVVKNVGRNTNAAYEVKINAPASVEVKVTPTKLSFSEE  722

Query  2002  IDTLSYEVTFQS--------LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               +LSYE++F S        ++    +FGS+ WSDG H V SPIAV W
Sbjct  723   NKSLSYEISFSSNGSVGLERVKGLESAFGSIEWSDGIHSVRSPIAVHW  770



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/708 (56%), Positives = 508/708 (72%), Gaps = 13/708 (2%)
 Frame = +1

Query  22    RSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGS  201
             + +++LY Y H  HGFS  LTP+Q ++L  VPG++SV+PD++ +L TT +P FLGL S S
Sbjct  63    QPAKILYNYNHAIHGFSVHLTPTQLAKLRLVPGILSVIPDQIRQLHTTHTPTFLGL-SES  121

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
             S L  +S YG  +IIGVLD+GIWPE  S SD GL+ +P +W+  CE GP FPA+SCN+K+
Sbjct  122   SRLWQNSGYGDGVIIGVLDTGIWPEHKSLSDSGLSDVPANWKGICETGPDFPASSCNKKL  181

Query  382   IGARAYYRGYEAVTGRPIVDEPKSAI--DMTGHGThvasiaagsavananvnghaRGEAR  555
             IGARA+++GY    GRPI +  +SA   D  GHGTH A+ AAGS   NA++  +A GEAR
Sbjct  182   IGARAFHKGYITHKGRPIDESKESASPRDTEGHGTHTATTAAGSLAHNASLFQYATGEAR  241

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A+ ARIA YK+CW   C ++DIL+ MDQA+ DGVHV+SLS+G     G A  Y+ D I
Sbjct  242   GMASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVG---ATGHAPQYDHDSI  298

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             AIGAF A Q G++VSC AGN+GP PYTA+NIAPWILTVGASTIDREFPA V LGNG  F+
Sbjct  299   AIGAFSASQHGIVVSCSAGNAGPGPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFS  358

Query  916   GTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             G SLY G     +++ +VY     SRYC  G +  SKV+GKIV C +  N   V++G AV
Sbjct  359   GVSLYSGDPLVDHKLPLVYAGDVGSRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAV  417

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GG+GMI++N    G EL+A++ ++P   V     + I  Y+K+ +S TA I+FRGT+
Sbjct  418   KLAGGLGMILANTADSGEELIADSHLLPATEVGEIAANKIRQYIKSDQSPTATILFRGTI  477

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              G SP+AP+VAAFSSRGPN+LTPEILKPDVIAPGVNILA WTG + P++   D RR EFN
Sbjct  478   IGTSPAAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLELDPRRVEFN  537

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSM+CPHVSG+AA+LRK YP WSPAAIKSAL+TT YTLDNSG++ + DL +G  ST
Sbjct  538   IISGTSMSCPHVSGIAALLRKAYPDWSPAAIKSALVTTAYTLDNSGKN-IKDLASGEEST  596

Query  1636  PHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG  1815
             P  HG+GHVDP +A DPGLVYD   +DY+ FLC IGYDS +IA+F+R  P  D  +  +G
Sbjct  597   PFIHGAGHVDPNSALDPGLVYDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKVG  656

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
             +PG LNYPS +VVF++    +TYKR VKNVG   +  Y+V V +P+NV + VSP++LVF+
Sbjct  657   SPGNLNYPSISVVFQSTSDVVTYKRVVKNVGGSLDAVYEVKVNSPANVDIKVSPSKLVFS  716

Query  1996  DRIDTLSYEVTFQSLRQS-----ADSFGSLRWSDGTHLVTSPIAVSWE  2124
                 TLSYE+TF S+          +FGS+ WSDG H V  PIAV W 
Sbjct  717   AENKTLSYEITFSSVSLDWPTIIPSTFGSIEWSDGIHGVRGPIAVKWR  764



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/721 (57%), Positives = 508/721 (70%), Gaps = 13/721 (2%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P  +H  SS+LLYTY    +GFSA LTP QA  L   PG++SV+PDR   L TTR+P FL
Sbjct  62    PSPDHPHSSKLLYTYSKAINGFSAHLTPLQAEILRQHPGILSVIPDRPRHLHTTRTPHFL  121

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT  363
             GL S S  + P+S Y  D+IIGVLD+GIWPER SFSD  L+ +P  ++  CE    FPA+
Sbjct  122   GL-SDSFGIWPNSKYADDVIIGVLDTGIWPERHSFSDSTLSDVPRRFKGICETSKDFPAS  180

Query  364   SCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngh  537
             +CN+KIIGARA+YRGYE+   RPI   +E KS  D  GHGTH AS AAGS V+NA++  +
Sbjct  181   ACNKKIIGARAFYRGYESYMERPIDETEESKSPRDTEGHGTHTASTAAGSLVSNASLFDY  240

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             ARGEARG+A  ARIAVYK+CW   C ++DIL+ MDQA+ADGV V+SLS+G     G+A  
Sbjct  241   ARGEARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVG---ASGYAPQ  297

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y++D IAIG+FGA Q GV+VSC AGNSGP P+TA NIAPWILTVGASTIDREFPA   LG
Sbjct  298   YDQDSIAIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPADAILG  357

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
             +GR+F G SLY G      ++ +VYG     R+C  G+L+ SKV+GKIV C +  N   V
Sbjct  358   DGRSFGGVSLYAGESLPDFKLRLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGGNAR-V  416

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
             ++G AVK +GG+GMI++N    G EL+A++ +IP  +V A  GD I +Y+K ++  TA I
Sbjct  417   EKGAAVKLAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQYPTATI  476

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
             VFRGTV   SP AP+VAAFSSRGPN LT EILKPDVIAPGVNILAAWTG+  P++   D 
Sbjct  477   VFRGTVISPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTDLEIDC  536

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR +FNI+SGTSM+CPHVSGLAA+LRK YP WSPA IKSALMTT Y LDNSG + + DL 
Sbjct  537   RRVDFNIISGTSMSCPHVSGLAALLRKAYPDWSPAVIKSALMTTAYNLDNSGEN-IKDLA  595

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             +G  STP  HG+GHVDP  A +PGLVYD  V++YV FLC+IGYD ++I++F+R     D 
Sbjct  596   SGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPASSDI  655

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
               R L  PG LNYPSF+VVF +N   + YKR VKNVG   +  Y+V V  P NV V V P
Sbjct  656   CTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWP  715

Query  1978  NRLVFTDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSE  2142
             ++L F+     L+YE+TF S     L  S    GS+ WSDG HLV SPIAV W   SVS 
Sbjct  716   SKLAFSAEKKALAYEITFSSVGLDGLGVSPQQSGSIEWSDGVHLVRSPIAVRWIQGSVSS  775

Query  2143  L  2145
             +
Sbjct  776   M  776



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/722 (57%), Positives = 512/722 (71%), Gaps = 19/722 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L++ ++ S +LY+YEH A GFSARLT  QASEL  +PGV+SV P+++ E+ TT +P FLG
Sbjct  77    LTSSTQPSRILYSYEHAATGFSARLTAGQASELRRIPGVLSVWPEQVHEVHTTHTPHFLG  136

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L +  S L P+SDY  D+IIGVLD+GIWPE  SF+D  L+P+P SW+  CE GP FPA  
Sbjct  137   L-ANDSGLWPNSDYADDVIIGVLDTGIWPELRSFNDSELSPVPESWKGVCETGPDFPA--  193

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRKIIGAR ++RGYE+  GR I   +E KS  D  GHGTH AS AAGS V NA++  +A
Sbjct  194   CNRKIIGARTFHRGYESALGRQIDESEESKSPRDTEGHGTHTASTAAGSVVQNASMFEYA  253

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              GEARG+AT ARIAVYK+CW   C ++DIL+ MDQA+ADGVHV+SLS+G K   G A  Y
Sbjct  254   NGEARGMATKARIAVYKICWNQGCLDSDILAAMDQAIADGVHVISLSVGAK---GLAPKY  310

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             + D IAIGAFGA++ GVIVSC  GNSGP P+TA+NIAPWILTVGASTIDREFPA V LGN
Sbjct  311   DRDSIAIGAFGAMEHGVIVSCSVGNSGPKPFTAVNIAPWILTVGASTIDREFPADVVLGN  370

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             GR F G SLY G   +   + +V      SR C+ G+L+ S V GKIV C +      V+
Sbjct  371   GRIFRGVSLYTGDPLNATHLPLVLADECGSRLCVAGKLNPSLVSGKIVVCDRGGG-KRVE  429

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVK +GG GMI++N +  G ELVA++ +IP  +V    GD I  Y  +  S TA I 
Sbjct  430   KGRAVKLAGGAGMILANTKTTGEELVADSHLIPATMVGKTAGDEIKRYADSKSSPTATIA  489

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             FRGTV GNS  AP+VA+FSSRGPN LTPEILKPDVIAPGVNILA WTG+ +P+    D R
Sbjct  490   FRGTVMGNSLLAPKVASFSSRGPNRLTPEILKPDVIAPGVNILAGWTGSNSPTGLDMDER  549

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R EFNI+SGTSMACPHVSGLAA+LRK +P WSPAAIKSALMTT Y  DNSG S + DL T
Sbjct  550   RVEFNIISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALMTTAYNSDNSG-SQITDLAT  608

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  STP  HGSGHV+P  A DPGLVYD G +DYV FLC++GY S+ I +F+R+   V+C 
Sbjct  609   GNKSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCD  667

Query  1801  NRNLGNPGALNYPSFAVVFKNNL------QTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
             ++ +  PG LNYPSF+VVF  +       + + +KR V+NVG  KN  Y V V  P +V+
Sbjct  668   SQKM-KPGDLNYPSFSVVFNADSAVIKRGRVVKHKRVVRNVGSSKNAVYSVKVNPPPSVK  726

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLRQS-ADSFGSLRWSDGTHLVTSPIAVSWEGRSVS  2139
             + VSP++LVFT++    SYEVTF S+  S    FGS+ W+DG+H V SP+AV W    V+
Sbjct  727   INVSPSKLVFTEKNQVASYEVTFTSVGASLMTEFGSIEWTDGSHRVRSPVAVRWHNDLVA  786

Query  2140  EL  2145
              +
Sbjct  787   SM  788



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/719 (56%), Positives = 505/719 (70%), Gaps = 21/719 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             LS  +    LLY+Y H + GF+A L+ +QA++L   P V+SV+PDR  ++ TT +P FLG
Sbjct  85    LSTTTTPPNLLYSYSHSSTGFAAHLSQAQAAQLRRHPAVLSVIPDRAHQIHTTHTPNFLG  144

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L  GS  L P+S Y +D+I+GVLD+GIWPE  SFSD G + +P +W+  CEVGP FPA S
Sbjct  145   LHDGS-GLWPNSHYASDVIVGVLDTGIWPELLSFSDDGYDHVPPTWKGSCEVGPDFPAGS  203

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRKI+GARA+Y+GYEA  G P+    E KS  D  GHGTH AS AAGS V +A +  +A
Sbjct  204   CNRKIVGARAFYKGYEAAKG-PMNETKESKSPRDTEGHGTHTASTAAGSVVPDAGLFDYA  262

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
             RGEARG+AT ARIA YK+CW   C ++DIL+ MDQA+ DGVHV+SLS+G     G A  +
Sbjct  263   RGEARGMATKARIAAYKICWSTGCYDSDILAAMDQAIEDGVHVISLSVG---SSGLAPQF  319

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             ++D IAIGA  AVQ GV+VSC AGNSGPD +TA NIAPWILTVGASTIDREFPA V LG+
Sbjct  320   DKDGIAIGALHAVQSGVLVSCSAGNSGPDAFTATNIAPWILTVGASTIDREFPADVVLGD  379

Query  901   GRTFTGTSLYFGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
             GRTF G SLY+G   + +  + +V G    SR C  G LD SK  GK+V C +  +   V
Sbjct  380   GRTFKGVSLYYGDGLNDSVYLELVRGADCGSRLCKAGDLDTSKAAGKMVICDR-GDTARV  438

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G AVKQ+GGVGMI++N    G EL+A++ +IP  +V    GD I DYV    + TA I
Sbjct  439   AKGDAVKQAGGVGMILANTAESGEELIADSHLIPATMVGQIAGDQIRDYVSAVPNPTATI  498

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
              F+GTV G SPSAPRVAAFSSRGPN LTPEILKPDVIAPGVNILA WTG+ AP++   D 
Sbjct  499   RFKGTVIGPSPSAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSAAPTDLEIDP  558

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR +FNI+SGTSM+CPHVSGLAA+LR  YPSWSPAA+KSALMTT Y LDNSG++ + DL 
Sbjct  559   RRVQFNIISGTSMSCPHVSGLAALLRNAYPSWSPAAVKSALMTTAYYLDNSGKN-ITDLA  617

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             TG  S+P  HGSGHVDP  A +PGLVYD   NDY+  LC +GY+S +IA+FL+    +DC
Sbjct  618   TGKQSSPFVHGSGHVDPNKALNPGLVYDINANDYISLLCAMGYNSTRIAIFLKEPTTIDC  677

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
               +NL   G LNYPSF+VVF++    + Y R VKNVG   +  Y+V+V  P NV V+VSP
Sbjct  678   AAKNLSTAGNLNYPSFSVVFESGKNVVKYTRVVKNVGSSADAVYEVSVNAPLNVDVSVSP  737

Query  1978  NRLVFTDRIDTLSYEVTFQSLRQS-----------ADSFGSLRWSDGTHLVTSPIAVSW  2121
              +L F+    TLSYE++F S+ ++             SFGS+ WSDG+H V SPIAV W
Sbjct  738   RKLEFSADKQTLSYEISFTSISETYLTGKVKPILGTSSFGSIEWSDGSHRVRSPIAVRW  796



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/722 (57%), Positives = 513/722 (71%), Gaps = 19/722 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L++ ++ S +LY+YEH A GFSARLT  QASEL  +PGV+SV P+++ E+ TT +P FLG
Sbjct  57    LTSSTQPSRILYSYEHAATGFSARLTAGQASELRRIPGVLSVWPEQVHEVHTTHTPHFLG  116

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L +  S L P+SDY  D+IIGVLD+GIWPE  SF+D  L+P+P SW+  CE GP FPA  
Sbjct  117   L-ANDSGLWPNSDYADDVIIGVLDTGIWPELRSFNDSELSPVPESWKGVCETGPDFPA--  173

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRKIIGAR ++RGYE+  GR I   +E KS  D  GHGTH AS AAGS V NA++  +A
Sbjct  174   CNRKIIGARTFHRGYESALGRQIDESEESKSPRDTEGHGTHTASTAAGSVVQNASMFEYA  233

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              GEARG+AT ARIAVYK+CW   C ++DIL+ MDQA+ADGVHV+SLS+G K   G A  Y
Sbjct  234   NGEARGMATKARIAVYKICWNQGCLDSDILAAMDQAIADGVHVISLSVGAK---GLAPKY  290

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             + D IAIGAFGA++ GVIVSC  GNSGP P+TA+NIAPWILTVGASTIDREFPA V LGN
Sbjct  291   DRDSIAIGAFGAMEHGVIVSCSVGNSGPKPFTAVNIAPWILTVGASTIDREFPADVVLGN  350

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             GR F G SLY G   +   + +V      SR C+ G+L+ S V GKIV C +      V+
Sbjct  351   GRIFRGVSLYTGDPLNAPHLPLVLADECGSRLCVAGKLNPSLVSGKIVVCDRGGG-KRVE  409

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVK +GG GMI++N +  G ELVA++ +IP  +V    GD I  Y  +  S TA I 
Sbjct  410   KGRAVKLAGGAGMILANTKTTGEELVADSHLIPATMVGKTAGDEIKRYADSKSSPTATIA  469

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             FRGTV GNS  AP+VA+FSSRGPN LTPEILKPDVIAPGVNILA WTG+ +P+    D R
Sbjct  470   FRGTVMGNSLLAPKVASFSSRGPNRLTPEILKPDVIAPGVNILAGWTGSNSPTGLDMDER  529

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R EFNI+SGTSMACPHVSGLAA+LRK +P WSPAAIKSALMTT Y  DNSG S + DL +
Sbjct  530   RVEFNIISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALMTTAYNSDNSG-SQITDLAS  588

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  STP  HGSGHV+P  A DPGLVYD G +DYV FLC++GY S+ I +F+R+   V+C 
Sbjct  589   GNKSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCD  647

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTI------TYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
             ++ +  PG LNYPSF+VVF  +   I       +KR V+NVG  K+  Y V V +P +V+
Sbjct  648   SQKM-KPGDLNYPSFSVVFNADSAVIKRGGVVKHKRVVRNVGSSKDAVYSVKVNSPPSVK  706

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS-FGSLRWSDGTHLVTSPIAVSWEGRSVS  2139
             + VSP++LVFT++    SYEVTF S+  S  + FGS+ W+DG+H V SP+AV W    V+
Sbjct  707   INVSPSKLVFTEKNQVASYEVTFTSVGASLMTVFGSIEWTDGSHRVRSPVAVRWHNDLVA  766

Query  2140  EL  2145
              +
Sbjct  767   SM  768



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/708 (56%), Positives = 508/708 (72%), Gaps = 17/708 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             +++LY+Y++ A GFSAR+T  QA  L  VPGV+SV+PDR  +L TT +P FLGL + S  
Sbjct  67    AKILYSYDYAARGFSARITSGQADRLRRVPGVVSVIPDRARQLHTTHTPTFLGL-ADSFG  125

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D+I+GVLD+GIWPER SFSD GL+ +P+ W+ KCE G  FPATSCNRKIIG
Sbjct  126   LWPNSDYADDVIVGVLDTGIWPERPSFSDDGLSAVPSGWKGKCETGQDFPATSCNRKIIG  185

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR +Y+GYEA  G PI +  E KS  D  GHGTH AS AAGS VANA+   +A+GEARG+
Sbjct  186   ARLFYKGYEADRGSPIDESKESKSPRDTEGHGTHTASTAAGSVVANASFFQYAKGEARGM  245

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A  ARIA YK+CW   C ++DIL+ MDQAVADGVHV+SLS+G    +G+A  Y+ D IAI
Sbjct  246   AVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVG---ADGYAPEYDVDSIAI  302

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP   TA+N+APWILTV ASTIDREFPA V LG+GR F G 
Sbjct  303   GAFGASEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPANVILGDGRIFGGV  362

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G   +  ++ +VY     S+ C PG+LD SKV GKIV C +  N   V++G AVK 
Sbjct  363   SLYSGDPLNDTKLPLVYSGDCGSQLCYPGKLDPSKVAGKIVLCDRGGNAR-VEKGSAVKL  421

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG GM+++N+   G ELVA++ ++P  +V    GD I DYVK+  S  A IVF+GTV G
Sbjct  422   AGGAGMVLANLADSGEELVADSHLLPATMVGQKAGDKIRDYVKSDSSPKATIVFKGTVIG  481

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP+APR+AAFS RGPN++TPEILKPDV APGVNILA WTG+I P++   D RR EFNI+
Sbjct  482   KSPTAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVEFNII  541

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSGLAA+LRK YP W+ AAIKSALMTT Y +DNSG+ T  DL TG  S+P 
Sbjct  542   SGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALMTTAYNVDNSGK-TFTDLATGQESSPF  600

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HGSGHVDP  A DPGLVYD  + DYV+FLC IGYD ++I+ F++ +  V+C  ++  +P
Sbjct  601   VHGSGHVDPNRALDPGLVYDIEMKDYVNFLCAIGYDPKRISPFVKETSSVNCSEKSFVSP  660

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPS   V  ++   + YKR VKNVG+  N  Y+V +  P++V V V+P +L F++ 
Sbjct  661   GDLNYPS-FSVVFSSESVVKYKRVVKNVGRNTNAVYEVKISVPASVEVKVTPTKLSFSEE  719

Query  2002  IDTLSYEVTF--------QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               +LSYE++F        ++++    +FGS+ WSDG H V SPIAV W
Sbjct  720   NKSLSYEISFSSNGSVGLETVKGLESAFGSIEWSDGIHSVRSPIAVYW  767



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/720 (57%), Positives = 511/720 (71%), Gaps = 17/720 (2%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L  H+R +++LYTY+    GFSARL+ +QA+ L+ VPGVISV+PD +    TTR+P+FLG
Sbjct  57    LPPHNRPAKILYTYDRAVRGFSARLSAAQAAALSRVPGVISVIPDAVRHPHTTRTPKFLG  116

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L + S  L P++DY  D+I+GVLD+GIWPER SFSD GL+P+P+ W+  C   P FPAT 
Sbjct  117   L-ADSFGLWPNADYADDVIVGVLDTGIWPERPSFSDEGLSPVPSHWKGSCVDAPDFPATL  175

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CN+KIIGA+ +Y GYEA  G+ + +  E KS  D  GHGTH AS AAGS V NA++ G+A
Sbjct  176   CNKKIIGAKTFYLGYEASRGKTMEESNESKSPRDTEGHGTHTASTAAGSRVVNASLFGYA  235

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
             +GEARG+A  ARIAVYK+CW   C ++DIL+ M+ A+ DGV V+SLS+G     G+A  Y
Sbjct  236   KGEARGMAVKARIAVYKICWAFGCYDSDILAAMEHAIEDGVDVISLSVG---ANGYAPQY  292

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             + D IAIGAFGA + G++VSC AGNSGPD YTA+NIAPWILTVGAST+DREFPA V LG+
Sbjct  293   DFDSIAIGAFGAAEHGIVVSCSAGNSGPDSYTAVNIAPWILTVGASTLDREFPADVILGD  352

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             GRTF G SLY G       + +VYG    SRYC  GQLD +KV GKIV C +  N   V+
Sbjct  353   GRTFGGVSLYHGDSLGEKLLPLVYGADCGSRYCYTGQLDPAKVAGKIVICDRGGNAR-VE  411

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AV  +GG G+I++N+   G EL+A+A  IP  +V    GD I  Y ++  + TA I 
Sbjct  412   KGNAVHVAGGAGLIMANLADSGEELLADAHFIPATMVGQTAGDKIRAYARSDPNPTATIA  471

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             FRGTV   SP APRVA+FSSRGP++ T EILKPDVIAPGVNILA WTG I P++   D R
Sbjct  472   FRGTVISTSPPAPRVASFSSRGPSYRTAEILKPDVIAPGVNILAGWTGYIGPTDLESDTR  531

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             + EFNI+SGTSM+CPHVSGLAA+LRK +P WSPAAIKSALMTT Y LDNSG   + DL T
Sbjct  532   KVEFNIISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALMTTAYNLDNSG-GNITDLAT  590

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S P  HGSGHVDP  A DPGLVYD  + DYV FLCTIGYDS++I++F + +  VDC 
Sbjct  591   GSESNPFVHGSGHVDPNRAVDPGLVYDLEITDYVAFLCTIGYDSRRISVFTKQASSVDCD  650

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
                   PG LNYPSF+VVF  +   + YKRTVKNVGK  N  Y+V V TP  V V+VSP+
Sbjct  651   ALGFKTPGNLNYPSFSVVFSGSESVVKYKRTVKNVGKEANAVYEVKVNTPLGVEVSVSPS  710

Query  1981  RLVFTDRIDTLSYEVTFQS--------LRQSADSFGSLRWSD-GTHLVTSPIAVSWEGRS  2133
             +LVF+++ D LSYEVTF+S        +  S  SFGS+ WSD G+HLV SPIAV W   S
Sbjct  711   KLVFSEKEDKLSYEVTFKSSANAVGFEITGSKSSFGSIEWSDGGSHLVRSPIAVLWRRNS  770



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/721 (57%), Positives = 505/721 (70%), Gaps = 13/721 (2%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P  +H  SS+LLYTY    +GFSA LTP Q   L   PG++SV+PDR   L TTR+P FL
Sbjct  62    PSPDHPHSSKLLYTYSKAINGFSAHLTPLQTEILRQYPGILSVIPDRPRHLHTTRTPHFL  121

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT  363
             GL S S  + P+S Y  D+IIGVLD+GIWPER SFSD  L+ +P  ++  CE    FPA+
Sbjct  122   GL-SDSFGIWPNSKYADDVIIGVLDTGIWPERHSFSDSTLSDVPRRFKGICETSKDFPAS  180

Query  364   SCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngh  537
             +CN+KIIGARA+YRGYE+   RPI   DE KS  D  GHGTH AS AAGS V+NA++  +
Sbjct  181   ACNKKIIGARAFYRGYESYMERPIDETDESKSPRDTEGHGTHTASTAAGSLVSNASLFDY  240

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             ARGEARG+A  ARIAVYK+CW   C ++DIL+ MDQA+ADGV V+SLS+G     G+A  
Sbjct  241   ARGEARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVG---ASGYAPQ  297

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y++D IAIG+FGA Q GV+VSC AGNSGP P+TA NIAPWILTVGASTIDREFPA   LG
Sbjct  298   YDQDSIAIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPADAILG  357

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
             +GR F G SLY G      ++ +VYG     R+C  G+L+ SKV+GKIV C +  N   V
Sbjct  358   DGRIFGGVSLYAGESLPDFKLHLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGGNAR-V  416

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
             ++G AVK +GG+GMI++N    G EL+A++ +IP  +V A  GD I +Y+K ++  TA I
Sbjct  417   EKGAAVKLAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQYPTATI  476

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
             VFRGTV   SP AP+VAAFSSRGPN LT EILKPDVIAPGVNILAAWTG+  P++   D 
Sbjct  477   VFRGTVISPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTDLEIDP  536

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR +FNI+SGTSM+CPHVSGLAA+LRK YP WSPAAIKSALMTT Y LDNSG + + DL 
Sbjct  537   RRVDFNIISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALMTTAYNLDNSGEN-IKDLA  595

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             +G  STP  HG+GHVDP  A +PGLVYD  V++YV FLC+IGYD ++I++F+R     D 
Sbjct  596   SGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPVSSDI  655

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
               R L  PG LNYPSF+VVF +N   + YKR VKNVG   +  Y+V V  P NV + V P
Sbjct  656   CTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAINVWP  715

Query  1978  NRLVFTDRIDTLSYEVTF-----QSLRQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSE  2142
             ++L F+     L+YE+TF       L  S    GS+ WSDG HLV SPIAV     SVS 
Sbjct  716   SKLAFSAEKKALAYEITFSIVGLDGLGVSPQQSGSIEWSDGVHLVRSPIAVRGIQGSVSS  775

Query  2143  L  2145
             +
Sbjct  776   M  776



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/720 (55%), Positives = 513/720 (71%), Gaps = 18/720 (3%)
 Frame = +1

Query  22    RSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGS  201
             R + L+Y+Y    +GFSA L+PSQ + L  +P VISV+PDR+ ++ TT +P+FLG  SG+
Sbjct  68    RPATLIYSYSRAVNGFSAVLSPSQVAFLRLIPAVISVIPDRIHQIHTTHTPRFLGF-SGN  126

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
              +L  +SD G D+I+GVLD+GIWPE  SFSD GL P+P+SW+  CE+GP FPA++C+RK+
Sbjct  127   FSLWSNSDDGEDVIVGVLDTGIWPEHPSFSDSGLGPVPSSWKGACEIGPDFPASACSRKL  186

Query  382   IGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             IGARA+Y+GYE+     + D  E KS  D  GHGTH AS AAGS VANA++  +ARGEAR
Sbjct  187   IGARAFYKGYESHLNGSMDDSKESKSPRDTEGHGTHTASTAAGSVVANASLYQYARGEAR  246

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A+ ARIA YK+CW   C ++DIL+ MDQAV+DGV V+SLS+G     G A  Y+ED I
Sbjct  247   GMASKARIAAYKICWSSGCYDSDILAAMDQAVSDGVQVISLSVG---ANGLAPAYHEDSI  303

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             AIGAFGA Q GV+VSC AGNSGP PYTA+NIAPWILTVGASTIDREFPA   +G+GR F 
Sbjct  304   AIGAFGAAQHGVVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADAVIGDGRVFY  363

Query  916   GTSLYFGIQP-SPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
             GTSLY G    S +Q+ +VY     SR C PG+L++S V+GKIV C +  N   V++G A
Sbjct  364   GTSLYAGEDSLSDSQIPLVYSGDCGSRLCYPGKLNSSLVKGKIVLCDRGGNAR-VEKGSA  422

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK-NTKSATARIVFRG  1269
             VKQ+GG+GMI++N    G EL A++ +IP  +V +A G+ I DY+K +++S TA I F G
Sbjct  423   VKQAGGLGMILANTDESGEELTADSHLIPATMVGSAAGNQIRDYIKISSESPTATIRFEG  482

Query  1270  TVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTE  1449
             TV G SPSAPRVAAFSSRGPN LTP+ILKPDVIAPGVNILA WTG++ P++   D RR  
Sbjct  483   TVIGPSPSAPRVAAFSSRGPNHLTPQILKPDVIAPGVNILAGWTGSVGPTDLDIDPRRVT  542

Query  1450  FNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP  1629
             FNI+SGTSM+CPHVSGLAA+LRK +P+WSPA IKSAL+TT Y +DNSG S + DL TG  
Sbjct  543   FNIISGTSMSCPHVSGLAALLRKAHPNWSPAMIKSALVTTAYNVDNSGES-IKDLATGKS  601

Query  1630  STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNR  1806
             S P  HG+GHVDP  A DPGLVYD  + +YV FLC +GYD   I++F+ +  L + C   
Sbjct  602   SNPFIHGAGHVDPNKALDPGLVYDIDMKEYVAFLCAVGYDWPAISVFIHDPKLFNACETS  661

Query  1807  NLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRL  1986
              L  PG LNYPS   V  ++ + + Y+R VKNVG   +  Y V + +P+NV + VSP+RL
Sbjct  662   KLRTPGDLNYPSLVAVLGSSGEVVKYRRVVKNVGSKADAVYNVGINSPTNVEIEVSPSRL  721

Query  1987  VFTDRIDTLSYEVTFQSL-------RQSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
              F+     L YEVTF+S+        +  + FGS+ W+DG H+V SP+A+ W   SV  +
Sbjct  722   EFSKEKRELEYEVTFRSVVLGGRVGAEPREEFGSIEWTDGDHVVRSPVAIRWSQGSVQPI  781



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/708 (55%), Positives = 501/708 (71%), Gaps = 13/708 (2%)
 Frame = +1

Query  22    RSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGS  201
             + + +LY Y H  HGFS  LTP+Q ++L  VPG++SV+PD++ +L TT +  FLGL  GS
Sbjct  65    QPARILYNYNHAIHGFSVHLTPTQLAKLRLVPGILSVIPDQICQLHTTHTSTFLGLSEGS  124

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
               L  +S YG  +IIGVLD+GIWPE  S SD GL+ +P +W+  CE GP FPA+SCN+K+
Sbjct  125   -RLWQNSGYGDGVIIGVLDTGIWPEHKSLSDSGLSDVPANWKGICETGPDFPASSCNKKL  183

Query  382   IGARAYYRGYEAVTGRPIVDEPKSAI--DMTGHGThvasiaagsavananvnghaRGEAR  555
             IGARA+Y+GY    GRPI +  +SA   D  GHGTH A+ AAGS   NA++  +A GEAR
Sbjct  184   IGARAFYKGYITHKGRPIDESKESASPRDTEGHGTHTATTAAGSLAHNASLFQYATGEAR  243

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A+ ARIA YK+CW   C ++DIL+ MDQA+ DGVHV+SLS+G     G A  Y+ D I
Sbjct  244   GMASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVG---ATGHAPQYDHDSI  300

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             AIGAF A Q G++VSC AGN+GP PYTA+NIAPWILTVGASTIDREFPA V LGNG   +
Sbjct  301   AIGAFSASQHGIVVSCSAGNAGPGPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVLS  360

Query  916   GTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             G SLY G      ++ +VY     SRYC  G +  SKV+GKIV C +  N   V++G AV
Sbjct  361   GVSLYSGDPLVDYKLPLVYAGDVGSRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAV  419

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GG+GMI++N    G EL+A++ ++P   V     + I  Y+K+ +S TA I+FRGT+
Sbjct  420   KLAGGLGMILANTADSGEELIADSHLLPATEVGEIAANKIRQYIKSDQSPTATILFRGTI  479

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              G+SP+AP+VAAFSSRGPN+LTPEILKPDVIAPGVNILA WTG + P++   D RR EFN
Sbjct  480   IGSSPAAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLELDPRRVEFN  539

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSM+CPHVSG+ A+LRK YP WSPAAIKSAL+TT YTLDNSG++ + DL +   ST
Sbjct  540   IISGTSMSCPHVSGIVALLRKAYPDWSPAAIKSALVTTAYTLDNSGKN-IKDLASAEEST  598

Query  1636  PHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG  1815
             P  HG+GHVDP +A DPGLVYD   +DY+ FLC IGYDS +IA+F+R  P  D  +  + 
Sbjct  599   PFIHGAGHVDPNSALDPGLVYDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKVS  658

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
             +PG LNYPSF+VVF++    +T KR VKNVG   +  Y+V V +P+NV + VSP++LVF+
Sbjct  659   SPGNLNYPSFSVVFQSTSDVVTCKRVVKNVGSSLDAVYEVKVNSPANVDIKVSPSKLVFS  718

Query  1996  DRIDTLSYEVTFQSLRQS-----ADSFGSLRWSDGTHLVTSPIAVSWE  2124
                 TLSYE+TF S+          ++GS+ WSDG H V  PIAV W 
Sbjct  719   AENKTLSYEITFSSVGLDWPTIIPSTYGSIEWSDGIHGVRGPIAVKWR  766



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/712 (55%), Positives = 509/712 (71%), Gaps = 13/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLY Y H  HGFSA+LT +Q   L  VPG++SV+PD++ ++ TT +P FLGL S S  
Sbjct  67    AKLLYNYNHATHGFSAQLTTTQVEMLRRVPGILSVIPDQIRQIHTTHTPAFLGL-SESFG  125

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L  +S YG  +IIGVLD+GIWPE  S SD GL+ +P +W+  CE GP FPA+SCN+K+IG
Sbjct  126   LWENSGYGDGVIIGVLDTGIWPEHRSLSDSGLSDVPANWKGICETGPDFPASSCNKKLIG  185

Query  388   ARAYYRGYEAVTGRPIVDEPKSAI--DMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARA+ +GY +  GR I D  +SA   D  GHGTH ++ AAGS+V NA++  +A GEARG+
Sbjct  186   ARAFNKGYISHRGRHIDDSKESASPRDTEGHGTHTSTTAAGSSVHNASLFEYASGEARGM  245

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIA YK+CW   C ++DIL+ MDQA+ DGVHV+SLS+G     G A  Y+ D IAI
Sbjct  246   ASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVG---ATGHAPQYDHDSIAI  302

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAF A Q G++VSC AGNSGPDPYTA+NIAPWILTVGASTIDREFPA V LGNG  F+G 
Sbjct  303   GAFSASQHGIVVSCSAGNSGPDPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFSGV  362

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +VY     +RYC  G +  SKV+GKIV C +  N   V++G AVK 
Sbjct  363   SLYSGDPLVGFKLPLVYAGDVGNRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAVKL  421

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG+GMI++N    G EL+A++ ++P   V     + I +YVK ++  TA I FRGT+ G
Sbjct  422   AGGLGMILANTADSGEELIADSHLLPATEVGEIAANKIREYVKLSQYPTATINFRGTIIG  481

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP+AP+VAAFSSRGPN+LTPEILKPDVIAPGVNILA WTG + P++   D RR EFNI+
Sbjct  482   TSPAAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLEIDPRRVEFNII  541

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+ A+LRK YP WSPAAIKSAL+TT + LDNSG++ + DL +   STP 
Sbjct  542   SGTSMSCPHVSGIVALLRKAYPDWSPAAIKSALVTTAHNLDNSGKN-IKDLASSEESTPF  600

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HG+GHVDP +A DPGLVYD   +DY+ FLC IGYDS++IA+F+R  P  D  +  +G+P
Sbjct  601   IHGAGHVDPNSALDPGLVYDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKVGSP  660

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF++N   +TY+RTVK+VG   +  Y+V V  P+NV + VSP+RLVF   
Sbjct  661   GNLNYPSFSVVFQSNSDVVTYRRTVKSVGNSPDAVYEVEVNAPANVDIKVSPSRLVFNAE  720

Query  2002  IDTLSYEVTFQSLRQ-----SADSFGSLRWSDGTHLVTSPIAVSWEGRSVSE  2142
               T+SYE+TF S+       ++ +FGS+ WS+G H V SPIAV W   S  E
Sbjct  721   NKTVSYEITFSSVSSGWSSINSATFGSIEWSNGIHRVRSPIAVKWRQGSSRE  772



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/703 (57%), Positives = 504/703 (72%), Gaps = 11/703 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLYTY+   HGFSA LT SQA++L + P V+SV PD+  +L TT +P FLGL   S  
Sbjct  67    TKLLYTYDRAVHGFSAALTSSQATQLLSHPAVLSVTPDQPRQLHTTHTPSFLGLAE-SFG  125

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D+I+GVLD+GIWPER SFSD GL P+P+ W+  C   P FP++SCNRKIIG
Sbjct  126   LWPNSDYADDVIVGVLDTGIWPERPSFSDSGLGPVPSRWKGTCVSAPDFPSSSCNRKIIG  185

Query  388   ARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARAY+ GYEA  GR +   +E KS  D  GHGTH AS AAGS VANA++  +ARGEARG+
Sbjct  186   ARAYFDGYEAYIGRLMDESNESKSPRDTEGHGTHTASTAAGSPVANASLFSYARGEARGM  245

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIAVYK+CW   C ++DIL+ MDQA+ADGV ++SLS+G     G +  Y+ D IAI
Sbjct  246   ATKARIAVYKICWSFGCFDSDILAAMDQAIADGVDIISLSVG---ASGRSPAYDRDSIAI  302

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             G+FGA Q GV+VS  AGNSGP+P+TA NIAPWILTVGAST+DREFPA V LG+ R F G 
Sbjct  303   GSFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTVDREFPADVILGDNRVFGGV  362

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G     +Q+ ++YG  A SRYC  G L  SKV+GKIV C +  N   V +G AVK 
Sbjct  363   SLYSGEPLVDHQLPLIYGGDAGSRYCYAGALKPSKVQGKIVVCDRGGNAR-VGKGSAVKL  421

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG+G I++N    G EL+A+A +IP   V     D I +Y++ ++  TA IVFRGTV G
Sbjct  422   AGGLGFILANTADSGEELLADAHLIPATEVGEIAADQIREYIRLSQYPTATIVFRGTVVG  481

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP+AP+VAAFSSRGPN LTPEILKPDVIAPGVNILA WTGA AP++   D RRTEFNI+
Sbjct  482   TSPAAPKVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGASAPTDLDIDPRRTEFNII  541

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+AA+LRK YP+WS AAIKSAL+TT YTLD+SG+  + DL TG  STP 
Sbjct  542   SGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALITTAYTLDDSGKK-IRDLATGKESTPF  600

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGN  1818
              HG+GHVDP  A +PGL+YD  VNDYV FLC+IGY  ++IA+FL      D C   +L +
Sbjct  601   VHGAGHVDPNRALNPGLIYDLNVNDYVAFLCSIGYSPRQIAVFLGKPTGSDICTKNSLAS  660

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
             PG LNYPS +V+  ++   + YKR   NVG   +  Y+V V  P+ V ++VSP++L F++
Sbjct  661   PGDLNYPSLSVILSSDQSLVKYKRVATNVGGNVDAVYKVNVTAPAGVEISVSPSKLEFSE  720

Query  1999  RIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
                +LSYEVTF+        + +GS+ W+DG+HLV SP+AV W
Sbjct  721   ENQSLSYEVTFRRGVGYDGGERYGSIEWTDGSHLVRSPVAVRW  763



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/717 (56%), Positives = 506/717 (71%), Gaps = 19/717 (3%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             S+LLYTY    +GFSA LT SQAS+L  + GV+SV+PD+  +L TTR+ QFLGL + +  
Sbjct  118   SKLLYTYGKSINGFSATLTASQASKLRGIRGVVSVVPDQPRQLHTTRTYQFLGL-TDNFG  176

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D++IGVLD+GIWPER SFS  GL+ +P+ W+  CE    FPA++CN KIIG
Sbjct  177   LWPNSDYAEDVVIGVLDTGIWPERPSFSGAGLSRVPSGWKGICETAKDFPASACNGKIIG  236

Query  388   ARAYYRGYEAVTGRPIVDEPKSAI---DMTGHGThvasiaagsavananvnghaRGEARG  558
             AR++Y+GY A  G+PI DE K ++   D  GHGTH +S AAG+ V+NA+   +A GEARG
Sbjct  237   ARSFYKGYLAALGKPI-DESKESLSPRDTEGHGTHTSSTAAGAVVSNASFLHYAPGEARG  295

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +AT ARIA YK+CW   C ++DIL+ MDQA++DGVH++SLS+G  +    A PY  D IA
Sbjct  296   MATKARIAAYKICWSLGCYDSDILAAMDQAISDGVHIISLSVGSSH----ASPYFLDSIA  351

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             IG+FGA Q GV+VSC AGNSGPD YTA NIAPWILTVGASTIDREFPA V LG+ R F G
Sbjct  352   IGSFGAAQHGVLVSCSAGNSGPDAYTATNIAPWILTVGASTIDREFPADVILGDDRIFNG  411

Query  919   TSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
              SLY G     +++ +VY R A  RYC  G+L   KV G IV C +  N   V++G AVK
Sbjct  412   VSLYAGDSLGASKLPLVYAREAGDRYCHEGKLIPKKVEGTIVVCDRGGNAR-VEKGSAVK  470

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GM+++N+   G EL+A++ ++P  +V   +GD I +Y+K+T++ TA IVFRGTV 
Sbjct  471   HAGGFGMVLANLEDSGEELLADSHLLPATMVGQINGDKIKEYIKSTENPTATIVFRGTVI  530

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             G+SP+AP+VAAFSSRGPN L PEILKPDVIAPGVNILA WTG I P++   D RR EFNI
Sbjct  531   GSSPAAPKVAAFSSRGPNILNPEILKPDVIAPGVNILAGWTGFIGPTDLEIDPRRVEFNI  590

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSG+AA+LRK YPSWSPAAIKSAL+TT Y +DNSG  TL DL TG  S P
Sbjct  591   ISGTSMSCPHVSGIAALLRKAYPSWSPAAIKSALITTAYDVDNSGE-TLRDLATGEESNP  649

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGN  1818
               HG+GHVDP  A +PGLVYD GVNDYV FLC+IGYDS  I++F+R     D   +    
Sbjct  650   FVHGAGHVDPNRALNPGLVYDAGVNDYVAFLCSIGYDSALISIFVREPTSSDICAKTFDK  709

Query  1819  PGA------LNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              GA      LNYPSF+VVF +N Q + YKR V NVG   +  Y+V+V  P+ V + VSP+
Sbjct  710   IGALISSGDLNYPSFSVVFDSNRQVVKYKRVVTNVGSETDAVYEVSVSEPAGVDIKVSPS  769

Query  1981  RLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
             RLVF       ++EVTF +      S  FGS+ W+DGTH V SP+A  W   S + +
Sbjct  770   RLVFRADNQKQTFEVTFTTSVDYIKSSRFGSVVWTDGTHRVRSPVAFKWRTGSAASM  826



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/712 (55%), Positives = 508/712 (71%), Gaps = 13/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLY Y H   GFSA+LT +Q  +L  VPG++SV+PD++ +L TT +P FLGL S SS 
Sbjct  67    AKLLYNYNHAIRGFSAQLTTTQVEKLRRVPGILSVIPDQIRQLHTTHTPAFLGL-SESSG  125

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L  +S YG  +IIGVLD+GIWPE  S SD GL+ +P +W+  CE GP FPA+SCN+K+IG
Sbjct  126   LWENSGYGDGVIIGVLDTGIWPEHRSLSDSGLSDVPANWKGICETGPDFPASSCNKKLIG  185

Query  388   ARAYYRGYEAVTGRPIVDEPKSAI--DMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARA+ +GY +  GR I +  +SA   D  GHGTH ++ AAGS+V NA++  +A GEARG+
Sbjct  186   ARAFNKGYISHKGRHIDESKESASPRDTEGHGTHTSTTAAGSSVHNASLFEYASGEARGM  245

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIA YK+CW   C ++DIL+ MDQA+ DGVHV+SLS+G     G A  Y+ D IAI
Sbjct  246   ASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVG---ATGHAPQYDHDSIAI  302

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAF A Q G++VSC AGNSGPDPYTA+NIAPWILTVGASTIDREFPA V LGNG  F G 
Sbjct  303   GAFSASQHGIVVSCSAGNSGPDPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFGGV  362

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +VY     +RYC  G +  SKV+GKIV C +  N   V++G AVK 
Sbjct  363   SLYSGDPLVDFKLPLVYAGDVGNRYCYMGSISPSKVQGKIVVCDRGGNAR-VEKGAAVKL  421

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG+GMI++N    G EL+A++ ++P   V     D I +YVK ++  TA I FRGT+ G
Sbjct  422   AGGLGMILANTADSGEELIADSHLLPATEVGEIAADKIREYVKLSQYPTATINFRGTIIG  481

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SPSAP+VAAFSSRGPN+LTPEILKPDVIAPGVNILA WTG + P++   D RR EFNI+
Sbjct  482   TSPSAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLEIDPRRVEFNII  541

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+ A+LRK YP WSPAAIKS+L+TT + LDNSG++ + DL +   STP 
Sbjct  542   SGTSMSCPHVSGIVALLRKAYPDWSPAAIKSSLVTTAHNLDNSGKN-IKDLASSEESTPF  600

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HG+GHVDP +A +PGLVYD   +DY+ FLC IGYDS++IA+F+R  P  D  +   G+P
Sbjct  601   IHGAGHVDPNSALNPGLVYDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKEGSP  660

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF++N   +TY+RTVKNVG   +  Y+V V  P+NV + VSP++LVF   
Sbjct  661   GNLNYPSFSVVFQSNSDEVTYRRTVKNVGNSLDAVYEVEVNAPANVDIKVSPSKLVFNAE  720

Query  2002  IDTLSYEVTFQSLRQ-----SADSFGSLRWSDGTHLVTSPIAVSWEGRSVSE  2142
               T+SY++TF S+       ++ +FGS+ WS+G H V SPIAV W   S  E
Sbjct  721   NKTVSYDITFSSVSSGWSSINSATFGSIEWSNGIHRVRSPIAVKWRQGSSRE  772



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=773

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/705 (57%), Positives = 497/705 (70%), Gaps = 15/705 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLYTY    HGFSA L+ SQA  L + P V+SV+PD   +L TTR+  FLGL   + N
Sbjct  68    TKLLYTYSRAVHGFSATLSASQAHALQSHPAVLSVVPDMPRQLHTTRTYDFLGL---ADN  124

Query  208   LG--PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
              G  P+SDY  D+IIGVLD+GIWPER SFSD GL P+P +W+ KC +   FPA+SCNRKI
Sbjct  125   FGIWPNSDYADDVIIGVLDTGIWPERPSFSDSGLGPVPKTWKGKCVITGDFPASSCNRKI  184

Query  382   IGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             IGARAY+ GYE+  G+P+   +E +S  D  GHGTH AS A GS V+NA+   +A GEAR
Sbjct  185   IGARAYFNGYESHLGKPMDESNESRSPRDTEGHGTHTASTAGGSRVSNASFYEYASGEAR  244

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A+ ARIA YK+CW   C ++DIL+ MDQA+ADGVH++SLS+G     G A PY+ D I
Sbjct  245   GMASKARIAAYKICWTFGCFDSDILAAMDQAIADGVHIISLSVG---ASGGAPPYDRDSI  301

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             AIGAFGA Q GV+VS  AGNSGP  +TA NIAPWILTVGAST+DREFPA V LG+GR F 
Sbjct  302   AIGAFGAAQHGVLVSASAGNSGPGKFTATNIAPWILTVGASTLDREFPADVVLGDGRVFN  361

Query  916   GTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             G SLY G      ++ +VYG    SR C  G L  SKV+GKIV C +  N  +  +G AV
Sbjct  362   GVSLYSGEGLMDYKLPLVYGGDCGSRLCYSGALQPSKVQGKIVVCDRGGNARVA-KGSAV  420

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GG+GMI++N    G EL+A++ +IP  +V     D I  Y+K   +ATA I FRGTV
Sbjct  421   KLAGGIGMIMANTEESGEELLADSHLIPATMVGQMAADQIRSYIKTGHNATATIKFRGTV  480

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              G SP +P+VA+FSSRGPN LTPEILKPDVIAPGVNILA WTGA +P++   D RR EFN
Sbjct  481   IGTSPPSPKVASFSSRGPNSLTPEILKPDVIAPGVNILAGWTGASSPTDLDIDPRRVEFN  540

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSM+CPHVSG+AA+LRK YP WSPAAIKSAL+TT YTLDNSG + + DL  G  ST
Sbjct  541   IISGTSMSCPHVSGIAALLRKAYPKWSPAAIKSALVTTAYTLDNSG-NKIKDLANGGEST  599

Query  1636  PHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNL  1812
             P  HG+GHVDP  A +PGLVYD  VNDYV F+C+IGY  ++IA+F+R     D C   +L
Sbjct  600   PFVHGAGHVDPNRALNPGLVYDIDVNDYVAFMCSIGYGPRQIAVFMRELAGDDICARNSL  659

Query  1813  GNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVF  1992
              +PG LNYPSFAVVFK   + + YKR V NVG V +  Y+V V  P+ V ++V P++LVF
Sbjct  660   ASPGDLNYPSFAVVFKPGRELVKYKRVVTNVGSVVDAVYEVNVDAPAGVEISVEPSKLVF  719

Query  1993  TDRIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++   T SYEVTF       + + +GS+ WSDG H V SP+AV W
Sbjct  720   SEVNQTQSYEVTFAKGIGYVNGERYGSIEWSDGRHHVRSPVAVRW  764



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/714 (55%), Positives = 499/714 (70%), Gaps = 17/714 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    HGFSARL+PSQ S L   P VISV+PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAVHGFSARLSPSQTSALRRHPSVISVIPDQAREIHTTHTPAFLGF-SDNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL+P+P++W+  CE+GP FPA+SCNRK+IGAR
Sbjct  128   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGAR  187

Query  394   AYYRGY-EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIATN  570
             A+Y+GY     G    +E KS  D  GHGTH AS AAGS V NA++  +A+G ARG+A+ 
Sbjct  188   AFYKGYLTHRNGSKHAEESKSPRDTAGHGTHTASTAAGSVVVNASLYQYAQGVARGMASK  247

Query  571   ARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGAF  750
             ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     GFA  Y++D IAIGAF
Sbjct  248   ARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ANGFAPEYHKDSIAIGAF  304

Query  751   GAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSLY  930
             GA++ G++VSC AGNSGP P TA NIAPWILTVGAST+DREF A    G+G+ FTGTSLY
Sbjct  305   GAMRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTVDREFTANAITGDGKVFTGTSLY  364

Query  931   FGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQSG  1107
              G +P P+ Q+S+VY     SR C PG+L++S V GKIV C +  N   V++G AVK +G
Sbjct  365   AG-EPLPDSQISLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIAG  422

Query  1108  GVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGNS  1287
             G GMI++N    G EL A++ ++P  +V A  GD I DY+KN+ S TA I F GT+ G S
Sbjct  423   GAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSDSPTATISFLGTLIGPS  482

Query  1288  PSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMSG  1467
             P +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   D RR +FNI+SG
Sbjct  483   PPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFNIISG  542

Query  1468  TSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAH  1647
             TSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y  +NSG   + DL TG  S    H
Sbjct  543   TSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIH  601

Query  1648  GSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPG  1824
             G+GHVDP  A +PGLVYD    DYV FLC +GY+   I +FL++  L D C    L   G
Sbjct  602   GAGHVDPNKALNPGLVYDVDAKDYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAG  661

Query  1825  ALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDRI  2004
              LNYPSF+VVF +N   + Y+R VKNVG   +  Y+V V+ P+NV + VSP++L F+   
Sbjct  662   DLNYPSFSVVFGSNDGVVKYRRVVKNVGSNVDAVYEVGVKAPANVEIDVSPSKLAFSKET  721

Query  2005  DTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
               + YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV   
Sbjct  722   REMEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWSQGSVQSF  775



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/722 (55%), Positives = 499/722 (69%), Gaps = 19/722 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L  H R +E+LYTY+    GFSARL+ +QA  L  VP V+SV+PD +  L TT +P+FLG
Sbjct  58    LPPHHRPAEILYTYDRAVRGFSARLSAAQADALRRVPAVVSVIPDAVRYLHTTHTPKFLG  117

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L + S  L P+SDY  D+I+GVLD+GIWPERSSFSD GL+ +P+ W+  C     FPAT 
Sbjct  118   L-ADSFGLWPNSDYADDVIVGVLDTGIWPERSSFSDEGLSAVPSHWKGSCVDAADFPATL  176

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CN+K+IG +A+Y GYEA  G  + +  E KS  D  GHGTH AS AAGS VANA++ G+A
Sbjct  177   CNKKLIGTKAFYLGYEASRGTTMEESNESKSPRDTEGHGTHTASTAAGSIVANASLLGYA  236

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              GEARG+A  ARIAVYK+CW   C ++DIL+  +QAV DGV V+SLS+G     G A  Y
Sbjct  237   EGEARGMAIKARIAVYKICWTFGCYDSDILAAFEQAVIDGVDVISLSVG---ANGHAPQY  293

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             + D IAIGAF A + G++VSC AGNSGPDPYTA+NIAPWILTVGAST+DR+FPAVVTLG+
Sbjct  294   DYDSIAIGAFAAAEHGIVVSCSAGNSGPDPYTAVNIAPWILTVGASTLDRDFPAVVTLGD  353

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
               T+TG SLY G       + +VY     +RYC  G LD+SKV GKIV C +  N    +
Sbjct  354   NTTYTGVSLYAGEPLGDKLLPLVYAADCGNRYCYSGSLDSSKVAGKIVICDRGGNAR-AE  412

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AV Q+GG GMI++N+     EL+A+A  IP  +V    G+ I  YVK+  + TA I 
Sbjct  413   KGNAVHQAGGAGMILANLADSAEELLADAHFIPATMVGEIAGNKIRAYVKSDPNPTATIT  472

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F+GTV   SP APRVA+FSSRGPN+ T EILKPDVIAPGVNILA WTG + P++   D+R
Sbjct  473   FKGTVISTSPPAPRVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGYVGPTDLESDSR  532

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R  FNI+SGTSM+CPHVSGLAA+LRK +P WSPAAIKSALMT+ Y LDN+G + + DL T
Sbjct  533   RVAFNIISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALMTSAYNLDNTG-ANITDLAT  591

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  STP  HG+GHVDP  A DPGLVYD    DY+ FLCTIGYDS++I++F +++  VDC 
Sbjct  592   GAESTPFVHGAGHVDPNRAVDPGLVYDLDTTDYIAFLCTIGYDSRRISVFTKDASSVDCD  651

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
                   PG LNYPSF+VVF      + Y RTV NVG   +  Y+V V  P  V V+VSP+
Sbjct  652   KLGFKTPGNLNYPSFSVVFYGEESVVKYNRTVTNVGSEVDAVYEVRVGAPPGVEVSVSPS  711

Query  1981  RLVFTDRIDTLSYEVTFQS----------LRQSADSFGSLRWSD-GTHLVTSPIAVSWEG  2127
             +LVF++  D LSYEVTF+S          +  +  SFGS+ WSD G+HLV SPIA  W  
Sbjct  712   KLVFSETEDKLSYEVTFKSSSSASSGLEIVGSAKSSFGSIEWSDGGSHLVRSPIAAVWRT  771

Query  2128  RS  2133
              S
Sbjct  772   SS  773



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/714 (55%), Positives = 498/714 (70%), Gaps = 17/714 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    +GFSARL+PSQ S L   P VIS++PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAVNGFSARLSPSQTSALRRHPSVISLIPDQAREIHTTHTPAFLGF-SDNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL+P+P++W+  CE+GP FPA+SCNRK+IGAR
Sbjct  128   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGAR  187

Query  394   AYYRGY-EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIATN  570
             A+Y+GY     G    +E KS  D  GHGTH AS AAGS V NA++  +ARG ARG+A+ 
Sbjct  188   AFYKGYLTHRNGSKHAEESKSPRDTAGHGTHTASTAAGSVVVNASLYQYARGVARGVASK  247

Query  571   ARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGAF  750
             ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     GFA  Y++D IAIGAF
Sbjct  248   ARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ANGFAPEYHKDSIAIGAF  304

Query  751   GAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSLY  930
             GA++ G++VSC AGNSGP P TA NIAPWILTVGAST+DREF A    G+G+ FTGTSLY
Sbjct  305   GAMRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTVDREFTANAITGDGKVFTGTSLY  364

Query  931   FGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQSG  1107
              G +P P+ Q+ +VY     SR C PG+L++S V GKIV C +  N   V++G AVK  G
Sbjct  365   AG-EPLPDSQIPLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIGG  422

Query  1108  GVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGNS  1287
             G GMI++N    G EL A++ ++P  +V A  GD I DY+KN+ S TA I F GT+ G S
Sbjct  423   GAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSNSPTATISFLGTLIGPS  482

Query  1288  PSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMSG  1467
             P +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   D RR +FNI+SG
Sbjct  483   PPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFNIISG  542

Query  1468  TSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAH  1647
             TSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y  +NSG   + DL TG  S    H
Sbjct  543   TSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIH  601

Query  1648  GSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPG  1824
             G+GHVDP  A +PGLVYD    +YV FLC +GY+   I +FL++  L D C    L   G
Sbjct  602   GAGHVDPNKALNPGLVYDLDAKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAG  661

Query  1825  ALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDRI  2004
              LNYPSF+VVF +++  + Y+R VKNVG   +  YQV V+ P+NV + VSP++L F+   
Sbjct  662   DLNYPSFSVVFGSSVDVVKYRRVVKNVGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKET  721

Query  2005  DTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
               + YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV   
Sbjct  722   REMEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWSQGSVQSF  775



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/715 (55%), Positives = 496/715 (69%), Gaps = 17/715 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    HGFSARL+P Q + L   P VISV+PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAVHGFSARLSPIQTAALRRHPSVISVIPDQAREIHTTHTPAFLGF-SQNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL PIP++W+ +CE+GP FPA+SCNRK+IGAR
Sbjct  128   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLGPIPSTWKGECEIGPDFPASSCNRKLIGAR  187

Query  394   AYYRGYEAV---TGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             A+YRGY      T +    E +S  D  GHGTH AS AAGS VANA++  +ARG A G+A
Sbjct  188   AFYRGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGTATGMA  247

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             + ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     G A  Y+ D IAIG
Sbjct  248   SKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ASGSAPEYHTDSIAIG  304

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA + G++VSC AGNSGP+P TA NIAPWILTVGAST+DREF A    G+G+ FTGTS
Sbjct  305   AFGATRHGIVVSCSAGNSGPNPETATNIAPWILTVGASTVDREFAANAITGDGKVFTGTS  364

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY G     +Q+S+VY     SR C PG+L++S V GKIV C +  N   V++G AVK +
Sbjct  365   LYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKLA  423

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA+I F GT+ G 
Sbjct  424   GGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTLIGP  483

Query  1285  SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMS  1464
             SP +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   D RR +FNI+S
Sbjct  484   SPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIIS  543

Query  1465  GTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHA  1644
             GTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y ++NSG   + DL TG  S    
Sbjct  544   GTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFI  602

Query  1645  HGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNP  1821
             HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L D C    L   
Sbjct  603   HGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPTLYDACETSKLRTA  662

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF +  + + YKR VKNVG   +  Y+V V++P+NV + VSP++L F+  
Sbjct  663   GDLNYPSFSVVFASTGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKE  722

Query  2002  IDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                L YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV   
Sbjct  723   KSVLEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  777



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/714 (55%), Positives = 498/714 (70%), Gaps = 17/714 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    +GFSARL+PSQ S L   P VIS++PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAVNGFSARLSPSQTSALRRHPSVISLIPDQAREIHTTHTPAFLGF-SDNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL+P+P++W+  CE+GP FPA+SCNRK+IGAR
Sbjct  128   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGAR  187

Query  394   AYYRGY-EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIATN  570
             A+Y+GY     G    +E KS  D  GHGTH AS AAGS V NA++  +ARG ARG+A+ 
Sbjct  188   AFYKGYLTHRNGSKHAEESKSPRDTAGHGTHTASTAAGSVVVNASLYQYARGVARGMASK  247

Query  571   ARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGAF  750
             ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     GFA  Y++D IAIGAF
Sbjct  248   ARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ANGFAPEYHKDSIAIGAF  304

Query  751   GAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSLY  930
             GA++ G++VSC AGNSGP P TA NIAPWILTVGAST+DREF A    G+G+ FTGTSLY
Sbjct  305   GAMRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTVDREFTANAITGDGKVFTGTSLY  364

Query  931   FGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQSG  1107
              G +P P+ Q+ +VY     SR C PG+L++S V GKIV C +  N   V++G AVK  G
Sbjct  365   AG-EPLPDSQIPLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIGG  422

Query  1108  GVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGNS  1287
             G GMI++N    G EL A++ ++P  +V A  GD I DY+KN+ S TA I F GT+ G S
Sbjct  423   GAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSNSPTATISFLGTLIGPS  482

Query  1288  PSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMSG  1467
             P +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   D RR +FNI+SG
Sbjct  483   PPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFNIISG  542

Query  1468  TSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAH  1647
             TSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y  +NSG   + DL TG  S    H
Sbjct  543   TSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIH  601

Query  1648  GSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPG  1824
             G+GHVDP  A +PGL+YD    +YV FLC +GY+   I +FL++  L D C    L   G
Sbjct  602   GAGHVDPNKALNPGLIYDLDAKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAG  661

Query  1825  ALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDRI  2004
              LNYPSF+VVF +++  + Y+R VKNVG   +  YQV V+ P+NV + VSP++L F+   
Sbjct  662   DLNYPSFSVVFGSSVDVVKYRRVVKNVGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKET  721

Query  2005  DTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
               + YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV   
Sbjct  722   REMEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWSQGSVQSF  775



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/712 (56%), Positives = 505/712 (71%), Gaps = 12/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLYTY+   HGFSA LT SQA++L + P V+SV PD+  +L TT +P FLGL + S  
Sbjct  105   TKLLYTYDRSVHGFSATLTSSQATQLLSHPSVLSVTPDQPRQLHTTHTPNFLGL-ADSFG  163

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D++IGVLD+GIWPER SFSD G+ PIP  W+  C     FP+++CNRKIIG
Sbjct  164   LWPNSDYADDVVIGVLDTGIWPERPSFSDSGIGPIPTRWKGTCVTTADFPSSACNRKIIG  223

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARAY+ GYE+  GR + +  E KS  D  GHGTH AS AAG+ VANA+   +A+GEARG+
Sbjct  224   ARAYFNGYESHIGRLMDETAEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQGEARGM  283

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIAVYK+CW   C ++DIL+ MDQA+ADGV ++SLS+G     G A PY+ D IAI
Sbjct  284   ATKARIAVYKICWSSGCFDSDILAAMDQAIADGVDIISLSVG---AGGRAPPYDRDSIAI  340

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA Q GV+VS  AGNSGP+P+TA NIAPWILTVGASTIDREFPA V LG+ R  +G 
Sbjct  341   GAFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVISGV  400

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +V+G    SRYC  G L  SKV+GKIV C +  N  +  +G AVK 
Sbjct  401   SLYSGEPLVDYKLPLVHGGDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVA-KGGAVKL  459

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG+GMI++N    G EL+A+  +IP   V     + I +Y++ ++  TA IVFRGTV G
Sbjct  460   AGGLGMILANTEESGEELLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRGTVIG  519

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
             +SPS+PRVAAFSSRGPN LTPEILKPDVIAPGVNILA WTGA AP++   D RR EFNI+
Sbjct  520   SSPSSPRVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVEFNII  579

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+AA+LRK YP+WS AAIKSAL+TT YTLDN+G+  + DL TG  STP 
Sbjct  580   SGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALITTAYTLDNAGKK-INDLGTGEESTPF  638

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGN  1818
              HG+GHVDP  A +PGLVYD  VNDYV FLC+IGY  ++IA+F+      D C   +L +
Sbjct  639   VHGAGHVDPNRALNPGLVYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDICTRNSLAS  698

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
             PG LNYPSF+VV  ++   + YKR   NVG   +  Y+VTV  P+ V ++V P +LVF+ 
Sbjct  699   PGDLNYPSFSVVLSSDQGLVKYKRIATNVGADADAVYEVTVNAPAGVEISVEPRKLVFSA  758

Query  1999  RIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2145
                T SYEVTF+      S + +GS+ W+DG HLV SP+AV W   RS++ +
Sbjct  759   ENQTQSYEVTFKRGVGYDSGERYGSIEWTDGRHLVRSPVAVRWSSARSLASM  810



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/715 (55%), Positives = 496/715 (69%), Gaps = 17/715 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    HGFSARL+P Q + L   P VISV+PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAVHGFSARLSPIQTAALRRHPSVISVIPDQAREIHTTHTPAFLGF-SQNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL PIP++W+ +CE+GP FPA+SCNRK+IGAR
Sbjct  128   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLGPIPSTWKGECEIGPDFPASSCNRKLIGAR  187

Query  394   AYYRGYEAV---TGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             A+YRGY      T +    E +S  D  GHGTH AS AAGS VANA++  +ARG A G+A
Sbjct  188   AFYRGYLTQRNGTKKHAAMESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGTATGMA  247

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             + ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     G A  Y+ D IAIG
Sbjct  248   SKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ASGSAPEYHTDSIAIG  304

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA + G++VSC AGNSGP+P TA NIAPWILTVGAST+DREF A    G+G+ FTGTS
Sbjct  305   AFGATRHGIVVSCSAGNSGPNPETATNIAPWILTVGASTVDREFAANAITGDGKVFTGTS  364

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY G     +Q+S+VY     SR C PG+L++S V GKIV C +  N   V++G AVK +
Sbjct  365   LYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKLA  423

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA+I F GT+ G 
Sbjct  424   GGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTLIGP  483

Query  1285  SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMS  1464
             SP +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   D RR +FNI+S
Sbjct  484   SPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIIS  543

Query  1465  GTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHA  1644
             GTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y ++NSG   + DL TG  S    
Sbjct  544   GTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFI  602

Query  1645  HGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNP  1821
             HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L D C    L   
Sbjct  603   HGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPTLYDACETSKLRTA  662

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF +  + + YKR VKNVG   +  Y+V V++P+NV + VSP++L F+  
Sbjct  663   GDLNYPSFSVVFASTGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKE  722

Query  2002  IDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                L YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV   
Sbjct  723   KSVLEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  777



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/713 (56%), Positives = 506/713 (71%), Gaps = 16/713 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLY YE  A+GFSAR+T  QA EL  VPG+ISV+PD++ +L TTR+P FLGL   + N
Sbjct  68    TKLLYNYERAANGFSARITTVQAEELRRVPGIISVIPDQIRQLHTTRTPHFLGL---ADN  124

Query  208   LGPSSD--YGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
             LG  +D  Y  D+IIGVLD+GIWPER SFSD GL+P+P  W+  C+ G    A +CNRKI
Sbjct  125   LGLWADTNYADDVIIGVLDTGIWPERPSFSDEGLSPVPARWKGTCDTGEGVSAFACNRKI  184

Query  382   IGARAYYRGYEA-VTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             IGARAY+ GYE+ + G   +  + KSA D  GHGTH AS AAGS V NA+   +ARGEAR
Sbjct  185   IGARAYFYGYESNLRGSLKVSSDFKSARDTEGHGTHTASTAAGSFVNNASFFQYARGEAR  244

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A+ ARIA YK+CW   C ++DIL+ MDQA++DGV V+SLS+G     G A  Y  D I
Sbjct  245   GMASRARIAAYKICWEFGCYDSDILAAMDQAISDGVDVISLSVG---SSGRAPAYYRDSI  301

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             AIGAFGA+Q GV+VSC AGNSGP PYTA+NIAPWILTVGASTIDREF A V LG+GR F+
Sbjct  302   AIGAFGAMQHGVVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFLADVILGDGRVFS  361

Query  916   GTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             G SLY G     +++ +VYG    SRYC  G LD+SKV GKIV C +  N  +  +G AV
Sbjct  362   GVSLYSGDPLGDSKLQLVYGGDCGSRYCYSGSLDSSKVAGKIVVCDRGGNARVA-KGGAV  420

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GG+GM+++N    G EL+A++ +IP  +V A  G+ + DY+    + TA IVFRGTV
Sbjct  421   KSAGGLGMVLANTEENGEELLADSHLIPGTMVGAIAGNKLRDYIHTDPNPTATIVFRGTV  480

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              G+SP APRVAAFSSRGPN+ T EILKPDVIAPGVNILA W+G  +P+    D RR EFN
Sbjct  481   IGDSPPAPRVAAFSSRGPNYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVEFN  540

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSM+CPHVSG+AA+LRK +P+WSPAAIKSAL+TT+Y+LD+SG+  + DL T   S 
Sbjct  541   IISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALITTSYSLDSSGK-PIKDLSTSEESN  599

Query  1636  PHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG  1815
             P  HG+GH++P  A +PGL+YD    DYV FLC+IGYDS++IA+F++ S         L 
Sbjct  600   PFVHGAGHINPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYFQLCEHKLT  659

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
             NPG LNYPSF+VVF    + + Y RTV NVG    V Y+V V+ P  V ++V PN+L F 
Sbjct  660   NPGNLNYPSFSVVFDEE-EVVKYTRTVTNVGDETEVVYEVKVEAPQGVVISVVPNKLEFN  718

Query  1996  DRIDTLSYEVTFQSLR--QSADSFGSLRWSDGTHLVTSPIAVSWE-GRSVSEL  2145
                 T SYE+TF  +   + + SFGS++W DG H V SPIAVS++ G S++ +
Sbjct  719   KEKTTQSYEITFTKINGFKESASFGSIQWGDGIHSVRSPIAVSFKTGGSIASM  771



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/715 (55%), Positives = 495/715 (69%), Gaps = 17/715 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    HGFSARL+P Q + L   P VISV+PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAVHGFSARLSPIQTAALRRHPSVISVIPDQAREIHTTHTPDFLGF-SQNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +SDYG D+I+GVLD+GIWPE  SFSD GL P+P++W+ +CE+GP FPA+SCNRK+IGAR
Sbjct  128   GNSDYGEDVIVGVLDTGIWPEHPSFSDSGLGPVPSTWKGECEIGPDFPASSCNRKLIGAR  187

Query  394   AYYRGYEAV---TGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AYY+GY      T +    E +S  D  GHGTH AS AAGS VANA++  +A G ARG+A
Sbjct  188   AYYKGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLFQYAPGTARGMA  247

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             + ARIA YK+CW   C ++DIL+ MDQAVADGVHV+SLS+G     G+A  Y+ D IAIG
Sbjct  248   SKARIAAYKICWSSGCYDSDILAAMDQAVADGVHVISLSVG---ASGYAPEYHTDSIAIG  304

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA + G++VSC AGNSGP P TA NIAPWILTVGAST+DREF A    G+G+ FTGTS
Sbjct  305   AFGATRHGIVVSCSAGNSGPGPETATNIAPWILTVGASTVDREFSANAITGDGKVFTGTS  364

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY G     +Q+S+VY     SR C PG+L++S V GKIV C +  N   V++G AVK +
Sbjct  365   LYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVKIA  423

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA+I F GT+ G 
Sbjct  424   GGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTLIGP  483

Query  1285  SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMS  1464
             SP +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   D RR +FNI+S
Sbjct  484   SPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIIS  543

Query  1465  GTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHA  1644
             GTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y ++NSG   + DL TG  S    
Sbjct  544   GTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFI  602

Query  1645  HGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNP  1821
             HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L + C    L   
Sbjct  603   HGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPTLFNACETSKLRTA  662

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF +  + + YKR VKNVG   +  Y+V V++P+NV + VSP++L F+  
Sbjct  663   GDLNYPSFSVVFGSTGEVVKYKRAVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKE  722

Query  2002  IDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
                L YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV   
Sbjct  723   KSELEYEVTFKSVVLGGGVGSVPGHEFGSIEWADGEHVVKSPVAVQWGQGSVQSF  777



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/712 (56%), Positives = 497/712 (70%), Gaps = 12/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             + LLY Y   A GF+ARLTP+QA+ +  +P V++VLPDRL    TT SP FL L S S+ 
Sbjct  68    ARLLYAYSRAASGFAARLTPAQAAAIRRLPSVLAVLPDRLCHPHTTHSPVFLRL-STSTG  126

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P S + +D++IGVLD+GI+P R+SF+D  L P P++WR  CE G  F A+SCNRK+IG
Sbjct  127   LWPFSSFASDVVIGVLDTGIYPSRASFADDSLPPPPSTWRGYCESGNGFNASSCNRKLIG  186

Query  388   ARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR +Y+GYEA  G PI    E KS +D  GHGTH AS AAG+ V++A    +ARGEARG+
Sbjct  187   ARFFYQGYEAAMGHPIDETKESKSPLDTEGHGTHTASTAAGAVVSDAGFYQYARGEARGM  246

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIA YK+CW G C ++DIL+ MD A+ADGV V+SLS+G     G+A  +  D IAI
Sbjct  247   ATKARIAAYKICWAGGCYDSDILAAMDAAIADGVDVISLSVG---AGGYAPSFYRDSIAI  303

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP   TA+NIAPWILTVGASTIDREFPA V LG+G T+ G 
Sbjct  304   GAFGAARHGVVVSCSAGNSGPGQRTAVNIAPWILTVGASTIDREFPADVVLGDGNTYGGA  363

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G   +   + +VY   + SR C+PG LDA+ V GKIV C++  N   V++G AVK 
Sbjct  364   SLYAGDPINSTYLPLVYAGDSGSRLCIPGFLDAAVVAGKIVLCERGTNAR-VEKGSAVKL  422

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG GMI++N    G ELVA++ +IP  +V+   G  I DY+K+  S TA IVFRGT  G
Sbjct  423   AGGAGMILANDAASGGELVADSHLIPATMVSHTSGSKITDYIKSQPSPTATIVFRGTAIG  482

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP+AP+VAAFSSRGPNF   EILKPDVIAPGVNILA WTG   P++   D RR EFNI+
Sbjct  483   ASPAAPKVAAFSSRGPNFRVAEILKPDVIAPGVNILAGWTGMNGPTDLDIDPRRVEFNII  542

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSMACPHVSG+AA+LR+ YP WSPAAIKSALMTT Y  D+SG  T+ DL T   STP 
Sbjct  543   SGTSMACPHVSGIAALLRRAYPDWSPAAIKSALMTTAYNSDDSGE-TIKDLATEAESTPF  601

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
               G+GHVDP  A DPGLVYD+ V+DY+ FLC + Y   +IA+F RN   V+C    L +P
Sbjct  602   VRGAGHVDPNRALDPGLVYDSNVDDYLAFLCAMEYSPAQIAVFTRNEISVNCSTAALDSP  661

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYP+F+V+F +N   +TYKR V+NVG     AY+  V +P  V VTV+P+ LVF   
Sbjct  662   GDLNYPAFSVIFSSNSDVVTYKRVVRNVGTSAAAAYEARVSSPPGVDVTVTPSTLVFDAV  721

Query  2002  IDTLSYEVTFQSLRQSA----DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
               +LSYE+TF SL   A     ++GS+ WSDG H V SPIAV+W+   VS +
Sbjct  722   NVSLSYEITFTSLASQAVAGSYAYGSISWSDGDHDVRSPIAVTWDLSLVSSI  773



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/712 (55%), Positives = 504/712 (71%), Gaps = 12/712 (2%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLYTY+   HGFSA LT SQA++L + P V+SV PD+  +L TT +P FLGL + S  
Sbjct  67    TKLLYTYDRSVHGFSATLTSSQATQLLSHPSVLSVTPDQPRQLHTTHTPNFLGL-ADSFG  125

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D++IGVLD+GIWPER SFSD G+ P+P  W+  C     FP+++CNRKIIG
Sbjct  126   LWPNSDYADDVVIGVLDTGIWPERPSFSDSGIGPVPTRWKGTCVTTADFPSSACNRKIIG  185

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             ARAY+ GYE+  GR + +  E KS  D  GHGTH AS AAG+ VANA+   +A+G+ARG+
Sbjct  186   ARAYFNGYESHIGRLMDETTEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQGDARGM  245

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIAVYK+CW   C ++DIL+ MDQA+ADGV ++SLS+G     G A PY+ D IAI
Sbjct  246   ATKARIAVYKICWSFGCFDSDILAAMDQAIADGVDIISLSVG---ASGNAPPYDRDSIAI  302

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA Q GV+VS  AGNSGP+P+TA NIAPWILTVGASTIDREFPA V LG+ R  +G 
Sbjct  303   GAFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVISGV  362

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      ++ +VYG    SRYC  G L  SKV+GKIV C +  N  +  +G AVK 
Sbjct  363   SLYSGEPLVDYKLPLVYGGDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVA-KGGAVKL  421

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG+GMI++N    G EL+A+  +IP   V     + I +Y++ ++  TA IVFRGTV G
Sbjct  422   AGGLGMILANTEESGEELLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRGTVIG  481

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
             +SPS+P+VAAFSSRGPN LTPEILKPDVIAPGVNILA WTGA AP++   D RR EFNI+
Sbjct  482   SSPSSPQVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVEFNII  541

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+AA+LRK +P+WS AAIKSAL+TT YTLDN+G+  + DL TG  STP 
Sbjct  542   SGTSMSCPHVSGIAALLRKAFPNWSIAAIKSALITTAYTLDNAGKK-IKDLGTGEESTPF  600

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGN  1818
              HG+GHVDP  A +PGL+YD  VNDYV FLC+IGY  ++IA+F+      D C   +L +
Sbjct  601   VHGAGHVDPNRALNPGLIYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDMCTRNSLAS  660

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
             PG LNYPSF+VV  ++   I YKR   NVG   +  Y+VTV  P+ V ++V P +LVF+ 
Sbjct  661   PGDLNYPSFSVVLSSDQGLIKYKRIATNVGGDADAVYEVTVNAPAGVEISVEPRKLVFSA  720

Query  1999  RIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2145
                T SYEVTF+        + +GS+ W+DG HLV SP+AV W   RS++ +
Sbjct  721   ENQTQSYEVTFKRGVGYDGGERYGSIEWTDGRHLVRSPVAVRWSSARSLASM  772



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/719 (55%), Positives = 505/719 (70%), Gaps = 15/719 (2%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             LS     ++LLY YE  A+GFSAR+T +QA EL  VPG+ISV+PDR+ +L TTR+P FLG
Sbjct  61    LSPSPHPTKLLYNYERAANGFSARITTAQAEELRRVPGIISVIPDRIRQLHTTRTPHFLG  120

Query  187   LISGSSNLGPSSD--YGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             L   + NLG  +D  Y  D+IIGVLD+GIWPER SFSD GL P+P  W+  C+ G    A
Sbjct  121   L---ADNLGLWADTNYADDVIIGVLDTGIWPERPSFSDEGLAPVPARWKGTCDTGEGSSA  177

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
              +CNRKIIGARA++ GYE+     +    + KSA D  GHGTH AS AAGS V NA+   
Sbjct  178   LACNRKIIGARAFFXGYESNLRGSLKGSSDFKSARDTDGHGTHTASTAAGSFVKNASFFQ  237

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +ARGEARG+A+ ARIA YK+CW   C ++DIL+ MDQA++DGV V+SLS+G     G A 
Sbjct  238   YARGEARGMASRARIAAYKICWEFGCYDSDILAAMDQAISDGVDVISLSVG---SSGRAP  294

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D IAIGAFGA+Q G++VSC AGNSGP PYTA+NIAPWI+TVGASTIDREF A V L
Sbjct  295   AYYRDSIAIGAFGAMQHGIVVSCSAGNSGPGPYTAVNIAPWIVTVGASTIDREFLADVIL  354

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G+ R F+G SLY G     +++ +VYG    SRYC  G LD+SKV G+IV C +  N  +
Sbjct  355   GDNRVFSGVSLYSGDPLGDSKLPLVYGGDCGSRYCYSGSLDSSKVAGRIVVCDRGGNARV  414

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
               +G AVK +GG+GM+++N    G EL+A++ +IP  +V    G+ + DY+    + TA 
Sbjct  415   A-KGGAVKSAGGLGMVLANTEENGEELLADSHLIPGTMVGEIAGNKLRDYIHTDPNPTAT  473

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             IVFRGTV G+SP AP+VA+FSSRGPN+ T EILKPDVIAPGVNILA W+G  +P+    D
Sbjct  474   IVFRGTVIGDSPPAPKVASFSSRGPNYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNID  533

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR EFNI+SGTSM+CPHVSG+AA+LRK +P+WSPAAIKSAL+TT+Y+LD+SG S + DL
Sbjct  534   PRRVEFNIISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALITTSYSLDSSG-SPIKDL  592

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              T   S P  HG+GH+DP  A +PGL+YD    DYV FLC+IGYDS++IA+F++ S    
Sbjct  593   ATSEESNPFVHGAGHIDPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYSQ  652

Query  1795  CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVS  1974
                  L NPG LNYPSF+VVF +  + + Y RTV NVG    V Y V V+ P  V ++V 
Sbjct  653   LCEHKLSNPGNLNYPSFSVVFDDG-EVVKYTRTVTNVGDETEVVYGVKVEAPQGVEISVV  711

Query  1975  PNRLVFTDRIDTLSYEVTFQSLR--QSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
             PN+L F     TLSYE+TF  +   + + SFGS++WSDG H V SPIAVS++  S++ +
Sbjct  712   PNKLEFNKEKTTLSYEITFTKINGFKESASFGSIQWSDGIHNVRSPIAVSFKTGSIASM  770



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/718 (55%), Positives = 501/718 (70%), Gaps = 15/718 (2%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
             S  + LLYTY   A GFS R+TPSQ S L   P V++V PD++    TT +P+FLGL   
Sbjct  67    SHPATLLYTYSAAAAGFSVRITPSQLSHLRRHPAVLAVEPDQVRHPHTTHTPRFLGLAE-  125

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             S  L P+SDY  D+I+GVLD+GIWPE  SFSD  L+P+P++W+  CEV   FPA+SCNRK
Sbjct  126   SFGLWPNSDYADDVIVGVLDTGIWPELRSFSDDNLSPVPSTWKGSCEVSRDFPASSCNRK  185

Query  379   IIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             IIGA+A+Y+GYEA    PI +  E KS  D  GHGTH +S AAG  V+NA++  +A+GEA
Sbjct  186   IIGAKAFYKGYEAYLDGPIDESAESKSPRDTEGHGTHTSSTAAGGVVSNASLFHYAQGEA  245

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             RG+AT ARIA YK+CW   C ++DIL+ MD+AVADGVHV+SLS+G     G+A  Y  D 
Sbjct  246   RGMATKARIAAYKICWKYGCFDSDILAAMDEAVADGVHVISLSVG---SSGYAPQYFRDS  302

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IA+GAFGA +  V+VSC AGNSGP P+TA+NIAPWILTVGASTIDREFPA V LG+GR F
Sbjct  303   IALGAFGAARHNVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVILGDGRVF  362

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              G SLY+G      Q+ +VY +   +RYC  G L+ASKV+GKIV C +  N   V++G A
Sbjct  363   GGVSLYYGESLPDFQLRLVYAKDCGNRYCYLGSLEASKVQGKIVVCDRGGNAR-VEKGSA  421

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GG+GMI++N    G EL+A+A ++   +V    GD I  Y++ ++  TA I F+GT
Sbjct  422   VKLAGGLGMIMANTAESGEELLADAHLLAATMVGQIAGDEIKKYIRLSQYPTATIEFKGT  481

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G SPSAP+VA+FSSRGPN LT EILKPDVIAPGVNILA WTG + P++   D RR EF
Sbjct  482   VIGGSPSAPQVASFSSRGPNHLTSEILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEF  541

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPH SG+AA+LRK YP WSPAAIKSALMTT Y +DNSG   + DL TG  S
Sbjct  542   NIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSG-GNIKDLGTGKES  600

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-C----  1797
              P  HG+GHVDP  A +PGLVYD+ +NDY+ FLC+IGYD+ +IA+F R     + C    
Sbjct  601   NPFTHGAGHVDPNRALNPGLVYDSDINDYLAFLCSIGYDANQIAVFTREPAAANPCEGKV  660

Query  1798  -RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVS  1974
              R   L +PG LNYPSF+V        + YKR V NVG V +  Y V V  P  V VTV+
Sbjct  661   GRTGRLASPGDLNYPSFSVELGRGSDLVKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVA  720

Query  1975  PNRLVFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
             PN LVF+    T ++EV F  +   ++DSFGS+ W+DG+H+V SPIAV W G S S L
Sbjct  721   PNTLVFSGENKTQAFEVAFSRVTPATSDSFGSIEWTDGSHVVRSPIAVRWSGDSSSSL  778



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/713 (56%), Positives = 508/713 (71%), Gaps = 14/713 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++LYTY+   +GFSA LT  QA EL    GV+SV+PD++ +L TTR+P FLGL +GS  L
Sbjct  67    KILYTYDRAINGFSAHLTAGQADELRQYLGVLSVIPDQIRQLHTTRTPHFLGLTNGS-GL  125

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +  YG D+IIGVLD+GIWPE  SFSD GL P+P +W+  CE+   FPA+SCNRK+IGA
Sbjct  126   WLNGAYGEDVIIGVLDTGIWPEHPSFSDSGLTPVPANWKGICEISADFPASSCNRKLIGA  185

Query  391   RAYYRGYEAVTGRPIVDEPKSAI--DMTGHGThvasiaagsavananvnghaRGEARGIA  564
             RA+Y+G+ +  G+PI +   SA   D  GHGTH AS A GS V NA+    ARGEARG+A
Sbjct  186   RAFYKGFVSYHGKPIDESRDSASPRDTEGHGTHTASTAGGSFVQNASFYQFARGEARGMA  245

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             + ARIA YK+CW   C ++DIL+ MDQA+ADGVHV+SLS+G     G+A  Y+ D IA+G
Sbjct  246   SKARIAAYKICWSIGCFDSDILAAMDQAIADGVHVISLSVG---ATGYAPQYDHDSIAVG  302

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA Q G++VSC AGNSGPDP+TA+NIAPWILTVGASTIDREFPA V LGNG TF G S
Sbjct  303   AFGATQNGIVVSCSAGNSGPDPFTAVNIAPWILTVGASTIDREFPADVVLGNGMTFGGVS  362

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY G      ++ ++Y     +RYCL G +  SKV+GKIV C +  N   V++G AVK +
Sbjct  363   LYSGEPLVDYKLPLIYAGDCGNRYCLIGGISPSKVQGKIVVCDRGVNAR-VEKGAAVKLA  421

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GG+GMI++N    G EL+A++ ++P  +V    G+ I  Y+K  +  TA IVF GTV GN
Sbjct  422   GGLGMILANTADSGEELIADSHLLPATMVGEIAGNQIKQYIKFGQYPTATIVFEGTVIGN  481

Query  1285  SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMS  1464
             SP AP+VAAFSSRGPN LTPEILKPDVIAPGVNILA WTGA +P++   D RR +FNI+S
Sbjct  482   SPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGAASPTDLDIDPRRVQFNIIS  541

Query  1465  GTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHA  1644
             GTSM+CPHVSG+AA+LRK Y  WSPAAIKSAL+TT Y+LDNSG + L DL +G  ST   
Sbjct  542   GTSMSCPHVSGIAALLRKAYTDWSPAAIKSALITTAYSLDNSGENIL-DLASGKESTAFV  600

Query  1645  HGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPG  1824
             HG+GHVDP +A DPGLVYD    D++ FLCTIGYDS++I++F+     ++  ++ L +PG
Sbjct  601   HGAGHVDPNSALDPGLVYDLETRDFILFLCTIGYDSKRISVFIGEPASLNVCDQKLSSPG  660

Query  1825  ALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDRI  2004
              LNYPSF+VVF ++   +TYKR VKNVG   N  Y+  V  P+NV + +S ++L F+   
Sbjct  661   NLNYPSFSVVFDSSSDVVTYKRVVKNVGSSVNAVYEAKVNAPANVDIKLSTSKLEFSAEN  720

Query  2005  DTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2145
              +LSYE+TF S         + SFGS+ WSDGTH V SPIAV W EG S + +
Sbjct  721   KSLSYEITFSSASLGLSSFGSQSFGSIEWSDGTHRVRSPIAVKWLEGSSKASI  773



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/712 (55%), Positives = 495/712 (70%), Gaps = 13/712 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              LLY Y   A GF+ARL+P+QA+ + ++P V+SVLPDR  +   T SP FL L S SS L
Sbjct  76    RLLYAYSRAAAGFAARLSPAQAAAVRSLPHVLSVLPDRARQPHITHSPTFLRL-SPSSGL  134

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT-SCNRKIIG  387
              PSS + +D ++ VLD+GI+P R+SF D  L+  P+SWR  C+ GP F ++ +CNRK+IG
Sbjct  135   WPSSSFASDAVVAVLDTGIFPSRASFFDSSLSAPPSSWRGSCDSGPGFNSSQACNRKLIG  194

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR +Y+GYEA  G PI +  E KS +D  GHGTH AS AAG+AV +A    +ARGEARG+
Sbjct  195   ARFFYKGYEAAMGHPIDESRESKSPLDTEGHGTHTASTAAGAAVDDAGFYQYARGEARGM  254

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIA YK+CW   C ++DIL+ MD A+ DG  V+SLS+G     GFA  ++ D IAI
Sbjct  255   ATKARIAAYKICWASGCFDSDILAAMDAAIDDGADVISLSVG---ANGFAPSFDRDSIAI  311

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GVIVSC AGNSGP PYTA+NIAPWILTVGASTIDREFPA V LG+G T+ G 
Sbjct  312   GAFGAARHGVIVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYGGV  371

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G   +   + +V      SR C+ G LD++KV GKIV C + AN   V++G AVK 
Sbjct  372   SLYAGELSNSTDLPLVDAGDCGSRLCITGYLDSAKVAGKIVLCDRGANAR-VEKGSAVKL  430

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG GMI++N    G EL+A++ +IP  +V  + GD I  Y+K+  S TA IVF+GTV  
Sbjct  431   AGGAGMILANTAENGEELIADSHLIPATMVGESAGDKIRGYIKSQSSPTATIVFKGTVIS  490

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
             +SP AP+VAAFSSRGPN+  PEILKPDVIAPGVNILAAWTGA +P++   D RR EFNI+
Sbjct  491   SSPPAPKVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGASSPTDLDIDPRRVEFNII  550

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+AA+L K YP WSPAAIKSALMTT   LDNSG   + DL TG  STP 
Sbjct  551   SGTSMSCPHVSGIAALLHKTYPDWSPAAIKSALMTTASNLDNSGE-LIKDLATGKESTPF  609

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
               G+GHVDP  A DPGLVYD+ V DY+ FLC IGY  Q+IALF R+   V+C    L +P
Sbjct  610   VRGAGHVDPNKALDPGLVYDSQVEDYLAFLCAIGYSPQQIALFTRDEIAVNCSALTLASP  669

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYP+F+ VF +    +TY R V+NVG   + AY+  V  P  V VTV+P++LVF   
Sbjct  670   GDLNYPAFSAVFSSASDVVTYSRVVRNVGGPDDAAYEAEVSCPPGVNVTVTPSKLVFDAV  729

Query  2002  IDTLSYEVTFQSLRQSA----DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
               +LSY++T  S+  +A     SFG + WSDG H+V SPIAVSW    VS +
Sbjct  730   EQSLSYKITLASMADAAVAGSRSFGWISWSDGAHIVRSPIAVSWRESLVSSI  781



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/726 (54%), Positives = 500/726 (69%), Gaps = 20/726 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L +  + + LLY+Y    HGFSA+L+P Q + L   P VISV+PD+  E+ TT +P FLG
Sbjct  57    LPSSPKPATLLYSYSRAVHGFSAQLSPIQTAVLLRNPAVISVIPDQAREIHTTHTPAFLG  116

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
               S +S L  +SDYG D+I+GVLD+GIWPE  SFSD GL PIP++W+ +CE+GP FPA S
Sbjct  117   F-SDNSGLWSNSDYGEDVIVGVLDTGIWPEHPSFSDSGLGPIPSTWKGECEIGPDFPAES  175

Query  367   CNRKIIGARAYYRGY----EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvng  534
             CNRK+IGARA+YRGY    +  +      E +S  D  GHGTH AS AAGS VANA++  
Sbjct  176   CNRKLIGARAFYRGYLTSKKNASSTHTAKESRSPRDTEGHGTHTASTAAGSVVANASLFH  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A+G ARG+A+ ARIA YK+CW G C ++DI++ MDQA+ADGVHV+SLS+G     GFA 
Sbjct  236   YAQGIARGMASKARIAAYKICWTGGCYDSDIMAAMDQAIADGVHVISLSVG---SSGFAS  292

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y+ D IAIGAFGA + G++VSC AGNSGP   TA NIAPWILTVGAST+DREF A    
Sbjct  293   EYHMDSIAIGAFGATRHGIVVSCSAGNSGPGSETATNIAPWILTVGASTVDREFSANAIT  352

Query  895   GNGRTFTGTSLYFGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANIT  1071
             G+G+ FTGTSLY G +P PN Q+S+VY     SR C  G+L++S V GKIV C +  N  
Sbjct  353   GDGKVFTGTSLYAG-EPLPNSQISLVYSGDCGSRLCYSGKLNSSLVEGKIVLCDRGGNAR  411

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G AVK +GG GMI++N    G EL A++ ++P  +V A  GD I DY+K+++S TA
Sbjct  412   -VEKGSAVKLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKSSESPTA  470

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              I F GT+ G SP +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   
Sbjct  471   TISFLGTLIGPSPPSPRVAAFSSRGPNHVTPIILKPDVIAPGVNILAGWTGMVGPTDLDI  530

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR +FNI+SGTSM+CPHVSGLAA+LRK +  WSPAAIKSAL+TT Y ++NSG   + D
Sbjct  531   DPRRVQFNIISGTSMSCPHVSGLAALLRKAHLDWSPAAIKSALVTTAYDIENSGE-PIED  589

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
             L TG  S    HG+GHVDP  A +PGLVYD  V +YV FLC +GY    I +FL++  L 
Sbjct  590   LATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVKEYVAFLCAVGYSFPGILVFLQDPSLY  649

Query  1792  D-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
             D C    L   G LNYPSF+V+F + +  + YKR VKNVG   +  YQV V++P NV + 
Sbjct  650   DACETSKLRTAGDLNYPSFSVIFGSTVDVVKYKRVVKNVGSNVDAVYQVGVKSPVNVEID  709

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEG  2127
             VSP++L F+     L YEVTF+S+             FGS++W+DG H+V SP+AV W  
Sbjct  710   VSPSKLEFSKEKSELEYEVTFKSVVLGGGVGSVPGQEFGSIQWTDGEHVVKSPVAVQWRQ  769

Query  2128  RSVSEL  2145
              SV   
Sbjct  770   SSVQSF  775



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/718 (55%), Positives = 499/718 (69%), Gaps = 23/718 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y     GFSARL+P+Q + L     VISV+PD+  E+ TT +P FLG  S +S L 
Sbjct  68    LLYSYSRAVQGFSARLSPTQTAALRRHTSVISVIPDQAREIHTTHTPSFLGF-SDNSGLW  126

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL+P+P++W+  CE+GP FPA+SCNRK+IGAR
Sbjct  127   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGACEIGPDFPASSCNRKLIGAR  186

Query  394   AYYRGYEAVTGR----PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             A+Y+GY  +T R        E +S  D  GHGTH AS AAGS VANA++  +ARG ARG+
Sbjct  187   AFYKGY--LTHRNGTVKAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGVARGM  244

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     G+A  Y+ D IAI
Sbjct  245   ASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ANGYAPEYHMDSIAI  301

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + G++VSC AGNSGP P TA NIAPWILTVGASTIDREF A    GNG+ FTGT
Sbjct  302   GAFGATRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTIDREFSANAITGNGKVFTGT  361

Query  922   SLYFGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
             SLY G +P P+ Q+S+VY     SR C PG+L+AS V GKIV C +  N   V++G AVK
Sbjct  362   SLYAG-EPLPDSQLSLVYSGDCGSRLCYPGKLNASLVEGKIVLCDRGGNAR-VEKGSAVK  419

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GMI++N    G EL A++ ++P  +V A  GD I +Y++ + S TA I F GT+ 
Sbjct  420   IAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIREYIQKSDSPTATISFLGTLI  479

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             G SP +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   D RR +FNI
Sbjct  480   GPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNI  539

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y  +NSG   + DL TG  S  
Sbjct  540   ISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGE-PIEDLATGKSSNS  598

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLG  1815
               HG+GHVDP  A +PGLVYD  V DYV FLC +GY+   I +FL++  L + C    L 
Sbjct  599   FIHGAGHVDPNKALNPGLVYDIDVKDYVAFLCAVGYEFPGILVFLQDPTLYNACETSKLR  658

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
               G LNYPSF+VVF +++  + Y+R VKNVG      Y+V V++P+NV + VSP RL F+
Sbjct  659   TAGDLNYPSFSVVFGSSVDVVKYRRVVKNVGTNVEAVYEVGVKSPANVEIDVSPRRLAFS  718

Query  1996  DRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSW-EGRSVSEL  2145
                  L YEVTF+S+             FGS+ W+DG H+V SP+AV W +G SV   
Sbjct  719   KGESELEYEVTFRSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSSVQSF  776



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/708 (56%), Positives = 498/708 (70%), Gaps = 18/708 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             +LYTY    HGFSA L PSQA+ L + P ++S+  D++  L TT +P FLGL   SS L 
Sbjct  75    ILYTYTSAIHGFSAHLAPSQAAHLQSHPDILSIQTDQIRYLHTTHTPVFLGLTE-SSGLW  133

Query  214   PSSDYGADIIIGVLDSGIWPERSSFS---DRGLNPIPNSWRNKCEVGPQFPATSCNR--K  378
             P+S + +++I+GVLD+GIWPE  SFS   D       NSW+ KCE+   FP++SCN   K
Sbjct  134   PNSHFASEVIVGVLDTGIWPELRSFSTSDDSNSLKSLNSWKGKCEISKDFPSSSCNSNSK  193

Query  379   IIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             IIGA+A+Y+GYEA   RPI +  E KS  D  GHGTH AS AAGS V NA++ G ARGEA
Sbjct  194   IIGAKAFYKGYEAYLQRPIDETVESKSPRDTEGHGTHTASTAAGSVVGNASLFGFARGEA  253

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             +G+AT ARIA YK+CW   C ++DIL+ MD+AVADGVHV+SLS+G     G+A  Y  D 
Sbjct  254   KGMATKARIAAYKICWKLGCFDSDILAAMDEAVADGVHVISLSVG---SNGYAPHYYRDS  310

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IAIGAFGA Q GV+VSC AGNSGP PYT++NIAPWILTVGASTIDREFPA V LG+GR F
Sbjct  311   IAIGAFGAAQHGVVVSCSAGNSGPGPYTSVNIAPWILTVGASTIDREFPADVVLGDGRVF  370

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              G SLY+G     N++ ++YG    SRYC  G LD+SKV+GKIV C +  N   V++G A
Sbjct  371   GGVSLYYGDSLPDNKLPLIYGADCGSRYCYLGSLDSSKVQGKIVVCDRGGNAR-VEKGSA  429

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK++GG+GMI++N    G EL+A+A ++   +V     + I +Y+K++++ TA I F+GT
Sbjct  430   VKKAGGLGMIMANTEENGEELLADAHLVAATMVGENAAEKIREYIKSSENPTATIKFKGT  489

Query  1273  VTGN--SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRT  1446
             V G   SPSAP+VA+FSSRGPN+ T EILKPDVIAPGVNILA WTG + P++   D RR 
Sbjct  490   VIGGEGSPSAPQVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGKVGPTDLEIDPRRV  549

Query  1447  EFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGY  1626
             EFNI+SGTSM+CPHVSG+AA+LRK YP WSPAAIKSALMTT Y +DNSG   + DL TG 
Sbjct  550   EFNIISGTSMSCPHVSGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSG-GKIKDLGTGK  608

Query  1627  PSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRN  1803
              S P  HG+GHVDP  A +PGLVYD  +NDY+ FLC+IGYD+++I +F R     + C N
Sbjct  609   ESNPFVHGAGHVDPNKALNPGLVYDLNINDYLAFLCSIGYDAKEIQIFTREPTSYNVCEN  668

Query  1804  -RNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              R   +PG LNYPSF+VVF  N   + YKR + NVG   +  Y V V  P  V V+VSP+
Sbjct  669   ERKFTSPGDLNYPSFSVVFGANNGLVKYKRVLTNVGDSVDAVYTVKVNAPFGVDVSVSPS  728

Query  1981  RLVFTDRIDTLSYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +LVF+    T ++EVTF  +    + SFGSL WSDG+H+V SPIA  W
Sbjct  729   KLVFSSENKTQAFEVTFTRIGYGGSQSFGSLEWSDGSHIVRSPIAARW  776



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/716 (55%), Positives = 503/716 (70%), Gaps = 26/716 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y   AHGFSARL+P Q + L   P VIS++PD+  E+ TT +P FLG  S ++ L 
Sbjct  71    LLYSYTRAAHGFSARLSPLQTAALRRHPSVISIIPDQAREIHTTHTPDFLGF-SQNTGLW  129

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +SD G D+IIGVLD+GIWPE  SFSD GL P+P++W+ +CE GP FPA+SCNRK+IGAR
Sbjct  130   SNSDDGEDVIIGVLDTGIWPEHPSFSDSGLGPVPSTWKGECETGPDFPASSCNRKLIGAR  189

Query  394   AYYRGYEA--VTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AYYRGY A  V G  +    + +S  D  GHGTH AS AAGS VANA++  +A+G ARG+
Sbjct  190   AYYRGYYAGQVNGTKLHAAKDSRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGM  249

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIA YK+CW   C ++DIL+GMDQAVADGVHV+SLS+G     G+A+ +++D IAI
Sbjct  250   ASKARIAAYKICWSVGCYDSDILAGMDQAVADGVHVISLSVG---SSGYAREFSKDSIAI  306

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP P TA NIAPW+LTVGAST+DREF A V  G+G+ FTGT
Sbjct  307   GAFGATRHGVVVSCSAGNSGPGPETATNIAPWMLTVGASTVDREFSANVVTGDGKVFTGT  366

Query  922   SLYFG--IQPSP-----NQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             SLY G  +  SP     +Q+S+VY     S+ C  G+L++S V+GKIV C +  +   V+
Sbjct  367   SLYAGESLPDSPMSLPESQISLVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGGSAR-VE  425

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVK +GG GMI++N    G EL A++ ++P  +V A  GD I DY+K T S TA I 
Sbjct  426   KGRAVKLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTTDSPTATIN  485

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT+ G +P +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   D R
Sbjct  486   FLGTLIGPTPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDIDPR  545

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R +FNI+SGTSM+CPHVSGLAA+LRK +P WSPAA+KSAL+TT Y ++NSG   L DL T
Sbjct  546   RVQFNIISGTSMSCPHVSGLAALLRKAHPDWSPAAVKSALVTTAYDVENSGEP-LEDLAT  604

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-C  1797
             G PS    HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L D C
Sbjct  605   GKPSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDAC  664

Query  1798  RNRNLGNPGALNYPSFAVVFKNNL-QTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVS  1974
                 L   G LNYPSFAVVF +   + + YKR VKNVG   +  Y+V V++P+NV + VS
Sbjct  665   ETSKLRTAGDLNYPSFAVVFGSTTGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVS  724

Query  1975  PNRLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSW  2121
             P++L F+     L YEVTF+S+          +  FGS+ W+DG H+V SP+AV W
Sbjct  725   PSKLEFSKEKSELEYEVTFKSVVLGGGVGSVPSQEFGSIEWTDGDHVVKSPVAVQW  780



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/715 (55%), Positives = 498/715 (70%), Gaps = 25/715 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y   AHGFSARL+P Q   L   P VIS++PD+  E+ TT +P FLG  S +S L 
Sbjct  69    LLYSYSRAAHGFSARLSPLQTEALRRHPSVISIIPDQAREIHTTHTPDFLGF-SQNSGLW  127

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +SD G D+IIGVLD+GIWPE  SFSD GL P+P++W+ +CE GP FPA+SCNRK+IGAR
Sbjct  128   SNSDDGEDVIIGVLDTGIWPEHPSFSDSGLGPVPSAWKGECETGPDFPASSCNRKLIGAR  187

Query  394   AYYRGYEA--VTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
              YYRGY A  V G  +    + +S  D  GHGTH AS AAGS VANA++  +A+G ARG+
Sbjct  188   GYYRGYFAGQVNGTKLHAAKDSRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGM  247

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIA YK+CW   C ++DIL+GMDQAVADGVHV+SLS+G     G+A+ +++D IAI
Sbjct  248   ASKARIAAYKICWSVGCYDSDILAGMDQAVADGVHVISLSVG---SSGYARDFSKDSIAI  304

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV+VSC AGNSGP P TA NIAPW+LTVGAST+DREF A V  G+G+ FTGT
Sbjct  305   GAFGATRHGVVVSCSAGNSGPGPETATNIAPWMLTVGASTVDREFSANVVTGDGKVFTGT  364

Query  922   SLYFG-------IQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             SLY G       +    +Q+S+VY     S+ C  G+L++S V+GKIV C +  +   V+
Sbjct  365   SLYAGESLPDSQMSLPDSQISLVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGGSAR-VE  423

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVK +GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA I 
Sbjct  424   KGRAVKLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTATIN  483

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT+ G SP +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   D R
Sbjct  484   FLGTLIGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDIDPR  543

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R +FNI+SGTSM+CPHVSGLAA+LR+ +P+WSPAA+KSAL+TT Y ++NSG   L DL T
Sbjct  544   RVQFNIISGTSMSCPHVSGLAALLRRAHPNWSPAAVKSALVTTAYDVENSGE-PLEDLAT  602

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-C  1797
             G PS    HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L D C
Sbjct  603   GKPSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDAC  662

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
                 L   G LNYPSFAVVF +    + YKR VKNVG   +  Y+V V++P+NV + VSP
Sbjct  663   ETSKLRTAGDLNYPSFAVVFGSTGDVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSP  722

Query  1978  NRLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++L F      L YEVTF+S+          +  FGS+ W+DG H+V SP+AV W
Sbjct  723   SKLEFNKEKSELEYEVTFKSVVLGGGVGSVPSQEFGSIEWTDGDHVVKSPVAVQW  777



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/715 (54%), Positives = 500/715 (70%), Gaps = 25/715 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y   AHGFSARL+P Q   L   P VIS++PD+  E+ TT +P FLG  S +S L 
Sbjct  70    LLYSYSRAAHGFSARLSPLQTEALRRHPSVISIIPDQAREIHTTHTPDFLGF-SQNSGLW  128

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +SD G D+IIGVLD+GIWPE  SFSD GL P+P++W+ +CE GP FPA+SCNRK+IGAR
Sbjct  129   SNSDDGEDVIIGVLDTGIWPEHPSFSDSGLGPVPSAWKGECETGPDFPASSCNRKLIGAR  188

Query  394   AYYRGYEA--VTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AYYRGY A  V G  +    + +S  D  GHGTH AS AAGS VANA++  +A+G ARG+
Sbjct  189   AYYRGYFAGQVNGTKLHAAKDSRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGM  248

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIA YK+CW   C ++DIL+GMDQAVADGVHV+SLS+G     G+A+ +++D IAI
Sbjct  249   ASKARIAAYKICWSVGCYDSDILAGMDQAVADGVHVISLSVG---SSGYARDFSKDSIAI  305

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             G+FGA + G++VSC AGNSGP P TA NIAPW+LTVGAST+DREF A V  G+G+ +TGT
Sbjct  306   GSFGATRHGIVVSCSAGNSGPGPETATNIAPWMLTVGASTVDREFSANVITGDGKVYTGT  365

Query  922   SLYFG-------IQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             SLY G       +    +Q+S+VY     S+ C  G+L++S V+GKIV C +  +   V+
Sbjct  366   SLYAGESLPDSQMSLPESQISLVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGGSAR-VE  424

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G AVK +GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA I 
Sbjct  425   KGRAVKLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTATIN  484

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT+ G SP +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   D R
Sbjct  485   FLGTMIGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDIDPR  544

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R +FNI+SGTSM+CPHVSGLAA+LR+ +P WSPAA+KSAL+TT Y ++NSG   L DL T
Sbjct  545   RVQFNIISGTSMSCPHVSGLAALLRRAHPDWSPAAVKSALVTTAYDVENSGE-PLEDLAT  603

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-C  1797
             G PS    HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L D C
Sbjct  604   GKPSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDAC  663

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
                 L   G LNYPSFAVVF ++ + + YKR VKNVG   +  Y+V V++P+NV + VSP
Sbjct  664   ETSKLRTAGDLNYPSFAVVFGSSGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEIDVSP  723

Query  1978  NRLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++L F      L YEVTF+S+          +  FGS+ W+DG H+V SP+AV W
Sbjct  724   SKLEFNKEKSELEYEVTFKSVVLGGGVGSVPSQEFGSIEWTDGDHVVKSPVAVQW  778



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/712 (55%), Positives = 495/712 (70%), Gaps = 13/712 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              LLY Y     GF+ARL+P+QA+ L ++P ++SVLPDR  +  TTRSP FL L S  S L
Sbjct  73    RLLYFYSRATTGFAARLSPAQAAALRSLPYILSVLPDRARQPHTTRSPTFLRL-SPYSGL  131

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT-SCNRKIIG  387
              PSS + +D +I VLD+GI+P R SF D  L+P P+SWR  C+ G  F ++ +CNRK+IG
Sbjct  132   WPSSSFASDAVIAVLDTGIFPSRPSFLDSSLSPPPSSWRGSCDSGSGFNSSQACNRKLIG  191

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR +Y+GYE+  G PI +  E KS +D  GHGTH AS AAG+AV +A    +ARGEARG+
Sbjct  192   ARFFYKGYESAMGHPIDESRESKSPLDTEGHGTHTASTAAGAAVEDAGFYQYARGEARGM  251

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             AT ARIA YK+CW   C ++DIL+ MD A+ DG  V+SLS+G     GFA  +  D IAI
Sbjct  252   ATKARIAAYKICWAAGCFDSDILAAMDAAIDDGADVISLSVG---ATGFAPSFYRDSIAI  308

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAFGA + GV VSC AGNSGP PYTA+NIAPWILTVGASTIDREFPA V LG+G T+ G 
Sbjct  309   GAFGAARHGVTVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYGGV  368

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G   +   + +VY     SR C+ G LD++KV GKIV C + AN   V++G AVK 
Sbjct  369   SLYAGELLNSTDLPLVYAGDCGSRLCISGYLDSAKVAGKIVLCDRGANAR-VEKGSAVKL  427

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GG GMI++N    G EL+A++ +IP  +V  + GD I DY+K+  S TA +VFRGTV  
Sbjct  428   AGGAGMILANTAENGEELIADSHLIPATMVGESAGDKIRDYIKSQSSPTATVVFRGTVIS  487

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
             +SP AP+VAAFSSRGPN+  PEILKPDVIAPGVNILAAWTG  +P++   D RR  FNI+
Sbjct  488   SSPPAPKVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGISSPTDLDIDPRRVLFNII  547

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSG+AA+L K YP WSPAAIKSALMTT Y LDNSG   + DL TG  STP 
Sbjct  548   SGTSMSCPHVSGIAALLHKTYPDWSPAAIKSALMTTAYNLDNSGE-IIKDLSTGEESTPF  606

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
               G+GHVDP  A DPGL+YD+ V DY+ FLC IGY +Q+IALF R+   V+C    L +P
Sbjct  607   VRGAGHVDPNKALDPGLIYDSQVEDYLAFLCAIGYSTQQIALFTRDETTVNCSAMTLASP  666

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYP+F+VVF +    +T+ R V+NVG   +  Y+  +  P  V VTV+P++LVF   
Sbjct  667   GDLNYPAFSVVFSSTSDIVTFSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPSKLVFDAV  726

Query  2002  IDTLSYEVTFQSLRQSA----DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
               +LSYE+TF S+  +A    + FG + WSDGTH V SPIAVSW    V+ +
Sbjct  727   DQSLSYEITFASIADAAVAGSNGFGGISWSDGTHSVRSPIAVSWRQSFVASM  778



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/713 (55%), Positives = 501/713 (70%), Gaps = 15/713 (2%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P S H+ S  +LYTY    HGFSA LTPSQA+ L   P V+S+ PD++  L TT +P FL
Sbjct  56    PPSQHTPS--ILYTYTSAIHGFSAHLTPSQAAHLTTHPDVLSIQPDQIRHLHTTHTPDFL  113

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPE--RSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             GL   +S L P+S + +D+IIGVLD+GIWPE    S      +P+P+SW+  CEV   FP
Sbjct  114   GLAE-TSGLWPNSHFASDVIIGVLDTGIWPELKSFSDPSLSSSPLPSSWKGTCEVSHDFP  172

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvn  531
             ++SCN KIIGA+A+Y+GYE+   RPI +  E KS  D  GHG+H AS AAGS V+NA++ 
Sbjct  173   SSSCNGKIIGAKAFYKGYESYLQRPIDETVESKSPRDTEGHGSHTASTAAGSIVSNASLF  232

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
               A+GEA+G+AT ARIA YK+CW   C ++DIL+ MD+AV+DGVHV+SLS+G     G+A
Sbjct  233   SFAQGEAKGMATKARIAAYKICWSLGCFDSDILAAMDEAVSDGVHVISLSVG---ASGYA  289

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y  D IAIGAFGA Q GV+VSC AGNSGP  YT+ NIAPWILTVGASTIDREFPA V 
Sbjct  290   PQYYHDSIAIGAFGASQHGVVVSCSAGNSGPGSYTSTNIAPWILTVGASTIDREFPADVI  349

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANIT  1071
             LG+GR F G SLY G      ++ +VYG    SRYC  G LD+SKV+GKIV C +  N  
Sbjct  350   LGDGRVFGGVSLYDGDDLPDYKLPLVYGADCGSRYCFIGSLDSSKVQGKIVVCDRGVNAR  409

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G AVK +GG+GMI++N    G EL+A+A ++   +V     D I +Y+++++  TA
Sbjct  410   -VEKGSAVKLAGGLGMIMANTEGSGEELLADAHLVAATMVGQIAADKIREYIRSSQYPTA  468

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              I F+GTV G SP+AP+VA+FSSRGPN++T EILKPDVIAPGVNILA WTG + P++   
Sbjct  469   TIEFKGTVIGGSPAAPQVASFSSRGPNYVTSEILKPDVIAPGVNILAGWTGKVGPTDLDF  528

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR EFNI+SGTSM+CPHVSG+AA+LRK YP+WSPAAIKSALMTT Y +DNSG   + D
Sbjct  529   DTRRVEFNIISGTSMSCPHVSGIAALLRKAYPNWSPAAIKSALMTTAYDVDNSGEK-IKD  587

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
             L TG  S P  HG+GHVDP  A +PGLVYD   NDY+ FLC+IGYD++KI +F R     
Sbjct  588   LGTGKESNPFVHGAGHVDPNRALNPGLVYDLNSNDYLSFLCSIGYDAKKIQIFTREPTSF  647

Query  1792  D-CRNRN-LGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
             D C  R  L +PG LNYPSF+VVF  N   + YKR V NVG   +  Y V V +P  V V
Sbjct  648   DVCEKREKLVSPGNLNYPSFSVVFGVNNGLVKYKRVVTNVGGYVDAVYTVKVNSPFGVDV  707

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +VSP++LVF+    T ++E+TF  +    + SFGS+ WSDG+H+V SPIAV W
Sbjct  708   SVSPSKLVFSGENKTQAFEITFARVGYGGSQSFGSIEWSDGSHIVRSPIAVRW  760



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/705 (55%), Positives = 494/705 (70%), Gaps = 17/705 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLYTY   A GFS RLTPSQAS L   P V+++  D++    TT +P+FLGL + S  L 
Sbjct  67    LLYTYSSAASGFSVRLTPSQASHLRRHPSVLALHSDQIRHPHTTHTPRFLGL-ADSFGLW  125

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
             P+SDY  D+I+GVLD+GIWPE  SFSD  L+PIP+SW+  C+  P FP++ CN KIIGA+
Sbjct  126   PNSDYADDVIVGVLDTGIWPELKSFSDHNLSPIPSSWKGSCQPSPDFPSSLCNNKIIGAK  185

Query  394   AYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             A+Y+GYE+   RPI +  E KS  D  GHGTH AS AAG+ V+NA++  +ARGEARG+AT
Sbjct  186   AFYKGYESYLERPIDESQESKSPRDTEGHGTHTASTAAGAVVSNASLFHYARGEARGMAT  245

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGA  747
              ARIA YK+CW   C ++DIL+ MD+AV+DGVHV+SLS+G     G+A  Y  D IA+GA
Sbjct  246   KARIAAYKICWKLGCFDSDILAAMDEAVSDGVHVISLSVG---SSGYAPQYYRDSIAVGA  302

Query  748   FGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSL  927
             FGA +  V+VSC AGNSGP P TA+NIAPWILTVGAST+DREFPA V LG+GR F G SL
Sbjct  303   FGAAKHNVLVSCSAGNSGPGPSTAVNIAPWILTVGASTVDREFPADVILGDGRVFGGVSL  362

Query  928   YFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQSG  1107
             Y+G      ++ +VY +   SRYC  G L++SKV+GKIV C +  N   V++G AVK +G
Sbjct  363   YYGESLPDFKLPLVYAKDCGSRYCYIGSLESSKVQGKIVVCDRGGNAR-VEKGSAVKLTG  421

Query  1108  GVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGNS  1287
             G+GMI++N    G EL+A+A ++   +V    GD I +Y+K ++  TA I FRGTV G S
Sbjct  422   GLGMIMANTEANGEELLADAHLLAATMVGQTAGDKIKEYIKLSQYPTATIEFRGTVIGGS  481

Query  1288  PSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMSG  1467
             PSAP+VA+FSSRGPN LT +ILKPDVIAPGVNILA WTG + P++   D RR EFNI+SG
Sbjct  482   PSAPQVASFSSRGPNHLTSQILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNIISG  541

Query  1468  TSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAH  1647
             TSM+CPH SG+AA+LRK YP WSPAAIKSALMTT Y +DNSG   + DL +G  S P  H
Sbjct  542   TSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSG-GNIKDLGSGKESNPFIH  600

Query  1648  GSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC-------RNR  1806
             G+GHVDP  A +PGLVYD   NDY+ FLC++GYD+ +IA+F R  P V+        R  
Sbjct  601   GAGHVDPNRALNPGLVYDLDSNDYLAFLCSVGYDANQIAVFTRE-PAVESVCEGKVGRTG  659

Query  1807  NLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRL  1986
              L +PG LNYPSFAV        + Y+R V NVG   +V Y V V  P  V V VSP+ L
Sbjct  660   KLASPGDLNYPSFAVKLGGEGDLVKYRRVVTNVGSEVDVVYTVKVNAPPGVGVGVSPSTL  719

Query  1987  VFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVS  2118
             VF+    T ++EVTF   +   ++SFGS+ W+DG+H+V SPIAV+
Sbjct  720   VFSGENKTQAFEVTFSRAKLDGSESFGSIEWTDGSHVVRSPIAVT  764



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/707 (54%), Positives = 487/707 (69%), Gaps = 17/707 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y  V HGFSARL+    + L   P VISV PD+  ++ TT +P FLG  S ++ L 
Sbjct  75    LLYSYSRVLHGFSARLSSLHTAALRRHPSVISVTPDQARQIHTTHTPAFLGF-SQNTGLW  133

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +SD G D+I+GVLD+GIWPE  SFSD  L P+P++W+ +CE GP FPA+SCNRKIIGAR
Sbjct  134   SNSDDGEDVIVGVLDTGIWPEHPSFSDSDLGPVPSTWKGECETGPDFPASSCNRKIIGAR  193

Query  394   AYYRGY---EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AYY+GY      T      E +S  D  GHGTH AS AAGS VANA++  +A+G ARG+A
Sbjct  194   AYYKGYLTRRNGTKLHAAKESRSPRDTEGHGTHTASTAAGSVVANASLYHYAQGTARGMA  253

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             + ARIA YK+CW   C ++DIL+ ++QAVADGVHV+SLS+G     G A  Y+ D IAIG
Sbjct  254   SKARIAAYKICWSSGCYDSDILAALEQAVADGVHVISLSVG---ASGSAPEYHRDSIAIG  310

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA + G++VSC AGNSGP P TA NIAPWILTVGAST+DREF A V  G+G+ FTGTS
Sbjct  311   AFGATRHGIVVSCSAGNSGPGPETATNIAPWILTVGASTVDREFSANVITGDGKVFTGTS  370

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY G     +Q+S+VY     SR C  G+L++S V GKIV C +  +   V++G AVK +
Sbjct  371   LYAGESLPDSQISLVYSGDCGSRLCSVGELNSSLVEGKIVLCDRGGSAR-VEKGRAVKLA  429

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA I F GT+ G 
Sbjct  430   GGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTSNSPTATISFLGTLIGP  489

Query  1285  SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMS  1464
             SP +PRVAAFSSRGPN LTP ILKPD+IAPGVNILA WTG + P++   D RR +FNI+S
Sbjct  490   SPPSPRVAAFSSRGPNHLTPVILKPDMIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIIS  549

Query  1465  GTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHA  1644
             GTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y ++NSG + + DL TG  S P  
Sbjct  550   GTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDVENSGEA-IEDLATGKSSNPFI  608

Query  1645  HGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNP  1821
             HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L D C    L   
Sbjct  609   HGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTA  668

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+VVF +  +   Y+R VKNVG   +  Y+V V++P+NV + VSP++LVF+  
Sbjct  669   GDLNYPSFSVVFGSTGEVAKYRRVVKNVGSNVDAVYEVGVKSPANVEIEVSPSKLVFSKE  728

Query  2002  IDTLSYEVTFQSL-------RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
                L YEVTF+S+             FGS+ W+DG H+V SP+A  W
Sbjct  729   KRELEYEVTFKSVVLGGGVGSMPGQEFGSIEWTDGDHVVKSPVAFQW  775



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/710 (54%), Positives = 483/710 (68%), Gaps = 18/710 (3%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLY+Y+    GFSA L+  QA  L  VPGVIS++PD    L TTR+PQFLGL + S  
Sbjct  42    AKLLYSYDRAVRGFSAHLSGDQADALRRVPGVISLVPDERRVLHTTRTPQFLGL-ADSFG  100

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P+SDY  D+I+GVLD+GIWPER SFSD GL P+P  W+  C     FP + CNRKIIG
Sbjct  101   LWPNSDYADDVIVGVLDTGIWPERPSFSDEGLPPVPERWKGGCIEAADFPKSLCNRKIIG  160

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
              +AY+ GYEA  G+ + +  E  S  D  GHGTH AS AAGS V+NA++ G+A GEARG+
Sbjct  161   TKAYFLGYEATRGKTMEESNESNSPRDTEGHGTHTASTAAGSVVSNASLFGYAPGEARGM  220

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A+ ARIAVYK+CW   C ++DIL+  +QAV DGV V+SLS+G     G A PY  D IAI
Sbjct  221   ASRARIAVYKICWSFGCYDSDILAAFEQAVVDGVDVISLSVG---SSGHAPPYYLDSIAI  277

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAF AV+ G++VSC AGNSGP  Y+A+NIAPWILTVGAST+DREFPA V LG+G T+ G 
Sbjct  278   GAFAAVENGIVVSCSAGNSGPSSYSAVNIAPWILTVGASTLDREFPADVILGDGTTYGGV  337

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G      Q S+VY   A +RYC  G+L  + V GKIV C +  N  +  +G +V  
Sbjct  338   SLYAGESLGGQQYSLVYAADAGNRYCYSGRLSPALVAGKIVICDRGGNARVA-KGNSVHL  396

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVG+I++N+   G EL+A+A  IP  +V    GD I  Y ++  + TA I FRGTV G
Sbjct  397   AGGVGVILANLADSGEELLADAHFIPATMVGQTAGDKIRSYARSDPNPTATIAFRGTVIG  456

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
              SP APRVA+FSSRGPN+ T EILKPDVIAPGVNILA WTG + P++   D R+ EFNI+
Sbjct  457   TSPPAPRVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGEVGPTDLDSDTRKVEFNII  516

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPHVSGLAA+L+K +P W+PAAIKSAL+TT Y +D++G + + DL TG  S   
Sbjct  517   SGTSMSCPHVSGLAALLKKAHPDWTPAAIKSALVTTAYVVDDNG-APISDLATGGKSNSF  575

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
              HG+GHVDP  A DPGLVYD   +DYV FLCTIGYD+ +I++F   +   DC    LG P
Sbjct  576   VHGAGHVDPNRALDPGLVYDIQTSDYVAFLCTIGYDANRISVFTDAAYSTDCSAVGLGTP  635

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+ VF      + YKRTVKNVG   +  Y+V V+ P    VTV+P++L F+  
Sbjct  636   GNLNYPSFSAVFSGRGAVVKYKRTVKNVGLNADAVYEVEVKAPIGASVTVTPSKLTFSQN  695

Query  2002  IDTLSYEVTFQSLRQSAD---------SFGSLRWSD-GTHLVTSPIAVSW  2121
                LS+EV   S+  + D         +FGS+ WSD G+H V SP+AV W
Sbjct  696   ATELSFEVELSSVAGAVDLESSGSSLAAFGSIEWSDGGSHRVRSPVAVLW  745



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/710 (55%), Positives = 496/710 (70%), Gaps = 20/710 (3%)
 Frame = +1

Query  37    LYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGP  216
             LYTY   A GFS RL+PSQAS L   P V+++LPD++    TT +P+FLGL + S  L P
Sbjct  109   LYTYSSAAAGFSVRLSPSQASLLRRHPSVLALLPDQIRHPHTTHTPRFLGL-ADSFGLWP  167

Query  217   SSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNS--WRNKCEVGPQFPATSCNRKIIGA  390
             +SDY  D+I+GVLD+GIWPE  SFSD  L+PI +S  W+  C+  P FP++ CN KIIGA
Sbjct  168   NSDYADDVIVGVLDTGIWPELKSFSDENLSPISSSSSWKGSCQSSPDFPSSLCNNKIIGA  227

Query  391   RAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             +A+Y+GYE+   RPI +  E KS  D  GHGTH AS AAG+ V+NA++  +A+GEARG+A
Sbjct  228   KAFYKGYESYLERPIDESQESKSPRDTEGHGTHTASTAAGAVVSNASLFHYAQGEARGMA  287

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             T ARIA YK+CW   C ++DIL+ MD+AV+DGVHV+SLS+G     G+A  Y  D IA+G
Sbjct  288   TKARIAAYKICWKLGCFDSDILAAMDEAVSDGVHVISLSVG---ASGYAPQYYRDSIAVG  344

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA +  V+VSC AGNSGP P TA+NIAPWILTVGAST+DREFPA V LG+GR F G S
Sbjct  345   AFGAARHNVLVSCSAGNSGPGPSTAVNIAPWILTVGASTVDREFPADVILGDGRVFGGVS  404

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQS  1104
             LY+G +    ++ +VY +   SRYC  G L++SKV+GKIV C +  N   V++G AVK +
Sbjct  405   LYYGEKLPDFKLPLVYAKDCGSRYCYMGSLESSKVQGKIVVCDRGGNAR-VEKGSAVKLA  463

Query  1105  GGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGN  1284
             GG+GMI++N    G EL+A+A ++   +V  A GD I +Y+K ++  TA I FRGTV G 
Sbjct  464   GGLGMIMANTEANGEELLADAHLLAATMVGQAAGDKIKEYIKLSQYPTATIEFRGTVIGG  523

Query  1285  S-PSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
             S PSAP+VA+FSSRGPN LT +ILKPDVIAPGVNILA WTG + P++   D RR EFNI+
Sbjct  524   SEPSAPQVASFSSRGPNHLTSQILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNII  583

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPH SG+AA+LRK YP WSPAAIKSALMTT Y +DNSG S + DL +G  S P 
Sbjct  584   SGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGS-IKDLGSGKESNPF  642

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC-------R  1800
              HG+GHVDP  A +PGLVYD    DYV FLC++GYD+ +IA+F R  P  +        R
Sbjct  643   IHGAGHVDPNRAINPGLVYDLDTGDYVAFLCSVGYDANQIAVFTRE-PAAESVCEGKVGR  701

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
                L +PG LNYPSFAV        +  KR V NVG   +  Y V V  P  V V VSP+
Sbjct  702   TGKLASPGDLNYPSFAVKLGGEGDLVKNKRVVTNVGSEVDAVYTVKVNPPPGVGVGVSPS  761

Query  1981  RLVFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSWEG  2127
              +VF+    T ++EVTF  ++   ++SFGS+ W+DG+H+V SPIAV+W G
Sbjct  762   TIVFSAENKTQAFEVTFSRVKLDGSESFGSIEWTDGSHVVRSPIAVTWSG  811



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/722 (54%), Positives = 495/722 (69%), Gaps = 20/722 (3%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSP--QFLGLI  192
             S  + LLYT    A GFS R+TPSQ S L   P V++V P+         +   +FLGL 
Sbjct  96    SHPATLLYT-TRAAAGFSVRITPSQLSHLRRHPAVLAVEPEPGPPHPPPPTHTPRFLGLA  154

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCN  372
               S  L P+SDY  D+I+GVLD+GIWPE  SFSD  L+P+P++W+  CEV   FPA+SCN
Sbjct  155   E-SFGLWPNSDYADDVIVGVLDTGIWPELRSFSDDNLSPVPSTWKGSCEVSRDFPASSCN  213

Query  373   RKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRG  546
             RKIIGA+A+Y+GYEA    PI +  E KS  D  GHGTH +S AAG  V+NA++  +A+G
Sbjct  214   RKIIGAKAFYKGYEAYLDGPIDESAESKSPRDTEGHGTHTSSTAAGGVVSNASLFHYAQG  273

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
             EARG+AT ARIA YK+CW   C ++DIL+ MD+AVADGVHV+SLS+G     G+A  Y  
Sbjct  274   EARGMATKARIAAYKICWKYGCFDSDILAAMDEAVADGVHVISLSVG---SSGYAPQYFR  330

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IA+GAFGA +  V+VSC AGNSGP P+TA+NIAPWILTVGASTIDREFPA V LG+GR
Sbjct  331   DSIALGAFGAARHNVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVILGDGR  390

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQG  1086
              F G SLY+G      Q+ +VY +   +RYC  G L+ASKV+GKIV C +  N   V++G
Sbjct  391   VFGGVSLYYGESLPDFQLRLVYAKDCGNRYCYLGSLEASKVQGKIVVCDRGGNAR-VEKG  449

Query  1087  FAVKQSG--GVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
              AVK +G  G+G+I++N    G EL+A+A ++   +V    GD I  Y++ ++  TA I 
Sbjct  450   SAVKLAGAGGLGVIMANTAESGEELLADAHLLAATMVGQIAGDEIKKYIRLSQYPTATIE  509

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F+GTV G SPSAP+VA+FSSRGPN LT EILKPDVIAPGVNILA WTG + P++   D R
Sbjct  510   FKGTVIGGSPSAPQVASFSSRGPNHLTSEILKPDVIAPGVNILAGWTGRVGPTDLDIDPR  569

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R EFNI+SGTSM+CPH SG+AA+LRK YP WSPAAIKSALMTT Y +DNSG   + DL T
Sbjct  570   RVEFNIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSG-GNIKDLGT  628

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-C  1797
             G  S P  HG+GHVDP  A +PGLVYD+ +NDY+ FLC+IGYD+ +IA+F R     + C
Sbjct  629   GKESNPFTHGAGHVDPNRALNPGLVYDSDINDYLAFLCSIGYDANQIAVFTREPAAANPC  688

Query  1798  -----RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                  R   L +PG LNYPSF+V        + YKR V NVG V +  Y V V  P  V 
Sbjct  689   EGKVGRTGRLASPGDLNYPSFSVELGRGSDLVKYKRVVTNVGSVVDAVYTVKVNAPPGVD  748

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSWEGRSVS  2139
             VTV+PN LVF+    T ++EV F  +   ++DSFGS+ W+DG+H+V SPIAV W G S S
Sbjct  749   VTVAPNTLVFSGENKTQAFEVAFSRVTPATSDSFGSIEWTDGSHVVRSPIAVRWSGDSSS  808

Query  2140  EL  2145
              L
Sbjct  809   SL  810



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/696 (54%), Positives = 484/696 (70%), Gaps = 21/696 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y    HGFSARL+P Q + L   P VISV+PD+  E+ TT +P FLG  S +S L 
Sbjct  672   LLYSYSRAVHGFSARLSPIQTAALRRNPAVISVIPDQAREIHTTHTPTFLGF-SDNSGLW  730

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGAR  393
              +S+YG D+I+GVLD+GIWPE  SFSD GL+P+P++W+ +CE GP FPA+SCNRK+IGAR
Sbjct  731   SNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGECETGPDFPASSCNRKLIGAR  790

Query  394   AYYRGYEAVTGR-----PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             A+Y+GY  +T R         E +S  D  GHGTH AS AAGS VANA+   +A G ARG
Sbjct  791   AFYKGY--LTHRNGSTTHTAKESRSPRDTEGHGTHTASTAAGSVVANASFYQYASGLARG  848

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +A+ ARIA YK+CW G C ++DIL+ MDQAV+DGVHV+SLS+G     G+A  Y++D IA
Sbjct  849   MASKARIAAYKICWTGGCYDSDILAAMDQAVSDGVHVISLSVG---ANGYAPEYHKDSIA  905

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             IGAFGA + G++VSC AGNSGP P TA NIAPWILTVGASTIDREF A    G+G+ FTG
Sbjct  906   IGAFGATRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTIDREFTANAITGDGKVFTG  965

Query  919   TSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
             TSLY G     +Q+S+VY     SR C PG+L++S V GKIV C +  N   V++G AVK
Sbjct  966   TSLYAGESLPDSQISLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR-VEKGSAVK  1024

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GMI++N    G EL A++ ++P  +V A  GD I DY+KN+ S TA I F GT+ 
Sbjct  1025  IAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSDSPTATISFLGTLI  1084

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             G SP +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   D RR +FNI
Sbjct  1085  GPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNI  1144

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y  +NSG   + DL TG  S  
Sbjct  1145  ISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYVTENSGEP-IEDLATGKTSNS  1203

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLG  1815
               HG+GHVDP  A +PGLVYD  V DYV FLC +GY+   I +FL++  L + C    L 
Sbjct  1204  FIHGAGHVDPNKALNPGLVYDIDVKDYVAFLCAVGYEFPGILVFLQDPALYNACETSKLR  1263

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
               G LNYPSF+VVF + +  + Y+R VKNVG   +  Y++ V++P+NV + VSP++L F+
Sbjct  1264  TAGDLNYPSFSVVFGSTVDVLKYRRVVKNVGSNVDAVYEIGVKSPANVEIEVSPSKLAFS  1323

Query  1996  DRIDTLSYEVTFQSL-------RQSADSFGSLRWSD  2082
                  L +EVTF+S+             FGS+ W+D
Sbjct  1324  KEKSELEFEVTFKSVVLGGGDGSMPGHEFGSIEWTD  1359



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/711 (52%), Positives = 486/711 (68%), Gaps = 15/711 (2%)
 Frame = +1

Query  13    NHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
             N  ++  L+Y+Y H A GF+A L+ +Q +EL +   V+S++PD++ ++QTTR+ QFLGL 
Sbjct  61    NTLKTPMLIYSYTHSATGFAASLSAAQVAELRSHRSVLSIIPDQVHQVQTTRTTQFLGLS  120

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVG-PQFPATSC  369
              GS  L P SD G+DIIIGV+D+GIWP   SFSD G  P+P +W+  C VG P FPA SC
Sbjct  121   EGS-GLWPQSDQGSDIIIGVIDTGIWPGHRSFSDVGYGPVPTTWKGSCPVGDPDFPAGSC  179

Query  370   NRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGE  549
             N+K+IGARA+Y GYEA  GR    E KS  D  GHGTH AS AAGS V NA +  +A+G 
Sbjct  180   NKKLIGARAFYAGYEANYGRLPGKERKSPKDYNGHGTHCASTAAGSKVVNAALFNYAKGT  239

Query  550   ARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNED  729
             ARG+AT ARIA YKVCW   C  +DIL+GMDQA+ DGVHV+S S+     E     Y+  
Sbjct  240   ARGVATKARIAAYKVCWGRRCHASDILAGMDQAIKDGVHVISASLSSLPDE-----YDVS  294

Query  730   PIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRT  909
              +AIGA  A Q GV+VS  AGN+GP   T   +APW+L  GASTIDR+F A V L +GRT
Sbjct  295   LMAIGAAHAAQNGVLVSSSAGNNGPSHSTITKVAPWMLITGASTIDRQFQADVILADGRT  354

Query  910   FTGTSLYFGIQPSPNQ-VSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQG  1086
             F+G +LY G      Q + +V G  + S+ C  G L  +K++GKIV C +  NI+ V+  
Sbjct  355   FSGVTLYPGDPSKEGQFLPLVTGEISGSKNCQRGHLKKTKIQGKIVVC-EYGNISGVEMS  413

Query  1087  FAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT----AR  1254
             ++V+++ G GMI+ N    G EL + A  IP  +V+ + GD I  Y   + + T    A+
Sbjct  414   YSVQEASGAGMILINHARLGAELTSEAYFIPAIMVSYSAGDAIKKYASTSSTPTIKPSAK  473

Query  1255  IVFRGTVTGN-SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
             I FRGTVTG+ +PS+PRVAAFSSRGPNFLT EILKPDVIAPGV+ILAAW+GA   +    
Sbjct  474   IKFRGTVTGSATPSSPRVAAFSSRGPNFLTSEILKPDVIAPGVDILAAWSGAGGLTHLDF  533

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D R  EFNI+SGTSMACPHVSGLAAML+K +P+W+PAAI SA+ TT Y +D++G+  +I+
Sbjct  534   DTRCVEFNIISGTSMACPHVSGLAAMLKKAHPTWTPAAIMSAIKTTAYNIDSTGKE-IIE  592

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
               T  PSTP  HGSGH+DP  A DPGLVYD  ++DY+ FLCTIGYD+++I +  +   +V
Sbjct  593   ASTLLPSTPFVHGSGHIDPNKAVDPGLVYDLQISDYIAFLCTIGYDTKRIHVLFKEPAVV  652

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             DC ++ L +PG LNYPSF+VVF+ +   + Y R VKNVG  KN  Y+V V+ P NV ++V
Sbjct  653   DCASQILSSPGNLNYPSFSVVFRGDTNKVKYTRVVKNVGSSKNAVYKVNVKVPLNVHISV  712

Query  1972  SPNRLVFTDRIDTLSYEVTFQSLRQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
             +P  L FT  + TLSY++TF S      SFGS+ W+DG+H V SPIAV WE
Sbjct  713   APTTLAFTSTVQTLSYDITFTSTSIGPPSFGSIEWTDGSHHVRSPIAVQWE  763



>ref|XP_004954115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/706 (54%), Positives = 483/706 (68%), Gaps = 16/706 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             +LY+Y+H A G +ARLTP QA+  A   GV++V PD+  +L TT +P FL L   +  L 
Sbjct  75    VLYSYQHAATGIAARLTPEQAAHAAAGEGVLAVYPDQARQLHTTHTPAFLHLTEAAGLLP  134

Query  214   PSSDYGADIIIGVLDSGIWP-ERSSFSD-RGLNPIPNSWRNKCEVGPQFPATS-CNRKII  384
              ++   +  ++GVLD+G++P  R SF+   GL P P S+   C     F A++ CN K+I
Sbjct  135   AATRGASSAVVGVLDTGLYPIGRGSFAAPAGLGPAPASFSGGCVSTGSFNASAYCNSKLI  194

Query  385   GARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             GA+ +Y+GYEA  G PI    E KS +D  GHGTH AS AAGS VA A    +A+G+A G
Sbjct  195   GAKVFYQGYEAALGHPIDETKESKSPLDTEGHGTHTASTAAGSPVAGAGFFDYAKGQAVG  254

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +   ARIA YK+CW   C ++DIL+ MD+AVADGV V+SLS+G     G+A  + +D IA
Sbjct  255   MDAGARIAAYKICWKSGCYDSDILAAMDEAVADGVDVISLSVG---AGGYAPSFFQDSIA  311

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             IGAF AV KG++VSC AGNSGP  YTA NIAPWILTVGASTIDREFPA V LG+GR F G
Sbjct  312   IGAFHAVSKGIVVSCSAGNSGPGEYTATNIAPWILTVGASTIDREFPADVVLGDGRVFGG  371

Query  919   TSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
              SLY G   +  Q+ +V+     SR CL G+LD  KV GKIV C++      V++G AVK
Sbjct  372   VSLYAGDPLNSTQLPLVFAGDCGSRLCLLGELDPKKVAGKIVLCER-GKTARVEKGAAVK  430

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GMI++N    G ELVA++ ++P  +V    GD I  YV+   S TA IVFRGTV 
Sbjct  431   LAGGAGMILANTEASGEELVADSHLVPATMVGQKFGDKIKYYVQTDPSPTATIVFRGTVI  490

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             G SPSAPRVA+FSSRGPN+   EILKPDVIAPGVNILAAWTGA +P++   D+RR EFNI
Sbjct  491   GKSPSAPRVASFSSRGPNYRAREILKPDVIAPGVNILAAWTGAASPTDLDIDSRRVEFNI  550

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSGLAA+LR+ +P WSPAAIKSALMTT Y LDNSG  T+ DL TG  STP
Sbjct  551   ISGTSMSCPHVSGLAALLRQAHPDWSPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTP  609

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGN  1818
                G+GHVDP +A DPGLVYD G +DYV FLCT+GY    I++F ++S + DC +R    
Sbjct  610   FVRGAGHVDPNSALDPGLVYDAGTDDYVAFLCTLGYPPSLISIFTKDSSVADC-SRKFAR  668

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
              G LNYP+FA VF +   ++TY R V+NVG   +  Y+  + +PS V VTVSP++LVF D
Sbjct  669   SGDLNYPAFAAVFSSYKDSVTYHRVVRNVGSNSSAVYESKIVSPSGVDVTVSPSKLVFDD  728

Query  1999  RIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +  +L+YE+T        +  +  SFGS+ WSDG H VTSPIAV+W
Sbjct  729   KNRSLAYEITIAVSGNPVIVDAKYSFGSISWSDGVHNVTSPIAVTW  774



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/712 (54%), Positives = 479/712 (67%), Gaps = 18/712 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLY+Y+ VAHGFSAR+ PSQA  L N P ++SV P+R   L TTR+P+FLGL S    L 
Sbjct  64    LLYSYDRVAHGFSARILPSQADILRNFPEILSVRPERTYSLHTTRTPEFLGL-SKDQGLW  122

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCE--VGPQFPATSCNRKIIG  387
             P+SDY  D+IIGVLD+GIWPER SFSD GL  +P  W+  C+   G       CNRKIIG
Sbjct  123   PNSDYAKDVIIGVLDTGIWPERPSFSDNGLTTVPERWKGVCDSGAGKILSGEFCNRKIIG  182

Query  388   ARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AR + +GYEAV G+    +E  S +D  GHGTH AS AAG+ V+ A+  G+A GEARG+A
Sbjct  183   ARWFAKGYEAVNGKINETEESPSPLDTEGHGTHTASTAAGALVSGADFYGYAAGEARGMA  242

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
             TNARIAVYK+CW   C ++DIL+ MDQAV DGV V+SLS+G  +    A  +++D IAIG
Sbjct  243   TNARIAVYKICWKTGCYDSDILAAMDQAVGDGVDVISLSVGSSH---LAPEFDDDSIAIG  299

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA + GV+VSC AGNSGP P+TA NIAPWILTVGASTIDR+FPA V LG+G    G S
Sbjct  300   AFGAARHGVVVSCSAGNSGPGPHTATNIAPWILTVGASTIDRDFPADVILGDGTILAGVS  359

Query  925   LYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI-VDQGFAVKQ  1101
             LY G + SP   S+V    +  R C  G+L  +KV GK V C++   IT  V +G +VK 
Sbjct  360   LYTGNR-SPENFSVVLAADSGDRLCRKGRLIPAKVAGKTVVCER--GITARVAKGLSVKD  416

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             SGG  M+++N    G ELVA+A ++P  +V   +GD I  YV++  + +A I+FRGTVTG
Sbjct  417   SGGAAMVLTNTEESGEELVADAHLLPATMVGQINGDKIRKYVRSANNPSAGILFRGTVTG  476

Query  1282  N-SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
               + +AP VAAFSSRGPN+ +PEI+KPDVIAPGVNILA WTGA  P+    D RR  FN+
Sbjct  477   KYATAAPMVAAFSSRGPNYRSPEIVKPDVIAPGVNILAGWTGATGPTGLETDGRRWNFNV  536

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSGLAA+L+  +P WSPAA+KSALMTT Y  DN+G ST+ DL  G  STP
Sbjct  537   ISGTSMSCPHVSGLAALLKNAFPHWSPAAVKSALMTTAYDSDNNG-STIKDLADGKESTP  595

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGN  1818
                GSGHVDP  A DPGLVYD    DYV +LC +GYDS +IA+F      VDCR      
Sbjct  596   FVRGSGHVDPNRALDPGLVYDIKPEDYVAYLCALGYDSVRIAVFTGGKS-VDCRVVGFAK  654

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
              G LNYPSF++VF        + RTV NVG  ++ AY  ++  P +VR+ V P +LVF  
Sbjct  655   SGDLNYPSFSMVFGPGKTVAKFSRTVTNVGDARS-AYAASINGPDSVRIRVDPEKLVFCA  713

Query  1999  RIDTLSYEVTFQSLRQSA---DSFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
             +  +LSY VTF+ +   +     FG L WSDG H V SPIA SWEG   S  
Sbjct  714   QNQSLSYSVTFEYVEGYSPLDTCFGLLTWSDGRHDVKSPIAFSWEGALASSF  765



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/708 (54%), Positives = 484/708 (68%), Gaps = 19/708 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             +LY+Y+H A G +ARLTP QA+  A   GV++V PD+  +L TT +P FL L   ++ L 
Sbjct  74    VLYSYQHAATGIAARLTPQQAAHAAAGEGVLAVYPDQARQLHTTHTPAFLRLTE-AAGLL  132

Query  214   PSSDYGAD--IIIGVLDSGIWP-ERSSFSDR-GLNPIPNSWRNKCEVGPQFPATS-CNRK  378
             P++  GA    ++GVLD+G++P  RSSF+   GL P P S+   C     F A++ CN K
Sbjct  133   PAATGGASSSAVVGVLDTGLYPIGRSSFAAADGLGPAPASFSGGCVSAGSFNASAYCNSK  192

Query  379   IIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGA+ +Y+GYEA  G PI    E KS +D  GHGTH AS AAGS VA A    +A G+A
Sbjct  193   LIGAKFFYQGYEAALGHPIDETKESKSPLDTEGHGTHTASTAAGSPVAGAGFFDYAEGQA  252

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
              G+   ARIA YK+CW   C ++DIL+ MD+AVADGV V+SLS+G     G+A  +  D 
Sbjct  253   VGMDPGARIAAYKICWTSGCYDSDILAAMDEAVADGVDVISLSVG---ANGYAPSFFTDS  309

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IAIGAF AV KG++VSC AGNSGP  YTA+NIAPWILTVGASTIDREFPA V LG+GR F
Sbjct  310   IAIGAFHAVSKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDREFPADVVLGDGRVF  369

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              G SLY G      Q+ +V+     S  CL G+LD+ KV GK+V C +  N   V++G A
Sbjct  370   GGVSLYAGDPLDSTQLPLVFAGDCGSPLCLMGELDSKKVAGKMVLCLR-GNNARVEKGAA  428

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GGVGMI++N    G EL+A++ ++P  +V    GD I  YV+   S TA IVFRGT
Sbjct  429   VKLAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTDPSPTATIVFRGT  488

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G S SAPRVAAFSSRGPN+  PEILKPDVIAPGVNILAAWTGA +P++   D+RR EF
Sbjct  489   VIGKSRSAPRVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASPTDLDIDSRRVEF  548

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPHVSGLAA+LR+ +P WSPAAIKSALMTT Y LDNSG  T+ DL TG  S
Sbjct  549   NIISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALMTTAYNLDNSGE-TIKDLATGVES  607

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   G+GHVDP  A DPGLVYD G +DYV FLCT+GY    I++F +++ + DC  +  
Sbjct  608   TPFVRGAGHVDPNAALDPGLVYDAGSDDYVAFLCTLGYSPSLISIFTQDASVADCSTK-F  666

Query  1813  GNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVF  1992
               PG LNYP+FA VF +   ++TY+R V+NVG   +  YQ T+ +P  V VTV+P++L F
Sbjct  667   ARPGDLNYPAFAAVFSSYQDSVTYRRVVRNVGSNSSAVYQPTIASPYGVDVTVTPSKLAF  726

Query  1993  TDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               +  +L YE+T        +  S+ SFGS+ WSDG H VTSPIAV+W
Sbjct  727   DGKQQSLGYEITIAVSGNPVIVDSSYSFGSITWSDGAHDVTSPIAVTW  774



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/703 (53%), Positives = 486/703 (69%), Gaps = 13/703 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +L+Y+Y H A GF+A L+ +QA+EL + P V+S++PD++ ++QTTR+ QFL L  GS  L
Sbjct  67    KLIYSYTHSATGFAASLSAAQAAELRSHPAVLSIIPDQVHQVQTTRTTQFLDLSEGS-GL  125

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVG-PQFPATSCNRKIIG  387
              P SD G++IIIGV+D+GIWP   SFSD G  P+P +W+  C VG P FPA SCN+K+IG
Sbjct  126   WPQSDQGSEIIIGVIDTGIWPGHRSFSDVGYGPVPTTWKGSCPVGDPDFPAGSCNKKLIG  185

Query  388   ARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             A A+Y GYEA  GR    E KS  D  GHGTH ASIAAGS V NA +  +A+G ARG+AT
Sbjct  186   AYAFYAGYEANYGRLPRKERKSPKDYNGHGTHCASIAAGSKVVNAALFNYAKGTARGVAT  245

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF-AKPYNEDPIAIG  744
              ARIA YK CW   C ++DIL+ MD+A+ DGVH++S SIG      F A  Y+   IAIG
Sbjct  246   KARIAAYKACWGSECQDSDILAAMDKAIKDGVHIISASIG-----SFPAVQYDFSAIAIG  300

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             +  A Q GV+VS  AGN GP   T  N+APW+L VGAS+IDR+F A VTL +GRTF+G +
Sbjct  301   SAHAAQSGVLVSSAAGNDGPGRGTVSNVAPWMLVVGASSIDRQFEADVTLADGRTFSGVT  360

Query  925   LYFGIQPSPNQ-VSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             LY G   +  Q + +V G  + S+ C  GQL  +KV+GKIV C +   I   +  ++V++
Sbjct  361   LYPGDPSADAQFLPIVTGENSGSKNCKRGQLQKTKVKGKIVVC-EYGKIADTEMSYSVQE  419

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKN-TKSATARIVFRGTVT  1278
             +GG GMI+ N  + G EL + A  IP  +V+ + GD I  Y    T   +A+I FRGTVT
Sbjct  420   AGGAGMILINDANWGAELRSQAYFIPAVMVSYSAGDAIKKYASTPTIKTSAKIKFRGTVT  479

Query  1279  GN-SPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
             G+ +PS+PRVAAFSSRGPN +  EILKPDVIAPGVNILAAW+GA  P+    D RR EFN
Sbjct  480   GSATPSSPRVAAFSSRGPNIVNTEILKPDVIAPGVNILAAWSGAAGPTGLDFDTRRVEFN  539

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSMACPHVSGLAAML+K +P+W+PAAI SA+MTT Y +D++G+  +ID+ T  PST
Sbjct  540   IISGTSMACPHVSGLAAMLKKAHPTWTPAAIMSAIMTTAYNIDSTGKE-IIDVSTLLPST  598

Query  1636  PHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG  1815
             P   GSGH+DP  A DPGLVYD  V+DY+ FLCT GY    I +  +   ++DC ++ L 
Sbjct  599   PFVRGSGHIDPNKAVDPGLVYDLQVSDYIAFLCTAGYTKNMIRVIFKAPAVIDCASQKLS  658

Query  1816  NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFT  1995
             +PG LNYPSF+VVF+     + Y R VKNVG  KN  Y+V V+ P NV+++V+P+ L FT
Sbjct  659   SPGNLNYPSFSVVFRGATNKVKYTRVVKNVGSSKNAVYKVNVKAPLNVQISVAPSTLTFT  718

Query  1996  DRIDTLSYEVTFQSLRQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
               + TLSY++TF S  + A SFGS+ WSDG H V SPIA+ W+
Sbjct  719   STVQTLSYDITFTSTSRGASSFGSIEWSDGNHHVRSPIAIQWK  761



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/706 (54%), Positives = 483/706 (68%), Gaps = 16/706 (2%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             +LY+Y+H A G +ARLTP QA+  A   GV++V PD++ +L TT +P FLGL   +  L 
Sbjct  79    VLYSYQHAATGIAARLTPEQAAHAAAGEGVLAVYPDKVRQLHTTHTPSFLGLTETAGLLP  138

Query  214   PSSDYGADIIIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPQFPATS-CNRKII  384
              ++   +  ++GVLD+G++P  R SF+   GL P P S+   C     F A++ CN K+I
Sbjct  139   AAAGGASSAVVGVLDTGLYPIGRGSFAATAGLGPPPASFSGGCVSAASFNASAYCNSKLI  198

Query  385   GARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             GA+ +Y+GYEA  G PI    E KS +D  GHGTH AS AAGS V  A    +A+G+A G
Sbjct  199   GAKFFYQGYEAGLGHPIDETKESKSPLDTEGHGTHTASTAAGSPVPGAGFFDYAKGQAVG  258

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +   ARIAVYK+CW   C ++DIL+ MD+AVADGV V+SLS+G     G+A  +  D IA
Sbjct  259   MDPGARIAVYKICWASGCYDSDILAAMDEAVADGVDVISLSVG---ANGYAPRFYTDSIA  315

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             IGAF AV+KG++VSC AGNSGP  YTA+NIAPWILTVGASTIDREFPA V LG+GR F G
Sbjct  316   IGAFHAVRKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDREFPADVVLGDGRVFGG  375

Query  919   TSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
              SLY G      Q+ +V+     SR CL G+LD  KV GKIV C +  N   V++G AVK
Sbjct  376   VSLYAGDPLDSTQLPLVFAGDCGSRLCLIGELDPKKVAGKIVLCLR-GNNARVEKGAAVK  434

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GGVGMI++N    G EL+A++ ++P  +V    GD I  YV+   S TA I+FRGTV 
Sbjct  435   LAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTDPSPTATIMFRGTVI  494

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             G SPSAP+VAAFSSRGPN+  PEILKPDVIAPGVNILAAWTGA +P++   D RR EFNI
Sbjct  495   GKSPSAPQVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASPTDLDIDTRRVEFNI  554

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSGLAA+LR+ +P WSPAAIKSALMTT Y LDNSG  T+ DL TG  STP
Sbjct  555   ISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTP  613

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGN  1818
                G+GHVDP  A DPGLVYD G++DYV FLCT+GY    I++F ++  + +C +R    
Sbjct  614   FVRGAGHVDPNAALDPGLVYDAGIDDYVAFLCTLGYSPSLISIFTQDGSVANC-SRKFAR  672

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
              G LNYP+FA VF +   ++TY R V+NVG   +  Y+  + +PS V VTVSP++LVF  
Sbjct  673   SGDLNYPAFAAVFSSYQDSVTYHRVVRNVGSNSSAVYEPKIVSPSGVDVTVSPSKLVFDG  732

Query  1999  RIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +  +L YE+T        +   + SFGS+ WSDG H VTSPIAV+W
Sbjct  733   KQQSLGYEITIAVSGNPVIVDVSYSFGSITWSDGAHDVTSPIAVTW  778



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/722 (52%), Positives = 481/722 (67%), Gaps = 53/722 (7%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L +  + + LLY+Y     GFSARL+P+Q ++L   P VISV+PD+  E+ TT +P FLG
Sbjct  59    LPSSPQPATLLYSYSRAVQGFSARLSPTQTADLRRHPSVISVIPDQAREIHTTHTPAFLG  118

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
               S +S L  +S+YG D+I+GVLD+GIWPE  SFSD GL+P+P++W+  CE GP FPA+S
Sbjct  119   F-SDNSGLWSNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVPSTWKGACETGPDFPASS  177

Query  367   CNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRG  546
             CNRK+IGARA+Y+GY  +T R              HGTH AS AAGS VANA++  +ARG
Sbjct  178   CNRKLIGARAFYKGY--LTHR--------------HGTHTASTAAGSVVANASLYQYARG  221

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+A+ ARIA                     AVADGVHV+SLS+G     G+A  Y+ 
Sbjct  222   VARGMASKARIA---------------------AVADGVHVISLSVG---ANGYAPEYHM  257

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAFGA + G++VSC AGNSGP P TA NIAPWILTVGAST DREF A    G+G+
Sbjct  258   DSIAIGAFGATRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTTDREFSANAITGDGK  317

Query  907   TFTGTSLYFGIQPSPN-QVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQ  1083
              FTGTSLY G +P P+ Q+S+VY     SR C PG+L+AS V GKIV C +  N   V++
Sbjct  318   VFTGTSLYAG-EPLPDSQLSLVYSGDCGSRLCYPGKLNASLVEGKIVLCDRGGNAR-VEK  375

Query  1084  GFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVF  1263
             G AVK +GG GMI++N+   G EL A++ ++P  +V A  GD I +Y++ + S TA I F
Sbjct  376   GSAVKIAGGAGMILANIAESGEELTADSHLVPATMVGANAGDQIREYIQKSVSPTATISF  435

Query  1264  RGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRR  1443
              GT  G SP +PRVAAFSSRGPN +TP ILKPDVIAPGVNILA WTG + P++   D RR
Sbjct  436   LGTSIGPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRR  495

Query  1444  TEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTG  1623
              +FNI+SGTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y  +NSG   + DL TG
Sbjct  496   VQFNIISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDTENSGE-PIEDLATG  554

Query  1624  YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD-CR  1800
              PS    HG+GHVDP  A +PGLVYD  V DYV FLC +GY+   I +FL++  L + C 
Sbjct  555   KPSNSFIHGAGHVDPNKALNPGLVYDIDVKDYVAFLCAVGYEFPGILVFLQDPTLYNACE  614

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
                L   G LNYPSF+VVF + +  + Y+R VKNVG   +  Y+V V++P+NV + VSP 
Sbjct  615   TSKLKTSGDLNYPSFSVVFGSTVDVVKYRRVVKNVGTNVDAVYEVGVKSPANVEIDVSPR  674

Query  1981  RLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEGRSVS  2139
             +L F+     L YEVTF+S+             FGS+ W+DG H+V SP+AV W   SV 
Sbjct  675   KLAFSKGEGELEYEVTFRSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQ  734

Query  2140  EL  2145
               
Sbjct  735   SF  736



>ref|NP_001048301.1| Os02g0779200 [Oryza sativa Japonica Group]
 dbj|BAD19517.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10215.1| Os02g0779200 [Oryza sativa Japonica Group]
 gb|EAZ24820.1| hypothetical protein OsJ_08598 [Oryza sativa Japonica Group]
Length=782

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/716 (53%), Positives = 478/716 (67%), Gaps = 19/716 (3%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              LLY+Y H A G +ARLTP QA+ +   PGV++V PD+  +L TT +P FL L   S  L
Sbjct  72    RLLYSYAHAATGVAARLTPEQAAHVEAQPGVLAVHPDQARQLHTTHTPAFLHLTQASGLL  131

Query  211   GPSSDYGADI-IIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPQFPATS-CNRK  378
               ++  GA   I+GVLD+GI+P  R SF+   GL P P S+   C     F A++ CN K
Sbjct  132   PAAASGGASSPIVGVLDTGIYPIGRGSFAPTDGLGPPPASFSGGCVSTASFNASAYCNNK  191

Query  379   IIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGA+ +Y+GYEA  G  I   +E KS +D  GHGTH AS AAGS V  A    +ARG+A
Sbjct  192   LIGAKFFYKGYEAALGHAIDETEESKSPLDTEGHGTHTASTAAGSPVTGAGFFDYARGQA  251

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
              G++  A IA YK+CW   C ++DIL+ MD+AVADGV V+SLS+G     G+A  +  D 
Sbjct  252   VGMSPAAHIAAYKICWKSGCYDSDILAAMDEAVADGVDVISLSVG---AGGYAPSFFRDS  308

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IAIG+F AV KG++VS  AGNSGP  YTA NIAPWILTVGASTIDREFPA V LGNG+ +
Sbjct  309   IAIGSFHAVSKGIVVSASAGNSGPGEYTATNIAPWILTVGASTIDREFPADVVLGNGQVY  368

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              G SLY G   +   + +VY     SR C+ G+LD +KV GKIV C++ +N  +  +G A
Sbjct  369   GGVSLYSGEPLNSTLLPVVYAGDCGSRLCIIGELDPAKVSGKIVLCERGSNARVA-KGGA  427

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GG GMI+ N    G ELVA++ ++P  +V    GD I  YV++  S TA IVFRGT
Sbjct  428   VKVAGGAGMILVNTAESGEELVADSHLVPATMVGQKFGDKIKYYVQSDPSPTATIVFRGT  487

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G SPSAPRVAAFSSRGPN+  PEILKPDVIAPGVNILAAWTG  AP++   D RR EF
Sbjct  488   VIGKSPSAPRVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGESAPTDLDIDPRRVEF  547

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPHVSGLAA+LR+  P WSPAAIKSALMTT Y +DNS  + + DL TG  S
Sbjct  548   NIISGTSMSCPHVSGLAALLRQAQPDWSPAAIKSALMTTAYNVDNS-SAVIKDLATGTES  606

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   G+GHVDP  A DPGLVYD G  DYV FLCT+GY    I+LF  +  + +C  +  
Sbjct  607   TPFVRGAGHVDPNRALDPGLVYDAGTEDYVSFLCTLGYSPSIISLFTTDGSVANCSTK-F  665

Query  1813  GNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVF  1992
                G LNYP+FAVV  +   ++TY R V+NVG   N  Y+  + +PS V VTVSP++LVF
Sbjct  666   PRTGDLNYPAFAVVLSSYKDSVTYHRVVRNVGSNANAVYEAKIDSPSGVDVTVSPSKLVF  725

Query  1993  TDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSW--EGRSVS  2139
              +   +LSY++T  +     +  +  +FGS+ WSDG H VTSPIAV+W   GR+ S
Sbjct  726   DESHQSLSYDITIAASGNPVIVDTEYTFGSVTWSDGVHDVTSPIAVTWPSNGRAAS  781



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/717 (50%), Positives = 484/717 (68%), Gaps = 26/717 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E++Y Y++V HGF+ARLT  QA  L   PG++SVLP+ + +L TTR+P FLG
Sbjct  51    LKSVSESAEMIYVYKNVVHGFAARLTARQAESLETQPGILSVLPELIYQLHTTRTPLFLG  110

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   S N+ P SD  +D+I+GVLD+G+WPER SF D G  P+P+SW+ +CE    F +  
Sbjct  111   L-DRSVNIFPESDAMSDVIVGVLDTGVWPERKSFDDTGFGPVPDSWKGECESSNNFSSAM  169

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK++GAR + RGYE   G PI +  E KS  D  GHGTH AS AAGS V  A++ G+A
Sbjct  170   CNRKLVGARYFSRGYETTLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYA  228

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A  AR+A+YKVCWLG C N+DIL+GMD+A+ D V VLSLS+G     G    Y
Sbjct  229   SGTARGMAYRARVAMYKVCWLGGCFNSDILAGMDKAIDDKVDVLSLSLG-----GSTPDY  283

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
              +D IAIGAF A++KG++VSC AGN+GP+ ++  N APWI TVGA TIDR+FPA V+LGN
Sbjct  284   YKDSIAIGAFAAMEKGILVSCSAGNAGPNQFSLANQAPWITTVGAGTIDRDFPAYVSLGN  343

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLANI  1068
             G+ F+G SLY G       + +VY   A++      C+ G L   KV+GKIV C +  + 
Sbjct  344   GKNFSGVSLYAGDSLLNKMLPLVYAGNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGISA  403

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V +GF VK++GG GM+++N    G ELVA+A ++P A V    GD+I  Y+ +  + T
Sbjct  404   R-VQKGFVVKEAGGAGMVLANTAANGEELVADAHLLPAAAVGQKAGDVIKKYLFSDPNPT  462

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A I+F GT     PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+   
Sbjct  463   AEILFGGTKVDIEPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMA  521

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
             +D+RR EFNI+SGTSM+CPHVSGLAA+++ ++P WSPAAI+SALMT+ YT+  +G   L+
Sbjct  522   EDDRRVEFNIISGTSMSCPHVSGLAALIKGVHPEWSPAAIRSALMTSAYTVYKNG-GALV  580

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL  1788
             D+ TG PSTP  HG+GHVDP +A +PGLVYD   +DY++F+C + Y   +I    R +  
Sbjct  581   DVATGKPSTPFDHGAGHVDPVSAVNPGLVYDINADDYLNFMCALKYTPSQINSLARRN--  638

Query  1789  VDCRNRNLGNPGALNYPSFAVVF---KNNLQTITYKRTVKNVGKVKNVAYQVTVQTP-SN  1956
               C +    +   LNYPSFAV F    +   TI Y RT+ NVG      Y+VTV +P S+
Sbjct  639   FTCDSSKTYSVTDLNYPSFAVSFVAGSDGSNTIKYSRTLTNVGPAGT--YKVTVSSPNSS  696

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA--DSFGSLRWSDGTHLVTSPIAVSW  2121
             V++ V P  L FT   +  SY V+F +  +S+  D FG + WSDG H+V+SP+A+SW
Sbjct  697   VKIIVEPETLSFTQINEKKSYTVSFTAPSKSSATDVFGRIEWSDGKHVVSSPVAISW  753



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/716 (51%), Positives = 481/716 (67%), Gaps = 25/716 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E++Y Y++V HGF+ARLT  +A  L   PG++SVLP+ + +L TTR+P FLG
Sbjct  64    LKSVSESAEMIYVYKNVVHGFAARLTAQEAESLETQPGILSVLPEVIYQLHTTRTPLFLG  123

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   S N+ P SD  +D+I+GVLD+G+WPER SF D G  P+P+SW+ +CE    F +  
Sbjct  124   L-DKSVNIFPESDSMSDVIVGVLDTGVWPERKSFDDTGFGPVPDSWKGQCESSTNFSSAM  182

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK++GAR + RGYE   G PI +  E KS  D  GHGTH AS AAGS V  A++ G+A
Sbjct  183   CNRKLVGARYFSRGYETTLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYA  241

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A +AR+AVYKVCWLG C N+DIL+GMD+A+ D V VLSLS+G     G    Y
Sbjct  242   SGTARGMAYHARVAVYKVCWLGGCFNSDILAGMDKAIDDKVDVLSLSLG-----GSTPDY  296

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
              +D IAIGAF A++KG++VSC AGN+GP+ ++  N APWI TVGA TIDR+FPA V+LGN
Sbjct  297   YKDSIAIGAFAAMEKGILVSCSAGNAGPNQFSLSNQAPWITTVGAGTIDRDFPAYVSLGN  356

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLANI  1068
             G+ F+G SLY G       + +VY   A++      C+ G L   KV+GKIV C +  N 
Sbjct  357   GKNFSGVSLYAGDSLLNKMLPLVYAGNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGINA  416

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V +GF VK +GG GM+++N    G ELVA+A ++P A V    GD +  Y+ +  + T
Sbjct  417   R-VQKGFVVKAAGGAGMVLANTAANGEELVADAHLLPAAAVGLIAGDAVKKYLFSDPNPT  475

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A I+  GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+   
Sbjct  476   AEILIGGTKVGIQPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMA  534

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
             +D+RR EFNI+SGTSM+CPHVSGLAA+++ ++P WSPAAI+SALMTT YT+  +G   L+
Sbjct  535   EDDRRVEFNIISGTSMSCPHVSGLAALVKGVHPEWSPAAIRSALMTTAYTVYKNG-GALL  593

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL  1788
             D+ TG PSTP  HG+GHVDP +A +PGLVYD   +DY++F+C + Y   +I    R +  
Sbjct  594   DVATGKPSTPFDHGAGHVDPVSAVNPGLVYDINADDYLNFMCALKYTPSQINSLARRN--  651

Query  1789  VDCRNRNLGNPGALNYPSFAVVFKNNL--QTITYKRTVKNVGKVKNVAYQVTVQTP-SNV  1959
               C +    +   LNYPSFAV F  +    TI Y RT+ NVG      Y+VTV +P S+V
Sbjct  652   FTCDSSKKYSVTDLNYPSFAVSFPADTGSNTIKYSRTLTNVGPAGT--YKVTVSSPNSSV  709

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++ V P  + FT   +  SY V+F   S   S D FG + WSDG H+V+SP+A+SW
Sbjct  710   KIIVEPETVSFTQINEKKSYTVSFTAPSKSSSTDVFGRIEWSDGKHVVSSPVAISW  765



>ref|XP_003570496.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=785

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/720 (52%), Positives = 472/720 (66%), Gaps = 21/720 (3%)
 Frame = +1

Query  7     LSNHSRSSE--LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             L  H RS    LLYTY H A G +ARLT  QA+ +A  PGV++V  D    L TT +P F
Sbjct  62    LPRHLRSPRPRLLYTYAHAATGVAARLTEEQAAHVAAQPGVLAVHRDEARRLHTTHTPAF  121

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWP-ERSSF-SDRGLNPIPNSWRNKCEVGPQF  354
             L L   S  L  +    +D+++GVLD+GI+P  R SF     L   P S+R  C     F
Sbjct  122   LRLDQASGILPAAPGAASDVVVGVLDTGIYPIGRGSFLPSSNLGAPPKSFRGGCVSAGAF  181

Query  355   PATS-CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavanan  525
              A++ CN K++GA+ YY+GYE   GR +   +E KS +D  GHG+H AS AAGS VA A+
Sbjct  182   NASAYCNAKLVGAKFYYKGYEEGLGRAMDEAEESKSPLDTEGHGSHTASTAAGSPVAGAS  241

Query  526   vnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEG  705
             +  +ARG+A G+A  ARIA YK+CW   C ++DIL+  D+AV DGV V+SLS+G  +   
Sbjct  242   LFDYARGQAVGMAPGARIAAYKICWANGCYDSDILAAFDEAVYDGVDVISLSVGAGS---  298

Query  706   FAKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAV  885
              A P+  D IAIGAFGA++KG++VS  AGNSGP  YTA NIAPWILTVGAST+DREFPA 
Sbjct  299   LAPPFFRDSIAIGAFGAMKKGIVVSASAGNSGPGEYTATNIAPWILTVGASTVDREFPAD  358

Query  886   VTLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             V LG+G+ + G SLY G      ++ +VY     S YC  G LD SKV GKIV C +  N
Sbjct  359   VLLGDGKVYGGVSLYAGEPLGSRKLPVVYAADCGSAYCYRGSLDESKVAGKIVICDRGGN  418

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V++G AVK +GG+GMI++N    G EL+A+A ++P  +V    GD I  YVK+  S 
Sbjct  419   AR-VEKGAAVKLAGGIGMILANTEDSGEELIADAHLVPATMVGQTFGDKIKQYVKSDPSP  477

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I FRGTV   SPSAPRVAAFSSRGPN+   EILKPDVIAPGVNILAAWTG  AP++ 
Sbjct  478   TATIAFRGTVIAGSPSAPRVAAFSSRGPNYRAREILKPDVIAPGVNILAAWTGESAPTDL  537

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D RR EFNI+SGTSM+CPHVSGLAA+LR+ +P WSPAA+KSALMTT Y  DNSG  T+
Sbjct  538   AIDPRRVEFNIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYNEDNSGE-TI  596

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              DL TG  STP   G+GHVDP NA DPGLVYD   +DYV FLC +GY    I++F R+  
Sbjct  597   KDLATGVESTPFVRGAGHVDPNNALDPGLVYDADADDYVGFLCALGYSPSLISVFTRDGS  656

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
             + DC ++     G LNYP+FA VF ++  T+TY R V+NVG   N  Y+    +P+ V V
Sbjct  657   VADC-SKKPARSGDLNYPTFAAVFGSDNDTVTYHRVVRNVGSNANAVYEARFVSPAGVDV  715

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQ-------SLRQSADSFGSLRWSDGT-HLVTSPIAVSW  2121
             TV+P++L F +   +L Y++T          +  +  SFGSL WSDG  H VTS IAV+W
Sbjct  716   TVTPSKLAFDEEHQSLGYKITLAVSTKKNPVIVNAKYSFGSLTWSDGAGHNVTSAIAVTW  775



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/726 (50%), Positives = 476/726 (66%), Gaps = 33/726 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +V HGFSARLTP +A  L   PG++SVLP+   +L TTR+P F
Sbjct  61    SSLRSVSDSAEMLYVYNNVIHGFSARLTPQEAESLETQPGILSVLPELKYQLHTTRTPTF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++  P SD  +D+IIGVLD+G+WPE  SF D GL PIP SW+ +CE G  F +
Sbjct  121   LGL-DKSADFFPESDAMSDVIIGVLDTGVWPESKSFDDSGLGPIPASWKGQCESGTNFSS  179

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + RGYE   G PI +  E KS  D  GHGTH ++ A GS V  A++ G
Sbjct  180   SNCNRKLIGARYFSRGYETTLG-PIDESKESKSPRDDDGHGTHTSTTAGGSVVQGASLFG  238

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+AVYKVCW+G C ++DIL+ MD+A+ D V+VLSLS+G     G   
Sbjct  239   YAPGTARGMATRARVAVYKVCWVGGCFSSDILAAMDKAIDDNVNVLSLSLG-----GGIS  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+L
Sbjct  294   DYYRDSVAIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ F+G SLY G       +  VY   A    N   C+ G L   KV+GKIV C +  
Sbjct  354   GNGKNFSGVSLYKGNSLPNKMLPFVYAGNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGI  413

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGM+++N    G ELVA+A ++P   V    GD I DY+ +  +
Sbjct  414   NAR-VQKGSVVKAAGGVGMVLTNTAANGEELVADAHLLPATAVGQKTGDAIRDYLTSDSN  472

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I+F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  473   PTATILFEGTKVGIEPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTG  531

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               +D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G   
Sbjct  532   LEEDDRRVGFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKNG-GA  590

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG PSTP  HG+GHVDP +A +PGLVYD   +DY++FLC + Y   +I+   R +
Sbjct  591   IQDVSTGKPSTPLDHGAGHVDPVSALNPGLVYDITTDDYLNFLCALNYTPSQISSLARRN  650

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAYQV  1935
                 C      +   LNYPSFAV F              +I Y R + NVG      Y+V
Sbjct  651   --FTCNESKKYSVTDLNYPSFAVSFPAESAARTGSAGSSSIKYSRMLTNVGPAGT--YKV  706

Query  1936  TVQTP-SNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS---FGSLRWSDGTHLVTS  2103
             TV +P S+V++TV P  L F+   +  SY VTF +   S+ +   FG + WSDG H+V S
Sbjct  707   TVTSPTSSVKITVEPETLSFSQMNEKKSYTVTFTAPSMSSSTTNVFGRIEWSDGKHVVGS  766

Query  2104  PIAVSW  2121
             P+A+SW
Sbjct  767   PLAISW  772



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/606 (58%), Positives = 432/606 (71%), Gaps = 12/606 (2%)
 Frame = +1

Query  349   QFPATSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavana  522
              FPA++CN+KIIGARA+YRGYE+   RPI   +E KS  D  GHGTH AS AAGS V+NA
Sbjct  4     DFPASACNKKIIGARAFYRGYESYMERPIDETEESKSPRDTEGHGTHTASTAAGSLVSNA  63

Query  523   nvnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKE  702
             ++  +ARGEARG+A  ARIAVYK+CW   C ++DIL+ MDQA+ADGV V+SLS+G     
Sbjct  64    SLFDYARGEARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVG---AS  120

Query  703   GFAKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPA  882
             G+A  Y++D IAIG+FGA Q GV+VSC AGNSGP P+TA NIAPWILTVGASTIDREFPA
Sbjct  121   GYAPQYDQDSIAIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPA  180

Query  883   VVTLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLA  1062
                LG+GR F G SLY G      ++ +VYG     R+C  G+L+ SKV+GKIV C +  
Sbjct  181   DAILGDGRIFGGVSLYAGESLPDFKLHLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGG  240

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V++G AVK +GG+GMI++N    G EL+A++ +IP  +V A  GD I +Y+K ++ 
Sbjct  241   NAR-VEKGAAVKLAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQY  299

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA IVFRGTV   SP AP+VAAFSSRGPN LT EILKPDVIAPGVNILAAWTG+  P++
Sbjct  300   PTATIVFRGTVISPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTD  359

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR +FNI+SGTSM+CPHVSGLAA+LRK YP WSPAAIKSALMTT Y LDNSG + 
Sbjct  360   LEIDPRRVDFNIISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALMTTAYNLDNSGEN-  418

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + DL +G  STP  HG+GHVDP  A +PGLVYD  V++YV FLC+IGYD ++I++F+R  
Sbjct  419   IKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREP  478

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                D   R L  PG LNYPSF+VVF +N   + YKR VKNVG   +  Y+V V  P NV 
Sbjct  479   VSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVA  538

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQS-----LRQSADSFGSLRWSDGTHLVTSPIAVSWEG  2127
             V V P++L F+     L+YE+TF S     L  S    GS+ WSDG HLV SPIAV W  
Sbjct  539   VNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQSGSIEWSDGVHLVRSPIAVRWIQ  598

Query  2128  RSVSEL  2145
              SVS +
Sbjct  599   GSVSSM  604



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/718 (52%), Positives = 483/718 (67%), Gaps = 26/718 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY +V HGFS RLT  +A  L   PG++ VLP+   EL TTR+P+F
Sbjct  49    SSLKSVSDSAEMLYTYNNVIHGFSTRLTDEEAKLLEGRPGILLVLPEVRYELHTTRTPEF  108

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  L P SD  +++++GVLD+G+WPE  SF D+GL PIP+ W+ +CEVG  F A
Sbjct  109   LGL-DKNDGLFPQSDSASEVVVGVLDTGVWPESLSFDDKGLGPIPSGWKGECEVGKNFNA  167

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + RGYEA  G PI    E +S  D  GHGTH ++ AAGS V  A++ G
Sbjct  168   SNCNRKLIGARFFSRGYEATLG-PIDETKESRSPRDDDGHGTHTSTTAAGSVVDGASLFG  226

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT+AR+AVYKVCW+G C +ADIL+ MD+AV DGV+VLS+S+G     G   
Sbjct  227   YAAGAARGMATHARVAVYKVCWIGGCFSADILAAMDKAVDDGVNVLSMSLG-----GGMS  281

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA VTL
Sbjct  282   DYFRDSVAIGAFTAMERGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAYVTL  341

Query  895   GNGRTFTGTSLYFGIQPSPN-QVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ F+G SLY G +P P+ Q++ VY   A +      C+ G L   KV GKIV C + 
Sbjct  342   GNGKNFSGVSLYGG-KPLPDSQLTFVYAGNATNVTSGNLCMIGTLIPEKVAGKIVLCDRG  400

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  VKQ+GG GMI++N    G ELVA+A ++P   V    GD+I +Y+ +  
Sbjct  401   VNAR-VQKGSVVKQAGGAGMILANTAANGEELVADAHLLPATAVGQKTGDMIKNYLFSDP  459

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             + TA I+F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA W+GA+ P+
Sbjct  460   NPTATIIFGGTKLGIQPS-PVVAAFSSRGPNSITPEILKPDLIAPGVNILAGWSGAVGPT  518

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAIKSALMTT+YT   S   
Sbjct  519   GLAVDSRRVGFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIKSALMTTSYTTYKSSEK  578

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLR  1776
              + D+ TG PSTP  HG+GHVDP  A DPGLVYD  V+DY+DFLC + Y S +I +L  R
Sbjct  579   -IQDVATGKPSTPFDHGAGHVDPVAALDPGLVYDITVDDYLDFLCALKYTSLQIGSLAKR  637

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKRTVKNVGKVKNVAYQVTVQTPS  1953
             N    + +  ++ +   LNYPSFAV F +    T+ Y RT+ NVG        V+ QT +
Sbjct  638   NFTCDESKKYSVTD---LNYPSFAVSFTQGGTTTVKYTRTLTNVGTPGTYKVSVSSQTET  694

Query  1954  NVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V++ V P+ L F+   +  ++ VTF   SL     SF  L WSDG H+V SPIA SW
Sbjct  695   -VKILVEPDTLSFSQPNEKKTFTVTFSGGSLPSGTTSFARLEWSDGKHIVGSPIAFSW  751



>gb|AGN03879.1| senescence-associated subtilisin protease [Triticum aestivum]
Length=786

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/709 (51%), Positives = 472/709 (67%), Gaps = 20/709 (3%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLYTY   A G +ARLT +QA+ +A  PGV++V  D+  +L TT +P+FL L S +  L 
Sbjct  76    LLYTYARAATGVAARLTEAQAAHVAAQPGVLAVHRDQARQLHTTHTPEFLHLNSAAGVLP  135

Query  214   PSSDYGA--DIIIGVLDSGIWP-ERSSFS--DRGLNPIPNSWRNKCEVGPQFPATS-CNR  375
              +S  GA  D+++GVLD+GI+P  RSSF     GL P P+S+   C    +F A++ CN 
Sbjct  136   AASGSGAVSDVVVGVLDTGIYPLNRSSFKPVGDGLGPPPSSFSGGCVSAAKFNASAFCNS  195

Query  376   KIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGE  549
             K+IGA+ +Y+GYE   G PI +  E KS +D  GHGTH AS AAGS V  A    +ARG 
Sbjct  196   KLIGAKFFYKGYEEGLGHPINETLESKSPLDTEGHGTHTASTAAGSPVDGAGFYQYARGR  255

Query  550   ARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNED  729
             A G+A  ARIA YK+CW   C ++DIL+  D+AV DGV+V+SLS+G      +A  + ED
Sbjct  256   AVGMAPTARIAAYKICWKSGCFDSDILAAFDEAVGDGVNVISLSVG----STYAADFYED  311

Query  730   PIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRT  909
              IAIGAFGAV+KG++VS  AGNSGP  YTA NIAPWILTVGAST+DREFPA   LG+G  
Sbjct  312   SIAIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVGASTVDREFPADAVLGDGSV  371

Query  910   FTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGF  1089
             + G SLY G   +  ++ +VY     SR CL G+LD  KV GKIV C++  N   V++G 
Sbjct  372   YGGVSLYAGDPLNSTKLPLVYAADCGSRLCLIGELDKDKVAGKIVLCERGVNAR-VEKGA  430

Query  1090  AVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRG  1269
             AV ++GG+GMI++N    G EL+A+  +IP+ +V    GD I  YVK   S TA IVF G
Sbjct  431   AVGKAGGIGMILANTEESGEELIADPHLIPSTMVGQKFGDKIRHYVKTDPSPTATIVFHG  490

Query  1270  TVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTE  1449
             TV G SPSAPRVA+FSSRGPN   PEILKPDV APGVNILA WTG  +P++   D RR  
Sbjct  491   TVIGKSPSAPRVASFSSRGPNSRAPEILKPDVTAPGVNILADWTGEASPTDLDIDPRRVP  550

Query  1450  FNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP  1629
             FNI+SGTSM+CPHVSGLAA+LR+ +P WSP  +KSALMTT Y +DNSG   + DL TG  
Sbjct  551   FNIISGTSMSCPHVSGLAALLRQAHPDWSPTVVKSALMTTAYNMDNSGE-IIKDLATGTE  609

Query  1630  STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRN  1809
             STP   G+GHVDP +A +PGLVYD    DY+ FLC +GY   +IA+F R+  + DC ++ 
Sbjct  610   STPFVRGAGHVDPISALNPGLVYDADTADYIGFLCALGYTPAQIAVFTRDGSVADC-SKK  668

Query  1810  LGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLV  1989
                 G LNYP+FA VF +   ++TY R V+NVG   +  Y+  V++P+ V   V+P +LV
Sbjct  669   PARSGDLNYPAFAAVFSSYKDSVTYHRVVRNVGSDASAVYEAKVESPAGVDAKVTPAKLV  728

Query  1990  FTDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             F +   +L+YE+T        +  +  SFGS+ WSDG H VTSPIAV+W
Sbjct  729   FDEEHRSLAYEITLAVSGNPVIVDAKYSFGSVTWSDGKHNVTSPIAVTW  777



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/708 (51%), Positives = 468/708 (66%), Gaps = 17/708 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              L+YTY   A G +ARLT +QA+ +A  PGV++V  D   +L TT +P+FL L S +  L
Sbjct  74    RLVYTYARAATGVAARLTEAQAAHVAAQPGVLAVHRDEARQLHTTHTPEFLRLSSAAGLL  133

Query  211   GPSSDYGADIIIGVLDSGIWP-ERSSF--SDRGLNPIPNSWRNKCEVGPQFPATS-CNRK  378
               +S   +D+++GVLD+GI+P  R SF  +  GL P P+S+   C     F A++ CN K
Sbjct  134   PAASGAVSDVVVGVLDTGIYPLNRGSFKPAGDGLGPPPSSFSGGCVSAAAFNASAYCNSK  193

Query  379   IIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             ++GA+ +Y+GYEA  G PI +  E KS +D  GHGTH AS AAGS V  A    +ARG A
Sbjct  194   LVGAKFFYKGYEAGLGHPINENLESKSPLDTEGHGTHTASTAAGSPVDGAGFYNYARGRA  253

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
              G+A  ARIA YK+CW   C ++DIL+  D+AV DGV+V+SLS+G     G+A  + ED 
Sbjct  254   VGMAPTARIAAYKICWKSGCYDSDILAAFDEAVGDGVNVISLSVG---SSGYASAFYEDS  310

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IAIGAFGAV+KG++VS  AGNSGP  YTA NIAPWILTV AS+IDREFPA   LG+G  +
Sbjct  311   IAIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVAASSIDREFPADAILGDGSVY  370

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              G SLY G   +  ++ +VY     SR C  G+LD  KV GKIV C++  N  +  +G A
Sbjct  371   GGVSLYAGDPLNSTKLPVVYAADCGSRLCGRGELDKDKVAGKIVLCERGGNARVA-KGAA  429

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             V+++GG+GMI++N    G EL+A++ +IP  +V    GD I  YV    S TA IVF GT
Sbjct  430   VQEAGGIGMILANTEESGEELIADSHLIPATMVGQKFGDKIRQYVTTDPSPTATIVFHGT  489

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G SPSAPRVAAFSSRGPN+   EILKPDV APGVNILAAWTG  +P++   D RR  F
Sbjct  490   VIGKSPSAPRVAAFSSRGPNYRAAEILKPDVTAPGVNILAAWTGEASPTDLEIDPRRVPF  549

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPHVSGLAA+LR+ +P WSPAA+KSALMTT Y LDNSG   + DL TG  S
Sbjct  550   NIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYNLDNSGE-IIKDLATGSQS  608

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   G+GHVDP +A +PGLVYD    DY+ FLC +GY   +IA+F R+  + DC ++  
Sbjct  609   TPFVRGAGHVDPNSALNPGLVYDADTADYIGFLCALGYTPSQIAVFTRDGSVADC-SKKP  667

Query  1813  GNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVF  1992
                G LNYP+FA VF +   ++TY R V NVG      Y+  V++P+ V   V+P +LVF
Sbjct  668   ARSGDLNYPAFAAVFSSYKDSVTYHRVVSNVGGDPKAVYEAKVESPAGVDAKVTPAKLVF  727

Query  1993  TDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              +   +L+YE+T        +     SFGS+ WSDG H VTSPIAV+W
Sbjct  728   DEEHRSLAYEITLAVAGNPVIVDGKYSFGSVTWSDGVHNVTSPIAVTW  775



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/708 (51%), Positives = 468/708 (66%), Gaps = 17/708 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              L+YTY   A G +ARLT +QA+ +A  PGV++V  D   +L TT +P+FL L S +  L
Sbjct  74    RLVYTYARAATGVAARLTEAQAAHVAAQPGVLAVHRDEARQLHTTHTPEFLRLSSAAGLL  133

Query  211   GPSSDYGADIIIGVLDSGIWP-ERSSF--SDRGLNPIPNSWRNKCEVGPQFPATS-CNRK  378
               +S   +D+++GVLD+GI+P  R SF  +  GL P P+S+   C     F A++ CN K
Sbjct  134   PAASGAVSDVVVGVLDTGIYPLNRGSFKPAGDGLGPPPSSFSGGCVSAAAFNASAYCNSK  193

Query  379   IIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             ++GA+ +Y+GYEA  G PI +  E KS +D  GHGTH AS AAGS V  A    +ARG A
Sbjct  194   LVGAKFFYKGYEAGLGHPINENLESKSPLDTEGHGTHTASTAAGSPVDGAGFYNYARGRA  253

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
              G+A  ARIA YK+CW   C ++DIL+  D+AV DGV+V+SLS+G     G+A  + ED 
Sbjct  254   VGMAPTARIAAYKICWKSGCYDSDILAAFDEAVGDGVNVISLSVG---SSGYASAFYEDS  310

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IAIGAFGAV+KG++VS  AGNSGP  YTA NIAPWILTV AS+IDREFPA   LG+G  +
Sbjct  311   IAIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVAASSIDREFPADAILGDGSVY  370

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              G SLY G   +  ++ +VY     SR C  G+LD  KV GKIV C++  N  +  +G A
Sbjct  371   GGVSLYAGDPLNSTKLPVVYAADCGSRLCGRGELDKDKVAGKIVLCERGGNARVA-KGAA  429

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             V+++GG+GMI++N    G EL+A++ +IP  +V    GD I  YV    S TA IVF GT
Sbjct  430   VQEAGGIGMILANTEESGEELIADSHLIPATMVGQKFGDKIRQYVTTDPSPTATIVFHGT  489

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G SPSAPRVAAFSSRGPN+   EILKPDV APGVNILAAWTG  +P++   D RR  F
Sbjct  490   VIGKSPSAPRVAAFSSRGPNYRAAEILKPDVTAPGVNILAAWTGEASPTDLEIDPRRVPF  549

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPHVSGLAA+LR+ +P WSPAA+KSALMTT Y LDNSG   + DL TG  S
Sbjct  550   NIISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALMTTAYNLDNSGE-IIKDLATGSQS  608

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   G+GHVDP +A +PGLVYD    DY+ FLC +GY   +IA+F R+  + DC ++  
Sbjct  609   TPFVRGAGHVDPNSALNPGLVYDADTADYIGFLCALGYTPSQIAVFTRDGSVADC-SKKP  667

Query  1813  GNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVF  1992
                G LNYP+FA VF +   ++TY R V NVG      Y+  V++P+ V   V+P +LVF
Sbjct  668   ARSGDLNYPAFAAVFSSYKDSVTYHRVVSNVGGDPKAVYEAKVESPAGVDAKVTPAKLVF  727

Query  1993  TDRIDTLSYEVTFQ-----SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              +   +L+YE+T        +     SFGS+ WSDG H VTSPIAV+W
Sbjct  728   DEEHRSLAYEITLAVAGNPVIVDGKYSFGSVTWSDGVHNVTSPIAVTW  775



>ref|XP_010088794.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36977.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/727 (53%), Positives = 482/727 (66%), Gaps = 36/727 (5%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P+S H   S LLYTYE VA+GF+  LTPSQA++L ++PGV+SV+PD   EL  T + +FL
Sbjct  67    PISRHP--SMLLYTYERVANGFAVSLTPSQAAKLEDIPGVLSVMPDEAQELHITHTYRFL  124

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT  363
             GL S  S L PSS+YG DIIIGV D+GIWPE  SFSD GL+P+P+SW+  CE    FPA+
Sbjct  125   GL-SPDSGLWPSSNYGEDIIIGVFDTGIWPEHRSFSDAGLSPVPSSWKGTCETWNDFPAS  183

Query  364   SCNRKIIGARAYYRGY-------EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavana  522
             SCNRKIIGAR++  G+         +    I + P+   D  GHGTH  S AAGS V+NA
Sbjct  184   SCNRKIIGARSFLAGHYMSNLAGSTLNLSAITNSPR---DTYGHGTHTTSTAAGSVVSNA  240

Query  523   nvnghaRGEARGIATNARIAVYKVCWL-GTCSNADILSGMDQAVADGVHVLSLSIGLKNK  699
             +  G+A+GEA GIAT ARIAVYKVC     C  ADIL+GMDQAVADGV ++S+S+     
Sbjct  241   SFYGYAKGEAIGIATKARIAVYKVCATKKVCRVADILAGMDQAVADGVDIISMSL-----  295

Query  700   EGFAKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFP  879
              G  KPY  D IAI  FGA+Q G++VS   GN GP   T  ++ PW+LTVGAS++DREF 
Sbjct  296   SGGTKPYYRDNIAIATFGAMQHGILVSVSGGNQGPTRSTVNHLPPWVLTVGASSVDREFR  355

Query  880   AVVTLGNGRTFTGTSLYFG-IQPSPNQVSMVYGRRANSRYCLPGQLDAS-KVRGKIVYCK  1053
             A V LG+ RTF G SLY G   P  +Q  +VYG    + +C  GQ +   ++ GKI+ C+
Sbjct  356   ADVVLGDNRTFLGASLYPGPFFPFTDQYELVYGGDFGNVFCKVGQFNKQDQLAGKIIVCE  415

Query  1054  QLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKN  1233
             Q  + +  D  +AV    G G II N R  G EL A     P   V+  DG+ I  Y+++
Sbjct  416   Q-GDTSSSDMAYAVANVTGRGAIILNNRKYGEELRAEQHRWPATRVSMTDGNEIKRYLQS  474

Query  1234  TKSATARIVFRGTVTGNS-PSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAI  1410
             +++ TA I+FRGTV G++ P AP+VA FSSRGPN LTP+ILKPDVIAPG+NILAAWT A 
Sbjct  475   SENPTANILFRGTVNGSTFPPAPKVATFSSRGPNPLTPQILKPDVIAPGLNILAAWTNAT  534

Query  1411  APSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNS  1590
              P     D RR EFN++SGTSMACPHVSG++A+L+K YPSWSPAAIKSALMTT Y LDNS
Sbjct  535   GP-RGGNDPRRVEFNVISGTSMACPHVSGISALLKKAYPSWSPAAIKSALMTTAYNLDNS  593

Query  1591  GRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF  1770
             G+  L DL TG  STP AHGSGHVDP+ A DPGL+YD  V DYV FLC+IGY S+ I++F
Sbjct  594   GQR-LKDLATGKTSTPFAHGSGHVDPSRALDPGLIYDMSVTDYVGFLCSIGYSSKLISIF  652

Query  1771  LRN--SPLVDCRNR--NLG---NPGALNYPSFAVVFKNN-LQTITYKRTVKNVGKVKNVA  1926
                  SP + C      LG    PG LN PSF+VVFKN+ ++T+ Y+RTV NVG   +  
Sbjct  653   FTQTVSPKI-CEETYAALGARVTPGDLNLPSFSVVFKNDQVETVKYRRTVTNVGTNVDAV  711

Query  1927  YQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL--RQSADSFGSLRWSDGTHLVT  2100
             Y  T   P+ V++TVSP +LVF     T +YE+TF           FG ++WSDG H V 
Sbjct  712   YSATGVQPAGVKITVSPKKLVFDANNLTQTYEITFSPTGGHGKLARFGWIQWSDGIHSVR  771

Query  2101  SPIAVSW  2121
             S IA SW
Sbjct  772   STIAFSW  778



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/726 (50%), Positives = 473/726 (65%), Gaps = 33/726 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +V HGFSARLTP +A  L   PG++SVLP+   +L TTR+P F
Sbjct  61    SSLKSVSDSAEMLYVYNNVVHGFSARLTPQEAESLETQPGILSVLPELKYQLHTTRTPTF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL  G+ +  P SD  +D+IIGVLD+G+WPE  SF D GL P+P SW+ +CE G  F +
Sbjct  121   LGLDKGA-DFFPESDAMSDVIIGVLDTGVWPESKSFDDTGLGPVPASWKGQCESGTNFSS  179

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + RGYE   G PI +  E KSA D  GHGTH ++ A GS V  A++ G
Sbjct  180   SNCNRKLIGARYFSRGYETTLG-PIDESRESKSARDDDGHGTHTSTTAGGSVVQGASLFG  238

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+AVYKVCW+G C ++DIL+ MD+A+ D V+VLSLS+G     G   
Sbjct  239   YAPGTARGMATRARVAVYKVCWVGGCFSSDILAAMDKAIDDNVNVLSLSLG-----GGIS  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+L
Sbjct  294   DYYRDSVAIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ F+G SLY G   S   +  V+   A    N   C+ G L   KV+GKIV C +  
Sbjct  354   GNGKNFSGVSLYKGNSLSNKMLPFVFAGNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGI  413

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG GM+++N    G ELVA+A ++P   V    GD I DY+ +  +
Sbjct  414   NAR-VQKGSVVKAAGGAGMVLTNTAANGEELVADAHLLPATAVGQKTGDAIRDYLTSDSN  472

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               A I+F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  473   PMATILFEGTKVGIEPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTG  531

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               +D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G   
Sbjct  532   LEEDDRRVGFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKNG-GA  590

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG PST   HG+GHVDP +A +PGLVYD   +DY+DFLC + Y   +I    R +
Sbjct  591   IQDVSTGKPSTLFDHGAGHVDPVSALNPGLVYDITADDYLDFLCALNYTPSQINSLARRN  650

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAYQV  1935
                 C      +   LNYPSFAV F              +I Y RT+ NVG      Y+V
Sbjct  651   --FTCNESKKYSVTDLNYPSFAVSFPAESAARTGSAGSSSIKYSRTLTNVGPAGT--YKV  706

Query  1936  TVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS---FGSLRWSDGTHLVTS  2103
             TV +PSN V++ V P  L F+   +  SY VTF +   S+ +   FG + WSD  H+V S
Sbjct  707   TVTSPSNSVKIMVEPETLSFSQMNEKKSYTVTFTAPSMSSSTTNVFGRIEWSDEKHVVGS  766

Query  2104  PIAVSW  2121
             P+A+SW
Sbjct  767   PVAISW  772



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/724 (50%), Positives = 479/724 (66%), Gaps = 30/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +V HGFSARLT  +A  L    G++SVLP+   EL TTR+P F
Sbjct  57    SSLKSVSDSAEMLYVYNNVVHGFSARLTIQEAESLERQSGILSVLPELRYELHTTRTPSF  116

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++  P S+  +D+++GVLD+G+WPE  SF D GL PIP+SW+ +CE G  F +
Sbjct  117   LGL-DRSADFFPESNAMSDVVVGVLDTGVWPESKSFDDTGLGPIPDSWKGECESGTNFSS  175

Query  361   TSCNRKIIGARAYYRGYEAVTG-RPIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             ++CNRK+IGAR + +GYE   G   +  E KSA D  GHGTH A+ AAGS V  A++ G+
Sbjct  176   SNCNRKLIGARYFSKGYETTLGPVDVSKESKSARDDDGHGTHTATTAAGSVVQGASLFGY  235

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+AT AR+AVYKVCW+G C ++DIL+ MD+A+ D V+VLSLS+G  N +     
Sbjct  236   ASGTARGMATRARVAVYKVCWIGGCFSSDILAAMDKAIDDNVNVLSLSLGGGNSD-----  290

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+LG
Sbjct  291   YYRDSVAIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLG  350

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ F+G SLY G       +  VY   A    N   C+ G L   KV+GKIV C +  N
Sbjct  351   NGKNFSGVSLYKGDLSLSKMLPFVYAGNASNTTNGNLCMTGTLIPEKVKGKIVLCDRGIN  410

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  VK++GGVGM+++N    G ELVA+A ++P   V    G+ I  Y+ +  + 
Sbjct  411   PR-VQKGSVVKEAGGVGMVLANTAANGDELVADAHLLPATTVGQTTGEAIKKYLTSDPNP  469

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +T EILKPD+IAPGVNILA WTGA+ P+  
Sbjct  470   TATILFEGTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAVGPTGL  528

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT+  +G   L
Sbjct  529   AEDTRRVGFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYTVYKNG-GAL  587

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG PSTP  HG+GHVDP  A +PGLVYD   +DY++FLC + Y S +I    R + 
Sbjct  588   QDVSTGKPSTPFDHGAGHVDPVAALNPGLVYDLRADDYLNFLCALNYTSIQINSIARRN-  646

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNL--------QTITYKRTVKNVGKVKNVAYQV-T  1938
               +C      +   LNYPSFAVVF   +         ++ Y RT+ NVG      Y+V T
Sbjct  647   -YNCETSKKYSVTDLNYPSFAVVFPEQMTAGSGSSSSSVKYTRTLTNVGPAGT--YKVST  703

Query  1939  VQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPI  2109
             V +PSN V+V+V P  LVFT   +  SY VTF   S+  + + +G + WSDG H+V SP+
Sbjct  704   VFSPSNSVKVSVEPETLVFTRANEQKSYTVTFTAPSMPSTTNVYGRIEWSDGKHVVGSPV  763

Query  2110  AVSW  2121
             A+SW
Sbjct  764   AISW  767



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/724 (50%), Positives = 476/724 (66%), Gaps = 31/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY++V HGFS RLT  +A  L   PG++SVLP+   EL TTR+P+F
Sbjct  58    SSLKSVSDSAEMLYTYDNVIHGFSTRLTDEEAKLLEAQPGILSVLPEVRYELHTTRTPEF  117

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  L P SD  +++ +GVLD+GIWPE  SF D+GL P+P+ W+ +CEVG  F  
Sbjct  118   LGL-DKNEGLFPQSDIASEVFVGVLDTGIWPESLSFDDKGLGPVPSGWKGECEVGKNFNT  176

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA  G PI    E KS  D  GHGTH ++ AAGS V  A++ G
Sbjct  177   SNCNRKLIGARFFSKGYEATLG-PIDETKESKSPRDDDGHGTHTSTTAAGSVVDGASLFG  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+AVYKVCW+G C +ADIL+ M++A+ DGV+V+S+S+G     G   
Sbjct  236   YAAGAARGMATRARVAVYKVCWIGGCFSADILAAMEKAIDDGVNVISMSLG-----GGMA  290

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +A+GAF A+++G++VSC AGN+GP+ Y+  N+APWI TVGA T+DR+FPA V L
Sbjct  291   DYYKDTVAVGAFAAMERGILVSCSAGNAGPNSYSLSNVAPWITTVGAGTLDRDFPAYVNL  350

Query  895   GNGRTFTGTSLYFGIQPSPNQ-VSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ F+G SLY G +P P+  +  VY   A    N   C+ G L   KV GKIV C + 
Sbjct  351   GNGKNFSGVSLYSG-KPLPDSLIEFVYAGNATNVTNGNLCMVGTLIPEKVAGKIVLCDRG  409

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +GF VKQ+GGVGMI++N    G ELVA+A ++P   V    GD+I +Y+ +  
Sbjct  410   INAR-VQKGFVVKQAGGVGMILANTAANGEELVADAHLLPATAVGEKTGDMIKNYLFSDP  468

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             S TA I+F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNI+A W+GA+ P+
Sbjct  469   SPTATILFGGTKVGIQPS-PVVAAFSSRGPNAITPEILKPDLIAPGVNIIAGWSGAVGPT  527

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
               + D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAIKSALMTT Y    +G  
Sbjct  528   GLSMDSRRVNFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIKSALMTTAYITYKNGIK  587

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              + D+ TG  STP  HG+GHVDP +A DPGLVYD  V+DY+DFLC + Y S +I    R 
Sbjct  588   -IQDVATGRASTPFDHGAGHVDPVSALDPGLVYDITVDDYLDFLCALQYTSLQINSIARR  646

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKN--------NLQTITYKRTVKNVGKVKNVAYQV  1935
             +   D   +   +   LNYPSFA+ F             T+ Y RT+ NVG        V
Sbjct  647   NFTCDATKKY--SVTDLNYPSFAIPFDTAQSGRTAAATTTVKYTRTLTNVGTPATYKASV  704

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPI  2109
             T Q  S V++ V P  L F+   +  +Y VTF   S+     SF  L WSDG H+V SPI
Sbjct  705   TSQVAS-VKILVEPESLAFSQTNEKKTYTVTFSGGSMPSGTTSFARLEWSDGKHVVGSPI  763

Query  2110  AVSW  2121
             A SW
Sbjct  764   AFSW  767



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/723 (50%), Positives = 471/723 (65%), Gaps = 29/723 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +  HGF+ARLTP +A  L N PG++SVLP+   EL TTR+P F
Sbjct  60    SSLRSVSASAEMLYVYNNAVHGFAARLTPEEAESLQNQPGILSVLPEMKYELHTTRTPLF  119

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++  P S+   D+I+GVLD+G+WPE  SF D G  PIP SW+ +CE G  F +
Sbjct  120   LGL-DVSADYFPESNAMGDVIVGVLDTGVWPESKSFDDNGFGPIPASWKGECESGTNFTS  178

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
              +CNRK+IGAR + +GYE+  G   +  E KS  D  GHGTH ++ AAGS V  A++ G+
Sbjct  179   KNCNRKLIGARYFAKGYESTLGPIDVSKESKSPRDDDGHGTHTSTTAAGSVVQGASLLGY  238

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+AT+AR+AVYKVCW+G C ++DIL+G+D+A+ D V+VLSLS+G  N +     
Sbjct  239   ASGNARGMATHARVAVYKVCWVGGCFSSDILAGLDKAIDDNVNVLSLSLGGGNSD-----  293

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IAIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+LG
Sbjct  294   YYRDSIAIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLG  353

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ F+G SLY G       +  VY   A    N   C+ G L   +V+GKIV C +  N
Sbjct  354   NGKNFSGVSLYKGDSSLSKMLPFVYAGNASNMTNGNLCMTGTLIPEEVKGKIVLCDRGIN  413

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  VK +GG GM+++N    G EL+A+A +IP   V    G+ I  Y+ +  + 
Sbjct  414   PR-VQKGSVVKAAGGAGMVLANTAANGDELIADAHLIPATSVGQTTGEAIKKYLTSDPNP  472

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +T EILKPD+IAPGVNILA WTGA  P+  
Sbjct  473   TATILFEGTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAAGPTGL  531

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D+RR EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT+   G   L
Sbjct  532   AEDDRRVEFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYTVYKKG-GAL  590

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG PSTP  HG+GHVDP  A +PGLVYD   +DY++FLC + Y S +I    R   
Sbjct  591   QDVVTGKPSTPFDHGAGHVDPVAALNPGLVYDLKADDYLNFLCALNYTSIQINSVARRP-  649

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQT--------ITYKRTVKNVGKVKNVAYQVTV  1941
                C      +   LNYPSFAVVF   +          I + RT+ NVG      Y+V V
Sbjct  650   -FSCETSKKFSVADLNYPSFAVVFPEQMTASSGSGSSSIKHTRTLTNVGPAGT--YKVNV  706

Query  1942  QTPSN-VRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIA  2112
              +PSN V+V V P  L FT   +  SY VTF   S+  + + +  + WSDG H+V+SP+A
Sbjct  707   ISPSNSVKVVVEPEILAFTRMNEQKSYTVTFTAPSMPSTENVYARIEWSDGKHIVSSPVA  766

Query  2113  VSW  2121
             +SW
Sbjct  767   ISW  769



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/716 (50%), Positives = 479/716 (67%), Gaps = 27/716 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E++Y Y +V HGF+ARLT  +A  L   PG++SVL + + +L TTR+P FLG
Sbjct  63    LKSVSESAEMIYVYNNVIHGFAARLTAQEAESLKTQPGILSVLSEVIYQLHTTRTPLFLG  122

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L     ++   SD  +++IIG+LDSGIWPER SF D GL P+P SW+ +CE G  F +  
Sbjct  123   L-DNRPDVFNDSDAMSNVIIGILDSGIWPERRSFDDTGLGPVPESWKGECESGINFSSAM  181

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK+IGAR +  GYEA  G PI +  E KS  D  GHGTH AS AAGS V  A++ G+A
Sbjct  182   CNRKLIGARYFSSGYEATLG-PIDESKESKSPRDNEGHGTHTASTAAGSVVQGASLFGYA  240

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A  AR+AVYKVCWLG C   DIL+GMD+A+ D V+VLSLS+G ++ +     +
Sbjct  241   SGTARGMAYRARVAVYKVCWLGKCFGPDILAGMDKAIDDNVNVLSLSLGGEHFD-----F  295

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +AIGAF A++KG++VSC AGN+GP+ ++  N APWI TVGA T+DR+FPA V+LGN
Sbjct  296   YSDDVAIGAFAAMEKGIMVSCSAGNAGPNQFSLANQAPWITTVGAGTVDRDFPAYVSLGN  355

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLANI  1068
             G+ F+G SLY G       + +VY   A    N   C+ G L   KV+GKIV C    N+
Sbjct  356   GKNFSGVSLYAGDPLPSGMLPLVYAGNASNATNGNLCIMGTLIPEKVKGKIVLCDGGVNV  415

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
                ++G+ VK +GG GMI +N    G  L+A+A ++P A V   DGD I  Y+ +  + T
Sbjct  416   R-AEKGYVVKSAGGAGMIFANT--NGLGLLADAHLLPAAAVGQLDGDEIKKYITSDPNPT  472

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A I+F GT+ G  P AP +AAFSSRGPN +TPEILKPD+IAPGVNILA W+GA+ P+   
Sbjct  473   ATILFGGTMVGVQP-APILAAFSSRGPNSITPEILKPDIIAPGVNILAGWSGAVGPTGLP  531

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
             +D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT YT   +G   L+
Sbjct  532   EDDRRVEFNIISGTSMSCPHVSGLAALLKGVHPEWSPAAIRSALMTTAYTTYRNG-GALL  590

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL  1788
             D+ TG PSTP  HG+GHVDP +A +PGLVYD   +DY++FLC + Y   +I +  R +  
Sbjct  591   DVATGKPSTPFGHGAGHVDPVSAVNPGLVYDINADDYLNFLCALKYSPSQINIIARRN--  648

Query  1789  VDCRNRNLGNPGALNYPSFAVVFKNNL--QTITYKRTVKNVGKVKNVAYQVTVQTP-SNV  1959
               C +  + +   LNYPSF+V F  +    TI Y RT+ NVG   +  Y+V V  P S+V
Sbjct  649   FTCDSSKIYSVTDLNYPSFSVAFPADTGSNTIRYSRTLTNVG--PSGTYKVAVTLPDSSV  706

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQSLRQ--SADSFGSLRWSDGTHLVTSPIAVSW  2121
              + V P  + FT   + +SY V+F +  +  S + FG + WSDGTHLVTSP+A+SW
Sbjct  707   EIIVEPETVSFTQINEKISYSVSFTAPSKPPSTNVFGKIEWSDGTHLVTSPVAISW  762



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/723 (49%), Positives = 469/723 (65%), Gaps = 29/723 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +  HGF+ARLT  +A  L N PG++SVLP+   EL TTR+P F
Sbjct  61    SSLRSVSGSAEMLYVYNNAVHGFAARLTAEEAESLQNQPGILSVLPEMKYELHTTRTPSF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++  P S+   D+I+GVLD+G+WPE  SF D G  PIP SW+ +CE G  F +
Sbjct  121   LGL-DVSADYFPESNAMGDVIVGVLDTGVWPESKSFDDTGFGPIPASWKGECESGTNFTS  179

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
              +CNRK+IGAR + +GYE+  G   +  E KS  D  GHGTH ++ A GS V  A++ G+
Sbjct  180   KNCNRKLIGARYFAKGYESTLGPIDVSKESKSPRDDDGHGTHTSTTATGSVVQGASLLGY  239

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+AT+AR+AVYKVCW+G C ++DIL+ +D+A+ D V+VLSLS+G  N +     
Sbjct  240   ASGNARGMATHARVAVYKVCWVGGCFSSDILAALDKAIDDNVNVLSLSLGGGNSD-----  294

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+LG
Sbjct  295   YYRDSVAIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLG  354

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ F+G SLY G       +  VY   A    N   C+ G L   +V+GKIV C +  N
Sbjct  355   NGKNFSGVSLYKGASSLSKMLPFVYAGNASNMTNGNLCMSGTLIPEEVKGKIVLCDRGIN  414

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  VK +GG GM+++N    G EL+A+A +IP   V    G+ I +Y+ +  + 
Sbjct  415   PR-VQKGSVVKAAGGAGMVLANTAANGDELIADAHLIPATSVGQTTGEAIKNYLTSNPNP  473

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +T EILKPD+IAPGVNILA WTGA  P+  
Sbjct  474   TATILFEGTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAAGPTGL  532

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D+RR EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT+   G   L
Sbjct  533   AEDDRRVEFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYTVYKKG-GAL  591

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG PSTP  HG+GHVDP  A +PGLVYD   +DY++FLC + Y S +I    R  P
Sbjct  592   QDVVTGKPSTPFDHGAGHVDPVAALNPGLVYDLKADDYLNFLCALNYTSIQINSVARR-P  650

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQT--------ITYKRTVKNVGKVKNVAYQVTV  1941
                  N+       LNYPSFAVVF   +          I + RT+ NVG      Y+V V
Sbjct  651   FSCATNKKF-RVADLNYPSFAVVFPEQMTASSGSGSSSIKHTRTLTNVGPAGT--YKVNV  707

Query  1942  QTPSN-VRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIA  2112
               PSN V+V V P  L FT   +  SY VTF   S+  + + +  + WSDG H+V+SP+A
Sbjct  708   IKPSNSVKVVVEPETLAFTRMNEQKSYTVTFTAPSMPSTENVYARIEWSDGKHVVSSPVA  767

Query  2113  VSW  2121
             +SW
Sbjct  768   ISW  770



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/723 (50%), Positives = 477/723 (66%), Gaps = 31/723 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E+LY+Y+ VAHGFSARLT ++A  L ++ GV+SVLP+   EL TTR+P+FLG
Sbjct  59    LRSVSSSAEILYSYDTVAHGFSARLTTAEAQALESLDGVLSVLPEVRYELHTTRTPEFLG  118

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   S +L P ++ G+D+++GVLD+G+WPER SF D G  P+P  W+  CE G  F AT 
Sbjct  119   L-DKSDDLVPQANTGSDVVVGVLDTGVWPERKSFDDAGFGPVPAGWKGACEEGKDFKATD  177

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK+IGAR + +GYEA  G PI +  E +S  D  GHGTH ++ AAGSAV +A++ G A
Sbjct  178   CNRKLIGARFFSKGYEASMG-PIDETRELRSPRDSDGHGTHTSTTAAGSAVTDASLLGFA  236

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT AR+A YKVCW+G C ++DIL+ +D+AV DG HVLSLS+G     G    Y
Sbjct  237   AGTARGMATRARVAAYKVCWVGGCFSSDILAAIDRAVDDGCHVLSLSLG-----GGMSDY  291

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +AIGAF A++KGV+VSC AGNSGP   +  N+APWI TVGA T+DR+FPA V LGN
Sbjct  292   YRDSVAIGAFNAMEKGVLVSCSAGNSGPSASSLSNVAPWITTVGAGTLDRDFPAYVVLGN  351

Query  901   GRTFTGTSLYFGIQPSPNQ-VSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLAN  1065
             G+ ++G SLY G +P P+  + +VY   A++      C+PG L   KV GKIV C++  +
Sbjct  352   GKNYSGVSLYSG-KPLPSSPLPIVYAGNASNATGGNLCMPGTLMPEKVAGKIVLCERGIS  410

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G+ V+ +GG GMI++N    G ELVA+A ++P   V    GD I  Y+ +  S 
Sbjct  411   PR-VQKGYVVRDAGGAGMILANTDANGEELVADAHLLPANGVGEKAGDAIKRYLLSEMSP  469

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA IVF GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+  
Sbjct  470   TATIVFGGTKVGVRPS-PVVAAFSSRGPNVVTPEILKPDLIAPGVNILAGWTGAVGPTGL  528

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
             + D+RR EF+I+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y     G   +
Sbjct  529   SVDSRRVEFSIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYADYPGGNGGV  588

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             +D+ TG  +TP  +G+GHVDP    DPGLVYD   +DY+DFLC + Y S +IA   + + 
Sbjct  589   LDVATGKAATPFDYGAGHVDPRRGMDPGLVYDLTADDYIDFLCALNYTSLQIAAVAKRTN  648

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKN------NLQTITYKRTVKNVGKVKNVAYQVTVQT  1947
                 R R     G LNYPSFAV F+        + T+ + RT+ +VG      Y+ TV T
Sbjct  649   YTCDRKRTYAVSG-LNYPSFAVAFETASGDRVGVATVKHTRTMTSVGGPGT--YKATVAT  705

Query  1948  P---SNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIA  2112
                   V+V V P  L FT   +  SY V+F   SL   +  FG L WSDG H+V SPIA
Sbjct  706   AVTGGEVKVAVEPAELSFTKVGEKQSYTVSFSAPSLPSGSSGFGRLEWSDGKHVVASPIA  765

Query  2113  VSW  2121
              +W
Sbjct  766   FTW  768



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/720 (51%), Positives = 476/720 (66%), Gaps = 31/720 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTY +  HGFS RLTP +A  L   PGVISVLP++  EL TTR+P F
Sbjct  55    SSLKSVSESAELLYTYNNAIHGFSTRLTPQEADSLMTQPGVISVLPEQQYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   + +L P ++  +D+++GV+D+G+WPER SFSD+G  PIP++W+ KCEVG  F A
Sbjct  115   LGLDVHNGDLFPETEASSDVVVGVIDTGVWPERKSFSDKGYGPIPSTWKGKCEVGTNFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYEA  G PI +  E +S  D  GHGTH +S AAGS V  AN  G
Sbjct  175   SLCNRKLIGARFFARGYEAEKG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGANFLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+AVYKVCW G C ++D+L+ +D+A+ D V+VLS+S+     +    
Sbjct  234   FANGTARGMAPGARLAVYKVCWKGGCFDSDVLAAIDKAIDDNVNVLSISM-----DDLTL  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  + IAIGAF A+++G++VSC AGNSGP      N+APWI TVGA TIDR+FPA+V L
Sbjct  289   DYYRNDIAIGAFAAMERGILVSCSAGNSGPRSSDISNVAPWITTVGAGTIDRDFPALVIL  348

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG  ++G SL  G    P  +  VY   A    N  +C+ G L   KV+GKIV C +  
Sbjct  349   GNGNNYSGVSLIKG-DALPELLPFVYAGNASNATNGNFCVSGTLIPEKVKGKIVMCDRGV  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V++G  VK  GG+GMI++N    G ELVA+A ++P   V    G+II  YV    +
Sbjct  408   NFR-VEKGEVVKAVGGLGMILANTAENGEELVADAHLLPATAVGEKAGEIIRHYVITHPN  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I+ +GTV    PS P VAAFS RGPN  TP ILKPD+IAPGVNILAAWTGA  P+E
Sbjct  467   PTASILTQGTVVNVQPS-PVVAAFSLRGPNPTTPNILKPDLIAPGVNILAAWTGAKGPTE  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y+    G+  
Sbjct  526   LASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYSTYKDGKP-  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             LID+ TG PSTP  HG+GHV PT A +PGL+YD    DY+DFLC + Y S +I    R +
Sbjct  585   LIDIATGKPSTPFDHGAGHVSPTMAVNPGLIYDILTVDYLDFLCALNYTSSQIMKVSRRN  644

Query  1783  PLVD-CRNRNLGNPGALNYPSFAVVFKNNLQ---TITYKRTVKNVGKVKNVAYQVTVQTP  1950
                D  +  ++GN   LNYPSFA+    N+Q     TY RTV NVG+  + + +VT +T 
Sbjct  645   YTCDPSKTYSVGN---LNYPSFAL----NVQGSGAYTYTRTVTNVGEAGSYSVKVTSET-  696

Query  1951  SNVRVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             + V ++V P  L F +  +  SY VTF    S    ++SFGS++WSDG H+V SP+A+SW
Sbjct  697   TIVNISVVPAVLNFKEVNEKKSYSVTFNVDSSKASGSNSFGSIQWSDGIHVVGSPVAISW  756



>ref|XP_004954113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=776

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/704 (50%), Positives = 478/704 (68%), Gaps = 14/704 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              LLY+Y H A GF+ARLT  QA+ LA+   V++V+PD   +L TT +P FLGL S SS L
Sbjct  71    RLLYSYAHAATGFAARLTERQAAHLASQDSVLAVVPDATHQLHTTLTPSFLGL-SASSGL  129

Query  211   GPSSDYGADIIIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPQFPATS-CNRKI  381
              P+S    D++IG++D+G++P +R+SF+ D  L P P+++R +C   P F A++ CN K+
Sbjct  130   LPASGGATDVVIGIIDTGVYPKDRASFAADPSLPPPPSTFRGRCVSTPAFNASAYCNNKL  189

Query  382   IGARAYYRGYEAVTGRPIVD-EPKSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             +GA+ +  GYEA  G  I + E +S +D  GHGTH +S AAGSAVA+A    +A+G+A G
Sbjct  190   VGAKFFNLGYEAAHGGVIEETESRSPLDTNGHGTHTSSTAAGSAVADAAFFDYAKGKAVG  249

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +A  ARIA YK CW   C+ +DIL   D+A+ DGV+V+S+S+G     G A  +  D  A
Sbjct  250   MAPGARIAAYKACWTRGCTYSDILMAFDEAIKDGVNVISVSLG---AVGRAPQFYSDTTA  306

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             +GAF AV+KG++VS  AGN+GP  +TA+N+APWILTVGASTI+R+FPA + LGNG TFTG
Sbjct  307   VGAFSAVRKGIVVSASAGNAGPGEFTAVNVAPWILTVGASTINRQFPANIVLGNGETFTG  366

Query  919   TSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
             TSLY G+   P+++++VYG    S  C  G+L+ S V GKIV C    N     +G AVK
Sbjct  367   TSLYAGMPLGPSKIALVYGGDVGSSVCESGKLNTSTVAGKIVVCDPGVNGRAA-KGEAVK  425

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              + G G I+ + +  G + +A A ++P   VT A  + I +Y++   S  A IVF+GTV 
Sbjct  426   LARGAGAILVSSKAFGEQALATAHVLPATAVTFAAAEKIKNYIRTNASPVATIVFQGTVI  485

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             G +PS+PR+A+FSSRGPNF+ PEI KPDV APGV+ILAAWTG  +PSE   D RR +FNI
Sbjct  486   GRTPSSPRMASFSSRGPNFIAPEIFKPDVTAPGVDILAAWTGENSPSELDSDTRRVKFNI  545

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTP  1638
             +SGTSM+CPHVSG+AA+LR+ +P WSPAAIKSALMTT Y +DN+G   + D+ TG  STP
Sbjct  546   ISGTSMSCPHVSGIAALLRQAHPEWSPAAIKSALMTTAYNVDNAG-DIIKDMSTGEASTP  604

Query  1639  HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGN  1818
                G+GHVDP  A DPGLVYD G +DY+ FLC +GY +++IA+  R+  + DC  R+ G+
Sbjct  605   FVRGAGHVDPNCAVDPGLVYDAGTDDYISFLCALGYTAKQIAVLTRDGSVTDCSKRS-GS  663

Query  1819  PGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTD  1998
              G  NYP+F+VVF +    +T +R V+NVG      Y  +V +P+ VRVTV P  L F+ 
Sbjct  664   VGDHNYPAFSVVFSSGDGKVTQRRVVRNVGSNAMATYTASVTSPAGVRVTVEPPTLQFSA  723

Query  1999  RIDTLSYEVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSW  2121
                T  Y +TF + + S     +FGS+ WSDG H VTSPIA++W
Sbjct  724   TQKTQEYAITFAAQQGSVTEKYTFGSIVWSDGKHKVTSPIAITW  767



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/717 (50%), Positives = 473/717 (66%), Gaps = 32/717 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI------  192
              LLY+Y    HGF+A L P Q   L   P V++V PD L+ L TTRSP FLGL       
Sbjct  63    HLLYSYSAAVHGFAAVLHPEQLPLLRRHPAVLNVHPDPLLPLHTTRSPHFLGLSPWPPAP  122

Query  193   -SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSC  369
              S S +L P++    D++IGVLD+G+WPE  SF D GL  +P+ WR  CE G  FP++ C
Sbjct  123   SSRSHSLDPAAA-ATDVVIGVLDTGVWPESPSFDDAGLPEVPSRWRGACEAGVDFPSSLC  181

Query  370   NRKIIGARAYYRGYEAVTGRPIVDEPK----SAIDMTGHGThvasiaagsavananvngh  537
             NRK++GAR++ RGY A  G    D+P+    S  D  GHGTH AS AAG+ VANA++ G+
Sbjct  182   NRKLVGARSFGRGYRAAAGGGDADKPREEYASPRDRDGHGTHTASTAAGAPVANASLLGY  241

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A  AR+AVYKVCW   C  +DIL+G+D+A+ DGV VLSLS+G     G + P
Sbjct  242   ASGVARGMAPGARVAVYKVCWANGCYGSDILAGIDKAIEDGVDVLSLSLG-----GGSAP  296

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             ++ DP+A+GAF AVQ+G+ V+C AGNSGP P +  N APWI TVGA T+DR+FPA V LG
Sbjct  297   FSRDPVAVGAFSAVQRGIFVACSAGNSGPSPSSLTNTAPWITTVGAGTLDRDFPATVQLG  356

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA-----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             NG  + G SL  G       V +VYG+       +S++C+PG LD  +V+GK+V+C +  
Sbjct  357   NGERYAGLSLCSGAGLEDQMVPIVYGKGVQVGSNSSKFCMPGTLDPEQVKGKVVFCDRGI  416

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V++G  VK++GGVGMI++N    G ELVA++ ++PT  V A  G++I D+V+ + +
Sbjct  417   NAR-VEKGQVVKEAGGVGMILANAAVNGEELVADSHLLPTVAVGAKSGNLIRDFVRTSSN  475

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA + FRGTV G  PS P VAAFSSRGPN + P++LKPD+I PGVNILAAW+G++ P+ 
Sbjct  476   PTAMLSFRGTVLGVQPS-PVVAAFSSRGPNTVVPQLLKPDLIGPGVNILAAWSGSVGPTG  534

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               KD RR+ FNIMSGTSM+CPH+SG+AA+L+  +P WSP+AIKSALMTT YT DN+G S 
Sbjct  535   LAKDERRSAFNIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYTDDNTG-SP  593

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D   G P+TP A+GSGHVDP  A  PGL+YD G  DY+ FLC++ Y +  I    +++
Sbjct  594   LVDGAGGSPATPWAYGSGHVDPQKALSPGLIYDIGTGDYLAFLCSLEYSTDHIQAISKST  653

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                 C +R L NPG LNYPSF+VVF + + + + Y R + NVG V    Y V V  P  V
Sbjct  654   NKT-C-SRRLPNPGNLNYPSFSVVFGRRSRRFVKYNRVLTNVG-VPGSVYNVKVGGPPGV  710

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSW  2121
             +VTV P +L+F      L Y+VTF S +       +FG + WS   H V SP++  W
Sbjct  711   KVTVKPTKLIFNQVGQKLRYKVTFTSTKAGDPVDMAFGWITWSSEQHQVRSPVSYRW  767



>emb|CDP15538.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/720 (51%), Positives = 468/720 (65%), Gaps = 55/720 (8%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++LLY+YEH  HGF+ARL PSQA EL + PG++SV+PD + +LQTTRS QFLGL + SS 
Sbjct  69    TKLLYSYEHAIHGFAARLIPSQAEELRHQPGILSVIPDSISQLQTTRSLQFLGL-ADSSG  127

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             + P+++YG DIIIG+LD+GI P+  SFSD GL+P+P+SWR  CE    FP+ SCNRK+IG
Sbjct  128   IWPNTNYGEDIIIGILDTGIRPDHPSFSDAGLSPVPSSWRGGCETAVDFPSGSCNRKLIG  187

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR+YY GYE    R + +  E KS  D  GHGTH AS AAGS V +A    +A GEA+G+
Sbjct  188   ARSYYGGYEESMRRSLEEMGEFKSPTDYDGHGTHTASTAAGSVVRSAGFYEYATGEAKGV  247

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A  ARIA YKVCW G C ++DIL+ ++QA++DGVHVLSLS+G       A+PY+EDPIAI
Sbjct  248   AIKARIAAYKVCWRGGCFDSDILAAVNQAISDGVHVLSLSLGRSP----ARPYDEDPIAI  303

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
              AF A ++G++ S  AGNSGP   T  N+APWIL+VGASTIDREF A V LG+GRT  G 
Sbjct  304   AAFHAAERGILTSASAGNSGPSYGTVTNVAPWILSVGASTIDREFQADVVLGDGRTLLGV  363

Query  922   SLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             SLY G  P  N +             LP           IV C    +   V +G+AV  
Sbjct  364   SLYHG-NPLVNAL-------------LP----------LIVVCDVGGDTKGVAKGYAVHL  399

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVGMI++N   +  EL+  A +IP   V   +G+II  Y+++  + TA I+FRGTV G
Sbjct  400   AGGVGMILANTEERMEELMLEAHLIPATKVGITNGNIIKSYIRSQFAPTATIIFRGTVAG  459

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS--ESTKDNRRTEFN  1455
              +  APRV  FSSRGPN +T EILKPDVIAPGV ILAAW+    PS  +   D RR +FN
Sbjct  460   FTIWAPRVGVFSSRGPNVITQEILKPDVIAPGVYILAAWSKFANPSGFDGNIDKRRVDFN  519

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSMACPHVSG+AA+LRK  P WSPAAIKSA+MTT   +DN+GR+ ++D  T   ST
Sbjct  520   IISGTSMACPHVSGIAALLRKARPYWSPAAIKSAIMTTANNVDNNGRN-IVDRATDVAST  578

Query  1636  PHAHGSGHVDPTNAADPGLVYDTG------------VNDYVDFLCTIGYDSQKIALFLRN  1779
             P AHGSGHVDP  A +PGLVYD G            + DYV FLC+IGY   +IA+F+ N
Sbjct  579   PFAHGSGHVDPNKALNPGLVYDMGTRAAIKRYQLKLLGDYVQFLCSIGYTPARIAVFVSN  638

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
              P   CR      PG LNYPSF+VVF      +T+ R V+NV       Y V    P  V
Sbjct  639   PP-ESCRPGI--TPGDLNYPSFSVVFSRQRTVVTHTRRVRNVESTAAAVYTVRWNAPKFV  695

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF-----QSLRQSADSFGSLRWSDG-THLVTSPIAVSW  2121
              V V+P +L F    DTL+Y+VTF     +++  +  +FG L W DG  H+V SPIAV W
Sbjct  696   EVKVTPYKLAFDQYSDTLTYQVTFTSAAIETIGDTTSAFGYLEWIDGQQHIVRSPIAVLW  755



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/717 (50%), Positives = 472/717 (66%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGFS RLT  +A  L   PGVISVLP+   EL TTR+P F
Sbjct  54    SSLRSISDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  PIP+SW+  CE G  F A
Sbjct  114   LGLDEHTADLFPEAGSYSDVVVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFTA  173

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  174   SLCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  232

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  233   YASGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGMS  287

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP   +  N+APWI TVGA T+DR+FPA+  L
Sbjct  288   DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAIL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  348   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGI  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++P   V    GDII  YV    +
Sbjct  408   NAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPN  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  467   PTASISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  526   LASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKP-  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             L+D+ TG PSTP  HG+GHV PT A +PGL+YD    DY+ FLC + Y S +I ++  RN
Sbjct  585   LLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRN  644

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                   ++ ++ +   LNYPSFAV   + +    Y RTV +VG     + +VT +T + V
Sbjct  645   YTCDPSKSYSVAD---LNYPSFAVNV-DGVGAYKYTRTVTSVGGAGTYSVKVTSET-TGV  699

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  700   KISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISW  756



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/730 (48%), Positives = 464/730 (64%), Gaps = 33/730 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY +  HGF+ RLT  +A  L + PG++ VLP+   EL TTR+P F
Sbjct  60    SSLKSVSESAEMLYTYNNAIHGFATRLTAQEAKSLQDQPGILYVLPEVKYELHTTRTPSF  119

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+NL P SD   D+I+ VLD+G+WPE  SF D G+ P+P SW+  CE G  F +
Sbjct  120   LGL-QQSANLFPESDSEGDVIVAVLDTGVWPESKSFDDTGMGPVPASWKGACETGTNFTS  178

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
               CN+K+IGAR +  GYEA  G   +  E KS  D  GHGTH ++ AAG+ V  A++ G+
Sbjct  179   NHCNKKLIGARYFSTGYEATLGPIDVTKESKSPRDDDGHGTHTSTTAAGAIVGGASLFGY  238

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A  AR+AVYKVCW+G C ++DIL+ +D+A+ D V+VLSLS+G     G    
Sbjct  239   ASGSARGMAYRARVAVYKVCWIGGCFSSDILAAIDRAIEDSVNVLSLSLG-----GGTAD  293

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +AIGAF A++KG+ VSC AGN+GP  YT  N+APWI TVGA T+DR+FPA V+LG
Sbjct  294   YYRDSVAIGAFSAMEKGIFVSCSAGNAGPSAYTLSNLAPWITTVGAGTLDRDFPAYVSLG  353

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ F+G SLY G       +  VY   A    N   C+ G L   KV+GKIV C +  N
Sbjct  354   NGKNFSGVSLYKGDSLPAKLLPFVYAGNASNSTNGNLCMTGTLIPEKVKGKIVLCDRGIN  413

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  VK +GG GM+++N    G ELVA+A ++P + V    GD I DYV +  + 
Sbjct  414   PR-VQKGAVVKGAGGAGMVLANTAANGEELVADAHLLPASTVGQKSGDAIRDYVLSDANP  472

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNI+A WTGA+ P+  
Sbjct  473   TATILFEGTKVGIEPS-PVVAAFSSRGPNAITPEILKPDLIAPGVNIIAGWTGAVGPTGL  531

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D RR EFNI+SGTSM+CPHVSGLAA ++  +P WSPAAI+SALMTT YT   +G   L
Sbjct  532   AEDPRRVEFNIISGTSMSCPHVSGLAAFVKGAHPDWSPAAIRSALMTTAYTAYKNGGEKL  591

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             ID+ TG  STP+ HG+GHVDP  A +PGLVYD   +DY++FLC + Y S +I    R + 
Sbjct  592   IDVSTGKASTPYDHGAGHVDPVAALNPGLVYDLTTDDYLNFLCALNYTSLQIQGVARRN-  650

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNL--------------QTITYKRTVKNV-GKVKN  1920
                C      + G  NYPSF+V  +  +                + Y RT+ NV G    
Sbjct  651   -YSCDAGKTYSIGDFNYPSFSVSLQTQVIGGGGGSRSGGGSKSVVKYTRTLTNVGGGSGG  709

Query  1921  VAYQVTVQTPS-NVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTH  2091
               Y+V++ T S  V++TV P+ L FT   +  SY VTF   S+  + + FG + WSDG H
Sbjct  710   STYKVSISTTSPAVKITVEPDTLTFTKAYEKKSYTVTFSATSMPSNTNEFGRIEWSDGKH  769

Query  2092  LVTSPIAVSW  2121
             +V SP+ +SW
Sbjct  770   VVGSPVVISW  779



>ref|XP_010088796.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36979.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/724 (52%), Positives = 476/724 (66%), Gaps = 35/724 (5%)
 Frame = +1

Query  16    HSRS-SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
             HSR  S LLYTYE VA+GF+  LTPSQA+EL N+PGV+SV+PD   EL  T + +FLGL 
Sbjct  68    HSRHPSRLLYTYERVANGFAVSLTPSQAAELENIPGVLSVMPDEAQELHITHTYRFLGL-  126

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCN  372
             S  S L PSS+YG DIIIG+LD+GIWPE  SFSD GL+P+P+SW+  CE    FPATSCN
Sbjct  127   SSDSGLWPSSNYGEDIIIGILDTGIWPEHRSFSDAGLSPVPSSWKGTCETWNDFPATSCN  186

Query  373   RKIIGARAYYRGY-------EAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvn  531
             RKIIGAR++  G+         +    I + P+   D  GHGTH  S AAGS V+NA+  
Sbjct  187   RKIIGARSFLAGHYMSNLVGSTLNLSAITNSPR---DTDGHGTHTTSTAAGSVVSNASFY  243

Query  532   ghaRGEARGIATNARIAVYKVCWL-GTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
               A+G+A GIAT AR+AVYKVC     C  ADIL+GMDQAVADGV ++S+SI      G 
Sbjct  244   KFAKGKAIGIATKARVAVYKVCATRKVCRVADILAGMDQAVADGVDIISMSI-----SGG  298

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
              KPY++D IAI  FGA++ G++VS   GN GP   T  ++ PW+LTVGAS++DREF A V
Sbjct  299   TKPYHQDNIAIATFGAMKNGILVSASGGNKGPTRSTVNHLPPWVLTVGASSVDREFVASV  358

Query  889   TLGNGRTFTGTSLYFGIQ-PSPNQVSMVYGRRANSRYCLPGQLDAS-KVRGKIVYCKQLA  1062
              LG GR + GTSLY G + P  ++  +V+G    + +C  G+ +   ++  KI+ C+Q  
Sbjct  359   ILGTGRPYAGTSLYPGPRFPFLSRYELVHGGDFGNPFCKVGEFNKQDQLVDKIIVCEQDW  418

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             + +  D  +AV    G G II N R  G EL+A     P   V  +DG  I  Y++ +++
Sbjct  419   DTSSRDSAYAVANVSGRGAIIVNNRKHGEELLAEPHRWPATRVAMSDGYKIMKYLR-SEN  477

Query  1243  ATARIVFRGT-VTGNSP-SAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              TA I F GT + G  P +AP VA+FSSRGPN LTP+ILKPDVIAPG+NILAAW+ AI P
Sbjct  478   PTATINFYGTWIAGEYPITAPEVASFSSRGPNPLTPQILKPDVIAPGLNILAAWSNAIGP  537

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
                  D RR EFNI+SGTSMAC HVSG++A+L+K+YP+WSPAAIKSALMTT Y LDN G+
Sbjct  538   -WGDDDPRRVEFNIISGTSMACAHVSGISALLKKVYPTWSPAAIKSALMTTAYDLDNDGQ  596

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               L DL  G  STP AHGSGHVDP+ A DPGL+YD  V DYV FLC+IGYDS  I+ F  
Sbjct  597   R-LRDL-AGKRSTPFAHGSGHVDPSRALDPGLIYDMNVTDYVGFLCSIGYDSTLISKFFT  654

Query  1777  ---NSPLVDCRNRNLG---NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVT  1938
                +S + +     LG    PG LN PSF+ VF+N ++T+ Y+RTV NVG   +  Y  T
Sbjct  655   ETISSNICEETYAALGGRVTPGDLNVPSFSAVFENGVETVKYRRTVTNVGTNVDAVYSAT  714

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL---RQSADSFGSLRWSDGTHLVTSPI  2109
                P   ++T+SPNRLVF     T +YE+TF S    R    +FG ++WSDG H V S I
Sbjct  715   AVAPEGTKITISPNRLVFDANNPTQTYEITFSSTGGNRDKLATFGWIQWSDGIHSVRSTI  774

Query  2110  AVSW  2121
             A SW
Sbjct  775   ACSW  778



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/717 (50%), Positives = 469/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGFS RLT  +A  L   PGVISVLP+   EL TTR+P F
Sbjct  50    SSLRSVSDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLF  109

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  PIP++W+  CE G  F A
Sbjct  110   LGLEDHTADLFPETGSYSDVVVGVLDTGVWPESKSYSDEGFGPIPSTWKGGCEAGTNFTA  169

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  170   SLCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  228

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  229   YASGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGMS  283

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA+  L
Sbjct  284   DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPALAIL  343

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  344   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGV  403

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++P   V    GDII  YV    +
Sbjct  404   NAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPN  462

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWT A  P+ 
Sbjct  463   PTASISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTTAAGPTG  521

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  522   LASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKP-  580

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             L+D+ TG PSTP  HG+GHV PT A +PGL+YD    DY+ FLC + Y S +I ++  RN
Sbjct  581   LLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLSTEDYLGFLCALNYTSSQIRSVSRRN  640

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                   ++ ++ +   LNYPSFAV   +      Y RTV +VG     + +VT +T    
Sbjct  641   YTCDPSKSYSVAD---LNYPSFAVNV-DGAGAYKYTRTVTSVGGAGTYSVKVTSET-RGA  695

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  696   KISVEPAVLNFKEANEKKSYTVTFTVDSSKASGSNSFGSIEWSDGKHVVGSPVAISW  752



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/721 (50%), Positives = 479/721 (66%), Gaps = 27/721 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY    HGFS RLTP QA+ L++ PGV+SVLP+   EL TTR+P+F
Sbjct  63    SSLKSVSDSAEMLYTYTSAIHGFSTRLTPEQAASLSSQPGVLSVLPELKYELHTTRTPEF  122

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  + P SD   D+IIGVLD+G+WPE  SF D G  P+P+SW   CE G  F +
Sbjct  123   LGLGQTTETM-PQSDSAGDVIIGVLDTGVWPESKSFDDTGFGPVPSSWNGTCESGTNFNS  181

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA  G PI +  E KS  D  GHGTH A+ AAGS V  A++ G
Sbjct  182   SNCNRKLIGARYFAKGYEATLG-PIEESKESKSPRDDDGHGTHTATTAAGSFVPGASLLG  240

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A +ARIA YKVCW+G C ++DIL+ MD+A+ D V+VLS+S+G  N +    
Sbjct  241   YAPGTARGMAPHARIAAYKVCWVGGCFSSDILAAMDKAIDDNVNVLSMSLGGGNSD----  296

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +A+GAF A++KG+++SC AGN+GP  Y+  N APWI TVGA T+DR+FPA V+L
Sbjct  297   -YFRDSVAMGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFVSL  355

Query  895   GNGRTFTGTSLYFGIQPS-PNQVS-MVYGRRANS----RYCLPGQLDASKVRGKIVYCKQ  1056
             GNG+ F+G SLY G   S P+ ++  +Y   A++      C+ G L   +V+GKIV C +
Sbjct  356   GNGKNFSGVSLYRGNSNSMPSALTPFIYAGNASNATSGNLCMMGTLSPDQVKGKIVMCDR  415

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N   V +G  VK +GG+GMI++N    G ELVA+A ++P   V   + D+I  Y+ + 
Sbjct  416   GVNAR-VQKGAVVKAAGGLGMILANTAANGEELVADAHLLPATSVGQRNSDVIKSYLFSD  474

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + TA I+F GT  G  PS P VAAFSSRGPN +T +ILKPD++APGVNILA W+GA  P
Sbjct  475   PNPTATILFEGTKVGVQPS-PVVAAFSSRGPNSITADILKPDIVAPGVNILAGWSGAAGP  533

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             +    D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G+
Sbjct  534   TGLAIDARRVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKNGQ  593

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               L D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+DY++FLC + Y + +I+   +
Sbjct  594   K-LQDVATGKPSTPFDHGAGHVDPISALNPGLVYDLTVDDYLNFLCALNYSASEISSLAK  652

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT---YKRTVKNVGKVKNVAYQVTVQT  1947
              S   D + R   +   LNYPSFAV F++   +     Y RTV NVG+       VT   
Sbjct  653   RSYTCDEKRRY--SVRDLNYPSFAVNFEDRTTSTNVAKYTRTVTNVGRAGTYKATVTSDN  710

Query  1948  PSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVS  2118
             PS V++TV P+ L F    +  +Y VTF    S   +A+SFG L WSDG H+V SPIA+S
Sbjct  711   PS-VKITVEPDTLSFGQVNEKKAYTVTFSASGSAPLNANSFGRLEWSDGKHVVGSPIAMS  769

Query  2119  W  2121
             W
Sbjct  770   W  770



>emb|CDY67452.1| BnaCnng55020D [Brassica napus]
Length=748

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/715 (50%), Positives = 466/715 (65%), Gaps = 30/715 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY +  HGF+ RLTP +A  L   PGVISV P++  EL TTR+P F
Sbjct  55    SSLKSISESAEMLYTYNNAIHGFATRLTPEEADSLKTQPGVISVRPEQRYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +S L P +  G+D++IGVLD+G+WPE  SFSD G  PIP++W+ +CE G +F  
Sbjct  115   LGLGVHNSGLFPETGPGSDVVIGVLDTGVWPESKSFSDEGYGPIPSTWKGECEAGTKFTT  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvngha  540
             + CNRK+IGAR +  GYEA + R          D  GHGTH AS AAGS V  AN+ G A
Sbjct  175   SLCNRKLIGARFFVCGYEAESPR----------DDDGHGTHTASTAAGSIVEGANLLGFA  224

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A  AR+AVYKVCW   C ++D+L+G+D+A+ D V+VLSLS+G +N++     Y
Sbjct  225   NGTARGMAYRARVAVYKVCWKPQCFSSDVLAGIDKAIEDNVNVLSLSLGKRNRD-----Y  279

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +A+GAF A+++G+ VSC AGN GP P +  N+APWI TVGA T+DR+FPA+VTLGN
Sbjct  280   TND-VAMGAFSAMERGIFVSCSAGNDGPSPSSLSNVAPWITTVGAGTLDRDFPALVTLGN  338

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANS-----RYCLPGQLDASKVRGKIVYCKQLAN  1065
             G+++ G SL+      P  +  VY   A++     ++CL G L   KV GKIV C++  N
Sbjct  339   GKSYIGASLFKKDALPPTLLPFVYAGSASNNATYGKFCLSGTLIPEKVYGKIVMCEKGEN  398

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                 ++G  VK +GG+GMI+ N  ++G EL A A ++P   V    GDII  YVK   S 
Sbjct  399   -DRAEKGEVVKAAGGLGMILPNRANRGEELAAKAHVLPATTVGQKAGDIIRRYVKTDPSP  457

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA IV +GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA+ PS  
Sbjct  458   TASIVIQGTVVKVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGALGPSGL  516

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D  R EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  L
Sbjct  517   ASDTSRVEFNIISGTSMSCPHVSGLAALLKSVHPDWSPAAIRSALMTTAYNTYKDGKP-L  575

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             +D+ T  PSTP  HG+GHV P  A  PGL+YD    DY+DFLC + Y+S +I    R + 
Sbjct  576   LDILTVKPSTPFGHGAGHVSPATAISPGLIYDLTTKDYIDFLCALNYNSSQIGCVTRGN-  634

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
                C  R + +   LNYPSF+V    +  T  Y RTV NVG   +   +V  +T + V++
Sbjct  635   -YACDPRKMYSVADLNYPSFSVSVHGSGGTYKYTRTVTNVGGAGSYTVKVISETAA-VKI  692

Query  1966  TVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +V P  L F    +  SY VTF    S+   ++SFGS+ WSDG H+V SP+A+SW
Sbjct  693   SVEPAVLNFKKVNEKKSYSVTFTVVSSMAPRSNSFGSIEWSDGKHVVASPVAISW  747



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/722 (49%), Positives = 470/722 (65%), Gaps = 26/722 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +V HGFSARLT  +A  L    G++SVLP+   EL TTR+P F
Sbjct  57    SSLKSVSDSAEMLYVYNNVVHGFSARLTVQEAESLERQSGILSVLPEMKYELHTTRTPSF  116

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++  P S+  +D+I+GVLD+G+WPE  SF D GL P+P+SW+ +CE G  F +
Sbjct  117   LGL-DRSADFFPESNAMSDVIVGVLDTGVWPESKSFDDTGLGPVPDSWKGECESGTNFSS  175

Query  361   TSCNRKIIGARAYYRGYEAVTG-RPIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             ++CNRK+IGAR + +GYE   G   +  E KSA D  GHGTH A+ AAGS V  A++ G+
Sbjct  176   SNCNRKLIGARYFSKGYETTLGPVDVSKESKSARDDDGHGTHTATTAAGSIVQGASLFGY  235

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+AT AR+AVYKVCW+G C ++DIL+ MD+A+ D V+VLSLS+G  N +     
Sbjct  236   ASGTARGMATRARVAVYKVCWIGGCFSSDILAAMDKAIDDNVNVLSLSLGGGNSD-----  290

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+LG
Sbjct  291   YYRDSVAIGAFAAMEKGILVSCSAGNAGPGPYSLSNVAPWITTVGAGTLDRDFPAYVSLG  350

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ F+G SLY G       +  VY   A    N   C+ G L   KV+GKIV C +  N
Sbjct  351   NGKNFSGVSLYKGDLSLSKMLPFVYAGNASNTTNGNLCMTGTLIPEKVKGKIVLCDRGIN  410

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  VK++GGVGM+++N    G ELVA+A ++P   V    G+ I  Y+ +  + 
Sbjct  411   PR-VQKGSVVKEAGGVGMVLANTAANGDELVADAHLLPATTVGQTTGEAIKKYLTSDPNP  469

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +T EILKPD+IAPGVNILA WTG + P+  
Sbjct  470   TATILFEGTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGGVGPTGL  528

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT+  +G   L
Sbjct  529   AEDTRRVGFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYTVYKNG-GAL  587

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG PSTP  HG+GHVDP  A +PGLVYD   +DY++FLC + Y S +I    R + 
Sbjct  588   QDVSTGKPSTPFDHGAGHVDPVAALNPGLVYDLRADDYLNFLCALNYTSIQINSIARRN-  646

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQT--------ITYKRTVKNVGKVKNVAYQVTV  1941
               +C      +   LNYPSFAVVF   +          + Y RT+ NVG           
Sbjct  647   -YNCETSKKYSVTDLNYPSFAVVFLEQMTAGSGSSSSSVKYTRTLTNVGPAGTYKVSTVF  705

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAV  2115
              + ++V+V+V P  LVFT   +  SY VTF   S   + + FG + WSDG H+V SP+A+
Sbjct  706   SSSNSVKVSVEPETLVFTRVNEQKSYTVTFTAPSTPSTTNVFGRIEWSDGKHVVGSPVAI  765

Query  2116  SW  2121
             SW
Sbjct  766   SW  767



>ref|XP_010939822.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=769

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/723 (50%), Positives = 477/723 (66%), Gaps = 32/723 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+++LY Y+ VAHGFSARLTP++A  L ++ GV+ VL +   EL TTR+P+FLG
Sbjct  60    LRSVSDSAKILYLYDTVAHGFSARLTPAEAQALESLDGVLCVLAEVRYELHTTRTPEFLG  119

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   S  L P ++  +D+++GVLD+G+WPER SF D G  P+P  W+  CE G  F ATS
Sbjct  120   L-DKSDGLVPQANTASDVVVGVLDTGVWPERKSFDDTGFGPVPAGWKGACEEGKDFKATS  178

Query  367   CNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK+IGAR + +GYEA  G PI +  E +S  D+ GHGTH ++ AAGSAV +A++ G A
Sbjct  179   CNRKLIGARFFSKGYEASMG-PIDESRESRSPRDIDGHGTHTSTTAAGSAVTDASLLGFA  237

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG++T AR+A YKVCW G C ++DIL+ MD AV DG HVLSLS+G     G    Y
Sbjct  238   TGTARGMSTRARVAAYKVCWAGGCFSSDILAAMDAAVDDGCHVLSLSLG-----GGMSDY  292

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +AIGAF A++KGV+VSC AGN+GP   +  N+APWI TVGA T+DR+FPA V LGN
Sbjct  293   YRDSVAIGAFNAMEKGVLVSCSAGNAGPTDSSLSNVAPWITTVGAGTLDRDFPAYVVLGN  352

Query  901   GRTFTGTSLYFGIQPSPNQ-VSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLAN  1065
             G+ +TG SLY G +P P+  + +VY G  +NS     C+PG L   KV GKIV C +  +
Sbjct  353   GKNYTGVSLYSG-KPLPSTPLPIVYAGNASNSTSGNLCMPGTLIPEKVAGKIVLCDRGIS  411

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G+ V+++GG GM+++N    G ELVA+A ++P + V    GD I  Y+ +  S 
Sbjct  412   PR-VQKGYVVREAGGAGMVLANTDANGEELVADAHLLPASGVGEKAGDAIRAYLLSETSP  470

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA +VF GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+  
Sbjct  471   TASVVFGGTKVGVRPS-PVVAAFSSRGPNAVTPEILKPDLIAPGVNILAGWTGAVGPTGL  529

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
             + D+RR EF+I+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y+    G   L
Sbjct  530   SVDSRRVEFSIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYSAYPGGDG-L  588

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             +D+ TG  +TP  +G+GHVDP  A +PGLVYD   +DY+DFLC + Y S +IA   + + 
Sbjct  589   LDVATGKAATPFDYGAGHVDPPRAMEPGLVYDLTADDYIDFLCALNYTSLQIAAVAKRTN  648

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNN------LQTITYKRTVKNVGKVKNVAYQVTVQT  1947
                C ++       LNYPSFAV F          +T+ + RT+ NVG+     Y+ TV T
Sbjct  649   YA-CDDKKTYAVSGLNYPSFAVAFATTSGNGGGAETVKHTRTLTNVGEPGT--YKATVAT  705

Query  1948  P---SNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIA  2112
                   V+V V P  L FT   +  SY V+F   SL   +  FG L WSDG H+V SPIA
Sbjct  706   SVTGGEVKVAVEPAELRFTKGGEKQSYTVSFSAPSLPSGSLGFGRLEWSDGKHVVASPIA  765

Query  2113  VSW  2121
              SW
Sbjct  766   FSW  768



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/717 (50%), Positives = 471/717 (66%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGFS RLT  +A  L   PGVISVLP+   EL TTR+P F
Sbjct  54    SSLRSISDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  PIP+SW+  CE G  F A
Sbjct  114   LGLDEHTADLFPEAGSYSDVVVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFTA  173

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  174   SLCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  232

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  233   YASGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGMS  287

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP   +  N+APWI TVGA T+DR+FPA+  L
Sbjct  288   DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAIL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  348   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGI  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++P   V    GDII  YV    +
Sbjct  408   NAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPN  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  467   PTASISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P  SPAAI+SALMTT Y     G+  
Sbjct  526   LASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPECSPAAIRSALMTTAYKTYKDGKP-  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             L+D+ TG PSTP  HG+GHV PT A +PGL+YD    DY+ FLC + Y S +I ++  RN
Sbjct  585   LLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRN  644

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                   ++ ++ +   LNYPSFAV   + +    Y RTV +VG     + +VT +T + V
Sbjct  645   YTCDPSKSYSVAD---LNYPSFAVNV-DGVGAYKYTRTVTSVGGAGTYSVKVTSET-TGV  699

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  700   KISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISW  756



>dbj|BAJ97136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/722 (49%), Positives = 476/722 (66%), Gaps = 18/722 (2%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P+   S +  +LY+Y H A GF+ARLT  QA  LA+   V++V+PD + EL TT +P FL
Sbjct  68    PVEMSSPAPAVLYSYAHAATGFAARLTERQAELLASSSSVLAVVPDTMQELHTTLTPSFL  127

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPE-RSSFS-DRGLNPIPNSWRNKCEVGPQFP  357
             GL S SS L  +S+   D++IGV+D+G++PE R SF+ D  L P P+ +R +C  GP F 
Sbjct  128   GL-SPSSGLLKASNGATDVVIGVIDTGVYPEGRPSFAADPSLPPPPSKFRGRCVSGPSFN  186

Query  358   ATS-CNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvng  534
              ++ CN K++GA+ + RG EA+ GR +  + KSA+D  GHGTH +S A GSAVA+A    
Sbjct  187   GSALCNNKLVGAKFFQRGQEALRGRALGADSKSALDTNGHGTHTSSTAGGSAVADAGFFD  246

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +ARG+A G+A  ARIAVYK CW G C+++DIL+  D+A+ADGV V+S+S+G     G A 
Sbjct  247   YARGKAVGMAPGARIAVYKACWEG-CASSDILAAFDEAIADGVDVISVSLG---AVGSAP  302

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              +  D  A+GAF AV++G++VS  AGNSGP   TA NIAPW LTVGAST++R+FP  V L
Sbjct  303   DFYSDTTAVGAFRAVRRGIVVSASAGNSGPGDSTACNIAPWFLTVGASTLNRQFPGDVVL  362

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             GNG TFTGT+LY G    P ++ +VYG    S+ C  G+L+A+ V GKIV C+   N   
Sbjct  363   GNGETFTGTTLYAGEPLGPTKIPLVYGGDVGSKACEEGKLNATMVAGKIVLCEPGVNARA  422

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
               +  AVK +GG G I+++ +  G + +    + P   V   DG  I+ Y++   S TA 
Sbjct  423   A-KPLAVKLAGGAGAILASTQPFGEQALTTPHVHPATAVAFVDGAKIFKYIRAQASPTAT  481

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             I+FRGTV G++P +PR+AAFSSRGPN   PEI KPDV APGV+ILAAWTGA +P+E   D
Sbjct  482   IIFRGTVVGSTPPSPRMAAFSSRGPNLRAPEIFKPDVTAPGVDILAAWTGANSPTELDSD  541

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR ++NI+SGTSM+CPHVSG+AA+LR+  P WSPAAIKSALMTT Y +DN+G   + D+
Sbjct  542   TRRVKYNIISGTSMSCPHVSGIAALLRQARPEWSPAAIKSALMTTAYNVDNTG-GVIGDM  600

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              +G  STP A G+GH+DP +A DPGLVYD G  DY+ FLC +GY ++++A+F  +   + 
Sbjct  601   SSGDASTPFARGAGHIDPNSAVDPGLVYDAGTEDYITFLCALGYTARQVAVFGSS---IS  657

Query  1795  CRNRNLGNPGALNYPSFAVVF-KNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             C  R     G  NYP+F+VVF  N L  +T +R V+NVG      Y   V  P  VRV V
Sbjct  658   CSTRAGSAVGDHNYPAFSVVFTSNKLAVVTQRRVVRNVGSDAEATYTAKVTAPDGVRVRV  717

Query  1972  SPNRLVFTDRIDTLSYEVTF-QSLRQSAD---SFGSLRWSDGTHLVTSPIAVSWEGRSVS  2139
             SP  L F+    T  Y +TF Q    SA    +FGS+ WSDG H VTSPIAV+W    V+
Sbjct  718   SPETLRFSTTQKTQEYVLTFAQGSPGSATAKYTFGSIEWSDGEHSVTSPIAVTWPASKVA  777

Query  2140  EL  2145
             E+
Sbjct  778   EM  779



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/725 (50%), Positives = 469/725 (65%), Gaps = 37/725 (5%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E+LYTY +  HGFS +LTP +A  L   PGV+ VLP+   EL TTR+P+FLG
Sbjct  53    LKSASDSAEMLYTYSNAIHGFSTQLTPEEAEMLKFQPGVLFVLPELKYELHTTRTPEFLG  112

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   ++ L P S   +D+IIGVLD+G+WPE  SF D GL P+P SW+  CEVG  F +++
Sbjct  113   L-DQNNELFPESQSASDVIIGVLDTGVWPESKSFDDSGLGPVPASWKGTCEVGTNFSSSA  171

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK+IGAR + +GYEA  G PI    E KS  D  GHGTH ++ AAGS V  A++ G+A
Sbjct  172   CNRKLIGARYFSKGYEATLG-PIDTSKESKSPRDDDGHGTHTSTTAAGSVVTGASLFGYA  230

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT ARIA YKVCWLG C ++DIL  +DQA+ D V+VLS+S+G     G    Y
Sbjct  231   PGTARGMATRARIAAYKVCWLGGCFSSDILMAIDQAIDDNVNVLSMSLG-----GGMSDY  285

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +AIGAF A++KG+++SC AGN+GP  Y+  N APWI TVGA T+DR+FPA ++LGN
Sbjct  286   FRDSVAIGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFLSLGN  345

Query  901   GRTFTGTSLYFGIQPSP--NQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLA  1062
             G+ F+G SLY G   +        +Y G  +NS     C+ G L   KV+GKIV C +  
Sbjct  346   GKNFSGVSLYRGNSEATALEMTPFIYAGNASNSTSGNLCMMGSLIPEKVKGKIVMCDRGV  405

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGM++SN    G ELVA+A ++P   V   + D+I  Y+ +  +
Sbjct  406   NAR-VQKGTVVKAAGGVGMVLSNTGANGEELVADAHLLPATAVGQKNADLIKSYLFSDPN  464

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD++APGVNILA W+GA+ P+ 
Sbjct  465   PTAAILFEGTKVGIEPS-PVVAAFSSRGPNSITPDILKPDMVAPGVNILAGWSGAVGPTG  523

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   SG+  
Sbjct  524   LAVDSRRVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKSGQK-  582

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+DY++FLC + Y   +I    +  
Sbjct  583   LQDVATGKPSTPFDHGAGHVDPVSALNPGLVYDLTVDDYLNFLCALNYTETEITSLAKRK  642

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT--------YKRTVKNVGKVKNVAYQVT  1938
                 C      +   LNYPSFAV    NL+T +        Y RT+ NVG        VT
Sbjct  643   --FTCDESKSYSVRDLNYPSFAV----NLETGSSSKSTVSKYSRTLTNVGPAGTYKVTVT  696

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSA-DSFGSLRWSDGTHLVTSP  2106
                P NV++TV P  L F    +  SY V+F    SL  S  +SFG L WSDG H+V SP
Sbjct  697   QDNP-NVKITVEPESLSFAAANEKKSYTVSFAVTGSLPTSTLNSFGRLEWSDGKHIVGSP  755

Query  2107  IAVSW  2121
             IA+SW
Sbjct  756   IAISW  760



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/726 (50%), Positives = 460/726 (63%), Gaps = 29/726 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S +S +LY Y+ V HGFSARLT  +A++LA + GV++V P+   EL TTR+P+FLG
Sbjct  57    LRSVSAASNMLYAYDTVLHGFSARLTAQEAADLACLGGVLAVNPEARYELHTTRTPEFLG  116

Query  187   LISGSSNLG---PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             +  G ++ G   P S   AD+++GVLD+G+WPE  S+ D GL  +P+ W+ +C  G  F 
Sbjct  117   IADGGADQGGLFPQSGTAADVVVGVLDTGVWPESRSYDDAGLGEVPSFWKGRCVEGAGFN  176

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVD-EPKSAIDMTGHGThvasiaagsavananvng  534
             A++CNRK++GAR + RGYEA  G    D E +S  D  GHGTH +S AAG+AV  A++ G
Sbjct  177   ASACNRKLVGARFFNRGYEAAMGPMDTDRESRSPRDDDGHGTHTSSTAAGAAVPGASLFG  236

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+AVYKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G A 
Sbjct  237   FASGTARGMAPRARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGAA  291

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y+ D +AIGAF A+++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V L
Sbjct  292   DYSRDSVAIGAFSAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVAL  351

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ +TG SLY G       + ++Y   A++      C+PG L   KV GKIV C +  
Sbjct  352   GNGKNYTGVSLYSGKALPSTPLPIIYAANASNSTAGNLCMPGTLTPEKVAGKIVVCDRGV  411

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             +   V +GF V+ +GG GM++SN    G ELVA+A ++P   V   +G  I  YV +  S
Sbjct  412   SAR-VQKGFVVRDAGGAGMVLSNTAANGQELVADAHLLPATGVGEREGVAIKSYVASDPS  470

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA IV  GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILAAWTG   P+ 
Sbjct  471   PTATIVVAGTQVGVHPS-PVVAAFSSRGPNMVTPEILKPDIIAPGVNILAAWTGKAGPTG  529

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR  FNI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y   + G S 
Sbjct  530   LAADTRRVGFNIISGTSMSCPHVSGLAALLRSAHPDWSPAAVRSALMTTAYATYSGGSSP  589

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D  TG  +TP  +G+GHVDP+ A DPGLVYD G  DYVDFLC + Y    IA   R+ 
Sbjct  590   LLDAATGATATPFDYGAGHVDPSRAVDPGLVYDLGTRDYVDFLCALKYSPAMIATVARSR  649

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVK--NVAY  1929
                   NR   + G LNYPSF+V F          +   T+T+ RT+ NVG      V+ 
Sbjct  650   DFSCAENRTY-SVGGLNYPSFSVAFSTANGEGGESSAAATVTHTRTLTNVGGAGTYKVST  708

Query  1930  QVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTS  2103
              V       V V V P  L FT   +  SY V F S  Q + +  FG L WSDG H V S
Sbjct  709   SVAGAAAQGVTVAVEPTELAFTSAGEKKSYTVRFTSRSQPSGTSGFGRLVWSDGKHSVAS  768

Query  2104  PIAVSW  2121
             PIA +W
Sbjct  769   PIAFTW  774



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/717 (50%), Positives = 468/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGFS RLT  +A  L   PGVISVLP+   EL TTR+P F
Sbjct  61    SSLRSISDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  PIP +W+  CE G  F A
Sbjct  121   LGLDEHTADLFPETGASSDVVVGVLDTGVWPESKSYSDAGFGPIPATWKGGCETGTNFTA  180

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  181   SHCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  239

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  240   YASGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGMS  294

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPA+  L
Sbjct  295   DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAIL  354

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  355   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMSGTLIPEKVKGKIVMCDRGV  414

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GMI++N    G ELVA+A ++P   V    GDII  YV     
Sbjct  415   NAR-VQKGDVVKAAGGLGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPH  473

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  474   PTASISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTG  532

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  533   LASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKP-  591

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D+ TG PSTP  HG+GH  P  A +PGL+YD    DY+ FLC + Y S +I +  R +
Sbjct  592   LLDIATGKPSTPFDHGAGHASPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRIVSRRN  651

Query  1783  PLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                D  ++ ++ +   LNYPSFAV   +      Y RTV +VG     + +V  +T + V
Sbjct  652   YTCDPSKSYSVAD---LNYPSFAVNV-DGAGAYKYTRTVTSVGGAGTYSVKVASET-TGV  706

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF--QSLRQS-ADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F    +  SY VTF   S + S ++SFGS+ WSDG H+V SP+A+SW
Sbjct  707   KISVEPAVLDFKAANEKKSYTVTFTVDSTKGSGSNSFGSIEWSDGKHVVGSPVAISW  763



>emb|CDY00497.1| BnaA10g07760D [Brassica napus]
Length=775

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/721 (49%), Positives = 465/721 (64%), Gaps = 27/721 (4%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P S+    + +LYTY+   HG +ARL+  +A+ L   PGV++V+P+   EL TTRSP+FL
Sbjct  63    PKSHEEEGNRILYTYQTAFHGLAARLSKEEAARLEEEPGVVAVIPETRYELHTTRSPRFL  122

Query  184   GLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             GL    S  +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G  F  
Sbjct  123   GLERQESERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGVCETGRGFLK  182

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD---EPKSAIDMTGHGThvasiaagsavananvn  531
              +CNRKI+GAR +YRGYEA TG+  +D   E +S  D  GHGTH A+  AGS V  AN+ 
Sbjct  183   HNCNRKIVGARVFYRGYEAATGK--IDQELEYRSPRDKDGHGTHTAATVAGSPVRGANLL  240

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G A G ARG+A  AR+A YKVCW+G C ++DILS +DQAVADGVHVLS+S+G     G  
Sbjct  241   GFAYGTARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLG-----GGI  295

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y+ D +AI  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V 
Sbjct  296   STYSRDSLAIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVR  355

Query  892   LGNGRTFTGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYC  1050
             LG  R F G SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C
Sbjct  356   LGTRRVFKGVSLYKGRTVLSRGKQYPLVYLGRNASSPDPTSFCLDGALDQHNVAGKIVIC  415

Query  1051  KQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK  1230
              +      V +G  VK++GGVGMI++N    G ELVA+  ++P   V   +G +I +Y  
Sbjct  416   DR-GVTPRVQKGQVVKRAGGVGMILTNTATNGEELVADCHLLPAVAVGEKEGKVIKEYAM  474

Query  1231  NTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAI  1410
              +K ATA +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+G +
Sbjct  475   TSKRATASLEILGTRVGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDM  533

Query  1411  APSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNS  1590
             APS  + D RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAA+KSALMTT Y  DN 
Sbjct  534   APSSLSSDKRRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNM  593

Query  1591  GRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF  1770
                 L D     PS+P+ HG+GH+DP  A DPGLVYD G  +Y DFLCT      ++ +F
Sbjct  594   -LEPLTDAAGAEPSSPYDHGAGHIDPLKAIDPGLVYDIGPQEYFDFLCTQELSPSQLKVF  652

Query  1771  LRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTV  1941
              ++S    CR+   G NPG LNYP+ + +F  N  ++ +T +RTV NVG   + +Y+V+V
Sbjct  653   TKHSNR-SCRHSLAGNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVS-SYKVSV  710

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVS  2118
                    VTV P  L FT +   LSY VTF++ LR     FG L W   TH V SP+ ++
Sbjct  711   SPFKGATVTVQPKTLNFTTKHQKLSYTVTFRTKLRMKRPEFGGLLWKSATHKVRSPVIIT  770

Query  2119  W  2121
             W
Sbjct  771   W  771



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/717 (49%), Positives = 469/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGF+ RLT  +A  L   PGV+SVLP+   EL TTR+P F
Sbjct  55    SSLRSISDSAELLYTYENAIHGFATRLTQDEADSLMAQPGVLSVLPEHRYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +    D+++GVLD+G+WPE  S+SD G  P+P++W+  CE G  F A
Sbjct  115   LGLDDHNADLFPQTGASTDVVVGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  175   SHCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A +AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  234   YASGTARGMAPHARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGTS  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPA+  L
Sbjct  289   EYYRDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAIL  348

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  349   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGI  408

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++P   V    GD+I  YV     
Sbjct  409   NAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPH  467

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  468   PTATISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTG  526

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  527   LASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKP-  585

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             L+D+ TG PSTP  HG+GHV P  A +PGL+YD    DY+ FLC + Y S +I ++  RN
Sbjct  586   LLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRN  645

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                   ++ ++ +   LNYPSFAV  +       Y RTV +VG     + ++T +T + V
Sbjct  646   YTCDPSKSYSVAD---LNYPSFAVNVE-EAGAYKYTRTVTSVGGAGTYSVKLTSET-TAV  700

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F    +  SY VTF    S    ++SFG++ WSDG H+V SP+A+SW
Sbjct  701   KISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIEWSDGKHVVGSPVAISW  757



>gb|KFK28394.1| hypothetical protein AALP_AA8G509300 [Arabis alpina]
Length=754

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/716 (49%), Positives = 468/716 (65%), Gaps = 22/716 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGF+ RLT  +A  L   PGVISVLP+   EL TTR+P F
Sbjct  51    SSLRSISTSAELLYTYENAIHGFATRLTQQEADSLMTQPGVISVLPEHRYELHTTRTPLF  110

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  PIP++W+  CE+G  F A
Sbjct  111   LGLEEHNADLFPQTGASSDVVVGVLDTGVWPESKSYSDEGFGPIPSTWKGTCEIGTNFTA  170

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + +GYEA  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  171   SLCNRKLIGARFFSKGYEATMG-PIDESKESRSPRDDDGHGTHTSSTAAGSFVEGASLLG  229

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+AVYKVCW+G C ++DIL+ +D+A+ D V+VLS+S+G     G   
Sbjct  230   FANGTARGMAPKARVAVYKVCWVGGCFSSDILAAIDKAIDDNVNVLSMSLG-----GGMS  284

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIG+F A++KG++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPA+  L
Sbjct  285   DYYRDSVAIGSFAAMEKGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAVL  344

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SL+ G       +  VY   A    N   C+ G L    V+GKIV C +  
Sbjct  345   GNGKNYSGVSLFKGDSLPSKLLPFVYAGNASNATNGNLCMSGTLIPELVKGKIVMCDRGV  404

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++PT  V    GD+I  YV    +
Sbjct  405   NAR-VQKGEVVKAAGGVGMILANTAANGEELVADAHLLPTTAVGQKAGDLIRHYVLTEPN  463

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA ++ +GTV    PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  464   PTASVLIQGTVVNIKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAQGPTG  522

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  523   LASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYQTYKDGKP-  581

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             ++D+ TG PSTP  HGSGHV PT A +PGL+YD    DY+ FLC + Y S +I    R +
Sbjct  582   ILDIATGKPSTPFDHGSGHVSPTTAINPGLIYDLTTEDYLGFLCALNYTSSQIRSVARRN  641

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
               + C +    +   LNYPSFAV   +      Y RTV +VG     + ++  +T + V+
Sbjct  642   --LTCDSSKSYSVADLNYPSFAVNV-DGAGAYKYTRTVTSVGGSGTYSVKLYSETTA-VK  697

Query  1963  VTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+AVSW
Sbjct  698   ISVEPAVLNFKEVNEKKSYTVTFTVDSSKGSGSNSFGSIEWSDGKHVVASPVAVSW  753



>gb|ACN27710.1| unknown [Zea mays]
Length=701

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/712 (50%), Positives = 457/712 (64%), Gaps = 28/712 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             +LY Y+ V HGFSARLTP +AS+LA+  GV++V P+   EL TTR+P+FLG+      L 
Sbjct  1     MLYAYDTVLHGFSARLTPQEASDLASAEGVLAVNPEARYELHTTRTPEFLGIAG--QGLS  58

Query  214   PSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS-CNRKIIGA  390
             P S    D+++GVLD+G+WPE  S+ D GL  +P  W+ +CE GP F A++ CNRK++GA
Sbjct  59    PQSGTAGDVVVGVLDTGVWPESKSYDDAGLAEVPAWWKGQCEAGPGFDASAACNRKLVGA  118

Query  391   RAYYRGYEAVTGRPIVD-EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             R + +GYEA  G    D E +S +D  GHGTH +S AAG+AV  A++ G A G ARG+A 
Sbjct  119   RFFSKGYEAAMGPMDTDRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGTARGMAP  178

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGA  747
              AR+A YKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G A  Y+ D +AIGA
Sbjct  179   RARVAAYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGAADYSRDSVAIGA  233

Query  748   FGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSL  927
             F A ++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V LG+G+ +TG SL
Sbjct  234   FAATEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYTGVSL  293

Query  928   YFGIQPSPNQ-VSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
             Y G +P P+  + +VY   A++      C+PG L   KV GKIV C +  +   V +G  
Sbjct  294   YAG-KPLPSAPIPIVYAANASNSTAGNLCMPGTLVPEKVAGKIVVCDRGVSAR-VQKGLV  351

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             V+ +GG GM++SN    G ELVA+A ++P A V   +G  I  YV +  + TA +V  GT
Sbjct  352   VRDAGGAGMVLSNTAANGQELVADAHLLPAAGVGETEGTAIKSYVASAPNPTATVVVAGT  411

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
               G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA+WTG   P+    D RR  F
Sbjct  412   EVGVRPS-PVVAAFSSRGPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRVGF  470

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y    SG S+L+D  TG  +
Sbjct  471   NIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYA-SYSGGSSLLDAATGGMA  529

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP  +G+GHVDP  A DPGLVYD G  DYVDFLC + Y S  IA   R+       N+  
Sbjct  530   TPFDYGAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTY  589

Query  1813  GNPGALNYPSFAVVFK-------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
              + GALNYPSF+V +         +  T+T+ RT+ NVG         ++     V V V
Sbjct  590   -SVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDV  648

Query  1972  SPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2121
              P  L FT   +  SY V F S  Q + +  FG L WSDG H V SPIA +W
Sbjct  649   EPAELEFTSVGEKKSYTVRFTSKSQPSGTAGFGRLVWSDGKHSVASPIAFTW  700



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/717 (49%), Positives = 468/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGF+ RLT  +A  L   PGV+SVLP+   EL TTR+P F
Sbjct  56    SSLRSISDSAELLYTYENAIHGFATRLTQDEADSLMAQPGVLSVLPEHRYELHTTRTPLF  115

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  P+P++W+  CE G  F A
Sbjct  116   LGLDDHNADLFPQTGASSDVVVGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFTA  175

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  176   SHCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  234

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  235   YASGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGTS  289

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPA+  L
Sbjct  290   EYYRDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAIL  349

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  350   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVLCDRGV  409

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++P   V    GD+I  YV     
Sbjct  410   NAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPH  468

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA +   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  469   PTATVSILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTG  527

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  528   LASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKP-  586

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D+ TG PSTP  HG+GHV P  A +PGL+YD    DY+ FLC + Y S +I    R +
Sbjct  587   LLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRN  646

Query  1783  PLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                D  ++ ++ +   LNYPSFAV  +       Y RTV +VG     + ++T +T + V
Sbjct  647   YTCDPSKSYSVAD---LNYPSFAVNVE-EAGAYKYTRTVTSVGGAGTYSVKLTSETTA-V  701

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F    +  SY VTF    S    ++SFG++ WSDG H+V SP+A+SW
Sbjct  702   KISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIEWSDGKHVVGSPVAISW  758



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/719 (49%), Positives = 467/719 (65%), Gaps = 26/719 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY++V HGFS +LT  +A +L +  G+++VLP+   EL TTR+PQF
Sbjct  55    SSLKSVSDSAQMLYTYDNVIHGFSTQLTNEEAQQLESQAGILAVLPELRYELHTTRTPQF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL S +++L P SD  +++I+GVLD+G+WPE  SF+D GL PIP+ W+  CE G  F +
Sbjct  115   LGL-SKAADLFPESDSASEVIVGVLDTGVWPESKSFADTGLGPIPSGWKGACEAGTNFNS  173

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA  G PI    E KS  D  GHG+H AS AAGS V  A++ G
Sbjct  174   SNCNRKLIGARYFAKGYEATLG-PIDETKESKSPRDDDGHGSHTASTAAGSVVEGASLFG  232

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A+YKVCW+G C ++DIL+ M++A+ D V+VLS+S+G     G   
Sbjct  233   YAEGTARGMATRARVAIYKVCWIGGCFSSDILAAMEKAIDDNVNVLSMSLG-----GGMS  287

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA VTL
Sbjct  288   DYYRDSVAIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVTL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQV-SMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNGR ++G SLY G  P P ++   VY   A    N   C+ G L   KV GKIV C + 
Sbjct  348   GNGRNYSGVSLYRG-SPLPGKLLPFVYAGNASNATNGNLCMMGTLIPEKVAGKIVLCDRG  406

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  VK +G VGMI++N    G ELVA+A ++P   V    GD I  Y+ +  
Sbjct  407   MNAR-VQKGAVVKAAGAVGMILANTAANGEELVADAHLLPATAVGQKSGDAIKGYLFSNP  465

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             + T  I F GT  G  PS P VAAFSSRGPN +TPEILKPD IAPGVNILA W+GA+ P+
Sbjct  466   NPTVTIFFEGTKVGIEPS-PVVAAFSSRGPNSITPEILKPDFIAPGVNILAGWSGAVGPT  524

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D RR EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT D   + 
Sbjct  525   GLVTDTRRVEFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYT-DYKNKE  583

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              + D+ TG  STP  HG+GHVDP +A +PGLVYD  V DY+ FLC + Y   +I    R 
Sbjct  584   KMQDIATGKASTPFDHGAGHVDPVSALNPGLVYDLTVEDYLGFLCALNYSEFQIRSLARR  643

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKN---NLQTITYKRTVKNVGKVKNVAYQVTVQTP  1950
             +    C      +   LNYPSF+V F         + Y RT+ NVG        ++ QTP
Sbjct  644   N--FSCDASKKYSVTDLNYPSFSVNFDTITGGSSVVKYTRTLTNVGSPGTYKASISPQTP  701

Query  1951  SNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD--SFGSLRWSDGTHLVTSPIAVSW  2121
               V++++ P  L F+   +  SY VT     Q ++  SF  L WSDG + V SPIA+SW
Sbjct  702   -GVKISIQPETLSFSQANEKKSYTVTVTGSSQPSNTFSFARLEWSDGKYTVGSPIAISW  759



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/721 (49%), Positives = 464/721 (64%), Gaps = 27/721 (4%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P S+    + +LYTY+   HG +ARL+  +A+ L   PGV++V+P+   EL TTRSP+FL
Sbjct  63    PKSHEEEGNRILYTYQTAFHGLAARLSKEEAARLEEEPGVVAVIPETRYELHTTRSPRFL  122

Query  184   GLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             GL    S  +        D+++GVLD+GIWPE  SF+D G++P P++WR  CE G  F  
Sbjct  123   GLERQESERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPGPSTWRGACETGRGFLK  182

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD---EPKSAIDMTGHGThvasiaagsavananvn  531
              +CNRKI+GAR +YRGYEA TG+  +D   E +S  D  GHGTH A+  AGS V  AN+ 
Sbjct  183   HNCNRKIVGARVFYRGYEAATGK--IDQELEYRSPRDKDGHGTHTAATVAGSPVRGANLL  240

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G A G ARG+A  AR+A YKVCW+G C ++DILS +DQAVADGVHVLS+S+G     G  
Sbjct  241   GFAYGTARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLG-----GGI  295

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y+ D +AI  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V 
Sbjct  296   STYSRDSLAIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVR  355

Query  892   LGNGRTFTGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYC  1050
             LG  R F G SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C
Sbjct  356   LGTRRVFKGVSLYKGRTVLSRGKQYPLVYLGRNASSPDPTSFCLDGALDQHNVAGKIVIC  415

Query  1051  KQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK  1230
              +      V +G  VK++GGVGMI++N    G ELVA+  ++P   V   +G +I +Y  
Sbjct  416   DR-GVTPRVQKGQVVKRAGGVGMILTNTATNGEELVADCHLLPAVAVGEKEGKVIKEYAM  474

Query  1231  NTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAI  1410
              +K ATA +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+G +
Sbjct  475   TSKRATASLEILGTRVGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDM  533

Query  1411  APSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNS  1590
             APS  + D RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAA+KSALMTT Y  DN 
Sbjct  534   APSSLSSDKRRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNM  593

Query  1591  GRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF  1770
                 L D     PS+P+ HG+GH+DP  A DPGLVYD G  +Y DFLCT      ++ +F
Sbjct  594   -LEPLTDAAGAEPSSPYDHGAGHIDPLKAIDPGLVYDIGPQEYFDFLCTQELSPSQLKVF  652

Query  1771  LRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTV  1941
              ++S    CR+   G NPG LNYP+ + +F  N  ++ +T +RTV NVG   + +Y+V+V
Sbjct  653   TKHSNR-SCRHSLAGNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVS-SYKVSV  710

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVS  2118
                    VTV P  L FT +   LSY VTF++ LR     FG L W   TH V SP+ ++
Sbjct  711   SPFKGATVTVQPKTLNFTTKHQKLSYTVTFRTKLRMKRPEFGGLLWKSATHKVRSPVIIT  770

Query  2119  W  2121
             W
Sbjct  771   W  771



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/719 (50%), Positives = 465/719 (65%), Gaps = 25/719 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTY++  HGFS RLTP +A  L   PGVISVLP+   EL TTR+P F
Sbjct  58    SSLRSVSDSAELLYTYDNAIHGFSTRLTPEEAESLTGQPGVISVLPELRYELHTTRTPLF  117

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P SD   D+++GVLD+G+WPE  SF D G  P+P+ W+  CE G  F A
Sbjct  118   LGL-DHNADLFPQSDSATDVVVGVLDTGVWPESKSFDDSGFGPVPSGWKGACETGTNFSA  176

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCN K+IGAR + RGYEA  G PI +  E KSA D  GHGTH +S AAGS V  A++ G
Sbjct  177   SSCNHKLIGARFFARGYEATMG-PIDESKESKSARDDDGHGTHTSSTAAGSIVEGASLLG  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCWLG C ++DIL+ +D+A+ DGV+VLS+S+G     G   
Sbjct  236   YAAGTARGMAPRARVAVYKVCWLGGCFSSDILAAIDRAIEDGVNVLSMSLG-----GGMS  290

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPA VT 
Sbjct  291   DYYRDSVAIGAFAAMEKGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPAQVTF  350

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SL+ G       +  VY   A    N   C+ G L   +V+GKIV C +  
Sbjct  351   GNGKNYSGVSLFKGDALPAKLLPFVYAGNASNATNGNLCMTGTLIPERVKGKIVMCDRGV  410

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GMI++N    G ELVA+A ++P   V    GD I +YV    +
Sbjct  411   NAR-VQKGQVVKDAGGIGMILANTAANGEELVADAHLLPATAVGEKSGDEIREYVLTNPN  469

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA IVF GTV G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILAAWTG   P+ 
Sbjct  470   PTATIVFEGTVVGIQPS-PVVAAFSSRGPNSITPEILKPDLIAPGVNILAAWTGEAGPTG  528

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y+     +  
Sbjct  529   LAADERRVGFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYS-SYKDQKP  587

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             ++D+ TG  STP  HG+GHV P NA +PGLVYD    DY+ FLC + Y + +I    R++
Sbjct  588   ILDVATGKSSTPFDHGAGHVSPVNAINPGLVYDLSAEDYIGFLCALKYTASQIKSVARSN  647

Query  1783  PLVDCRNRNLGNPGALNYPSFAV---VFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPS  1953
                 C      +   LNYPSFAV     ++  +   Y RTV +VG       +++ +T +
Sbjct  648   --FTCDPSKTYSVTDLNYPSFAVNIDTTRSGTRAYKYTRTVTSVGGAGTYRVKISSET-T  704

Query  1954  NVRVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V++ V P  L F +  +  SY VTF    S   +++SFG + WSDG H+V SP+A SW
Sbjct  705   AVKIAVEPAVLSFKEVNEKQSYTVTFTVSSSSAPTSNSFGRIEWSDGKHVVGSPVAFSW  763



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/714 (50%), Positives = 464/714 (65%), Gaps = 30/714 (4%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL--ISGS  201
             S LLYTY+   HG++A L+P +A +L +   V++V  + + EL TTRSP FLGL      
Sbjct  77    SRLLYTYDSAFHGYAALLSPYEAEKLRSYDSVLAVYEEYVYELHTTRSPAFLGLGGYDAP  136

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
              ++        D++IGVLD+G+WPE  SFSD G+  +P  W+  CE GP FPA++CNRK+
Sbjct  137   VDMASLDQASEDVVIGVLDTGVWPESPSFSDAGMAVVPPKWQGACESGPDFPASACNRKL  196

Query  382   IGARAYYRGYEAVTG-------RPIVDEPKSAIDMTGHGThvasiaagsavananvngha  540
             IGAR++ RGY A  G             P+   D  GHGTH AS AAG+AV  A++ G+A
Sbjct  197   IGARSFSRGYLAAEGLGGSSNSSMESASPR---DRDGHGTHTASTAAGAAVPGASLFGYA  253

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
             RG ARG+A  AR+AVYKVCW   C ++DIL+GMD+AV DGV VLSLS+G     G A PY
Sbjct  254   RGTARGMAQRARVAVYKVCWSSGCFSSDILAGMDRAVTDGVDVLSLSLG-----GGAAPY  308

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D IAIGAF A +KGV VSC AGN+GPD  T  N+APWI T+GA T+DR+FPA V L N
Sbjct  309   YRDAIAIGAFSAAEKGVFVSCSAGNAGPDASTLANVAPWIATIGAGTLDRDFPAYVLLDN  368

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRA---NSRYCLPGQLDASKVRGKIVYCKQLANIT  1071
              + FTG SLY G      ++S+VYG+ +   +S  CL G LD   VRGKIV C +  N  
Sbjct  369   NQRFTGVSLYSGRGLKGKRLSIVYGQSSGLNSSNLCLAGTLDPKLVRGKIVLCDRGINAR  428

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G  V+ +GG GMI++N    G ELVA++  +P   V    GD I  YV+  KS  A
Sbjct  429   -VEKGEVVRSAGGAGMILANTAANGEELVADSHQLPAVAVGKKAGDEIRAYVRG-KSGIA  486

Query  1252  R--IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             R  +  RGTV G  PS P VAAFSSRGPN +TP++LKPDV+ PGVNILA WTGA  PS  
Sbjct  487   RATLAIRGTVLGVRPS-PVVAAFSSRGPNMVTPQVLKPDVVGPGVNILAGWTGAAGPSGL  545

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              KD RRT+FNI+SGTSM+CPH+SG+AA+L+  +P WSPAAIKSALMTT YT D +G S L
Sbjct  546   AKDKRRTKFNIISGTSMSCPHISGVAALLKAAHPDWSPAAIKSALMTTAYTRDTTG-SPL  604

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D  TG  STP AHGSGHVDP NA DPGL+YD   +DY+DFLC++ Y   ++ +  ++S 
Sbjct  605   RDAATGGLSTPLAHGSGHVDPQNALDPGLIYDLSTSDYLDFLCSLNYSDTQVRIVSKHSN  664

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
                 R++ L + G LNYPSF+V+F+   + + Y R + NVG+  +V Y V+V  P  V +
Sbjct  665   FSCPRDKVL-DTGNLNYPSFSVIFRGYEKVVRYSRVLTNVGEPSSV-YTVSVSAPEGVGI  722

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQSLRQSAD--SFGSLRWSDGTHLVTSPIAVSW  2121
             TV P RLVF    +   Y V F S  +++    FG + WS+  H V SPIA SW
Sbjct  723   TVKPQRLVFKGVGNKQGYTVEFASKIKTSGPMDFGWILWSNQKHKVRSPIAFSW  776



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/717 (49%), Positives = 470/717 (66%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTY +  HGFS RLTP +A  L   PGVISVLP+   EL TTR+P F
Sbjct  55    SSLRSVSESAELLYTYTNAIHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  SFSD G  PIP++W+  CEVG  F A
Sbjct  115   LGLDIHNADLFPETGASSDVVVGVLDTGVWPESKSFSDEGFGPIPSTWKGGCEVGTNFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYEA  G P+ +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  175   SLCNRKLIGARFFARGYEATMG-PVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+AVYKVCW G C ++DIL+ +D+A+ D V+VLS+S+G     G   
Sbjct  234   FANGTARGMAPRARVAVYKVCWQGGCFSSDILAAIDKAIDDNVNVLSMSLG-----GGMS  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIG+F A+++G++VSC AGN+GP  ++  N+APWI TVGA TIDR+FPA+  L
Sbjct  289   DYYRDGVAIGSFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTIDRDFPALAIL  348

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SL+ G       +  VY   A    N   C+ G L   KV+GKIV C +  
Sbjct  349   GNGKNYSGVSLFKGDALPAKLLPFVYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGV  408

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GMI++N    G ELVA+A ++P   V    GDII  YV    +
Sbjct  409   NAR-VQKGDVVKAAGGLGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVLTDPN  467

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I+ +GTV    PS P VAAFSSRGPN +TP ILKPD+IAPGVNILA WTGA  P+ 
Sbjct  468   PTATILIQGTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAGWTGAEGPTG  526

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+++ ++P WSPAAI+SALMTT Y     G+  
Sbjct  527   LASDSRRVEFNIISGTSMSCPHVSGLAALIKSVHPEWSPAAIRSALMTTAYKTYKDGKP-  585

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             ++D+ TG PSTP  HG+GHV PT A +PGL+YD    DY+ FLC + Y S +I ++  RN
Sbjct  586   ILDIATGKPSTPFDHGAGHVSPTTAINPGLIYDLTTADYLGFLCALNYTSSQIRSVSRRN  645

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                   ++ ++ +   LNYPSFA+   +      Y RTV +VG     + ++T +T + V
Sbjct  646   YTCDPSKSYSIAD---LNYPSFALNV-DGAGAYKYTRTVTSVGGAGTYSVKITSET-TAV  700

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  701   KISVQPAVLNFKEANEKKSYTVTFTVDSSKASGSNSFGSIEWSDGKHVVASPVAISW  757



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/713 (50%), Positives = 458/713 (64%), Gaps = 28/713 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++LY Y+ V HGFSARLTP +AS+LA+  GV++V P+   EL TTR+P+FLG+      L
Sbjct  63    KMLYAYDTVLHGFSARLTPQEASDLASAEGVLAVNPEARYELHTTRTPEFLGI--AGQGL  120

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS-CNRKIIG  387
              P S    D+++GVLD+G+WPE  S+ D GL  +P  W+ +CE GP F A++ CNRK++G
Sbjct  121   SPQSGTAGDVVVGVLDTGVWPESKSYDDAGLAEVPAWWKGQCEAGPGFDASAACNRKLVG  180

Query  388   ARAYYRGYEAVTGRPIVD-EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AR + +GYEA  G    D E +S +D  GHGTH +S AAG+AV  A++ G A G ARG+A
Sbjct  181   ARFFSKGYEAAMGPMDTDRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGTARGMA  240

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               AR+A YKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G A  Y+ D +AIG
Sbjct  241   PRARVAAYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGAADYSRDSVAIG  295

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AF A ++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V LG+G+ +TG S
Sbjct  296   AFAATEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYTGVS  355

Query  925   LYFGIQPSPNQ-VSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIVDQGF  1089
             LY G +P P+  + +VY   A++      C+PG L   KV GKIV C +  +   V +G 
Sbjct  356   LYAG-KPLPSAPIPIVYAANASNSTAGNLCMPGTLVPEKVAGKIVVCDRGVSAR-VQKGL  413

Query  1090  AVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRG  1269
              V+ +GG GM++SN    G ELVA+A ++P A V   +G  I  YV +  + TA +V  G
Sbjct  414   VVRDAGGAGMVLSNTAANGQELVADAHLLPAAGVGETEGTAIKSYVASAPNPTATVVVAG  473

Query  1270  TVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTE  1449
             T  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA+WTG   P+    D RR  
Sbjct  474   TEVGVRPS-PVVAAFSSRGPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRVG  532

Query  1450  FNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP  1629
             FNI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y    SG S+L+D  TG  
Sbjct  533   FNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYA-SYSGGSSLLDAATGGM  591

Query  1630  STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRN  1809
             +TP  +G+GHVDP  A DPGLVYD G  DYVDFLC + Y S  IA   R+       N+ 
Sbjct  592   ATPFDYGAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKT  651

Query  1810  LGNPGALNYPSFAVVFK-------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
               + GALNYPSF+V +         +  T+T+ RT+ NVG         ++     V V 
Sbjct  652   Y-SVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVD  710

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2121
             V P  L FT   +  SY V F S  Q + +  FG L WSDG H V SPIA +W
Sbjct  711   VEPAELEFTSVGEKKSYTVRFTSKSQPSGTAGFGRLVWSDGKHSVASPIAFTW  763



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/717 (49%), Positives = 466/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGF+ RLT  +A  L   PGV+SVLP+   EL TTR+P F
Sbjct  56    SSLRSISDSAELLYTYENAIHGFATRLTQDEADSLMTQPGVLSVLPEHRYELHTTRTPLF  115

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +    D+++GVLD+G+WPE  S+SD G  P+P++W+  CE G  F A
Sbjct  116   LGLDDHNADLFPQTGASTDVVVGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFTA  175

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  176   SHCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  234

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG++  AR+AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  235   FASGTARGMSPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGTS  289

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPA+  L
Sbjct  290   EYYRDGVAIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAIL  349

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  350   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGV  409

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK++GGVGMI++N    G ELVA+A ++P   V    GD+I  YV     
Sbjct  410   NAR-VQKGDVVKEAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPH  468

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWT A  P+ 
Sbjct  469   PTATISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTRAAGPTG  527

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  528   LASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKP-  586

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D+ TG PSTP  HG+GHV P  A +PGL+YD    DY+ FLC + Y S +I    R +
Sbjct  587   LLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRN  646

Query  1783  PLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                D  ++ ++ +   LNYPSFAV  +       Y RTV +VG     + ++T +T + V
Sbjct  647   YTCDPSKSYSVAD---LNYPSFAVNVE-EAGAYKYTRTVTSVGGAGTYSVKLTSETTA-V  701

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F    +  SY VTF    S    ++SFG++ WSDG H+V SP+A+SW
Sbjct  702   KISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIEWSDGKHVVGSPVAISW  758



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/722 (49%), Positives = 471/722 (65%), Gaps = 29/722 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LY Y++  HGFS RLTP +A  L N PG++SVLP+   EL TTRSP+F
Sbjct  34    SSLKSVSGSAQMLYFYDNAIHGFSTRLTPEEAELLENQPGILSVLPELRYELHTTRSPEF  93

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+++ P SD   D+IIGVLD+G+WPE  SF+D GL P+P +W+ +CE G  F +
Sbjct  94    LGL-DKSADMFPQSDSVGDVIIGVLDTGVWPESKSFADTGLGPVPATWKGQCESGTNFTS  152

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
              +CNRK+IGAR +  GYEA  G PI +  E KS  D  GHGTH AS A GS V  A++ G
Sbjct  153   ANCNRKLIGARFFGNGYEATLG-PIDESKESKSPRDDDGHGTHTASAAGGSVVEGASLFG  211

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT+AR+AVYKVCWLG C ++DIL+ MD+A+ADGV+VLS+S+G     G   
Sbjct  212   YAAGTARGMATHARVAVYKVCWLGGCFSSDILAAMDKAIADGVNVLSMSLG-----GGMS  266

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  267   DYYKDSVAIGAFAAMEKGILVSCSAGNAGPTSYSLSNVAPWITTVGAGTLDRDFPAFVSL  326

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNGR ++G SL+ G       +  VY   A    N   C+   L   KV GK+V C +  
Sbjct  327   GNGRNYSGVSLFKGSNLPGKLLPFVYAGNASNSTNGNLCMMDSLIPEKVAGKLVLCDRGV  386

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK++GG+GM+++N    G ELVA+A ++P   V   +GD+I  Y+ +  +
Sbjct  387   NAR-VQKGAVVKEAGGLGMVLANTAANGEELVADAHLLPATSVGQKNGDLIKSYLSSDSN  445

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W+G++ P+ 
Sbjct  446   PTATILFEGTKVGIQPS-PVVAAFSSRGPNSITPDILKPDLIAPGVNILAGWSGSVGPTG  504

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              + D RR EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y    +G+  
Sbjct  505   LSTDPRRVEFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYVAYKNGQK-  563

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D  +G  STP  HG+GHVDP +A DPGLVYD    DY+ FLC + Y + +I    R  
Sbjct  564   LKDTASGKDSTPFDHGAGHVDPVSALDPGLVYDLTSEDYLSFLCALNYTASQITSLARRR  623

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT-------YKRTVKNVGKVKNVAYQVTV  1941
                D   +   N    NYPSFAV F +  Q I        Y RT+ NV         ++ 
Sbjct  624   FSCDSNKKYSLND--FNYPSFAVNF-DTTQMINGGSSVAKYTRTLTNVVGAGTYKASISG  680

Query  1942  QTPSNVRVTVSPNRLVFTDRID--TLSYEVTFQSLRQSADSFGSLRWSDGTHLVTSPIAV  2115
             Q  + V+++V+P  L F+   +  T +  VT  SL  + ++F  L WSDG H+V SPIAV
Sbjct  681   QL-TGVKISVNPQVLNFSQAKEKKTFTVTVTGSSLPINTNAFARLEWSDGKHVVGSPIAV  739

Query  2116  SW  2121
             SW
Sbjct  740   SW  741



>ref|XP_004954112.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/729 (50%), Positives = 478/729 (66%), Gaps = 25/729 (3%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P S    +  LLY+Y H A GF+ARLT  QA+ LA+ P V++V  D + +L TT +P FL
Sbjct  62    PASISRPAPRLLYSYAHAATGFAARLTERQAAHLASQPSVLAVAADGIRQLHTTLTPSFL  121

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPE-RSSFS-DRGLNPIPNSWRNKCEVGPQFP  357
              L S SS L P+S+   D++IGVLD+GI+PE R+SF+ D  + P P  +R  C   P F 
Sbjct  122   RL-STSSGLLPASNGATDVVIGVLDTGIYPEDRASFAADPSMPPPPRRFRGSCVSTPSFN  180

Query  358   ATS-CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananv  528
             A++ CN K++GA+ ++ GYEA  G  +   ++P+S +D  GHGTH AS AAGSAVA A  
Sbjct  181   ASAYCNNKLVGAKFFHEGYEAAYGNRLDETEDPRSPLDSNGHGTHTASTAAGSAVAGAAF  240

Query  529   nghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
               +A+G+A G+A  ARIA YKVCW   C+++DIL   D+A+ DGV V+SLS+G     G 
Sbjct  241   YNYAKGKAVGMAPGARIAAYKVCWTNGCADSDILKAFDEAIKDGVDVISLSLG---AVGE  297

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
                ++ED IAIGAF AV+KG++VS  AGNSGP  YTA NIAPW +TVGASTI+R FPA V
Sbjct  298   PPNFHEDQIAIGAFNAVRKGIVVSASAGNSGPGEYTAKNIAPWFITVGASTINRRFPATV  357

Query  889   TLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANI  1068
              LGNG TFTG SLY G   S  ++ +VYG    S  C  G+L+AS V GKIV C    N 
Sbjct  358   VLGNGETFTGFSLYAGAPLSEAKIPLVYGGDVGSEVCEAGKLNASLVAGKIVVCDPGVN-  416

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V++G  V+ +GG G I+      G +++ +  ++P   VT A  + I  Y++ TK+A+
Sbjct  417   GRVEKGEVVRLAGGAGAILVGNEVFGEQVITSPHILPATAVTFAAAEKIKKYMR-TKNAS  475

Query  1249  --ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               A IVF+GTV G  PS+PR+A+FSSRGPNF  P ILKPDV APGV+ILAAWTGA +P+E
Sbjct  476   PVATIVFQGTVVGRKPSSPRMASFSSRGPNFRAPVILKPDVTAPGVDILAAWTGANSPTE  535

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR  FNI+SGTSM+CPHVSG+AA+LR+ +P WSPAAIKSALMTT Y +DN+G   
Sbjct  536   LDSDKRRVHFNIISGTSMSCPHVSGIAALLRQAHPDWSPAAIKSALMTTAYNVDNAG-DI  594

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF-LRN  1779
             + D+ TG  STP   G+GHVDP  AADPGLVYD G +DY+ FLC IGY  ++IA F  + 
Sbjct  595   IRDMSTGQASTPFVRGAGHVDPNRAADPGLVYDAGADDYMSFLCAIGYTDEQIAKFTTKG  654

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-ITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
              P V+C  R     G LNYP+F+VVF N+ +  +T +R V+NVG      Y+V V  P+ 
Sbjct  655   DPAVNCSTRR-ATAGDLNYPAFSVVFVNSTKNEVTQRRVVRNVGSNVRAKYRVAVTRPAG  713

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQSL------RQSADSFGSLRWSDGTHLVTSPIAVS  2118
             VRVTV P  L F  R  T  Y VTF  L       +  D  GS+ WSDG H VTSP+A++
Sbjct  714   VRVTVKPRILRFNRRQRTQEYAVTFMPLVGANVTEKYTD--GSIVWSDGKHRVTSPLAIT  771

Query  2119  WEGRSVSEL  2145
             W    V+ +
Sbjct  772   WPVSQVAAM  780



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/717 (49%), Positives = 466/717 (65%), Gaps = 23/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S++LLYTY +  HGFS RLTP +A  L   PGVISVLP+   EL TTRSP F
Sbjct  56    SSLRSVSESAQLLYTYNNAIHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLF  115

Query  181   LGLIS-GSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL    +++L P +   +D+++GVLD+G+WPE  SFSD+G  P+P++W+  CE G  F 
Sbjct  116   LGLDEHNNADLFPQTGASSDVVVGVLDTGVWPESKSFSDKGFGPVPSTWKGGCEAGTNFT  175

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvn  531
             A+ CNRK+IGAR + RGYEA  G P+ +  E +S  D  GHGTH +S AAGS V  A++ 
Sbjct  176   ASLCNRKLIGARFFARGYEATMG-PVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLL  234

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G A G ARG+   AR+AVYKVCWLG C ++DIL+ +D+A+ D V+VLS+S+G     G  
Sbjct  235   GFASGTARGMDPRARVAVYKVCWLGGCFSSDILAAIDKAIEDNVNVLSMSLG-----GGM  289

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y  D +AIGAF A+++G+ VSC AGN+GP P++  N+APWI TVGA T+DR+FPA+  
Sbjct  290   SDYYRDGVAIGAFAAMERGIFVSCSAGNAGPSPFSLSNVAPWITTVGAGTLDRDFPAIAI  349

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             LGNG+ F+G SL+ G+      +  +Y   A    N   C+ G L   KV+GKIV C + 
Sbjct  350   LGNGKNFSGVSLFKGVALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRG  409

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  VK +GGVGMI++N    G ELVA+A M+P   V    GDII  YV    
Sbjct  410   VNAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAGDIIRRYVLTDP  468

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             + TA ++ +GTV    PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+
Sbjct  469   NPTASVLIQGTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPT  527

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D RR EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y     G+ 
Sbjct  528   GLPSDPRRVEFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTAYRSYKDGKP  587

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              ++D+ TG PSTP  HG+G+V PT A +PGLVYD    DY+ FLC + Y S +I    R 
Sbjct  588   -ILDIATGKPSTPFDHGAGYVSPTIATNPGLVYDLTTVDYLGFLCALNYTSSQIRSVSRR  646

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
             +    C      +   LNYPSFAV    +     Y RTV +VG   +   +VT ++ + V
Sbjct  647   N--FTCDPTKTYSIADLNYPSFAVNVDGS-GAYKYTRTVTSVGGAGSYKVEVTSES-TAV  702

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V+P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A++W
Sbjct  703   KISVAPAVLNFKEVNEKKSYTVTFTVDSSKASGSNSFGSIEWSDGKHVVASPVAITW  759



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/725 (50%), Positives = 469/725 (65%), Gaps = 32/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY  V HGFS RLTP +A  L    G++SV+P+ + EL TTR+P+F
Sbjct  36    SALKSVSESADILYTYNTVIHGFSTRLTPEEAELLEKQGGILSVVPEMVYELHTTRTPEF  95

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL    +   P+SD   ++++GVLD+G+WPE  SF D GL PIP++W+  CE G  F +
Sbjct  96    LGLGKNDAVF-PASDSVGEVVVGVLDTGVWPELKSFDDTGLGPIPSTWKGTCETGTNFNS  154

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK++GAR + RGYEA  G P+ +  E KS  D  GHGTH A+ AAGSAV+ A++ G
Sbjct  155   SNCNRKLVGARYFSRGYEAAFG-PVDETAESKSPRDDDGHGTHTATTAAGSAVSGASLFG  213

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  ARIA YKVCWLG C  +DI++ M++AV DGV+V+S+SIG     G   
Sbjct  214   FATGIARGMAPQARIAAYKVCWLGGCFGSDIVAAMEKAVEDGVNVISMSIG-----GGLS  268

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +A GAF A  +G++VSC AGN GP P +  N+APWI TVGA T+DR+FPA VTL
Sbjct  269   DYYRDTVATGAFTATAQGILVSCSAGNGGPSPGSLTNLAPWITTVGAGTLDRDFPAYVTL  328

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SLY G     + V +VY G   NS     C+   L  ++V GKIV C +  
Sbjct  329   GNGKNYSGASLYNGKASIDSLVPLVYAGNITNSTSGSLCMSDSLIPAQVAGKIVICDRGG  388

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V +G  VK +GGVGMI++N    G ELVA+A ++PTA V    GDII  Y  +   
Sbjct  389   N-SRVQKGLEVKNAGGVGMILANTDLYGEELVADAHLLPTAAVGQKSGDIIKSYAFSDPK  447

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               ARI   GT  G  PS P VAAFSSRGPN LTPE+LKPD+IAPGVNILA WTGA+ P+ 
Sbjct  448   PVARIASGGTHLGIVPS-PVVAAFSSRGPNLLTPEVLKPDLIAPGVNILAGWTGAVGPTG  506

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T D RR  FNI+SGTSM+CPH+SGLAA+L+  +P WSP AI+SALMTT YT   SG+ T
Sbjct  507   LTDDKRRVNFNIISGTSMSCPHISGLAALLKAAHPDWSPTAIRSALMTTAYTTYKSGK-T  565

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             +ID+ TG PSTP  +G+GHV+P  A DPGLVYD  V DY+DFLC + Y + +I +  +  
Sbjct  566   IIDVSTGQPSTPFDYGAGHVNPVAALDPGLVYDATVEDYLDFLCALNYSAAQIKIATKRD  625

Query  1783  PLVD-CRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAYQ  1932
                D  +  +LG+   LNYPSF+V           K  + T+ Y RT+ NVG        
Sbjct  626   YTCDPSKKYSLGD---LNYPSFSVPLQTASGKGGGKGVITTVKYTRTLTNVGDPATYKVS  682

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             V+ Q  S V+++V P  L F+ + +  SY VTF   S+     SF  L WS+G  +V SP
Sbjct  683   VSSQIRS-VKISVEPESLSFSQQYEKKSYTVTFTATSMPSGTSSFAHLEWSNGKQVVGSP  741

Query  2107  IAVSW  2121
             IA SW
Sbjct  742   IAFSW  746



>ref|XP_010111995.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32306.1| Subtilisin-like protease [Morus notabilis]
Length=733

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/662 (53%), Positives = 453/662 (68%), Gaps = 22/662 (3%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P S H   S++LY YE VA+GF+A L  SQA +L N+ G++SV+PD   +LQ T + +FL
Sbjct  67    PPSRHP--SKILYAYEKVANGFAASLNLSQAEKLKNIHGILSVMPDESHQLQITHTYKFL  124

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT  363
             GL +    + P S+YG D+IIGVLD+GIWP+  SFSD+GL+P+P +W+ KCE    F A+
Sbjct  125   GLPT-RPGIWPYSNYGEDVIIGVLDTGIWPQHRSFSDKGLSPVPKTWKGKCETWDDFLAS  183

Query  364   SCNRKIIGARAYYRGYEAV----TGRPIVDEPKSAIDMTGHGThvasiaagsavananvn  531
              CNRK+IGARA+  GY       +G     E  S  D  GHGTHVAS AAG+  +NA+  
Sbjct  184   FCNRKLIGARAFLAGYHMSNLGGSGLNQSAETNSPRDTDGHGTHVASTAAGAVASNASFF  243

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G+A+G A G+A  ARIAVYKVC   TC  +D+L+GMDQAV+DGVH++S+SI      G  
Sbjct  244   GYAKGVAIGVAPKARIAVYKVCLTSTCKQSDMLAGMDQAVSDGVHIISMSI-----SGGT  298

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
              PY +D +AI +FGA++ GV++S  AGN GPDP+T  ++ PW+LTVGAS++DREF A V 
Sbjct  299   DPYYKDIMAIASFGAMRHGVLLSLAAGNDGPDPFTVNHLPPWVLTVGASSVDREFSADVA  358

Query  892   LGNGRTFTGTSLYFGIQ-PSPNQVSMVYGRRANSRYCLPGQL-DASKVRGKIVYCKQLAN  1065
             LG+GRTF G+SLY+G   P   Q  +VY     +++C PG   + +++ GKIV C     
Sbjct  359   LGDGRTFLGSSLYYGPHFPFYKQYKLVYAGDFGNKFCSPGDFTNQNQLAGKIVVCDYGGE  418

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
              + +D+GFAVK   G G II+N    G EL A   + PT  V   DG  I  Y+K++++ 
Sbjct  419   TSSLDKGFAVKDVNGRGTIIANNAQVGEELSAEPHVTPTTQVGIKDGRKIKRYIKSSRNP  478

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GTV G SP APRVAAFS+RGPN LTP+ILKPDVIAPG+NILAAWT  + PS  
Sbjct  479   TANILFHGTVIGTSPPAPRVAAFSNRGPNPLTPQILKPDVIAPGLNILAAWTQVVGPS-G  537

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D R+ EFNI+SGTSMA PHVSG+AA+LR  YP WSPAAIKSALMTT Y LDNSG+S +
Sbjct  538   EGDTRQVEFNIISGTSMAAPHVSGIAALLRNAYPDWSPAAIKSALMTTAYDLDNSGQS-I  596

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN--  1779
              DL TG  STP  HGSGHVDP  A +PGL+YD GV+DYV FLC+IGYDS++I++F R   
Sbjct  597   KDLATGKKSTPFVHGSGHVDPNRALNPGLIYDMGVSDYVGFLCSIGYDSEQISVFFRKLV  656

Query  1780  -SPLVDCRNRNLG---NPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQT  1947
              S + +    +LG    PG LN PSF+VVF N  +T+ Y+RTV NVG   +  Y V+ + 
Sbjct  657   RSDICEKTYDHLGARVTPGDLNLPSFSVVFDNEGETVKYRRTVTNVGSNVDAVYVVSGEA  716

Query  1948  PS  1953
             P+
Sbjct  717   PA  718



>ref|XP_003523991.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN04450.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/723 (50%), Positives = 469/723 (65%), Gaps = 30/723 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY+ VAHGFS RLT  +A  L+  PGV+SV+P+   +L TTR+P+F
Sbjct  61    SSLKSVSDSAEMLYTYKKVAHGFSTRLTTQEAELLSKQPGVLSVIPEVRYDLHTTRTPEF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL +  S L  +S   +D+I+GVLD+G+WPE  SF D GL P+P+SW+ +CE G  F  
Sbjct  121   LGL-AKYSTLSLASGKQSDVIVGVLDTGVWPELKSFDDTGLGPVPSSWKGECERGKNFNP  179

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CN+K++GAR + RGYEA  G PI +  E KS  D  GHG+H ++ AAGSAV  A++ G
Sbjct  180   SNCNKKLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGSHTSTTAAGSAVVGASLFG  238

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+A YKVCWLG C  +DI +G+D+A+ DGV++LS+SIG     G   
Sbjct  239   FANGTARGMATQARLATYKVCWLGGCFTSDIAAGIDKAIEDGVNILSMSIG-----GGLM  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D IAIG F A   G++VS  AGN GP   T  N+APW+ TVGA TIDR+FPA +TL
Sbjct  294   DYYKDTIAIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWLTTVGAGTIDRDFPAYITL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSR---YCLPGQLDASKVRGKIVYCKQLAN  1065
             GNG+ +TG SLY G  P  + + +VY    +      C  G L A KV GKIV C +  N
Sbjct  354   GNGKMYTGVSLYNGKLPPNSPLPIVYAANVSDESQNLCTRGTLIAEKVAGKIVICDRGGN  413

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V++G  VK +GG+GMI+SN    G ELVA++ ++P A +     + +  YV ++ + 
Sbjct  414   AR-VEKGLVVKSAGGIGMILSNNEDYGEELVADSYLLPAAALGQKSSNELKKYVFSSPNP  472

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA++ F GT  G  PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTGA+ P+  
Sbjct  473   TAKLGFGGTQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIAPGVNILAGWTGAVGPTGL  531

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
             T+D R  EFNI+SGTSM+CPHV+GLAA+L+  +P WSPAAI+SALMTT Y    +G+ T+
Sbjct  532   TEDTRHVEFNIISGTSMSCPHVTGLAALLKGTHPEWSPAAIRSALMTTAYRTYKNGQ-TI  590

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG P+TP  +G+GHVDP  A DPGLVYDT V+DY+ F C + Y S +I L  R   
Sbjct  591   KDVATGLPATPFDYGAGHVDPVAAFDPGLVYDTSVDDYLSFFCALNYSSYQIKLVARRD-  649

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNL---------QTITYKRTVKNVGKVKNVAYQVT  1938
                C  RN      LNYPSFAV F              T+ Y RT+ NVG      Y+V+
Sbjct  650   -FTCSKRNNYRVEDLNYPSFAVPFNTAYGVKGGSRKPATVQYTRTLTNVG--APATYKVS  706

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA--DSFGSLRWSDGTHLVTSPIA  2112
             V    +V++ V P  L F    +  +Y VTF S  + +  +SF  L WSDG H VTSPIA
Sbjct  707   VSQSPSVKIMVQPQTLSFGGLNEKKNYTVTFTSSSKPSGTNSFAYLEWSDGKHKVTSPIA  766

Query  2113  VSW  2121
              SW
Sbjct  767   FSW  769



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/725 (49%), Positives = 475/725 (66%), Gaps = 33/725 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LY Y +V HGFS RLT  +A  L   PG++S+L +   EL TTR+P+F
Sbjct  57    SSLKSVSESAEMLYKYSNVIHGFSTRLTAEEARSLQGRPGILSILEEVRYELHTTRTPEF  116

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++L P S   +++IIGVLD+GIWPE  SF D GL PIP+SW+ +CE G  F +
Sbjct  117   LGL-DKSADLFPESGSASEVIIGVLDTGIWPESKSFDDTGLGPIPSSWKGECETGTNFTS  175

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR + +GYEA  G PI +  E KS  D  GHGTH A+ AAGS V  A++ G
Sbjct  176   SSCNRKLIGARFFSKGYEATLG-PIDESKESKSPRDDDGHGTHTATTAAGSVVEGASLFG  234

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT ARIA YKVCW+G C + DIL+ +D+AV D V++LSLS+G     G   
Sbjct  235   FAEGTARGMATRARIAAYKVCWIGGCFSTDILAALDKAVEDNVNILSLSLG-----GGMS  289

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +A+GAFGA++KG++VSC AGNSGP PY+  N+APWI TVGA T+DR+FPA V+L
Sbjct  290   DYYRDSVAMGAFGAMEKGILVSCSAGNSGPSPYSLSNVAPWITTVGAGTLDRDFPAFVSL  349

Query  895   GNGRTFTGTSLYFGIQPSPNQV-SMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ ++G SLY G  P P  +   VY   A    N   C+   L   KV GK+V C + 
Sbjct  350   GNGKNYSGVSLYRG-DPLPGTLLPFVYAGNASNAPNGNLCMTNTLIPEKVAGKMVMCDRG  408

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  VK +GG+GM+++N    G ELVA+A ++P   V    GD I  Y+ +  
Sbjct  409   VNPR-VQKGSVVKAAGGIGMVLANTGTNGEELVADAHLLPATAVGQKSGDAIKSYLFSDH  467

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
              AT  I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W+GA+ P+
Sbjct  468   DATVTILFEGTKVGIQPS-PVVAAFSSRGPNSITPDILKPDLIAPGVNILAGWSGAVGPT  526

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D R  +FNI+SGTSM+CPH+SGLA +L+  +P WSPAAI+SALMTT YT   SG+ 
Sbjct  527   GLPTDKRHVDFNIISGTSMSCPHISGLAGLLKAAHPEWSPAAIRSALMTTAYTNYKSGQK  586

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              + D+ TG PST   HG+GHVDP +A +PGL+YD  V+DY++FLC I Y + +I++  + 
Sbjct  587   -IQDVATGKPSTAFDHGAGHVDPVSALNPGLIYDLTVDDYLNFLCAINYSAPQISILAKR  645

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNL--------QTITYKRTVKNVGKVKNVAYQV  1935
             +   D   +   +   LNYPSFAV  +  L          + + RT+ NVG      Y+V
Sbjct  646   NFTCDTDKKY--SVADLNYPSFAVPLQTPLGGGGEGSSTVVKHTRTLTNVGSPST--YKV  701

Query  1936  TVQTPS-NVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             ++ + S +V+++V P  L F++  +  S++VTF   S+  + + FG + WSDG H+V SP
Sbjct  702   SIFSESESVKISVEPGSLSFSELNEKKSFKVTFTATSMPSNTNIFGRIEWSDGKHVVGSP  761

Query  2107  IAVSW  2121
             I VSW
Sbjct  762   IVVSW  766



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/714 (50%), Positives = 466/714 (65%), Gaps = 27/714 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E++YTY +  HGF+ RLTP +A  L   PGVISV  ++  EL TTR+P F
Sbjct  54    SSLRSVSESAEMIYTYNNAIHGFATRLTPGEADSLMTQPGVISVQQEQKYELHTTRTPLF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P +   +DI+IGVLD+GIWPE  SFSD G  PIP++W+ +C+ G  F A
Sbjct  114   LGLDGQNAGLFPETGASSDIVIGVLDTGIWPESKSFSDEGYGPIPSTWKGECQAGTNFTA  173

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             + CNRK+IGAR +  GYE   G+    DE KS  D  GHGTH AS AAG+ V  AN  G 
Sbjct  174   SLCNRKLIGARFFSDGYERDYGKINQADESKSPRDDFGHGTHTASTAAGNVVKGANYLGF  233

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G A G+A   R++VYKVCW   C ++DIL+GMD+A+ D VH++SLSIG     G +  
Sbjct  234   ASGTASGMAHRVRVSVYKVCWKSACVSSDILAGMDKAIEDNVHIMSLSIG-----GKSTS  288

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  + I++GAF A+++G+ VSC AGN GP P +  N APWI TVGAS+IDREFP VV LG
Sbjct  289   YTGE-ISMGAFSAMERGIFVSCSAGNDGPSPSSLSNAAPWITTVGASSIDREFPGVVILG  347

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
             NG+ +TG SL+ G       +  VYG      YC  G L+  KV+GKIV C +  ++   
Sbjct  348   NGKNYTGVSLFNGNALPAKLLPFVYG-----NYCSRGTLNPEKVKGKIVMCIKDDSVR-T  401

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
             ++G  VK +GG+GMI++N    G E++A+A ++P   V    GDII  YV    + TA I
Sbjct  402   EKGEVVKAAGGLGMILANAAGSGEEVLADAHVLPVTAVGQKAGDIIRRYVLTDPNPTASI  461

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS--ESTK  1431
             + RGTV    PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA+ PS   +T 
Sbjct  462   LIRGTVVNVRPS-PMVAAFSSRGPNTITPNILKPDLIAPGVNILAAWTGALGPSGLGTTS  520

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR EFNI SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  ++D
Sbjct  521   DTRRVEFNINSGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYNTYKDGKP-ILD  579

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
             + TG PSTP  HG+GHV PT A +PGL+YD    DY+DF+C   Y+S  I +  R +   
Sbjct  580   VATGKPSTPFEHGAGHVSPTAAVNPGLIYDLTTEDYIDFICASNYNSSLITIISRGN--Y  637

Query  1792  DCRNRNLGNPGA-LNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
              C  +   +P A LNYPSFAV  K +  T  Y RTV NVG   + + +VT +T + V+++
Sbjct  638   ACPRKT--HPAADLNYPSFAVNVKGS-GTYKYTRTVTNVGGAGSYSVKVTSETTA-VKIS  693

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQSA---DSFGSLRWSDGTHLVTSPIAVSW  2121
             V P  L F +  +  SY VTF  +   A   +SFGS+ WSDG H+V SP+A+SW
Sbjct  694   VEPAVLNFKEVNEKKSYSVTFTVISSKAPMSNSFGSIEWSDGKHVVASPVAISW  747



>dbj|BAJ91400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/712 (50%), Positives = 468/712 (66%), Gaps = 26/712 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
              +LY+Y H A GF+ARLT  QA+ L +   V++V+PD + +L TT +P FLGL S SS L
Sbjct  75    RVLYSYSHAATGFAARLTGRQAAHLTSQRSVLAVVPDVMQQLHTTLTPSFLGL-SASSGL  133

Query  211   GPSSDYGADIIIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPQFPATS-CNRKI  381
              P+S+  +D++IGVLD+G++P +R++F+ D  L P P  +R  C   P F A++ CN K+
Sbjct  134   LPASNGASDVVIGVLDTGVYPIDRAAFAADPSLPPPPGKFRGACVSTPSFNASAYCNGKL  193

Query  382   IGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             +GA+ +Y+GYE   G PI   +E KS +D  GHGTH AS AAGSAV +A   G+ARG A 
Sbjct  194   VGAKVFYKGYEVNLGGPINETEESKSPLDTVGHGTHTASTAAGSAVPDAAFYGYARGNAV  253

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A  ARIA YKVCW   C ++DIL+  D+A+ADGV V+S S+G     G+A+P+  D  
Sbjct  254   GMAPGARIASYKVCWKYGCPSSDILAAFDEAIADGVDVISASLG---SSGYAEPFYMDST  310

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             A+GAF AV+KG+IVS  AGNSGP   TA NIAPW LTVGASTI+R FPA V LGNG TF+
Sbjct  311   AVGAFSAVRKGIIVSAAAGNSGPVESTANNIAPWFLTVGASTINRRFPADVVLGNGDTFS  370

Query  916   GTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             G SLY G    P  + +V GR   S+ C  G+++AS V GKIV C     +    QG AV
Sbjct  371   GASLYAGPPLGPTAIPLVDGRAVGSKTCEAGKMNASLVAGKIVLCGPA--VLNAAQGEAV  428

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GGVG I+++ +  G   V + +  P   VT A    I  Y+  T S  A IVF GTV
Sbjct  429   KLAGGVGAILTSTKQFGELAVGSPNTFPATTVTFAAAKRIKTYMNKTTSPAATIVFHGTV  488

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              G +PS+PR+A FSSRGPN   PEILKPDV APGV ILAAWTGA +PS    D RR  +N
Sbjct  489   IGPTPSSPRMAPFSSRGPNLHAPEILKPDVTAPGVEILAAWTGAASPSGLDSDRRRVHYN  548

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             ++SGTSMACPHVSG+AAMLR+  P WSPAAIKSALMTT Y +D++G + + D+ TG  ST
Sbjct  549   VLSGTSMACPHVSGIAAMLRQARPGWSPAAIKSALMTTAYNVDSAG-NVIGDMATGKAST  607

Query  1636  PHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG  1815
             P A G+GHVDP  A DPGLVYD G +DYV FLC +GY + ++A+F R+    +C      
Sbjct  608   PFARGAGHVDPDRALDPGLVYDAGTDDYVAFLCALGYTADEVAVFTRDGSSTNCS----A  663

Query  1816  NPGAL-----NYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              PG+      NYP+F  V  +   TIT +R V+NVG      Y+ TV +P+ +R+TV P 
Sbjct  664   APGSAYVGDHNYPAFVAVLTSRNGTITQRRVVRNVGSDVVATYRATVTSPAGMRITVKPR  723

Query  1981  RLVFTDRIDTLSYEVTFQSLRQSAD----SFGSLRWSDGTHLVTSPIAVSWE  2124
             +L F+    T  Y+VTF ++R +      +FGS+ WSDG H VTSPIA++W 
Sbjct  724   KLRFSKTHKTQEYQVTF-AIRAAGSIKEYTFGSIVWSDGEHKVTSPIAIAWS  774



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/725 (49%), Positives = 470/725 (65%), Gaps = 32/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LY Y +V HGFS RLT  +A  L    G+ISVLP+ + EL TTR+P+F
Sbjct  58    SSLKSVSESADMLYDYNNVIHGFSTRLTSEEAELLEKQEGIISVLPEMIYELHTTRTPEF  117

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S    P+SD  +++++GVLD+G+WPE  SF D GL PIP +W+ +CE G  F +
Sbjct  118   LGL-GKSEAFFPTSDSVSEVVVGVLDTGVWPEAKSFDDTGLGPIPRTWKGECETGKNFNS  176

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR + +GYEA  G P+ +  E +S  D  GHGTH ++ AAGSAV+ A++ G
Sbjct  177   SSCNRKLIGARFFSKGYEAAFG-PVDETVESRSPRDDDGHGTHTSTTAAGSAVSGASLFG  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+A YKVCWLG C  +DI++ MD+AV DGV+V+S+SIG     G   
Sbjct  236   FATGIARGMATQARVAAYKVCWLGGCFGSDIVAAMDKAVEDGVNVISMSIG-----GGLS  290

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A  +G++VSC AGN GP   +  NIAPWI TVGA T+DR+FPA V L
Sbjct  291   DYYRDIVAIGAFTATAQGILVSCSAGNGGPSQGSLSNIAPWITTVGAGTLDRDFPAYVRL  350

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ F+G SLY G   S + V +V    A++      C+ G L  +KV GKIV C +  
Sbjct  351   GNGKNFSGASLYSGKPLSDSLVPLVSAGNASNATSGSLCMSGTLIPTKVAGKIVICDRGG  410

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V +G  VK +GG+GMI++N    G ELVA+A ++PTA V     D+I  Y  +   
Sbjct  411   N-SRVQKGLEVKNAGGIGMILANTELYGDELVADAHLLPTAAVGQTSADVIKRYAFSDLK  469

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA  P+ 
Sbjct  470   PTATIAFGGTHIGVEPS-PVVAAFSSRGPNLVTPEILKPDIIAPGVNILAGWTGAAGPTG  528

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T D RR  FNI+SGTSM+CPHVSGLAA ++  +  WSPAAI+SALMTT YT   SG+ T
Sbjct  529   LTDDTRRVSFNIISGTSMSCPHVSGLAAFIKAAHQDWSPAAIRSALMTTAYTAYKSGK-T  587

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             ++D+ TG P+TP  +G+GHV+P  A DPGLVYD  V DY+ FLC + Y + +I A+  R+
Sbjct  588   ILDVSTGQPATPFDYGAGHVNPLAALDPGLVYDATVEDYLGFLCALNYSAAQIKAVINRD  647

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNN---------LQTITYKRTVKNVGKVKNVAYQ  1932
                   +  +LG+   LNYPSF+V  +             T+ Y RT+ NVG        
Sbjct  648   FTCDPAKKYSLGD---LNYPSFSVPLETASGKGGGAGVTSTVKYTRTLTNVGTPATYKVS  704

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSP  2106
             V+ +TPS V+++V P  L F+++ +  SY VTF   SL     +F  L WS G H+V SP
Sbjct  705   VSSETPS-VKISVEPESLSFSEQYEKKSYTVTFSATSLPSGTTNFARLEWSSGKHVVGSP  763

Query  2107  IAVSW  2121
             IA SW
Sbjct  764   IAFSW  768



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/725 (49%), Positives = 470/725 (65%), Gaps = 35/725 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY++V HGFS +LT  +A  L   PG++SVLP+   EL TTRSP+F
Sbjct  54    SSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESLEQRPGILSVLPELKYELHTTRSPEF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+NL P+S   +++I+GVLD+G+WPE  SF D GL P+P+SW+  CE G  F A
Sbjct  114   LGL-DKSANLFPTSGSASEVIVGVLDTGVWPESKSFDDTGLGPVPSSWKGACETGTNFNA  172

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + RGYEA  G PI +  E KS  D  GHGTH AS AAGS V  A++ G
Sbjct  173   SNCNRKLIGARYFARGYEATLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVEGASLFG  231

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCW+G C ++DIL+ ++QA+ D V+VLS+S+G     G   
Sbjct  232   YAAGTARGMATRARVAAYKVCWVGGCFSSDILAAIEQAIDDNVNVLSMSLG-----GGTS  286

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D IAIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  287   DYYKDSIAIGAFAAMEKGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSL  346

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SLY G       +  VY   A    N   C+   L   KV GKIV C +  
Sbjct  347   GNGQNYSGVSLYKGDGLPGKLLPFVYAGNASNATNGNLCMMDTLIPEKVAGKIVMCDRGV  406

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM+++N    G ELVA+A ++P   V    GD I  Y+ +   
Sbjct  407   NAR-VQKGAVVKAAGGLGMVLANTEGNGEELVADAHLLPATAVGQKFGDAIKSYLVSDPK  465

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TPE+LKPD+IAPGVNILA W+GA+ P+ 
Sbjct  466   PTVTILFEGTKVGVEPS-PVVAAFSSRGPNSITPELLKPDMIAPGVNILAGWSGAVGPTG  524

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y    +G+  
Sbjct  525   LATDSRRVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAYVSYKNGQK-  583

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D+ TG  STP  HG+GHV+P +A +PGLVYD  V+DY+ FLC + Y + +I    R  
Sbjct  584   LQDIATGKASTPFDHGAGHVNPVSALNPGLVYDLTVDDYLGFLCALNYTASQINSLARRK  643

Query  1783  PLVDCRNR-NLGNPGALNYPSFAVVFKNNLQT---------ITYKRTVKNVGKVKNVAYQ  1932
                D   R +L +    NYPSFAV    N++T         + Y R++ NVG        
Sbjct  644   FTCDASKRYSLAD---FNYPSFAV----NIETAQSSSGSSVLKYTRSLTNVGPPGTYKVF  696

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             +T  T   V+++V P  L FT   +  SY VTF   S+  + +SF  L WSDG ++V SP
Sbjct  697   ITSSTGPGVKISVEPATLSFTQANEKKSYTVTFTVSSMPSNTNSFAHLEWSDGKYIVGSP  756

Query  2107  IAVSW  2121
             IA+SW
Sbjct  757   IAISW  761



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/721 (49%), Positives = 467/721 (65%), Gaps = 27/721 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY++V HGFS +LT  +A  L   PG++SVLP+   EL TTRSP+F
Sbjct  55    SSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESLEQRPGILSVLPELKYELHTTRSPEF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+NL P+S   +++I+GVLD+G+WPE  SF D GL P+P+SW+  CE G  F A
Sbjct  115   LGL-DKSANLFPTSGSASEVIVGVLDTGVWPESKSFDDTGLGPVPSSWKGACETGTNFNA  173

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + RGYEA  G PI +  E KS  D  GHGTH AS AAGS V  A++ G
Sbjct  174   SNCNRKLIGARYFARGYEATLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVEGASLFG  232

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCW+G C ++DIL+ ++QA+ D V+VLS+S+G     G   
Sbjct  233   YAAGTARGMATRARVAAYKVCWVGGCFSSDILAAIEQAIDDNVNVLSMSLG-----GGTS  287

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  288   DYYKDSVAIGAFAAMEKGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SLY G       +  VY   A    N   C+   L   KV GKIV C +  
Sbjct  348   GNGQNYSGVSLYKGDGLPGKLLPFVYAGNASNATNGNLCMMDTLIPEKVAGKIVMCDRGV  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM+++N    G ELVA+A ++P   V    GD I  Y+ +   
Sbjct  408   NAR-VQKGAVVKAAGGLGMVLANTESNGEELVADAHLLPATAVGQKFGDAIKSYLVSDPK  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TPE+LKPD+IAPGVNILA W+GA+ P+ 
Sbjct  467   PTVTILFEGTKVGVEPS-PVVAAFSSRGPNSITPELLKPDMIAPGVNILAGWSGAVGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y    +G+  
Sbjct  526   LATDSRRVGFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAYVSYKNGQK-  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D+ TG  STP  HG+GHV+P +A +PGLVYD  V+DY+ FLC + Y + +I    R  
Sbjct  585   LQDIATGKASTPFDHGAGHVNPVSALNPGLVYDLTVDDYLGFLCALNYTASQINSLARRK  644

Query  1783  PLVDCRNR-NLGNPGALNYPSFAVVF-----KNNLQTITYKRTVKNVGKVKNVAYQVTVQ  1944
                D   R +L +    NYPSFAV        +    + Y RT+ NVG        +T  
Sbjct  645   FTCDASKRYSLAD---FNYPSFAVNIDAAQSSSGSSVLKYSRTLTNVGPPGTYKVSITSS  701

Query  1945  TPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVS  2118
             T   V+++V P  L FT   +  SY VTF   S+  + +SF  L WSDG ++V SPIA+S
Sbjct  702   TGPGVKISVEPATLSFTQANEKKSYTVTFTVSSMPSNTNSFARLEWSDGKYIVGSPIAIS  761

Query  2119  W  2121
             W
Sbjct  762   W  762



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/717 (50%), Positives = 468/717 (65%), Gaps = 26/717 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTYE+  HGFS RLT  +A  L   PGVISVLP+   EL TTR+P F
Sbjct  45    SSLRSISDSAELLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLF  104

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +++L P +   +D+++GVLD+G+WPE  S+SD G  PIP+SW+  CE G  F A
Sbjct  105   LGLDEHTADLFPEAGSYSDVVVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFTA  164

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYE+  G PI +  E +S  D  GHGTH +S AAGS V  A++ G
Sbjct  165   SLCNRKLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLG  223

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+     +AVYKVCWLG C ++DIL+ +D+A+AD V+VLS+S+G     G   
Sbjct  224   YASGTARGML--HALAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG-----GGMS  276

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G++VSC AGN+GP   +  N+APWI TVGA T+DR+FPA+  L
Sbjct  277   DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAIL  336

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ FTG SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +  
Sbjct  337   GNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGI  396

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GGVGMI++N    G ELVA+A ++P   V    GDII  YV    +
Sbjct  397   NAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPN  455

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I   GTV G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P+ 
Sbjct  456   PTASISILGTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTG  514

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  515   LASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKP-  573

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKI-ALFLRN  1779
             L+D+ TG PSTP  HG+GHV PT A +PGL+YD    DY+ FLC + Y S +I ++  RN
Sbjct  574   LLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRN  633

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                   ++ ++ +   LNYPSFAV   +      Y RTV +VG     + +VT +T + V
Sbjct  634   YTCDPSKSYSVAD---LNYPSFAVNV-DGAGAYKYTRTVTSVGGAGTYSVKVTSET-TGV  688

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  689   KISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISW  745



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/725 (49%), Positives = 470/725 (65%), Gaps = 35/725 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY++V HGFS +LT  +A  L   PG++SVLP+   EL TTRSP+F
Sbjct  54    SSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESLEQRPGILSVLPELKYELHTTRSPEF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+NL P+S   +++I+GVLD+G+WPE  SF D GL P+P+SW+  CE G  F A
Sbjct  114   LGL-DKSANLFPTSGSASEVIVGVLDTGVWPESKSFDDTGLGPVPSSWKGACETGTNFNA  172

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + RGYEA  G PI +  E KS  D  GHGTH AS AAGS V  A++ G
Sbjct  173   SNCNRKLIGARYFARGYEATLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVEGASLFG  231

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCW+G C ++DIL+ ++QA+ D V+VLS+S+G     G   
Sbjct  232   YAAGTARGMATRARVAAYKVCWVGGCFSSDILAAIEQAIDDNVNVLSMSLG-----GGTS  286

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  287   DYYKDSVAIGAFAAMEKGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSL  346

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SLY G       +  VY   A    N   C+   L   KV GKIV C +  
Sbjct  347   GNGQNYSGVSLYKGDGLPGKLLPFVYAGNASNATNGNLCMMDTLIPEKVAGKIVMCDRGV  406

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM+++N    G ELVA+A ++P   V    GD I  Y+ +   
Sbjct  407   NAR-VQKGAVVKAAGGLGMVLANTESNGEELVADAHLLPATAVGQKFGDAIKSYLVSDPK  465

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TPE+LKPD+IAPGVNILA W+GA+ P+ 
Sbjct  466   PTVTILFEGTKVGVEPS-PVVAAFSSRGPNSITPELLKPDMIAPGVNILAGWSGAVGPTG  524

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y    +G+  
Sbjct  525   LATDSRRVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAYVSYKNGQK-  583

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D+ TG  STP  HG+GHV+P +A +PGLVYD  V+DY+ FLC + Y + +I    R  
Sbjct  584   LQDIATGKASTPFDHGAGHVNPVSALNPGLVYDLTVDDYLGFLCALNYTASQINSLARRK  643

Query  1783  PLVDCRNR-NLGNPGALNYPSFAVVFKNNLQT---------ITYKRTVKNVGKVKNVAYQ  1932
                D   R +L +    NYPSFAV    N++T         + Y R++ NVG        
Sbjct  644   FTCDASKRYSLAD---FNYPSFAV----NIETAQSSSGSSVLKYTRSLTNVGPPGTYKVF  696

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             +T  T   V+++V P  L FT   +  SY VTF   S+  + +SF  L WSDG ++V SP
Sbjct  697   ITSSTGPGVKISVEPATLSFTQANEKKSYTVTFTVSSMPSNTNSFAHLEWSDGKYIVGSP  756

Query  2107  IAVSW  2121
             IA+SW
Sbjct  757   IAISW  761



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/723 (49%), Positives = 465/723 (64%), Gaps = 31/723 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S ++E++Y Y+  AHGFSARL+P++A  L + PGV+ V+ +   EL TTR+P+FLG
Sbjct  59    LRSVSDAAEIIYAYDTAAHGFSARLSPAEARALEHRPGVLGVVLEERYELHTTRTPEFLG  118

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT-  363
             L   S  L P S+  +D+++GVLD+G+WPER S+ D GL P+P SW+  CE G  F A  
Sbjct  119   L-DRSEGLIPQSNTESDVVVGVLDTGVWPERKSYDDAGLGPVPASWKGVCEEGKDFKAAD  177

Query  364   SCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngh  537
             +CNRK++GAR + +GYEA  G PI    E +S  D  GHGTH +S AAGS V +AN+ G+
Sbjct  178   ACNRKLVGARFFSKGYEASMG-PIDETKESRSPRDNDGHGTHTSSTAAGSVVPDANLLGY  236

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG++T AR+AVYKVCWLG C ++DIL+ MD+A+ DG  VLSLS+G     G    
Sbjct  237   AAGTARGMSTRARVAVYKVCWLGGCFSSDILAAMDKAIEDGCGVLSLSLG-----GGMSD  291

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +AIGAF A+ KGV+VSC AGN+GP   T  N+APWI TVGA TIDR+FPA V LG
Sbjct  292   YYRDSVAIGAFNAMAKGVVVSCSAGNAGPGTSTLSNVAPWITTVGAGTIDRDFPAYVVLG  351

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             +G+ +TG SLY G     + + ++Y   A    N   C+ G L   KV GKIV C +  N
Sbjct  352   DGKNYTGVSLYSGKPLPSSSLPLIYAGNATNATNGNLCMVGTLLPDKVSGKIVLCDRGIN  411

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +GF V+ +GG GMI++N    G ELVA+A ++P   V    GD I  Y+ +  + 
Sbjct  412   AR-VQKGFVVRDAGGAGMILANTAANGEELVADAHLLPATAVGEKAGDAIKSYLFSDPNP  470

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
              A + F GT  G  PS P VAAFSSRGPN +TP+ILKPD++APGVNILAAW+G++ P+  
Sbjct  471   KATVAFGGTKVGVMPS-PVVAAFSSRGPNAVTPDILKPDLVAPGVNILAAWSGSVGPTGQ  529

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D RRTEFNI+SGTSM+CPHVSGLAA LR  +P WSP AIKSALMTT Y  D  G   +
Sbjct  530   AADPRRTEFNIISGTSMSCPHVSGLAAFLRGAHPDWSPGAIKSALMTTAYA-DYPGGGGI  588

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             +D+ TG P+TP   G+GHVDP  A DPGLVYD  V+DY+DFLC + Y + +IA   R S 
Sbjct  589   LDVATGRPATPFDFGAGHVDPPKALDPGLVYDLTVDDYLDFLCALNYTTLQIASVSRRSN  648

Query  1786  LVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAYQVT  1938
               +C N+       LNYPSFAV F          +   T+ + RT+ NVG      Y+ T
Sbjct  649   F-NCDNKKAYAVSDLNYPSFAVAFATASGAGGGGSAATTVKHTRTLTNVGAPGT--YKAT  705

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIA  2112
             V  P   +VTV P+ L F    +  SY V F +  Q + +  FG L WSDG H+V SP++
Sbjct  706   VSAPQEAKVTVDPSELSFAAAGEKKSYTVAFSAASQPSGTAAFGRLEWSDGKHVVASPLS  765

Query  2113  VSW  2121
              +W
Sbjct  766   FTW  768



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/704 (51%), Positives = 461/704 (65%), Gaps = 22/704 (3%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPS  219
             Y+Y     GF+A L PSQA+ L   P V+ V  D +  L TTR+P+FLGL +  S   P+
Sbjct  73    YSYSAAYPGFAASLDPSQAASLRRSPAVLGVYEDAVYSLHTTRTPEFLGLSAELSAHDPN  132

Query  220   SD-YGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGARA  396
              D   AD++IGVLD+G+WPE  SF D G+  +P  WR +CE GP F    CN+K+IGAR+
Sbjct  133   PDPSSADVVIGVLDTGVWPESRSFDDSGMPDVPARWRGQCESGPDFDPRLCNKKLIGARS  192

Query  397   YYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             + +GY   +G   + +PK   S  D  GHGTH AS AAGS VANA++ G+A G ARG+AT
Sbjct  193   FSKGYHMASGGSFLKDPKETDSPRDQEGHGTHTASTAAGSRVANASLLGYASGTARGMAT  252

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGA  747
              AR+A YKVCW   C  +DIL+GMDQA+ DGV VLSLS+G     G + PY  D IAIG+
Sbjct  253   RARVASYKVCWRNGCFGSDILAGMDQAILDGVDVLSLSLG-----GGSAPYYRDTIAIGS  307

Query  748   FGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSL  927
             F AV++G+ VSC AGN+GP   T  N+APWI+TVGA T+DR+FPA   LGN   FTG SL
Sbjct  308   FAAVERGIFVSCSAGNAGPARATLANVAPWIMTVGAGTLDRDFPAYAVLGNKNRFTGVSL  367

Query  928   YFGIQPSPNQVSMVY--GRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQ  1101
             Y G       V +VY  G   +   CLPG L  + VRGK+V C +  N   V++G  V+ 
Sbjct  368   YSGPGMGKKLVGLVYDKGSDGSGNLCLPGSLQPALVRGKVVVCDRGTNAR-VEKGSVVRA  426

Query  1102  SGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTG  1281
             +GGVGMI++N    G ELVA++ ++P   V    GD+I +Y  +  + TA I F GTV G
Sbjct  427   AGGVGMILANTAASGEELVADSHLLPAVAVGRKVGDLIREYASSNLNPTATIGFGGTVLG  486

Query  1282  NSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIM  1461
               PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAW+GA+ P+   KD R+T+FNIM
Sbjct  487   VQPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSGAVGPTGLEKDTRKTQFNIM  545

Query  1462  SGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPH  1641
             SGTSM+CPH+SGLAA+L+  +P+WSP+AIKSALMTT+YT DN+  S+L D   G  STP 
Sbjct  546   SGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTSYTHDNT-NSSLRDAAGGTYSTPW  604

Query  1642  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  1821
             AHGSGHVDP  A  PGLVYD   +DYV FLC++ Y   ++    +  P V C +R   +P
Sbjct  605   AHGSGHVDPEKALSPGLVYDISTDDYVAFLCSLDYTIDQVRAVAKR-PNVTC-SRKFADP  662

Query  1822  GALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDR  2001
             G LNYPSF+V+F +  + + Y R + NVG   +V Y VTV  P  V VTV P +LVF   
Sbjct  663   GQLNYPSFSVLFGSK-RIVRYTRQLTNVGAAGSV-YAVTVMGPPAVEVTVKPPKLVFAKV  720

Query  2002  IDTLSYEVTFQS---LRQSADS-FGSLRWSDGTHLVTSPIAVSW  2121
              D  SY VTF S   + Q+  S FGS+ WS+  + V SP+A +W
Sbjct  721   GDRRSYTVTFVSKKGMNQTVRSDFGSIVWSNAQNEVRSPVAYAW  764



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/725 (49%), Positives = 469/725 (65%), Gaps = 32/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ +LYTY++V HGFS RLT  +A  L   PG++SVLP+   EL TTR+P+F
Sbjct  55    SSLKSVSASAAMLYTYKNVIHGFSTRLTAKEAESLQKQPGIVSVLPEVRYELHTTRTPEF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S  L P+S+  +++I+GVLD+G+WPE  SF D G+ P+P  W+  CEVG  F +
Sbjct  115   LGL-GKSETLFPTSEVQSEVIVGVLDTGVWPEIKSFDDTGMGPVPRGWKGVCEVGRNFKS  173

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR++ RGYE   G PI +  E KS  D  GHGTH ++ AAGS V  A++ G
Sbjct  174   SSCNRKLIGARSFSRGYEEAVG-PIDETAESKSPRDDDGHGTHTSTTAAGSVVNGASLFG  232

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+A YKVCWL  C  +DIL+GMD+A+ DGV+V+S+SIG     G   
Sbjct  233   FASGTARGMAAQARVATYKVCWLAGCFGSDILAGMDKAIEDGVNVMSMSIG-----GGLT  287

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+ +G+ VSC AGN GP   +  N+APWI TVGA T+DR FP  V+L
Sbjct  288   DYYRDTVAIGAFTAMAQGIFVSCSAGNGGPYANSISNVAPWITTVGAGTLDRNFPTYVSL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG++F+G SLY     S + V +V     +S      C+ G L  +KV GKIV C +  
Sbjct  348   GNGKSFSGVSLYSRRPLSGSMVPIVDAANVSSTSSGNLCMTGSLIPAKVAGKIVVCDRGG  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V++G  VK +GGVGMI++N    G ELVA+A ++P+A V    GD I +Y+ +   
Sbjct  408   N-SRVEKGVEVKDAGGVGMILTNTDSYGEELVADAQLLPSANVGEKAGDAIKNYISSDPG  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               A I+ RGT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  467   PMATIISRGTQLGIQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGAVGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D R   FNI+SGTSM+CPHVSGLAA+L+  +P WSP+AI+SALMTT Y+   +G+ T
Sbjct  526   LENDKRHVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIRSALMTTAYSTYGNGK-T  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFL-RN  1779
             L+D+ TG PSTP   G+GHVDP  A DPGLVYD  V DY+DFLC + Y S +I     R+
Sbjct  585   LLDISTGQPSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRD  644

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNL---------QTITYKRTVKNVGKVKNVAYQ  1932
                +  +  +LG+   +NYPSF+V F+             T+ Y RT+ NVG        
Sbjct  645   FACLSSKTYSLGD---VNYPSFSVPFETASGTWGGVGAPSTVKYTRTLTNVGTPTTYKAS  701

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             V+ Q+ S V++ V P  L F+ + +  SY VTF   S+     SF  L+WSDG H+V SP
Sbjct  702   VSSQSTS-VKILVEPESLSFSRQYEKKSYVVTFTASSMPSGTTSFARLQWSDGKHVVGSP  760

Query  2107  IAVSW  2121
             IA SW
Sbjct  761   IAFSW  765



>ref|XP_007136744.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
 gb|ESW08738.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
Length=777

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/724 (49%), Positives = 468/724 (65%), Gaps = 31/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E LYTY+HVAHGFS RLT  +A  L+  PG++SV+P+   +L TTR+P+F
Sbjct  67    SSLKSVSDSAERLYTYQHVAHGFSTRLTTQEAELLSKQPGILSVIPEIRYDLHTTRTPEF  126

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL      L  +S   +D+++GVLD+G+WPE  SF D+GL P+P+SW+ +CE G  F  
Sbjct  127   LGL-EKFITLSLASGRQSDVVVGVLDTGVWPELKSFDDKGLGPVPSSWKGECERGKNFGP  185

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
              +CN+K++GAR + +GYEA  G PI +  E KS  D  GHGTH ++ AAGSAVA A++ G
Sbjct  186   ANCNKKLVGARFFAKGYEAAFG-PIDESTESKSPRDDDGHGTHTSTTAAGSAVAGASLFG  244

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+A YKVCWLG C ++DI +G+D+A+ADGV++LS+SIG     G   
Sbjct  245   FANGTARGMATQARVATYKVCWLGGCFSSDIAAGIDKAIADGVNILSMSIG-----GGLT  299

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D IAIG F A    ++VS  AGN GP   +  N+APW+ TVGA TIDR+FPA VTL
Sbjct  300   DYYRDTIAIGTFAATAHRILVSNSAGNGGPSQASLSNVAPWLTTVGAGTIDRDFPAYVTL  359

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRR----ANSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+++TG SLY G  P  + + +VY       +    C  G L A+KV GKIV C +  
Sbjct  360   GNGKSYTGVSLYNGKLPPKSPIPIVYAGNVSGDSEGSLCSKGSLIAAKVAGKIVICDRGG  419

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V++G  VK +GG GMI++N    G ELVA++ ++P   +     +++  YV ++ +
Sbjct  420   NAR-VEKGLVVKSAGGSGMILANSEDYGEELVADSYLLPAIALGQKSSNVLKKYVFSSPN  478

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA++ F GT  G  PS P VAAFSSRGPN LTP++LKPD+IAPGVNILA WTGA+ P+ 
Sbjct  479   PTAKLSFGGTHLGVQPS-PVVAAFSSRGPNLLTPKVLKPDLIAPGVNILAGWTGAVGPTG  537

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T+D R  EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT+Y    +G+ T
Sbjct  538   MTEDTRHVEFNIISGTSMSCPHVSGLAALLKGTHPEWSPAAIRSALMTTSYRTYKNGQ-T  596

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D+YTG P+TP   G+GHVDP  A DPGLVYD  V+DY+ F C + Y S +I L  R  
Sbjct  597   LKDVYTGLPATPFDFGAGHVDPVAAFDPGLVYDATVDDYLSFFCALNYSSYQIKLVARRD  656

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNL---------QTITYKRTVKNVGKVKNVAYQV  1935
                 C  R       LNYPSFAV F               + YKRT+ NVG      Y+V
Sbjct  657   --FTCSKRKKYRVEDLNYPSFAVPFNTAFGVKGGSQKPTAVQYKRTLTNVG--APATYKV  712

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA--DSFGSLRWSDGTHLVTSPI  2109
             +V    +V++ V P  L F    +  SY VTF S  + +  +SF  L WSDG H V+SPI
Sbjct  713   SVTQSPSVKIVVEPQTLSFRQLNEKKSYTVTFTSSSKPSGTNSFAYLEWSDGKHKVSSPI  772

Query  2110  AVSW  2121
             A SW
Sbjct  773   AFSW  776



>emb|CDY29697.1| BnaA04g17300D [Brassica napus]
Length=747

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/716 (50%), Positives = 472/716 (66%), Gaps = 33/716 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTY +  HGFS RLTP +A  L   PGVISVLP++  EL TTR+P F
Sbjct  55    SSLKSVSESAELLYTYNNAIHGFSTRLTPQEADSLMTQPGVISVLPEQQYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   + +L P ++  +D+++GV+D+G+WPER SFSD+G  PIP++W+ KCEVG  F A
Sbjct  115   LGLDVHNGDLFPETEASSDVVVGVIDTGVWPERKSFSDKGYGPIPSTWKGKCEVGTNFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYEA  G PI +  E +S  D  GHGTH +S AAGS V  AN  G
Sbjct  175   SLCNRKLIGARFFARGYEAEKG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGANFLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+AVYKVCW G C ++D+L+ +D+A+ D V+VLS+S+     +    
Sbjct  234   FANGTARGMAPGARLAVYKVCWKGGCFDSDVLAAIDKAIDDNVNVLSISM-----DDLTL  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  + IAIGAF A+++G++VSC AGNSGP      N+APWI TVGA TIDR+FPA+V L
Sbjct  289   DYYRNDIAIGAFAAMERGILVSCSAGNSGPRSSDISNVAPWITTVGAGTIDRDFPALVIL  348

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             GNG  ++G SL  G    P  +  VY   A++        + +  +GKIV C +  N   
Sbjct  349   GNGNNYSGVSLIKG-DALPELLPFVYAGNASN------ATNGNFFKGKIVMCDRGVNFR-  400

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V++G  VK  GG+GMI++N    G ELVA+A ++P   V    G+II  YV    + TA 
Sbjct  401   VEKGEVVKAVGGLGMILANTAENGEELVADAHLLPATAVGEKAGEIIRHYVITHPNPTAS  460

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             I+ +GTV    PS P VAAFS RGPN  TP ILKPD+IAPGVNILAAWTGA  P+E   D
Sbjct  461   ILTQGTVVNVQPS-PVVAAFSLRGPNPTTPNILKPDLIAPGVNILAAWTGAKGPTELASD  519

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y+    G+  LID+
Sbjct  520   TRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYSTYKDGKP-LIDI  578

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              TG PSTP  HG+GHV PT A +PGL+YD    DY+DFLC + Y S +I    R +   D
Sbjct  579   ATGKPSTPFDHGAGHVSPTMAVNPGLIYDILTVDYLDFLCALNYTSSQIMKVSRRNYTCD  638

Query  1795  -CRNRNLGNPGALNYPSFAVVFKNNLQ---TITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
               +  ++GN   LNYPSFA+    N+Q     TY RTV NVG+  + + +VT +T + V 
Sbjct  639   PSKTYSVGN---LNYPSFAL----NVQGSGAYTYTRTVTNVGEAGSYSVKVTSET-TIVN  690

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++V P  L F +  +  SY VTF    S    ++SFGS++WSDG H+V SP+A+SW
Sbjct  691   ISVVPAVLNFKEVNEKKSYSVTFNVDSSKASGSNSFGSIQWSDGIHVVGSPVAISW  746



>ref|XP_011028928.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/725 (49%), Positives = 470/725 (65%), Gaps = 32/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LY Y ++ HGFS RLTP +A  L   PG++SVLP+ + +L TT SP+F
Sbjct  68    SSLKSVSESADMLYAYNNIIHGFSTRLTPEEAELLEKQPGILSVLPEMIYKLHTTHSPEF  127

Query  181   LGLISGSSNLGPSSDYG-ADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL  G S+  PS+    +++I+GVLD+G+WPE  SF D GL PIP++W+  CEVG  F 
Sbjct  128   LGL--GKSDAVPSASASISEVIVGVLDTGVWPEIKSFDDTGLGPIPSTWKGTCEVGKNFN  185

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvn  531
             ++SCNRK+IGA+ + +GYEA  G PI +  E KS  D  GHGTH A+ AAGSAV+ A++ 
Sbjct  186   SSSCNRKLIGAQYFSKGYEAAFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLF  244

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G+A G ARG+AT AR+A YKVCWLG C ++DIL+ M++AVADGV+V+S+SIG     G  
Sbjct  245   GYAFGTARGMATQARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVISMSIG-----GGI  299

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               YN D +AIGAF AV +G++VSC AGN GP   +  N+APWI TVGA T+DR+FPA V 
Sbjct  300   SDYNRDTVAIGAFRAVAQGILVSCSAGNGGPSAGSLTNVAPWITTVGAGTLDRDFPAYVN  359

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQL  1059
             LGNG+ ++G SLY G   S + + +VY G  +NS     C+ G L  S V GKIV C + 
Sbjct  360   LGNGKNYSGISLYSGKPLSDSLLPLVYAGNASNSTSGNLCMTGTLIPSHVAGKIVICDRG  419

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N + V +G  V+ SGG+GMI++N    G ELVA+A ++PT+ V     D I +Y  +  
Sbjct  420   LN-SRVQKGMVVRDSGGLGMILANTELYGEELVADAHLLPTSTVGQRTADAIKNYAFSDA  478

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
                A I   GT  G  PS P +AAFSSRGPN +TPE+LKPD+IAPGVNILA WTGA+ P+
Sbjct  479   KPMATIASGGTKLGVEPS-PVLAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGAVGPT  537

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
               T D R   FNI+SGTSM+CPHVSGLAA+++  +  WSPAAIKSALMTT Y    +G +
Sbjct  538   GLTSDKRHVSFNIISGTSMSCPHVSGLAALIKAAHQDWSPAAIKSALMTTAYATYKNGEN  597

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              ++D+ TG PSTP   G+GHV+P  A DPGLVYD  V+DY+DF C + Y +  I      
Sbjct  598   -ILDVATGQPSTPFDFGAGHVNPVAALDPGLVYDASVDDYIDFFCALNYSASDIKQIANK  656

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNN---------LQTITYKRTVKNVGKVKNVAYQ  1932
                  C +    + G LNYPSF+V  +             T+ Y RT+ NVG        
Sbjct  657   D--FTCDSSKKYSLGDLNYPSFSVPLQTASGKGGGAGVTSTVKYTRTLTNVGAPATYKLS  714

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             +T +TPS V++ V P  L F+   +  +Y VTF  +S+    +SF  L WSDG H+V SP
Sbjct  715   MTSKTPS-VKILVEPESLSFSKEYEKKTYTVTFTAKSMPSGTNSFAHLEWSDGKHVVGSP  773

Query  2107  IAVSW  2121
             IA SW
Sbjct  774   IAFSW  778



>ref|XP_010519206.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010519207.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=775

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/716 (50%), Positives = 459/716 (64%), Gaps = 28/716 (4%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
                + +LYTY+ V HG +ARL+  +A  L    GV++V+P+R  EL TTRSP FLGL   
Sbjct  69    EEETRILYTYQKVFHGVAARLSKEEAGRLEQESGVVAVIPERRYELHTTRSPTFLGLERR  128

Query  199   SSN--LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCN  372
              S   +        D+I+GVLD+GIWPE  SF+D G++P+P +WR  CE G  F    CN
Sbjct  129   DSENTVWEEKLMDHDVIVGVLDTGIWPESQSFNDTGMSPVPATWRGACETGRGFTKNHCN  188

Query  373   RKIIGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaR  543
             RKI+GAR +Y+GYEA TG+  +DE    KS  D  GHGTH A+  AGS V  AN+ G+A 
Sbjct  189   RKIVGARVFYKGYEAATGK--IDEQLEYKSPRDRDGHGTHTAATVAGSPVRGANLLGYAY  246

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G ARG+A  ARIA YKVCW+G C ++DILS +D+AVADGVHVLS+S+G     G    Y 
Sbjct  247   GTARGMAPRARIAAYKVCWVGGCFSSDILSAVDRAVADGVHVLSISLG-----GGISTYY  301

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
              D ++I AFGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG+G
Sbjct  302   RDSLSIAAFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVNLGSG  361

Query  904   RTFTGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             RT  G SLY G  +     Q  +VY G  A+S     +CL G LD   V GKIV C +  
Sbjct  362   RTVRGVSLYKGTTVLSKNRQYPLVYMGSNASSPDPSSFCLDGALDRRHVAGKIVICDR-G  420

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
                 V +G  V+++GG+GMI++N    G ELVA+  ++P   V   +G +I  Y   ++ 
Sbjct  421   VTPRVQKGQVVREAGGIGMILTNTATNGEELVADCHLLPAVAVGEKEGKMIKQYAMTSRR  480

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA +   GT  G  PS P VAAFSSRGPNFLT EILKPD++APGVNILAAWTG + PS 
Sbjct  481   PTANLQILGTRLGIKPS-PVVAAFSSRGPNFLTLEILKPDLVAPGVNILAAWTGDMGPSS  539

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              + D+RR +FNI+SGTSM+CPHVSG+AA+++  +P WSPAAIKSAL+TT Y  DN+  + 
Sbjct  540   LSSDHRRVKFNILSGTSMSCPHVSGVAALIKARHPDWSPAAIKSALLTTAYVHDNN-LNP  598

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D  TG PSTP+ HG+GH++P  A DPGLVYD G  DY +FLCT      ++ +F R+S
Sbjct  599   LRDASTGAPSTPYDHGAGHINPLKALDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFSRHS  658

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
               + CRN  L  PG LNY + + VF    N+  +T  RTV NVG   + +Y+V V     
Sbjct  659   NRI-CRN-TLSGPGDLNYAAISAVFTENTNVSALTLHRTVTNVGPHVS-SYKVVVSPFKG  715

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               V V P  L FT +   LSY +TF++ LRQ    FG L W   TH V SPI V+W
Sbjct  716   ASVIVEPKMLNFTSKHQKLSYRITFRTKLRQKRPEFGGLVWRSSTHKVRSPIVVTW  771



>ref|XP_007226995.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
 gb|EMJ28194.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
Length=769

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/725 (49%), Positives = 458/725 (63%), Gaps = 30/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY  + HGFS RLT  +A  L   PG++SVLP+R  EL TTR+P+F
Sbjct  58    SSLKSVSNSADMLYTYRTIIHGFSTRLTAEEAELLEKQPGILSVLPERKYELHTTRTPEF  117

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL    + L P+SD  + +I+GV+D+G+WPE  S+ D GL  +P+SW+  CEVG  F +
Sbjct  118   LGLGKSEAFL-PASDKVSQVIVGVVDTGVWPELKSYDDTGLAAVPSSWKGSCEVGTNFSS  176

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR + +GYEA  G PI +  E KS  D  GHGTH +S A GSAV  A++  
Sbjct  177   SSCNRKLIGARYFSKGYEAALG-PIDEKTESKSPRDDDGHGTHTSSTATGSAVPGASLFS  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+A YK CWLG C  +DI + M++AV DGV+VLSLSIG     G   
Sbjct  236   YASGTARGMAPQARVATYKACWLGGCFGSDITAAMEKAVEDGVNVLSLSIG-----GSQS  290

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A  +G++VSC AGN GPD  +  N+APWI TVGA T+DR+FPA V+L
Sbjct  291   DYYRDTVAIGAFSAAAQGILVSCSAGNGGPDSGSLSNVAPWITTVGAGTLDRDFPAFVSL  350

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             GN + + G SLY G   S   + +VY R A++      C P  L  +KV GKIV C +  
Sbjct  351   GNEKKYRGISLYRGTPLSSGLLPLVYARNASTSSTGELCSPESLIPAKVAGKIVVCDR-G  409

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
                 V +   VK++GG+GMI++N    G ELVA+A ++PTA V    GD I  Y+ +  +
Sbjct  410   GTPRVRKSLVVKKAGGLGMILANTDTYGEELVADAYLLPTAAVGQKAGDAIKSYIASGSN  469

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I    T     PS P VA+FSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  470   PTATIALGDTELDVQPS-PVVASFSSRGPNLITPEILKPDLIAPGVNILAGWTGAVGPTG  528

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               +D RR  FNI+SGTSM+CPHVSGLAA++   +P WSPAAIKSALMTT+YT   +G  T
Sbjct  529   LAEDKRRVTFNIISGTSMSCPHVSGLAALVMAAHPEWSPAAIKSALMTTSYTTYKTGE-T  587

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG P+TP  +G+GHVDP  A DPGLVYD  V DY+ FLC + Y + +I L     
Sbjct  588   IKDIATGNPATPFDYGAGHVDPVAALDPGLVYDAAVEDYLSFLCALNYTTTQIKLTTHKD  647

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQ---------TITYKRTVKNVGKVKNVAYQV  1935
                 C +    +   LNYPSFAV  +             T+ Y RT+ NVG        V
Sbjct  648   --FTCDSSKKYSLRDLNYPSFAVPLETASGKGGGSGASTTVKYTRTLTNVGTPATYKVSV  705

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             + QTPS V++TV P  L F+   +  +Y VTF   S      SFG L WSDG H V SPI
Sbjct  706   SSQTPS-VKITVEPESLSFSQAYEKKTYTVTFVASSSPSGTTSFGRLEWSDGKHTVGSPI  764

Query  2110  AVSWE  2124
             A SWE
Sbjct  765   AFSWE  769



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/728 (48%), Positives = 473/728 (65%), Gaps = 35/728 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY +V HGFS RLTP +A  +   PG++SVLP+   EL TTR+P F
Sbjct  54    SSLKSVSDSAEMLYTYNNVIHGFSTRLTPEEAQAMETRPGILSVLPELRYELHTTRTPSF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ + P SD  +++I+GVLD+G+WPE  SF D G  P+P+SW+ +CE+G  F  
Sbjct  114   LGLDQNAA-MFPESDSVSEVIVGVLDTGVWPESPSFDDTGFGPVPSSWKGECEIGTNFTK  172

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK++GAR + RGYEA  G PI +  E +S  D  GHGTH +S AAGS V+ A++ G
Sbjct  173   SNCNRKLVGARYFARGYEATLG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVSGASLFG  231

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  +R+AVYKVCW+G C ++DIL+ MD+A+ D  +VLSLS+G     G   
Sbjct  232   YAAGTARGMAPRSRVAVYKVCWIGGCFSSDILAAMDKAIDDNANVLSLSLG-----GGMS  286

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  287   DYYRDSVAIGAFAAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPAYVSL  346

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ F+G SLY G       +  VY        N   C+ G L   KV+GKIV C +  
Sbjct  347   GNGKNFSGVSLYRGDSLPGKLLPFVYAGNVSNVTNGNLCMTGTLIPEKVKGKIVLCDRGV  406

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM+++N    G ELVA+A ++P   V  + G+ I  Y+ +  +
Sbjct  407   NPR-VQKGSVVKAAGGIGMVLTNTAANGEELVADAHLLPATAVGQSTGEAIKQYLFSDSN  465

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA ++F GT  G  PS P VAAFSSRGPN +T EILKPD+IAPGVNILA W+GA+ P+ 
Sbjct  466   PTATVLFEGTKVGIEPS-PVVAAFSSRGPNSITAEILKPDLIAPGVNILAGWSGAVGPTG  524

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               +D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G+  
Sbjct  525   LAEDDRRVAFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTAYKNGK-L  583

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG PSTP  HG+GHVDP +A +PGLVYD GV DY++FLC + Y S +I    R  
Sbjct  584   IQDVSTGKPSTPFDHGAGHVDPVSALNPGLVYDLGVEDYLNFLCALNYTSAQIKSLARRD  643

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNL------------QTITYKRTVKNVGKVKNVA  1926
                 C  R   +   LNYPSFAV  +  +              + + RT+ NVG      
Sbjct  644   --FSCDTRKTYSVNDLNYPSFAVPLQAQMGSTGGSGSGTGSTVVKHTRTLTNVGPPGT--  699

Query  1927  YQV-TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLV  2097
             Y+V T  +  +V+++V P  L F+   +  SY VTF   S+  + + F  + WSDG H+V
Sbjct  700   YKVSTSSSSDSVKISVDPATLTFSQTNEKKSYTVTFTAPSMPSNTNEFARIEWSDGKHVV  759

Query  2098  TSPIAVSW  2121
              SP+A+SW
Sbjct  760   GSPVAISW  767



>emb|CDX99895.1| BnaC09g28100D [Brassica napus]
Length=775

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/721 (49%), Positives = 465/721 (64%), Gaps = 27/721 (4%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P S+    + +LYTY+   HG +ARL+  +A +L   PGV++V+P+   EL TTRSP+FL
Sbjct  63    PKSHEEEGNRILYTYQTAFHGLAARLSKEEAEKLEKEPGVVAVIPETRYELHTTRSPKFL  122

Query  184   GLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             GL    S  +        D+I+GVLD+GIWPE  SF+D G++P+P++WR  CE G  F  
Sbjct  123   GLERQESERVWAERVTDHDVIVGVLDTGIWPESESFNDTGMSPVPSTWRGACETGRGFLR  182

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD---EPKSAIDMTGHGThvasiaagsavananvn  531
             ++CNRKI+GAR +YRGYEA TG+  +D   E +S  D  GHGTH A+  AGS V  AN+ 
Sbjct  183   SNCNRKIVGARVFYRGYEAATGK--IDQELEYRSPRDKDGHGTHTAATVAGSPVRGANLL  240

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G A G ARG+A  AR+A YKVCW+G C ++DILS +DQAVADGVHVLS+S+G     G  
Sbjct  241   GFAYGTARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLG-----GGI  295

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y+ D +AI  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V 
Sbjct  296   STYSRDSLAIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVK  355

Query  892   LGNGRTFTGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYC  1050
             LG  R F G SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C
Sbjct  356   LGTTRVFKGVSLYKGRTVLSRAKQYPLVYLGRNASSPDPTSFCLDGALDQHNVAGKIVIC  415

Query  1051  KQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK  1230
              +      V +G  VK++GGVG+I++N    G ELVA+  ++P   V   +G +I +Y  
Sbjct  416   DR-GVTPRVQKGQVVKRAGGVGIILTNTATNGEELVADCHLLPAVAVGEKEGKVIKEYAM  474

Query  1231  NTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAI  1410
              +K ATA +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+G +
Sbjct  475   TSKRATASLEILGTRVGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDM  533

Query  1411  APSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNS  1590
             APS  + D RR  FNI+SGTSM+CPHVSG+AA++R  +P WSPAA+KSALMTT Y  DN 
Sbjct  534   APSSLSSDKRRVNFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNM  593

Query  1591  GRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF  1770
                 L D     PS+P+ HG+GH+DP  A DPGLVYD G  +Y DFLCT      ++ +F
Sbjct  594   -LEPLTDAAGAEPSSPYDHGAGHIDPLKAMDPGLVYDIGPQEYFDFLCTQELSPSQLKVF  652

Query  1771  LRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTV  1941
              ++S    CR+   G NPG LNYP+ + +F  N  ++ +T +RTV NVG   + +Y+V++
Sbjct  653   TKHSNR-SCRHSLAGNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVS-SYKVSL  710

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVS  2118
                    VTV P  L FT +   LSY VTF++ LR     FG L W   TH V SP+ ++
Sbjct  711   SPFKGATVTVQPKTLNFTTKHQKLSYTVTFRTKLRMKRPEFGGLLWKSSTHKVRSPVIIT  770

Query  2119  W  2121
             W
Sbjct  771   W  771



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/727 (49%), Positives = 476/727 (65%), Gaps = 34/727 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L   S S+E++Y Y +  HGFS +LTP QA  L + PGV+SVLP+   EL TTR+P+F
Sbjct  63    SSLKTVSDSAEMVYIYSNAIHGFSTKLTPEQAESLQSQPGVLSVLPELKYELHTTRTPEF  122

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  + P S+  +D+IIGVLD+G+WPE  SF D GL P+P SW+  CE G  F +
Sbjct  123   LGLGQTTETI-PQSNSESDVIIGVLDTGVWPESKSFDDTGLGPVPGSWKGACESGTNFNS  181

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA  G PI    E KS  D  GHGTH AS AAGSAV+ A++ G
Sbjct  182   SNCNRKLIGARYFAKGYEATVG-PIETSKESKSPRDDDGHGTHTASTAAGSAVSGASLFG  240

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  ARIA YKVCW+G C ++DI++ +DQA+AD V+VLS+S+G     G   
Sbjct  241   YAPGTARGMAPRARIAAYKVCWVGGCFSSDIVAAIDQAIADNVNVLSMSLG-----GGMS  295

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG+++SC AGN+GP  Y+  N APWI TVGA T+DR+FPA V+L
Sbjct  296   DYFRDSVAIGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFVSL  355

Query  895   GNGRTFTGTSLYFG-IQPSPNQVS-MVYGRRANS----RYCLPGQLDASKVRGKIVYCKQ  1056
             GNG+ F+G SLY G    +P  ++  VY   A++      C+ G L   +V+GKIV C +
Sbjct  356   GNGKNFSGVSLYRGNSNAAPTALTPFVYAGNASNATSGNLCMMGTLIPERVKGKIVMCDR  415

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N   V +G  VK +GGVGMI++N    G ELVA++ ++P   V   + D+I  Y+   
Sbjct  416   GVNAR-VQKGAVVKAAGGVGMILANTAANGEELVADSHLLPATSVGQQNADVIKSYLLKD  474

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + TA I+F GT  G  PS P VAAFSSRGPN +TP++LKPD++APGVNILA W+GAI P
Sbjct  475   PNPTATILFEGTKVGVQPS-PVVAAFSSRGPNSVTPDVLKPDIVAPGVNILAGWSGAIGP  533

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             +    D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G+
Sbjct  534   TGLAIDARRVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKNGQ  593

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               L D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+DY++FLC + Y + +I    +
Sbjct  594   K-LQDVATGKPSTPFDHGAGHVDPISALNPGLVYDLTVDDYLNFLCALNYSASEINSLAK  652

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNL-------QTITYKRTVKNVGKVKNVAYQV  1935
              S    C  +   +   LNYPSFAV F++           + Y RT+ NVG      Y+ 
Sbjct  653   RS--YTCDEKKKYSVRDLNYPSFAVNFESRYGGGTTSSNVVKYTRTLTNVGPPGT--YKA  708

Query  1936  TVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTFQSL----RQSADSFGSLRWSDGTHLVT  2100
             +V + S  V+++V P  L F+   +   Y VTF ++      + +SFG + WSDG H+V 
Sbjct  709   SVTSESQLVKISVEPETLSFSQANEKKVYTVTFSAVGSVPANAVNSFGRVEWSDGKHIVG  768

Query  2101  SPIAVSW  2121
             SPIA+SW
Sbjct  769   SPIAISW  775



>gb|KFK26784.1| hypothetical protein AALP_AA8G293000 [Arabis alpina]
Length=758

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/720 (49%), Positives = 462/720 (64%), Gaps = 30/720 (4%)
 Frame = +1

Query  16    HSRSSE----LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             HS   E    +LYTY+   HG +ARL+  +A  L    GV++V+P+   EL TTRSP FL
Sbjct  47    HSHEEEEDNRILYTYQTAFHGLAARLSQEEAERLEEEAGVVAVIPETKYELHTTRSPTFL  106

Query  184   GLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             GL    S  +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G +F  
Sbjct  107   GLERQESERVWAERVTDHDVVVGVLDTGIWPESQSFNDTGMSPVPSTWRGACETGKRFLR  166

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvn  531
              +CNRKI+GAR +YRGYEA TG+  +DE    +S  D  GHGTH A+  AGS V  AN+ 
Sbjct  167   QNCNRKIVGARVFYRGYEAATGK--IDEELEYRSPRDRDGHGTHTAATVAGSPVRGANLL  224

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G A G ARG+A  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G  
Sbjct  225   GFAYGTARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGI  279

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y+ D +AI  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V 
Sbjct  280   STYSRDSLAIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVK  339

Query  892   LGNGRTFTGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYC  1050
             LG  R+F G SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C
Sbjct  340   LGTMRSFKGVSLYKGRTVLSKNKQYPLVYFGRNASSPDPTSFCLDGALDRRHVAGKIVIC  399

Query  1051  KQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK  1230
              +      V +G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y  
Sbjct  400   DR-GVTPRVQKGQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKVIKQYAM  458

Query  1231  NTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAI  1410
              +K ATA +   GT  G  PS P VAAFSSRGPNFL+ EILKPDV+APGVNILAAW+G +
Sbjct  459   TSKRATATLEILGTKVGIKPS-PVVAAFSSRGPNFLSLEILKPDVLAPGVNILAAWSGDM  517

Query  1411  APSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNS  1590
             APS  + D RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN 
Sbjct  518   APSSLSSDRRRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNM  577

Query  1591  GRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF  1770
              +  + D     PSTP+ HGSGH+DP  A DPGLVYD G  DY +FLCT      ++ +F
Sbjct  578   LKP-ITDASGAAPSTPYDHGSGHIDPLKAIDPGLVYDIGPQDYFEFLCTQDLTPAQLKVF  636

Query  1771  LRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQ  1944
              ++S    C+N    NPG LNYP+ + +F  N  ++ +T +RTV NVG   + +Y+V+V 
Sbjct  637   TKHSNRT-CKNTLANNPGNLNYPAISALFPENARVKVMTLRRTVTNVGPHIS-SYKVSVS  694

Query  1945  TPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
                   VTV P  L FT +   LSY VTF++ LR     FG L W   TH V SP+ ++W
Sbjct  695   PFKGASVTVQPKTLNFTLKHQKLSYTVTFRTKLRMKRPEFGGLLWKSATHKVRSPVIITW  754



>ref|XP_010105479.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04835.1| Subtilisin-like protease [Morus notabilis]
Length=776

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/729 (49%), Positives = 467/729 (64%), Gaps = 36/729 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY++V HGFS R+T  +A  L N PGV+SV+P+   EL TTR+P F
Sbjct  60    SSLKSVSDSAEMLYTYDNVIHGFSTRITEEEAHLLNNQPGVVSVIPETRYELHTTRTPDF  119

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S +L  +SD  +D+IIGVLD+G+WPE  S+ D+GL P+P SW+ KCE G  F +
Sbjct  120   LGL-KESYSLIAASDKASDVIIGVLDTGVWPEIESYDDKGLGPVPKSWKGKCEAGKNFNS  178

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvn  531
             +SCNRK+IGAR++Y+GYE   GR  +DE    KS  D  GHGTH ++ AAGS V++A+V 
Sbjct  179   SSCNRKLIGARSFYKGYEKEAGR--IDEKVESKSPRDDDGHGTHTSTTAAGSHVSSASVL  236

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G+A G ARG+A  AR+A YKVCWL  C ++D+++G D+A+ADGVH+LS+S+G     G  
Sbjct  237   GYASGTARGMAPTARVATYKVCWLKGCFDSDLIAGFDKAIADGVHILSMSLG----GGSG  292

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y+ D +AI  F A  +G++VS  AGNSGP   T  N APWI TVGA TIDR+FPA V 
Sbjct  293   TEYHSDILAIATFAATARGILVSASAGNSGPYHGTVFNAAPWITTVGAGTIDRDFPAYVK  352

Query  892   LGNGRTFTGTSLYFGIQPSPN-QVSMVYG----RRANSRYCLPGQLDASKVRGKIVYCKQ  1056
             LGNG+ + G SLY G Q S    V +VYG      ++  +CLPG L   K +GKIV C  
Sbjct  353   LGNGQEYKGVSLYKGKQLSDKVLVPIVYGASVSNDSDGAFCLPGSLIPKKTKGKIVICFH  412

Query  1057  LANITIVDQGFAVKQSGGVGMIIS-NVRHQGYELVANADMIPTAVVTAADGDIIYDYVKN  1233
               N   V  G  VK +GG+GMI + +    G ELVA+A ++P A V+   G  I  YV +
Sbjct  413   GRN-GRVQAGLVVKDAGGIGMIYTRDDDSHGEELVADAHLLPAAFVSLEKGLEIRRYVDS  471

Query  1234  TKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIA  1413
               + TA I+   T  G  PS P VA+F SRGPN  TPEILKPD+IAPGVNILA WTGA+ 
Sbjct  472   VANPTATIIQGATKLGVQPS-PIVASFRSRGPNRRTPEILKPDLIAPGVNILAGWTGAVG  530

Query  1414  PSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSG  1593
             PS  + D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+S+LMTT Y+   +G
Sbjct  531   PSGLSLDKRRVNFNIISGTSMSCPHVSGLAALLKAAHPKWSPAAIRSSLMTTAYSTYKNG  590

Query  1594  RSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFL  1773
             + T+ D+ T   +TP   G+GHVDP  A DPGLVYD  V DY++FLC + Y  ++I    
Sbjct  591   K-TIEDVVTARAATPFDFGAGHVDPVAALDPGLVYDATVEDYINFLCALDYAPEQIKTVT  649

Query  1774  RNSPLVDCRNRNLGNPGALNYPSFAVVF-----------KNNLQTITYKRTVKNVGKVKN  1920
             +      C +    + G LNYPSFAV F           KN  QT+TY RT+ NVG    
Sbjct  650   KRD--FTCNSTKKYSVGDLNYPSFAVPFKAESEEEVGATKNVSQTMTYTRTLTNVG--AP  705

Query  1921  VAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHL  2094
               Y+V+V    +V++ V P  L F    +  +Y VTF   +L+     FG L WSDG H+
Sbjct  706   AKYEVSVSKIDSVKILVKPKSLSFKKAYEKKTYTVTFVASTLQWGTKHFGRLEWSDGKHI  765

Query  2095  VTSPIAVSW  2121
             V SPIA SW
Sbjct  766   VGSPIAFSW  774



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/724 (48%), Positives = 470/724 (65%), Gaps = 30/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E++Y Y +V HGFS RLT  +A  L   PG+++V+P+   EL TTRSPQF
Sbjct  50    SSLRSVSDSAEMIYAYNNVVHGFSTRLTTEEAQRLEAQPGILAVVPEMRYELHTTRSPQF  109

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++NL P S+  +++IIGVLD+G+WPE  SF D GL P+P+SW+ +CE G  F A
Sbjct  110   LGL-DKNANLYPESNSVSEVIIGVLDTGVWPESKSFDDTGLGPVPSSWKGECESGTNFSA  168

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA  G PI +  E +S  D  GHGTH AS AAGS V NA++ G
Sbjct  169   SNCNRKLIGARFFSKGYEATLG-PIDESKESRSPRDDDGHGTHTASTAAGSVVENASLFG  227

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+A YKVCW G C ++DI++ MD+AV D V+V+S+S+G     G   
Sbjct  228   YASGTARGMAARARVAAYKVCWAGGCFSSDIVAAMDKAVEDNVNVMSMSLG-----GGVS  282

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +A GAF A++KG++VSC AGN+GP P++  N +PWI TVGA T+DR+FPA V+L
Sbjct  283   DYYKDSVATGAFAAMEKGILVSCSAGNAGPSPFSLSNTSPWITTVGAGTLDRDFPAYVSL  342

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             G+ + F+G SLY G       +  +Y   A    N   C+ G L   KV GK+V+C +  
Sbjct  343   GDAKNFSGVSLYRGKSLPGTLLPFIYAANASNSGNGNLCMTGTLIPEKVAGKVVFCDRGV  402

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM+++N    G ELVA++ ++P   V    GDII  Y+ +   
Sbjct  403   NPR-VQKGAVVKAAGGIGMVLANTAANGEELVADSHLLPATAVGQKSGDIIRKYLVSDPK  461

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TP++LKPD+IAPGVNILA W+ ++ PS 
Sbjct  462   PTVTILFEGTKLGIEPS-PVVAAFSSRGPNSITPQLLKPDIIAPGVNILAGWSKSVGPSG  520

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR +FNI+SGTSM+CPHVSGLAA+++  +P WSPAAI+SALMTT YT   +G+  
Sbjct  521   LAIDDRRVDFNIISGTSMSCPHVSGLAALIKGAHPDWSPAAIRSALMTTAYTAYKNGQK-  579

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+DY++FLC + Y   +I    R  
Sbjct  580   IQDIATGKPSTPFDHGAGHVDPVSALNPGLVYDLTVDDYLNFLCALNYTPSQINSLARKD  639

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT-------YKRTVKNVGKVKNVAYQVTV  1941
                D + +   N   LNYPSFAVVF   L           + RT+ NVG        ++ 
Sbjct  640   FTCDSKKKYSVND--LNYPSFAVVFDGVLGGGGSGSSVVKHTRTLTNVGSPGTYKVSISS  697

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQS----LRQSADSFGSLRWSDGTHLVTSPI  2109
             +T S V+++V P  L FT   +  SY VTF S       SA+ FG + WSDG H+V SPI
Sbjct  698   ETKS-VKISVEPESLSFTGANEKKSYTVTFTSNGSAAPSSAEGFGRIEWSDGKHVVGSPI  756

Query  2110  AVSW  2121
             A SW
Sbjct  757   AFSW  760



>ref|NP_001050634.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|AAR87229.1| putaive subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|AAT78773.1| putative serine protease [Oryza sativa Japonica Group]
 gb|ABF97524.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12548.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|EAZ27735.1| hypothetical protein OsJ_11683 [Oryza sativa Japonica Group]
Length=765

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/725 (49%), Positives = 462/725 (64%), Gaps = 31/725 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S + ++LY Y+ V HGFSARLT  +A ++A + GV++V P+   EL TTR+P+FLG
Sbjct  51    LRSVSGAGKMLYAYDTVLHGFSARLTAREARDMAAMDGVLAVNPEARYELHTTRTPEFLG  110

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
              I+G+  L P S    D+++GVLD+G+WPE  S+ D GL  +P+ W+ +C  G  F +++
Sbjct  111   -IAGNDGLFPQSGTAGDVVVGVLDTGVWPESRSYDDAGLGEVPSWWKGECMAGTGFNSSA  169

Query  367   CNRKIIGARAYYRGYEAVTG-RPIVDEPKSAIDMTGHGThvasiaagsavananvnghaR  543
             CNRK++GAR + RGYEA  G      E +S  D  GHGTH +S AAG+AV+ A++ G A 
Sbjct  170   CNRKLVGARFFNRGYEAAMGPMDTTRESRSPRDDDGHGTHTSSTAAGAAVSGASLLGFAS  229

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G ARG+A  AR+AVYKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G A  Y 
Sbjct  230   GTARGMAPRARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGAADYA  284

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
              D +AIGAF A+++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V+LGNG
Sbjct  285   RDSVAIGAFAAMEQNVLVSCSAGNAGPGTSTLSNVAPWITTVGAGTLDRDFPAYVSLGNG  344

Query  904   RTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLANIT  1071
             + +TG SLY G       + +VY   A++      C+PG L   KV GKIV C +  +  
Sbjct  345   KNYTGVSLYAGKALPSTPLPIVYAANASNSTAGNLCMPGTLTPEKVAGKIVVCDRGVSAR  404

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V +GF V+ +GG GM++SN    G ELVA+A ++P A V A +G  I  YV +  S TA
Sbjct  405   -VQKGFVVRDAGGAGMVLSNTATNGEELVADAHLLPAAGVGAKEGAAIKAYVASDPSPTA  463

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              IV  GT     PS P VAAFSSRGPN LTPEILKPD+IAPGVNILAAWTG   P+    
Sbjct  464   TIVVAGTQVDVRPS-PVVAAFSSRGPNMLTPEILKPDIIAPGVNILAAWTGKAGPTGIAA  522

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTY-TLDNSGRST-L  1605
             D RR  FNI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y T   +G +  L
Sbjct  523   DTRRVAFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYSTYAGAGDANPL  582

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             +D  TG P+TP  +G+GHVDP +A DPGLVYD G  DYVDFLC + Y S  IA   R S 
Sbjct  583   LDAATGAPATPFDYGAGHVDPASAVDPGLVYDLGTADYVDFLCALNYTSTMIAAVAR-SK  641

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKN-----------NLQTITYKRTVKNVGKVKNVAYQ  1932
                C      +   LNYPSFAV +                T+T++RT+ NVG      Y+
Sbjct  642   SYGCTEGKAYSVYNLNYPSFAVAYSTASSQAAESSGAAATTVTHRRTLTNVGAAGT--YK  699

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSP  2106
             V+      V V V P  L FT   +  SY V+F +  Q + +  FG L WSDG H V SP
Sbjct  700   VSAAAMPGVAVAVEPTELAFTSAGEKKSYTVSFTAKSQPSGTAGFGRLVWSDGKHSVASP  759

Query  2107  IAVSW  2121
             +A +W
Sbjct  760   MAFTW  764



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/713 (50%), Positives = 458/713 (64%), Gaps = 26/713 (4%)
 Frame = +1

Query  22    RSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISG  198
                 +LY+Y+   HG +A+L+  + ++L    GV++V P+   +L TTRSP FLGL    
Sbjct  68    EEERILYSYQTAFHGVAAQLSEEEINKLRAQHGVLAVFPETKYQLHTTRSPLFLGLDRED  127

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             SS L        ++I+GVLD+GIWPE  SF+D G+ PIP  W+  CE G  F    C++K
Sbjct  128   SSKLWSDKLADHNVIVGVLDTGIWPESPSFNDTGMTPIPAHWKGACETGRGFEKHHCSKK  187

Query  379   IIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             I+GAR +YRGYEA +G+     E KSA D  GHGTH A   AGS V  AN+ G+A G AR
Sbjct  188   IVGARVFYRGYEAASGKINERGEYKSARDQDGHGTHTAGTVAGSVVRGANLLGYAYGTAR  247

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A  ARIA YKVCW+G C ++DILS +DQAVADGV+VLS+S+G     G    YN D +
Sbjct  248   GMAPGARIAAYKVCWVGGCFSSDILSAVDQAVADGVNVLSISLG-----GGVSSYNRDSL  302

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             +I AFGA++KGV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V  G G+  T
Sbjct  303   SIAAFGAMEKGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKFGTGKVIT  362

Query  916   GTSLYFGIQ--PSPNQVSMVY-----GRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G SLY G +   +  Q S++Y          S  CL G LD S+V GKIV C +  +   
Sbjct  363   GASLYKGKRNLSTEKQYSLIYLGNNSSSPMPSSLCLEGSLDGSEVAGKIVICDRGISPR-  421

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V +G  VK +GG+GMI++N    G ELVA++ +IP   V   +G +I  Y    ++ATA 
Sbjct  422   VQKGQVVKDAGGIGMILTNTAANGEELVADSHLIPAVAVGETEGKLIKHYASG-RNATAT  480

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             + F GT  G  PS P VAAFSSRGPNFLT EILKPD++APGVNILAAWTGA+ PS    D
Sbjct  481   LKFLGTKLGIRPS-PVVAAFSSRGPNFLTLEILKPDMVAPGVNILAAWTGALGPSSLPTD  539

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RRT FNI+SGTSM+CPHVSG+AA+L+  +P WSPAAIKSALMTT Y  DN+  S L D 
Sbjct  540   QRRTNFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTYNS-LKDS  598

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              T  PSTP+ HG+GH++P  A DPGLVYD G  DY +FLCT      ++ +F R S    
Sbjct  599   STATPSTPYDHGAGHINPRKAVDPGLVYDIGAQDYFEFLCTQQLSPSQLMVFARFSNRT-  657

Query  1795  CRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGK-VKNVAYQVTVQTPSNVRV  1965
             C + +L NPG LNYP+ + VF  +  + T+T  RT  NVG  + N  Y V V +     V
Sbjct  658   C-HHSLANPGDLNYPAISAVFPEDAKVSTLTLHRTATNVGSPISN--YHVRVSSFKGAVV  714

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V P+RL FT +   LSY+V F++  RQ A  FGSL W DG H V SPI ++W
Sbjct  715   KVEPSRLNFTSKHQKLSYKVIFETKSRQKAPEFGSLIWKDGAHKVRSPIVITW  767



>ref|XP_003549134.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/722 (48%), Positives = 465/722 (64%), Gaps = 26/722 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             SP ++      ++YTY++  HG +A+LT  +A +L    GV+++ PD   EL TTRSP F
Sbjct  66    SPEADMDNEERIIYTYQNAFHGVAAKLTEGEAKKLEAEEGVVAIFPDTKYELHTTRSPIF  125

Query  181   LGLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL  + S+N+      G D+I+GV+D+GIWPE  SF D G+ P+P  W+  CE+G  F 
Sbjct  126   LGLEPAKSTNMWSEKLAGHDVIVGVVDTGIWPESESFKDVGMRPVPAHWKGACEIGTGFT  185

Query  358   ATSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvng  534
              + CN+K++GAR +Y GYEA  GR     E KS  D  GHGTH A+   GS V  AN+ G
Sbjct  186   KSHCNKKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLG  245

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  ARIA YKVCW+G C ++DI+S +D+AVADGV+VLS+S+G     G   
Sbjct  246   YANGTARGMAPGARIAAYKVCWVGGCFSSDIVSAIDKAVADGVNVLSISLG-----GGVS  300

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +++ AFGA+++GV VSC AGN+GPDP +  N++PWI TVGAST+DR+FPA V L
Sbjct  301   SYYRDSLSVAAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPADVRL  360

Query  895   GNGRTFTGTSLYFG--IQPSPNQVSMVYGRRANSR-----YCLPGQLDASKVRGKIVYCK  1053
             GNG+  TG SLY G  +     Q  +VY    +SR      CL G LD   V GKIV C 
Sbjct  361   GNGKKVTGVSLYKGKNVLSIEKQYPLVYMGSNSSRVDPRSMCLEGTLDPKVVSGKIVICD  420

Query  1054  QLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKN  1233
             +  +   V +G  V+ +GGVGMI++N    G ELVA++ ++P   +   +G  +  YV +
Sbjct  421   RGLSPR-VQKGNVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLS  479

Query  1234  TKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIA  1413
             +KS+TA + F+GT  G  PS P VAAFSSRGPNFLT +ILKPD++APGVNILAAW+ AI 
Sbjct  480   SKSSTATLAFKGTRLGIKPS-PIVAAFSSRGPNFLTLDILKPDLVAPGVNILAAWSEAIG  538

Query  1414  PSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSG  1593
             PS    DNR+ +FNI+SGTSM+CPHVSG+AA+++  +P WSPAAIKSALMTT Y LDN+ 
Sbjct  539   PSGLKIDNRKVKFNIVSGTSMSCPHVSGIAALVKSRHPEWSPAAIKSALMTTAYVLDNT-  597

Query  1594  RSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFL  1773
             + TL D  T  PS+P+ HG+GH+DP  A DPGLVYD    DY +FLCT      ++ +F 
Sbjct  598   KKTLRDASTAKPSSPYDHGAGHIDPIRALDPGLVYDIVPQDYFEFLCTQNLTPTQLKVFA  657

Query  1774  RNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----ITYKRTVKNVGKVKNVAYQVT  1938
             + S    CR+ +L +PG LNYP+ + VF     T     +   RTV NVG   +  Y V 
Sbjct  658   KYSNR-SCRH-SLASPGDLNYPAISSVFTQKTPTSFPSPVIVHRTVTNVGP-PDSKYHVV  714

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAV  2115
             V       + V P  L FT +   LSY++TF+  +RQ++  FGS+ W DG H V SPI +
Sbjct  715   VSPFKGASIKVEPETLNFTGKHQKLSYKITFKPKVRQTSPEFGSMEWKDGLHTVRSPIMI  774

Query  2116  SW  2121
             +W
Sbjct  775   TW  776



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/722 (50%), Positives = 466/722 (65%), Gaps = 29/722 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E+LY+Y+ V+HGFS RLTP++A+ L +  GV+SVLP+   EL TTR+P FLG
Sbjct  54    LRSVSDSAEILYSYDTVSHGFSTRLTPAEAATLESREGVLSVLPEVRYELHTTRTPMFLG  113

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   S  L P +D G+D+++G+LD+G+WPER SF D G  P+P  W+  CE    F ATS
Sbjct  114   LDE-SHGLFPQADTGSDVVVGLLDTGVWPERKSFDDTGFGPVPAGWKGACEEAKDFKATS  172

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK+IGAR + + YEA  G PI    E +S  D  GHGTH A+ AAGSAV +A++ G A
Sbjct  173   CNRKLIGARFFSKSYEATVG-PINGTTESRSPRDDEGHGTHTATTAAGSAVTDASLFGFA  231

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT AR+A YKVCW   C ++DIL+ MD+AV DG HVLSLS+G +  E     Y
Sbjct  232   NGTARGMATRARVAAYKVCWAAGCFSSDILAAMDRAVDDGCHVLSLSLGGEMTE-----Y  286

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
              ED IAIGAF A++KG+++SC AGN GP   +  N+APWI+TVGA TIDR+FPA V LGN
Sbjct  287   YEDSIAIGAFNAMEKGLLISCSAGNGGPIASSVTNVAPWIITVGAGTIDRDFPAYVVLGN  346

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLANI  1068
             G+ +TG SLY G     + +  VY   A    +   C+PG L   KV GKIV C +  N 
Sbjct  347   GKNYTGVSLYSGKLLPKSPLPFVYAGNASNATDGNLCIPGTLIPEKVAGKIVLCDRGINW  406

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V +G+ V+++GG GM+++N    G E+VA+A ++P   V    GD I  Y+++ K+  
Sbjct  407   R-VQKGYVVREAGGAGMVLANADTYGEEVVADAHLLPATAVGQKAGDAIRAYLRSNKNPK  465

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A IVF GT  G  PS P VAAFSSRGPN +T EILKPD+IAPGVNILA WTGA  P+  +
Sbjct  466   ATIVFGGTKIGVRPS-PVVAAFSSRGPNLVTSEILKPDLIAPGVNILAGWTGAAGPTGLS  524

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
              D+RR  FNI+SGTSM+CPHVSG+AA+L+  +P WSPAA++SALMTT Y+    G S L 
Sbjct  525   GDSRRVVFNIISGTSMSCPHVSGIAALLKAAHPDWSPAAVRSALMTTAYSAYPGGDSGLF  584

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL  1788
             D+ TG  +TP  +G+GHVDP  A DPGL+YD    DY+DFLC + Y S+ IA   + +  
Sbjct  585   DVATGKAATPFDYGAGHVDPPRAVDPGLIYDLTTEDYIDFLCALKYTSRHIATVAKRTNY  644

Query  1789  VDCRNRNLGNPGALNYPSFAVVFK------NNLQTITYKRTVKNVGKVKNVAYQVTVQT-  1947
               C          LNYPSFAVVF+        + T+ + RTV NVG      Y+ TV T 
Sbjct  645   T-CDGTKTYAVSGLNYPSFAVVFQRASGAGGRVATVKHTRTVTNVGDPGT--YKSTVTTA  701

Query  1948  --PSNVRVTVSPNRLVFTDRIDTLSY--EVTFQSLRQSADSFGSLRWSDGTHLVTSPIAV  2115
                  V+V V P  L FT + +  SY   ++  SL   +  FG L WSDG H+V SPIA 
Sbjct  702   VAGGAVKVVVEPAELSFTKKGERRSYTVSLSSPSLPSVSSGFGRLEWSDGKHVVASPIAF  761

Query  2116  SW  2121
             SW
Sbjct  762   SW  763



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/727 (48%), Positives = 476/727 (65%), Gaps = 34/727 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L   S S+E++Y Y +  HGFS +LTP+QA  L + PGV+SVLP+   EL TTR+P+F
Sbjct  64    SSLKTVSDSAEMMYIYSNAIHGFSTKLTPAQAESLQSQPGVLSVLPELKYELHTTRTPEF  123

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  + P S+  +D+IIGVLD+G+WPE  SF D GL P+P SW+  CE G  F +
Sbjct  124   LGLGQTTETI-PQSNSESDVIIGVLDTGVWPESKSFDDTGLGPVPGSWKGACESGTNFNS  182

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA  G PI    E KS  D  GHGTH AS AAGS V+ A++ G
Sbjct  183   SNCNRKLIGARYFAKGYEATRG-PIETSKESKSPRDDDGHGTHTASTAAGSVVSGASLFG  241

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  ARIA YKVCW+G C ++DI++ +DQA+AD V+VLS+S+G     G   
Sbjct  242   YALGTARGMAPRARIAAYKVCWVGGCFSSDIVAAIDQAIADNVNVLSMSLG-----GGMS  296

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG+++SC AGN+GP  Y+  N APWI TVGA T+DR+FPA V+L
Sbjct  297   DYFRDSVAIGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFVSL  356

Query  895   GNGRTFTGTSLYFG-IQPSPNQVS-MVYGRRANS----RYCLPGQLDASKVRGKIVYCKQ  1056
             GNG+ F+G SLY G    +P  ++  VY   A++      C+ G L   +V+GKIV C +
Sbjct  357   GNGKNFSGVSLYRGNSNAAPTALTPFVYAANASNATSGNLCMMGTLIPEQVKGKIVMCDR  416

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N   V +G  VK +GGVGM+++N    G ELVA+A ++P   V   + D+I  Y+   
Sbjct  417   GVNAR-VQKGAVVKAAGGVGMVLANTAANGEELVADAHLLPATSVGLQNADVIKSYLFKD  475

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + TA I+F GT  G  PS P VAAFSSRGPN +TP++LKPD++APGVNILA W+GAI P
Sbjct  476   PNPTATILFEGTKVGVQPS-PVVAAFSSRGPNSVTPDVLKPDIVAPGVNILAGWSGAIGP  534

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             +    D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G+
Sbjct  535   TGLAIDARRVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKNGQ  594

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               L D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+DY++FLC + Y + +I    +
Sbjct  595   K-LQDVATGKPSTPFDHGAGHVDPISALNPGLVYDLTVDDYLNFLCALNYSATEINSLAK  653

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNL-------QTITYKRTVKNVGKVKNVAYQV  1935
              S    C  +   +   LNYPSFAV F++           + Y RT+ NVG   +  Y+ 
Sbjct  654   RS--YTCDEKKKYSVRDLNYPSFAVNFESRYGGGTTSSNVVRYTRTLTNVG--PSGTYKA  709

Query  1936  TVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTFQSL----RQSADSFGSLRWSDGTHLVT  2100
             +V + S  V+++V P  L F+   +   Y VT  ++      + +SFG + WSDG H+V 
Sbjct  710   SVTSESQLVKISVEPETLSFSQANEKKGYTVTLSAVGSVPANAENSFGRVEWSDGKHIVG  769

Query  2101  SPIAVSW  2121
             SPIA+SW
Sbjct  770   SPIAISW  776



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/726 (49%), Positives = 462/726 (64%), Gaps = 34/726 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY    HGF+ RLTP +A  L   PGVISV P++  EL TTR+P F
Sbjct  55    SSLKSASESAEMLYTYNSAIHGFATRLTPEEADSLMTQPGVISVQPEQQYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P +   +D++IGVLDSG+WPE  SFSD G  PIP +W+ +CE G +F A
Sbjct  115   LGLDVHNAGLFPETGAASDVVIGVLDSGVWPESKSFSDEGYGPIPTTWKGECEAGTKFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvn  531
             + CNRK+IGAR +  GYE   G   VDE K   S  D  GHGTH AS AAGS V  AN+ 
Sbjct  175   SHCNRKLIGARFFVHGYEGKYGP--VDESKESRSPRDDDGHGTHTASTAAGSIVEGANLL  232

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G A G ARG+A  AR+AVYKVCW   C ++D+L+G+D+A+ D V+VLSLS+G + ++   
Sbjct  233   GFANGTARGMAYRARVAVYKVCWKPKCFSSDVLAGIDKAIEDNVNVLSLSLGKRKRD---  289

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
                  + IA+GAF A++KG+ VSC AGN GP P +  N+APWI TVGA TIDR+FP +VT
Sbjct  290   ---YTNHIAMGAFSAMEKGIFVSCSAGNDGPSPSSLSNVAPWITTVGAGTIDRDFPTLVT  346

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVYGRRA--NSRY---CLPGQLDASKVRGKIVYCKQ  1056
             LGNG+++ G SL+      P  +  VY   A  N+ Y   CL G L   KV GKIV C++
Sbjct  347   LGNGKSYIGASLFKKDALPPKLLPFVYAGSASNNATYGKSCLSGTLIPEKVYGKIVMCEK  406

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N    ++G  VK +GG+GMI++N   +G EL A A ++P   V    GDII  YV   
Sbjct  407   GEN-GRAEKGEVVKAAGGIGMILANRASRGEELAAYAHVLPATNVGQKAGDIIRRYVMTD  465

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + T  IV +GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA+ P
Sbjct  466   PNPTVSIVIQGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGALGP  524

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             S    D RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y+    G+
Sbjct  525   SGLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYSTYKDGQ  584

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               L+D+ T  PSTP  HG+GHV P  A  PGL+YD    DY+DFLC + Y+  +I    R
Sbjct  585   P-LLDIATVKPSTPFGHGAGHVSPAMAISPGLIYDLTTEDYIDFLCALKYNQSQIIKVSR  643

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
                   C      +   LNYPSFAV    +  T  Y RTV NVG   + + +V  +T + 
Sbjct  644   GD--YTCDPSKTYSVADLNYPSFAVNVDKS-DTYKYTRTVTNVGGAGSYSVKVISET-TE  699

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVT----------FQSLRQSA-DSFGSLRWSDGTHLVTS  2103
             V+++V P  L F +  +  SYEVT          F S R S  +SFGS+ WSDG H+V S
Sbjct  700   VKISVEPAVLTFKEVNEKKSYEVTFTVNSSKPPRFSSFRPSGFNSFGSIEWSDGKHVVAS  759

Query  2104  PIAVSW  2121
             P+A+SW
Sbjct  760   PVAISW  765



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/718 (49%), Positives = 467/718 (65%), Gaps = 24/718 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTYE+  HGFS RLT ++A  L + PG++SV+ +   EL TTR+P+F
Sbjct  61    SSLKSVSDSAQMLYTYENAIHGFSTRLTLAEAKLLESQPGILSVMLELRYELHTTRTPEF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++L P SD  +++IIGVLD+G+WPE  SF D G  P+P+SW+ +CE G  F  
Sbjct  121   LGL-DKSADLLPQSDSVSEVIIGVLDTGVWPESKSFLDTGFGPVPSSWKGECESGTNFTT  179

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
              +CNRK+IGAR + RGYEA  G P+ +  E KS  D  GHGTH +S A GS+VA+A++ G
Sbjct  180   KNCNRKLIGARFFARGYEATLG-PVDESKESKSPRDDDGHGTHTSSTAGGSSVADASLFG  238

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCW+G C ++DIL+ MD+A+ DGV+VLS+S+G     G   
Sbjct  239   YAAGTARGMAARARVAVYKVCWVGGCFSSDILAAMDKAIDDGVNVLSMSLG-----GSMS  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG+ VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  294   YYYRDSVAIGAFAAMEKGIFVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQV-SMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ ++G SLY G    P ++   VY   A    N   C+ G L   +V GKIV C + 
Sbjct  354   GNGKNYSGVSLYKGDAILPGKLLPFVYAGNASNATNGNLCMMGTLIPEQVAGKIVLCDRG  413

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  VK +GG+GM++SN    G ELVA+A ++P   V    GD I +Y+ +  
Sbjct  414   VNPR-VQKGAVVKAAGGIGMVLSNTDANGEELVADAHLLPATAVGKKGGDEIKNYLFSDP  472

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
               TA I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W G+  P+
Sbjct  473   KPTATILFEGTKVGIQPS-PVVAAFSSRGPNSITPDILKPDMIAPGVNILAGWVGSAGPT  531

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D RR EFNI+SGTSM+CPHVSGLAA+++  +P WSPAAIKSALMTT Y    +G  
Sbjct  532   GLATDGRRVEFNIISGTSMSCPHVSGLAALIKAAHPDWSPAAIKSALMTTAYVTYKNGNK  591

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              L D+ TG  STP  HG+GHVDP +A +PGLVYD   +DY++FLC + Y + +I    R 
Sbjct  592   -LQDVATGKDSTPFDHGAGHVDPVSALNPGLVYDLTADDYLNFLCALNYSATEITSLARR  650

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPS  1953
                 D   +   +   LNYPSFAV F +      I + RT+ NVG        +T+Q+P 
Sbjct  651   KFTCDASKKY--SVTDLNYPSFAVNFGSGGADAVIKHSRTLTNVGAPGTYKVLITLQSP-  707

Query  1954  NVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD--SFGSLRWSDGTHLVTSPIAVSW  2121
              V+V V P  L F    +  SY VTF      AD  SFG + WS+G  +V SPIAVSW
Sbjct  708   GVKVAVEPETLSFRQANEKKSYTVTFTGSSMPADTNSFGRIEWSNGKQIVGSPIAVSW  765



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/717 (48%), Positives = 467/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L   S S+E++YTY++  HG++ RLT  +A  L    G+++VLP+   EL TTR+P F
Sbjct  57    SSLKTVSDSAEMIYTYDNAIHGYATRLTAEEARLLQRQTGILAVLPETRYELFTTRTPLF  116

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++L P S  G+D+I+GVLD+G+WPE  SF D GL P+P++W+  CE G  F A
Sbjct  117   LGL-DKSADLFPESSSGSDVIVGVLDTGVWPESKSFDDTGLGPVPSTWKGACETGTNFTA  175

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +G EA+ G PI   +E +SA D  GHGTH +S AAGS V+ A++ G
Sbjct  176   SNCNRKLIGARFFAKGVEAMLG-PINETEESRSARDDDGHGTHTSSTAAGSVVSGASLLG  234

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCW G C ++DIL+ +++A+ D V+VLSLS+G     G   
Sbjct  235   YASGTARGMATRARVAAYKVCWKGGCFSSDILAAIERAILDNVNVLSLSLG-----GGIS  289

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGNSGP PY+  N+APWI TVGA T+DR+FPA V L
Sbjct  290   DYYRDSVAIGAFSAMEKGILVSCSAGNSGPGPYSLSNVAPWITTVGAGTLDRDFPAYVAL  349

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA-----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNG  F+G SLY G     + + +VY         N   C+ G L   KV GKIV C + 
Sbjct  350   GNGLNFSGVSLYRGNALPDSSLPLVYAGNVSNGAMNGNLCITGTLSPEKVAGKIVLCDR-  408

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
                  V +G  VK +G +GM++SN    G ELVA+A ++P   V    GD I  Y+ +  
Sbjct  409   GLTARVQKGSVVKSAGALGMVLSNTAANGEELVADAHLLPATAVGQKAGDAIKKYLVSDA  468

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
               T +I F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W+ A+ P+
Sbjct  469   KPTVKIFFEGTKVGIQPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPT  527

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 DNRR +FNI+SGTSM+CPHVSGLAA+++  +P WSPAA++SALMTT YT+  +G  
Sbjct  528   GLPVDNRRVDFNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALMTTAYTVYKTGEK  587

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              L D  TG PSTP  HGSGHVDP  A +PGLVYD  V+DY+ FLC + Y + +I+   + 
Sbjct  588   -LQDSATGKPSTPFDHGSGHVDPVAALNPGLVYDLTVDDYLGFLCALNYSAAEISTLAKR  646

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                  C      +   LNYPSFAV+F+++   + + RT+ NVG        VT  T S V
Sbjct  647   K--FQCDAGKQYSVTDLNYPSFAVLFESSGSVVKHTRTLTNVGPAGTYKASVTSDTAS-V  703

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQSL---RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  ++ VTF S    + + ++FG + WSDG HLV SPI+V+W
Sbjct  704   KISVEPQVLSFKEN-EKKTFTVTFSSSGSPQHTENAFGRVEWSDGKHLVGSPISVNW  759



>gb|KHN21060.1| Subtilisin-like protease [Glycine soja]
Length=726

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/726 (49%), Positives = 464/726 (64%), Gaps = 37/726 (5%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E+LYTY+HVAHGFSARLTP     LA  PG++SV+P+   +L TTR+P FLG
Sbjct  16    LKSASPSAEILYTYKHVAHGFSARLTPKDVDTLAKQPGILSVIPELKYKLHTTRTPNFLG  75

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   ++ L P+S+  + ++IG+LD+G+WPE  S  D GL P+P++W+ +CE+G    +++
Sbjct  76    L-DKATTLLPASEQQSQVVIGLLDTGVWPELKSLDDTGLGPVPSTWKGQCEIGNNMNSSN  134

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK++GAR + +GYEA  G PI    E KSA D  GHG+H  + AAGS V  A++ G A
Sbjct  135   CNRKLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGSHTLTTAAGSVVPEASLFGLA  193

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT AR+AVYKVCWLG C  +DI +G+D+A+ DGV+VLS+SIG     G    Y
Sbjct  194   SGTARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDGVNVLSMSIG-----GSLMEY  248

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D IAIG+F A+  G++VS  AGN GP   +  N+APWI TVGA TIDR+FPA +TLG 
Sbjct  249   YRDIIAIGSFTAMSHGILVSTSAGNGGPSQGSLSNVAPWITTVGAGTIDRDFPAYITLGT  308

Query  901   GRTFTGTSLYFGIQPSPNQVSMVY-GRRANSR---YCLPGQLDASKVRGKIVYCKQLANI  1068
             G+T+TG SLY G   S + + +VY G  +NS     CL   L   KV GKIV C++  N 
Sbjct  309   GKTYTGASLYSGKPLSDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGNP  368

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V++G  VK +GG GMI++N    G ELVA++ ++P A +     +I+ +YV ++ + T
Sbjct  369   R-VEKGLVVKLAGGAGMILANSEAYGEELVADSHLLPAASLGQKSSEILKNYVSSSPNPT  427

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A+I F GT     PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTGA+ P+  T
Sbjct  428   AKIAFLGTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLIAPGVNILAGWTGAVGPTGLT  486

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
              D R   FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G  T+ 
Sbjct  487   VDTRHVSFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALMTTAYTSYKNGE-TIQ  545

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN---  1779
             D+ TG P TP  +G+GHVDP  A DPGLVYD  V+DY+ F C + Y S +I L  R    
Sbjct  546   DISTGQPGTPFDYGAGHVDPVAALDPGLVYDANVDDYLGFFCALNYSSFQIKLAARRDYT  605

Query  1780  -SPLVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAY  1929
               P  D R  +       NYPSFAV            + L+T+ Y R + NVG       
Sbjct  606   CDPKKDYRVED------FNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKA  659

Query  1930  QVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTS  2103
              V     SNV+  V PN L FT+  +   Y V+F   S+     SF  L W+DG H V S
Sbjct  660   SVMSLGDSNVKTVVEPNTLSFTELYEKKDYTVSFTYTSMPSGTTSFARLEWTDGKHKVGS  719

Query  2104  PIAVSW  2121
             PIA SW
Sbjct  720   PIAFSW  725



>ref|XP_003550312.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/726 (49%), Positives = 464/726 (64%), Gaps = 37/726 (5%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E+LYTY+HVAHGFSARLTP     LA  PG++SV+P+   +L TTR+P FLG
Sbjct  67    LKSASPSAEILYTYKHVAHGFSARLTPKDVDTLAKQPGILSVIPELKYKLHTTRTPNFLG  126

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   ++ L P+S+  + ++IG+LD+G+WPE  S  D GL P+P++W+ +CE+G    +++
Sbjct  127   L-DKATTLLPASEQQSQVVIGLLDTGVWPELKSLDDTGLGPVPSTWKGQCEIGNNMNSSN  185

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK++GAR + +GYEA  G PI    E KSA D  GHG+H  + AAGS V  A++ G A
Sbjct  186   CNRKLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGSHTLTTAAGSVVPEASLFGLA  244

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT AR+AVYKVCWLG C  +DI +G+D+A+ DGV+VLS+SIG     G    Y
Sbjct  245   SGTARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDGVNVLSMSIG-----GSLMEY  299

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D IAIG+F A+  G++VS  AGN GP   +  N+APWI TVGA TIDR+FPA +TLG 
Sbjct  300   YRDIIAIGSFTAMSHGILVSTSAGNGGPSQGSLSNVAPWITTVGAGTIDRDFPAYITLGT  359

Query  901   GRTFTGTSLYFGIQPSPNQVSMVY-GRRANSR---YCLPGQLDASKVRGKIVYCKQLANI  1068
             G+T+TG SLY G   S + + +VY G  +NS     CL   L   KV GKIV C++  N 
Sbjct  360   GKTYTGASLYSGKPLSDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGNP  419

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V++G  VK +GG GMI++N    G ELVA++ ++P A +     +I+ +YV ++ + T
Sbjct  420   R-VEKGLVVKLAGGAGMILANSEAYGEELVADSHLLPAASLGQKSSEILKNYVSSSPNPT  478

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A+I F GT     PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTGA+ P+  T
Sbjct  479   AKIAFLGTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLIAPGVNILAGWTGAVGPTGLT  537

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
              D R   FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G  T+ 
Sbjct  538   VDTRHVSFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALMTTAYTSYKNGE-TIQ  596

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN---  1779
             D+ TG P TP  +G+GHVDP  A DPGLVYD  V+DY+ F C + Y S +I L  R    
Sbjct  597   DISTGQPGTPFDYGAGHVDPVAALDPGLVYDANVDDYLGFFCALNYSSFQIKLAARRDYT  656

Query  1780  -SPLVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAY  1929
               P  D R  +       NYPSFAV            + L+T+ Y R + NVG       
Sbjct  657   CDPKKDYRVED------FNYPSFAVPMDTASGIGGGSDTLKTVKYSRVLTNVGAPGTYKA  710

Query  1930  QVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTS  2103
              V     SNV+  V PN L FT+  +   Y V+F   S+     SF  L W+DG H V S
Sbjct  711   SVMSLGDSNVKTVVEPNTLSFTELYEKKDYTVSFTYTSMPSGTTSFARLEWTDGKHKVGS  770

Query  2104  PIAVSW  2121
             PIA SW
Sbjct  771   PIAFSW  776



>ref|XP_008220305.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=769

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/724 (49%), Positives = 456/724 (63%), Gaps = 30/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY  + HGFS RLT  +A  L   PG++SVLP+R  EL TTR+P+F
Sbjct  58    SSLKSVSNSADMLYTYRTIIHGFSTRLTAEEAELLEKQPGILSVLPERKYELHTTRTPEF  117

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S  L P+SD  +++I+GV+D+G+WPE  S+ D GL  +P SW+  CEVG  F +
Sbjct  118   LGL-GKSEALLPASDKVSEVIVGVVDTGVWPELKSYDDTGLAAVPTSWKGSCEVGTNFSS  176

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR + +GYEA  G PI +  E KS  D  GHGTH +S AAGSAV  A++  
Sbjct  177   SSCNRKLIGARYFSKGYEAALG-PIDEKTESKSPRDDDGHGTHTSSTAAGSAVRGASLFS  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+A YK CWLG C  +DI + M++AV DGV+VLSLSIG    E    
Sbjct  236   YASGTARGMAPQARVATYKACWLGGCFGSDITAAMEKAVEDGVNVLSLSIGGSQSE----  291

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A  +G++VSC AGN GPD  +  N+APWI TVGA T+DR+FPA V+L
Sbjct  292   -YYRDTVAIGAFSAAAQGILVSCSAGNGGPDSGSLSNVAPWITTVGAGTLDRDFPAFVSL  350

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GN + + G SLY G   S   + +VY R A    N   C P  L  +KV GKIV C +  
Sbjct  351   GNQKKYRGISLYRGTSLSSGLLPLVYARNASTSSNGALCSPESLIPAKVAGKIVVCDR-G  409

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
                 V +   VK++GG+GMI++N    G ELVA+A ++ TA V    GD I  Y+ +  +
Sbjct  410   GTPRVQKSLVVKKAGGLGMILANTDSYGEELVADAYLLATAAVGQKAGDAIKSYIASGSN  469

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I    T     PS P VA+FSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  470   PTATIALGETELDVQPS-PVVASFSSRGPNLITPEILKPDLIAPGVNILAGWTGAVGPTG  528

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               +D RR  FNI+SGTSM+CPHVSGLAA++   +P WSPAAIKSALMTT+YT   +G  T
Sbjct  529   LAEDKRRVTFNIISGTSMSCPHVSGLAALVMAAHPEWSPAAIKSALMTTSYTTYKTGE-T  587

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG P+TP  +G+GHVDP  A DPGLVYD  V DY+ FLC + Y + +I L     
Sbjct  588   IKDIATGNPATPFDYGAGHVDPVAALDPGLVYDAAVEDYLSFLCALNYTTTQIKLTTHKD  647

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKN---------NLQTITYKRTVKNVGKVKNVAYQV  1935
                 C +    +   LNYPSFAV  +             T+ Y RT+ NVG        V
Sbjct  648   --FTCDSSKKYSLRDLNYPSFAVPLETASGKGGGSRASTTVKYTRTLTNVGTPATYKVSV  705

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             + QTPS V++TV P  L F+   +  +Y VTF   S      SFG L WSDG H V SPI
Sbjct  706   SSQTPS-VKITVDPESLSFSQAYEKKTYTVTFVTSSSPSGTTSFGRLEWSDGKHTVGSPI  764

Query  2110  AVSW  2121
             A SW
Sbjct  765   AFSW  768



>ref|XP_006280041.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
 gb|EOA12939.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
Length=779

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/709 (50%), Positives = 462/709 (65%), Gaps = 22/709 (3%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSN  207
              +LYTY+   HG +A+LT  +A  L    GV++V+P+   EL TTRSP FLGL    S  
Sbjct  77    RILYTYQTAFHGLAAQLTEEEAERLEEEDGVVAVIPETRYELHTTRSPTFLGLERQESER  136

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             +        D+I+GVLD+GIWPE  SF+D G++P+P++WR  CE G +F   SCNRKI+G
Sbjct  137   VWAERVTDHDVIVGVLDTGIWPESESFNDTGMSPVPSNWRGACETGKRFLKRSCNRKIVG  196

Query  388   ARAYYRGYEAVTGRPIVD-EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AR +Y+GYEA TG+   + E KS  D  GHGTH A+  AGS V  AN+ G A G ARG+A
Sbjct  197   ARVFYKGYEAATGKIEEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARGMA  256

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               AR+A YKVCW+G C ++DILS +DQAVADGVHVLS+S+G     G    Y+ D ++I 
Sbjct  257   PKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLG-----GGISTYSRDSLSIA  311

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
              FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG  RTF G S
Sbjct  312   TFGAMEMGVFVSCSAGNGGPDPLSLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGVS  371

Query  925   LYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIVDQ  1083
             LY G  +     Q  +VY GR A+S     +CL G LD S V GKIV C +      V +
Sbjct  372   LYKGRAVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDRSHVVGKIVICDR-GVTPRVQK  430

Query  1084  GFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVF  1263
             G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y   +K ATA +  
Sbjct  431   GQVVKKAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSKKATATLEI  490

Query  1264  RGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRR  1443
              GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + D RR
Sbjct  491   LGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWTGDLAPSSLSSDPRR  549

Query  1444  TEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTG  1623
              +FNI+SGTSM+CPHVSG+AA++R  +P WSPAA+KSALMTT Y  DN+ +  L D    
Sbjct  550   VKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNTLKP-LSDASGA  608

Query  1624  YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRN  1803
              PS+P+ HG+GH+DP  A DPGLVYD G  DY +FLCT      ++ +F ++S    C++
Sbjct  609   APSSPYDHGAGHIDPLKAMDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRT-CKH  667

Query  1804  RNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
                 NPG LNYP+ + +F  N  ++++T +RTV NVG   + +Y+V V       VTV P
Sbjct  668   TLAKNPGNLNYPAISALFPENTRVKSMTLRRTVINVGPHIS-SYKVFVSPFKGASVTVQP  726

Query  1978  NRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               L FT +   LSY VTF++ +R +   FG L W   TH V SP+ ++W
Sbjct  727   KTLNFTSKHQKLSYTVTFRTRMRMNRPEFGGLVWKSTTHKVRSPVIITW  775



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/713 (50%), Positives = 455/713 (64%), Gaps = 28/713 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++LY Y+ V HGFSARLTP +AS+LA+  GV++V P+   EL TTR+P+FLG+      L
Sbjct  63    KMLYAYDTVLHGFSARLTPQEASDLASAEGVLAVNPEARYELHTTRTPEFLGI--AGQGL  120

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA-TSCNRKIIG  387
              P S    D+++GVLD+G+WPE  S+ D GL  +P  W+ +C  GP F A T+CNRK++G
Sbjct  121   SPQSGTAGDVVVGVLDTGVWPESKSYDDXGLAEVPAWWKGQCXXGPGFDASTACNRKLVG  180

Query  388   ARAYYRGYEAVTGRPIVD-EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AR + +GYEA  G    D E +S +D  GHGTH +S AAG+AV  A++ G A G ARG+A
Sbjct  181   ARFFNKGYEAAMGPMDTDRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGTARGMA  240

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               AR+A YKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G A  Y+ D +AIG
Sbjct  241   PRARVAAYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGAADYSRDSVAIG  295

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AF A ++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V LG+G+ +TG S
Sbjct  296   AFAATEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYTGVS  355

Query  925   LYFGIQPSPNQ-VSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIVDQGF  1089
             LY G +P P+  + +VY   A++      C+PG L   KV GKIV C +  +   V +G 
Sbjct  356   LYAG-KPLPSAPIPIVYAANASNSTAGNLCMPGTLVPEKVAGKIVVCDRGVSAR-VQKGL  413

Query  1090  AVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRG  1269
              V+ + G GM++SN    G ELVA+A ++P A V   +G  I  YV +  + T  +V  G
Sbjct  414   VVRXAXGAGMVLSNTAANGQELVADAHLLPAAGVGEREGTAIKSYVASATNPTTTVVVAG  473

Query  1270  TVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTE  1449
             T  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA+WTG   P+    D RR  
Sbjct  474   TEVGVRPS-PVVAAFSSRGPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRVG  532

Query  1450  FNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP  1629
             FNI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y    SG S+L+D  TG  
Sbjct  533   FNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYA-SYSGGSSLLDAATGGM  591

Query  1630  STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRN  1809
             +TP  +G+GHVDP  A DPGLVYD G  DYVDFLC + Y S  IA   R+       N+ 
Sbjct  592   ATPFDYGAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKT  651

Query  1810  LGNPGALNYPSFAVVFK-------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
               + GALNYPSF+V +         +  T+T+ RT+ NVG         ++     V V 
Sbjct  652   Y-SVGALNYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVD  710

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2121
             V P  L FT   +  SY V F S  Q + +  FG L WSDG H V SPIA +W
Sbjct  711   VEPAELEFTSVGEKKSYTVRFTSKSQPSGTAGFGRLVWSDGKHSVASPIAFTW  763



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/717 (49%), Positives = 465/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY +  HGF+ RLTP +A  L   PGVISV  ++  EL TTR+P F
Sbjct  55    SSLKSASESAEMLYTYNNAIHGFATRLTPEEADSLMVQPGVISVQSEQQYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P +   +D++IGVLDSG+WPE  SFSD G  PIP +W+  C+ G +F  
Sbjct  115   LGLEVHNAGLFPETGAASDVVIGVLDSGVWPESKSFSDEGYGPIPPTWKGGCDAGTRFTM  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYEA+ G P+ +  E KS  D  GHGTH AS AAGS V  AN+ G
Sbjct  175   SLCNRKLIGARFFVRGYEAING-PVDESKESKSPRDDDGHGTHTASTAAGSVVEGANLLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARGIA  AR+AVYKVCW   C ++DIL+G+D+A+ D V++LS+S+      G   
Sbjct  234   FANGTARGIAYRARVAVYKVCWQPGCFSSDILAGIDKAIEDNVNILSISL-----SGITT  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D IAIGAF A+++G+ VSC AGN GP P++  NIAPWI TVGA T+DR+FPA+  L
Sbjct  289   YYTDD-IAIGAFAAMERGIFVSCSAGNFGPSPFSVTNIAPWITTVGAGTLDRDFPALAIL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQ-VSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ +TG SL+ G    P + +  +Y   A+       C PG L   KV+GKIV C   
Sbjct  348   GNGKNYTGVSLFKGDDELPAKLLPFIYAGNASDDAIGYLCFPGTLIPEKVKGKIVMCDT-  406

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
               +     G  VK +GG+GMII+N+  +G E+ A A  +P   V    GDII  YV    
Sbjct  407   GGVAPAMIGEVVKSAGGLGMIIANLAGRGEEVQAEAHFLPATAVGEKAGDIIRRYVLTDP  466

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             + TA IV +GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILAAWTG++ P+
Sbjct  467   NPTASIVIQGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGSLGPT  525

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G  
Sbjct  526   GLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYNTYKDGNP  585

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              +ID+ TG PSTP  HG+GHV PT A +PGL+YD    DY+DFLC + Y+S +I +  R 
Sbjct  586   -IIDISTGKPSTPFEHGAGHVSPTTAVNPGLIYDLTTVDYLDFLCALKYNSSQIGVVSRG  644

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
             +    C +    +   LNYPSFAV  + +  T  Y R V +VG   + + +VT +T + V
Sbjct  645   N--YTCDSSKTYSVADLNYPSFAVNVEGS-DTYKYTRPVTSVGGAGSYSVKVTSET-TAV  700

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++++ P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  701   KISIEPAVLNFREVNEKKSYSVTFTVDLSKPSGSNSFGSIEWSDGKHVVASPVAISW  757



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/725 (49%), Positives = 466/725 (64%), Gaps = 32/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ +LYTY++V HGFS RLT  +A  L   PG++SVLP+   EL TTR+P+F
Sbjct  55    SSLKSVSASAAMLYTYKNVIHGFSTRLTAKEAESLQKQPGIVSVLPEVRYELHTTRTPEF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S  L P+S+  +++I+GVLD+G+WPE  SF D G+ P+P  W+  CEVG  F +
Sbjct  115   LGL-GKSETLFPASEAQSEVIVGVLDTGVWPEIKSFDDTGMGPVPRGWKGVCEVGRNFKS  173

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR++ RGYE   G PI +  E KS  D  GHGTH ++ AAGS V  A++ G
Sbjct  174   SSCNRKLIGARSFSRGYEEAVG-PIDETAESKSPRDDDGHGTHTSTTAAGSVVNGASLFG  232

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+A  AR+A YKVCWL  C  +DIL+GMD+AV DGV+VLS+SIG     G   
Sbjct  233   FASGTARGMAAQARVATYKVCWLAGCFGSDILAGMDKAVEDGVNVLSMSIG-----GGLT  287

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+ +G+ VSC AGN GP   +  N+APWI TVGA T+DR+FP  V L
Sbjct  288   DYYRDTVAIGAFTAMAQGIFVSCSAGNGGPYADSISNVAPWITTVGAGTLDRDFPTYVRL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ F+G SLY     S + V +V     +S      C+ G L  +KV GKIV C +  
Sbjct  348   GNGKNFSGVSLYSRRPSSGSMVPIVDAADVSSTSSGNLCMTGSLIPAKVAGKIVVCDRGG  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V++G  VK +GGVGMI++N    G ELVA+A ++P+A V    GD I +Y+ +   
Sbjct  408   N-SRVEKGVEVKDAGGVGMILTNTDSYGEELVADAQLLPSANVGEKAGDAIKNYISSDPG  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               A I+ RGT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  467   PMATIISRGTQLGIQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGAVGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D R   FNI+SGTSM+CPHVSGLAA+L+  +P WSP+AIKSALMTT Y+ + +G+ T
Sbjct  526   LESDKRHVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIKSALMTTAYSTNGNGK-T  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFL-RN  1779
             L+D+ TG PSTP   G+GHVDP  A DPGLVYD  V DY+DFLC + Y S +I     R+
Sbjct  585   LLDISTGQPSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFQIKQATNRD  644

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKN---------NLQTITYKRTVKNVGKVKNVAYQ  1932
                +  +  +LG+   +NYPSF+V F+             T+ Y RT+ NVG        
Sbjct  645   FACLSSKTYSLGD---VNYPSFSVPFETASGTWGGVGATSTVKYTRTLTNVG-TPTTYMV  700

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
                   ++V++ V P  L F+ + +  SY VTF   S+     SF  L+WSDG H+V SP
Sbjct  701   SVSSQSTSVKILVEPESLSFSRQYEKKSYVVTFTASSMPSGTTSFARLQWSDGKHVVGSP  760

Query  2107  IAVSW  2121
             IA SW
Sbjct  761   IAFSW  765



>ref|XP_004292169.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/716 (50%), Positives = 466/716 (65%), Gaps = 30/716 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++L+ Y+ V HGFSA LT  QA+ L++ P V+ V  DR   L TTRSPQFLGL      L
Sbjct  59    QILHLYDTVFHGFSAALTSDQAASLSHHPAVLHVFEDRRRHLHTTRSPQFLGL-RNQRGL  117

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
                SDYG+D+I+GV D+G+WPER SFSD  L P+P  WR  CE G +F A++CN+K+IGA
Sbjct  118   WSESDYGSDVIVGVFDTGVWPERRSFSDLNLGPVPKRWRGVCETGDRFAASNCNKKLIGA  177

Query  391   RAYYRGYEAVT--GRPIVD-----EPKSAIDMTGHGThvasiaagsavananvnghaRGE  549
             R + +G+EA    G P+       E +SA D  GHGTH AS A G     A+++G+A G 
Sbjct  178   RFFIKGHEAAANAGGPMTAINGSVEFRSARDADGHGTHTASTATGRYAFEASMSGYASGI  237

Query  550   ARGIATNARIAVYKVCWLGT-CSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
             A+G+A  AR+A YKVCW  + C ++DIL+  D AV DGV V+S+SIG    +G + PY  
Sbjct  238   AKGVAPKARLAAYKVCWKDSGCFDSDILAAFDAAVKDGVDVISISIG--GGDGVSSPYYL  295

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             DPIAIG++GAV  GV VSC AGN GP+  +  N+APW+ TVGA TIDR FPAVV LG+GR
Sbjct  296   DPIAIGSYGAVSHGVFVSCSAGNDGPNGMSVTNLAPWLTTVGAGTIDRNFPAVVVLGDGR  355

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRA---NSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
               +G SLY G         +VY  ++   ++  C+   LD  +VRGKIV C +  N   V
Sbjct  356   RLSGVSLYAGAPLKGKMYPVVYPGQSGMLSASLCMENSLDPRQVRGKIVICDR-GNNPRV  414

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G  VK++GGVGMI++N    G  LV +A ++PTA V A +GD +  YV +T+  +A I
Sbjct  415   AKGMVVKKAGGVGMILANGITNGEGLVGDAHLLPTAAVGADEGDAVKAYVSSTRYPSATI  474

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
              F+GTV G  P AP VA+FS RGPN L PEILKPD+IAPGVNILAAWT A+ P+    DN
Sbjct  475   DFQGTVIGIKP-APVVASFSGRGPNGLNPEILKPDLIAPGVNILAAWTDAVGPTGLQTDN  533

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             R+TEFNI+SGTSMACPHVSG AA+L+  +P WSPAAI+SA+MTT    +N  + T+ D  
Sbjct  534   RKTEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMMTTAGITNNLNK-TMTDEA  592

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             TG PSTP+  G+GH++   A DPGLVYD    DYV FLC++GY  + I +  R+ P   C
Sbjct  593   TGKPSTPYDLGAGHLNLDRAMDPGLVYDITGEDYVRFLCSVGYGPRVIQVITRSPP--KC  650

Query  1798  RNRNLGNPGALNYPSFAVVFKNN---LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
               +   +PG LNYPS AV+F  +   L + T+ RTV NVG+  N  Y+  ++ P  V+VT
Sbjct  651   PGKTT-SPGNLNYPSIAVLFPTSAAGLSSKTFVRTVTNVGQ-PNAVYRPMIEAPRGVKVT  708

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLR------QSADSFGSLRWSDGTHLVTSPIAVS  2118
             V P++LVFT+ +   SY VT    R      +S   FGSL WSDG H+V SPI V+
Sbjct  709   VKPSKLVFTEAVKKRSYLVTVAVDRSNLVLGESGGVFGSLYWSDGKHVVRSPIVVT  764



>ref|XP_006841997.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
 gb|ERN03672.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
Length=753

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/715 (50%), Positives = 464/715 (65%), Gaps = 31/715 (4%)
 Frame = +1

Query  22    RSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGS  201
             +S+E+LYTY+ V HGF+ARLT  +A  L   P  +SV  + + +L TTR+P+FLGL  G+
Sbjct  54    QSTEILYTYDTVLHGFAARLTDEEAELLRQRPEALSVYEEAVYQLHTTRTPEFLGL-DGN  112

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
             + L P SDY  D+I+GVLD+G  PE  S+ D GL P+P+ WR +C+ G  F A+SCNRK+
Sbjct  113   NGLWPESDYATDVIVGVLDTGASPESKSYVDAGLGPVPSKWRGECQTGKNFDASSCNRKL  172

Query  382   IGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             IGA+ + +GYEAV G PI    E KS  D  GHGTH ++ AAG+ V +A++ G+A G AR
Sbjct  173   IGAQFFSKGYEAVMG-PIDETKESKSPKDDDGHGTHTSTTAAGAYVEHASLFGYAEGTAR  231

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+AT ARIA YKVCW G C ++DI++ MD+AVADGVH+LSLS+G     G +  Y+ D I
Sbjct  232   GMATRARIAAYKVCWAGGCFSSDIIAAMDRAVADGVHILSLSLG-----GGSIDYDRDSI  286

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             A+GAFGA++ GV VSC AGNSG D Y+  N+APWI T+GA T+DR+FPA V LGNG+ F+
Sbjct  287   AVGAFGAMEHGVFVSCSAGNSGSDTYSVSNVAPWIATIGAGTLDRDFPAYVALGNGQNFS  346

Query  916   GTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLANITIVDQ  1083
             G SLY G   S + +  +Y   A    N   CL G L   KV GKIV C +     +  +
Sbjct  347   GVSLYSGKPLSQSPLPFIYAANASNTTNGNLCLDGTLVEEKVAGKIVLCDRGVTARVA-K  405

Query  1084  GFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVF  1263
             G  V+++GGVGM+++N    G ELVA+A ++P   V    G+ I  Y+ + K+ TA IVF
Sbjct  406   GAVVRKAGGVGMVLANTASNGEELVADAHLLPATGVGEKSGEEIKSYLLSDKNPTANIVF  465

Query  1264  RGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRR  1443
              GT     PS P VAAFSSRGPN LT  ILKPD+IAPGVNILA W+  I P+    D RR
Sbjct  466   LGTKVNIRPS-PVVAAFSSRGPNPLTSAILKPDMIAPGVNILAGWSDTIGPTGLPSDTRR  524

Query  1444  TEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTG  1623
              E+NI+SGTSM+CPH+SGLAA+L+  +P WSPA IKSALMTT Y +DN+G   L D+ TG
Sbjct  525   VEYNIISGTSMSCPHISGLAALLKAAHPEWSPATIKSALMTTAYKVDNTGE-MLRDVATG  583

Query  1624  YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRN  1803
              P+T    G+GHVDP  A DP LVYDT   DY+DFLC + Y S +I+   + +    C +
Sbjct  584   RPATYFDFGAGHVDPQKALDPRLVYDTTPTDYLDFLCALNYSSTRISAIAKRT--YACGS  641

Query  1804  RNLGNPGALNYPSFAVVFKNNLQT-------ITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
              N  + G LNYPSFAV F+    T       +TY RTV NVG  +   Y+ +V     V+
Sbjct  642   GN--SVGNLNYPSFAVPFETATSTESSTPKVLTYSRTVTNVG--QPATYRASVIGGDPVK  697

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +TV P  L F ++    S+ VTF   SL   +  F +L  SDGT  V SPIA++W
Sbjct  698   ITVEPESLTFGEKGQKKSFTVTFTAGSLPSGSMKFATLELSDGTRTVASPIAMTW  752



>ref|XP_006374838.1| hypothetical protein POPTR_0014s01910g [Populus trichocarpa]
 gb|ERP52635.1| hypothetical protein POPTR_0014s01910g [Populus trichocarpa]
Length=779

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/724 (49%), Positives = 469/724 (65%), Gaps = 30/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LY Y ++ HGFS RLTP +A  L   PG+++VLP+ + +L TT SP+F
Sbjct  68    SSLKSVSESADMLYAYNNIIHGFSTRLTPEEAELLEKQPGILAVLPEMIYKLHTTHSPEF  127

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S  + P+S   +++I+GVLD+G+WPE  SF D GL PIP++W+  C VG  F +
Sbjct  128   LGL-GKSDAVPPASASMSEVIVGVLDTGVWPEIKSFDDTGLGPIPSTWKGTCAVGKNFNS  186

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGA+ + +GYEA  G PI +  E KS  D  GHGTH A+ AAGSAV+ A++ G
Sbjct  187   SSCNRKLIGAQYFSKGYEAAFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFG  245

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCWLG C ++DIL+ M++AVADGV+V+S+SIG     G   
Sbjct  246   YAFGTARGMATQARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVISMSIG-----GGIS  300

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              YN D +AIGAF AV +G++VSC AGN GP P +  N+APWI TVGA T+DR+FPA V+L
Sbjct  301   DYNRDTVAIGAFRAVAQGILVSCSAGNGGPSPGSLTNVAPWITTVGAGTLDRDFPAYVSL  360

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G SLY G   S + + +VY G  +NS     C+ G L  S+V GKIV C +  
Sbjct  361   GNGKNYSGISLYSGKPLSDSLLPLVYAGNVSNSTSGNLCMTGTLVPSQVAGKIVICDRGL  420

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V +G  V+ SGG+GMI++N    G ELVA+A ++PT+ V     D I +Y  +   
Sbjct  421   N-SRVQKGMVVRDSGGLGMILANTELYGEELVADAHLLPTSTVGQRTADAIKNYAFSDPK  479

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               A I   GT  G  PS P +AAFSSRGPN +TPE+LKPD+IAPGVNILA WTGA+ P+ 
Sbjct  480   PMATIASGGTKLGVEPS-PVLAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGAVGPTG  538

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T D R   FNI+SGTSM+CPHVSGLAA+++  +  WSPAAIKSALMTT Y    +G + 
Sbjct  539   LTSDKRHVSFNIISGTSMSCPHVSGLAALVKAAHQDWSPAAIKSALMTTAYATYKNGEN-  597

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             ++D+ TG PSTP   G+GHV+P  A DPGLVYD  V+DY++F C + Y +  I       
Sbjct  598   ILDVATGQPSTPFDFGAGHVNPVAALDPGLVYDASVDDYINFFCALNYSASDIKQITNKD  657

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNN---------LQTITYKRTVKNVGKVKNVAYQV  1935
                 C +    + G LNYPSF+V  +             T+ Y RT+ NVG        +
Sbjct  658   --FTCDSSKKYSLGDLNYPSFSVPLETASGKGGGAGVTSTVKYTRTLTNVGVPATYKLSM  715

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             T +TPS V++ V P  L F    +  +Y VTF   S+    +SF  L WSDG H+V SPI
Sbjct  716   TSKTPS-VKILVEPESLSFAKEYEKKTYTVTFTATSMPSGTNSFAHLEWSDGKHVVGSPI  774

Query  2110  AVSW  2121
             A SW
Sbjct  775   AFSW  778



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/718 (50%), Positives = 461/718 (64%), Gaps = 26/718 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S++LLYTY +  HGFS RLTP +A  L   PGVISVLP+   EL TTRSP F
Sbjct  57    SSLRSVSESAQLLYTYNNAIHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLF  116

Query  181   LGLIS-GSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL    +++L P +   +D+++GVLD+G+WPE  SFSD G  P+P++W+  CE G  F 
Sbjct  117   LGLDEHNNADLFPQTGASSDVVVGVLDTGVWPESKSFSDNGFGPVPSTWKGGCEAGTNFT  176

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananv  528
             A+ CNRK+IGAR + RGYEA  G   VDE K   S  D  GHGTH +S AAGS V  A++
Sbjct  177   ASLCNRKLIGARFFARGYEATMGP--VDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  234

Query  529   nghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
              G A G ARG+   AR+AVYKVCWLG C ++DIL+ +DQA+ D V+VLS+S+G     G 
Sbjct  235   LGFASGTARGMDPRARVAVYKVCWLGGCFSSDILAAIDQAIEDNVNVLSMSLG-----GG  289

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
                Y  D +AIGAF A+++G+ VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA+ 
Sbjct  290   MSDYYRDGVAIGAFAAMERGIFVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAIA  349

Query  889   TLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQ  1056
              LGNG+ ++G SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +
Sbjct  350   ILGNGKNYSGVSLFKGDALPDKLLPFIYAGNASNATNGNLCMTGSLIPEKVKGKIVMCDR  409

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N   V +G  VK +GGVGMI++N    G ELVA+A M+P   V    GDII  YV   
Sbjct  410   GVNAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAGDIIRRYVLTD  468

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + TA ++ +GTV    PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P
Sbjct  469   PNPTASVLIQGTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGP  527

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             +    D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y     G+
Sbjct  528   TGLPSDPRRVGFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTAYRSYKDGK  587

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               ++D+ TG PST   HG+G+V PT A +PGLVYD    DY+ FLC + Y S +I    R
Sbjct  588   P-ILDIATGKPSTAFDHGAGYVSPTIATNPGLVYDLTTVDYLGFLCALNYTSSQIRSVSR  646

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
              +    C      +   LNYPSFAV    +     Y RTV +VG     +Y+V V + S 
Sbjct  647   RN--FTCDPSKTHSVADLNYPSFAVNVDGS-GAYKYTRTVTSVGGAG--SYKVKVISEST  701

Query  1957  -VRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V+++V+P  L F +  +  SY VTF   S + S  SFG++ WSDG H+V SP+A++W
Sbjct  702   AVKISVAPAVLNFKEVNEKKSYTVTFTVDSSKASGSSFGNIEWSDGKHVVGSPVAITW  759



>ref|XP_009789180.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=779

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/713 (50%), Positives = 458/713 (64%), Gaps = 26/713 (4%)
 Frame = +1

Query  22    RSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISG  198
                 +LY+Y+   HG +A L+  + S+L   PGV++V P+   +L TTRSP FLGL    
Sbjct  76    EQERILYSYQTAFHGVAAHLSEEEVSKLQKQPGVLAVFPETKYQLHTTRSPLFLGLDRED  135

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             SS L        ++I+GVLD+GIWPE  SF+D G+ PIP  W+  CE G  F    C++K
Sbjct  136   SSKLWSDKLADHNVIVGVLDTGIWPESPSFNDTGMTPIPAHWKGACETGRGFEKHHCSKK  195

Query  379   IIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             IIGAR +YRGYEA +G+     E KSA D  GHGTH A   AGS V  AN+ G+A G AR
Sbjct  196   IIGARIFYRGYEAASGKINERGEYKSARDQDGHGTHTAGTVAGSVVRGANLLGYAYGTAR  255

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A  AR+A YKVCW+G C ++DILS +DQAVADGV+VLS+S+G     G    YN D +
Sbjct  256   GMAPGARVAAYKVCWVGGCFSSDILSAVDQAVADGVNVLSISLG-----GGVSSYNRDSL  310

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             +I AFGA++KGV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG G+  T
Sbjct  311   SIAAFGAMEKGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTGKVIT  370

Query  916   GTSLYFGIQ--PSPNQVSMVY-----GRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G SLY G +   +  Q S++Y          S  CL G LD ++V GKIV C +  +   
Sbjct  371   GASLYKGRRNLSTEKQYSLIYLGNNSSSPMPSSLCLEGTLDGAEVAGKIVICDRGISPR-  429

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V +G  VK +GGVGMI++N    G ELVA++ ++P   V   +G  I  Y  + ++ATA 
Sbjct  430   VQKGQVVKDAGGVGMILTNTAANGEELVADSHLLPAVAVGEREGRAIKHYA-SARNATAT  488

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             + F GT  G  PS P VAAFSSRGPNFLT EILKPD++APGVNILAAWTGA+ PS    D
Sbjct  489   LKFLGTKLGIRPS-PVVAAFSSRGPNFLTLEILKPDMVAPGVNILAAWTGALGPSSLPTD  547

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RRT FNI+SGTSM+CPHVSG+AA+L+  +P WSPAAIKSALMTT Y  DN+  S L D 
Sbjct  548   QRRTNFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTCNS-LKDS  606

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              T  PSTP+ HG+GH++P  A DPGLVYD G  DY +FLCT      ++ +F + S    
Sbjct  607   STATPSTPYDHGAGHINPRKAVDPGLVYDIGAQDYFEFLCTQQLSPSQLMVFGKFSNRT-  665

Query  1795  CRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGK-VKNVAYQVTVQTPSNVRV  1965
             C + +L NPG LNYP+ + VF  +  + T+T  RTV NV   + N  Y V V +     V
Sbjct  666   C-HHSLANPGDLNYPAISAVFPEDAKVSTLTLHRTVTNVASPISN--YHVRVSSFEGAVV  722

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V P+RL FT +   LSY+V F++  R  A  FGSL W DGTH V S I ++W
Sbjct  723   KVEPSRLNFTSKHQKLSYKVIFETKSRLKAPEFGSLIWKDGTHKVRSTIVITW  775



>ref|XP_003544482.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=774

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/724 (49%), Positives = 465/724 (64%), Gaps = 29/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY+HVAHGFS RLTP  A  L+  PG++SV+P+   +L TTR+P F
Sbjct  62    SSLKSASPSAEILYTYKHVAHGFSTRLTPEDADTLSKQPGILSVIPELKYKLHTTRTPSF  121

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P+S+  + +IIGVLD+G+WPE  S  D GL P+P++W+ +CE+G    +
Sbjct  122   LGL-DKATTLLPASEQQSQVIIGVLDTGVWPELKSLDDTGLGPVPSTWKGQCEIGNNMNS  180

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK++GAR + +GYEA  G PI    E KSA D  GHG+H  + AAGS V  A++ G
Sbjct  181   SNCNRKLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGSHTLTTAAGSVVPEASLFG  239

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+AVYKVCWLG C  +DI +G+D+A+ DGV+VLS+SIG     G   
Sbjct  240   LASGTARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDGVNVLSMSIG-----GSLM  294

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D IAIG+F A   G++VS  AGN GP   +  N+APWI TVGA TIDR+FPA +TL
Sbjct  295   EYYRDIIAIGSFTATSHGILVSTSAGNGGPSQGSLSNVAPWITTVGAGTIDRDFPAYITL  354

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVY-GRRANSR---YCLPGQLDASKVRGKIVYCKQLA  1062
             G G+T+TG SLY G   S + + +VY G  +NS     CL   L   KV GKIV C++  
Sbjct  355   GTGKTYTGASLYRGKPLSDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGG  414

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V++G  VK +GG GMI++N    G ELVA++ ++P A +     +I+ +YV ++ +
Sbjct  415   NPR-VEKGLVVKLAGGAGMILANSEAYGEELVADSHLLPAASLGQKSSEILKNYVSSSPN  473

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA+I F GT     PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  474   PTAKIAFLGTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLIAPGVNILAGWTGAVGPTG  532

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T D+R   FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G  T
Sbjct  533   LTVDSRHISFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALMTTAYTSYKNGE-T  591

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG P+TP  +G+GHVDP  A DPGLVYD  V+DY+ F C + Y S +I L  R  
Sbjct  592   IQDVSTGQPATPFDYGAGHVDPVAALDPGLVYDANVDDYLGFFCALNYSSFQIKLAARRD  651

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNL---------QTITYKRTVKNVGKVKNVAYQV  1935
                 C ++ +      NYPSFAV  +            +T+ Y R + NVG        V
Sbjct  652   --FTCDSKKVYRVEDFNYPSFAVPLETTSGIGGGSDAPKTVKYSRVLTNVGAPGTYKASV  709

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPI  2109
                   NV++ V P  L FT+  +   Y V+F+  S+     SF  L W+DG H V SPI
Sbjct  710   VSLGDLNVKIVVEPETLSFTELYEKKGYMVSFRYTSMPSGTTSFARLEWTDGKHRVGSPI  769

Query  2110  AVSW  2121
             A SW
Sbjct  770   AFSW  773



>ref|NP_568765.1| subtilase 1.3 [Arabidopsis thaliana]
 dbj|BAB11244.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL87307.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AED96122.1| subtilase 1.3 [Arabidopsis thaliana]
Length=780

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/713 (49%), Positives = 460/713 (65%), Gaps = 26/713 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGS  201
             ++ +LYTY+   HG +A+LT  +A  L    GV++V+P+   EL TTRSP FLGL    S
Sbjct  76    NNRILYTYQTAFHGLAAQLTQEEAERLEEEDGVVAVIPETRYELHTTRSPTFLGLERQES  135

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
               +        D+++GVLD+GIWPE  SF+D G++P+P +WR  CE G +F   +CNRKI
Sbjct  136   ERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPATWRGACETGKRFLKRNCNRKI  195

Query  382   IGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +GAR +YRGYEA TG+  +DE    KS  D  GHGTH A+  AGS V  AN+ G A G A
Sbjct  196   VGARVFYRGYEAATGK--IDEELEYKSPRDRDGHGTHTAATVAGSPVKGANLFGFAYGTA  253

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             RG+A  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D 
Sbjct  254   RGMAQKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGVSTYSRDS  308

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             ++I  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V +G  RTF
Sbjct  309   LSIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKIGTMRTF  368

Query  913   TGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANIT  1071
              G SLY G  + P   Q  +VY GR A+S     +CL G LD   V GKIV C +     
Sbjct  369   KGVSLYKGRTVLPKNKQYPLVYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDR-GVTP  427

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V +G  VK++GG+GM+++N    G ELVA++ M+P   V   +G +I  Y   +K ATA
Sbjct  428   RVQKGQVVKRAGGIGMVLTNTATNGEELVADSHMLPAVAVGEKEGKLIKQYAMTSKKATA  487

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + 
Sbjct  488   SLEILGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDMAPSSLSS  546

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR +FNI+SGTSM+CPHVSG+AA+++  +P WSPAAIKSALMTT Y  DN  +  L D
Sbjct  547   DPRRVKFNILSGTSMSCPHVSGVAALIKSRHPDWSPAAIKSALMTTAYVHDNMFKP-LTD  605

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                  PS+P+ HG+GH+DP  A DPGLVYD G  +Y +FLCT      ++ +F ++S   
Sbjct  606   ASGAAPSSPYDHGAGHIDPLRATDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRT  665

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
              C++    NPG LNYP+ + +F  N  ++ +T +RTV NVG   + +Y+V+V       V
Sbjct  666   -CKHTLAKNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHIS-SYKVSVSPFKGASV  723

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             TV P  L FT +   LSY VTF++  R     FG L W   TH V SP+ ++W
Sbjct  724   TVQPKTLNFTSKHQKLSYTVTFRTRFRMKRPEFGGLVWKSTTHKVRSPVIITW  776



>ref|XP_008679257.1| PREDICTED: subtilisin-like protease [Zea mays]
 gb|AFW64267.1| putative subtilase family protein [Zea mays]
Length=780

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/714 (49%), Positives = 470/714 (66%), Gaps = 16/714 (2%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANV-PGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
              LLY+Y H A GF+ARLT +QA+ LA+    V++V+PD   +L TT +P FL L S SS 
Sbjct  74    RLLYSYAHAATGFAARLTGAQAAHLASRRSAVLAVVPDATQQLHTTLTPSFLRL-SDSSG  132

Query  208   LGPSSDYGADIIIGVLDSGIWP-ERSSFS-DRGLNPIPNSWRNKCEVGPQFPATS-CNRK  378
             L  +S    D+++GV+D+G++P +R+SF+ D  L P P+++R +C   P F A++ CN K
Sbjct  133   LLQASGGATDVVVGVIDTGVYPKDRASFAADPSLPPPPSTFRGRCVSTPAFNASAYCNNK  192

Query  379   IIGARAYYRGYEAVTGRPIVDE--PKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             ++GA+ +  GYEA  G   VDE   +S +D  GHGTH +S AAGSAV NA    +A+G A
Sbjct  193   LVGAKFFGLGYEAAHGGGAVDETDSRSPLDTNGHGTHTSSTAAGSAVPNAAFFDYAKGTA  252

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
              G+A  ARIA YK CW   C+++DIL   D+A+ DGV+VLS+S+G     G A P+  D 
Sbjct  253   IGMAPRARIAAYKACWARGCTSSDILMAFDEAIKDGVNVLSVSLG---AVGQAPPFYSDS  309

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
              A+GAF AV++G++VS  AGNSGP  +TA+N+APWILTVGAST++R F A V LG+G TF
Sbjct  310   TAVGAFSAVRRGIVVSASAGNSGPGEFTAVNVAPWILTVGASTVNRRFSANVVLGSGDTF  369

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
              GTSLY G    P+++ +VYG    S  C  G+L ASKV GKIV C    N     +G A
Sbjct  370   AGTSLYAGTPLGPSKIPLVYGGDVGSSVCEAGKLIASKVAGKIVVCDPGVNGRAA-KGEA  428

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GG G I+ + +  G + +    + P   VT A  + I  Y++ + S  A IVF GT
Sbjct  429   VKLAGGAGAILVSAKAFGEQPITTPHIHPATAVTFAVAEKIKRYIRTSASPVATIVFLGT  488

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
             V G +PS+PR+A+FSSRGPN L PEILKPDV APGV+ILAAWTG  +PSE   D RR +F
Sbjct  489   VVGGTPSSPRMASFSSRGPNLLAPEILKPDVTAPGVDILAAWTGENSPSELDSDTRRVKF  548

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPS  1632
             NI+SGTSM+CPHVSG+AAMLR+  P WSPAAIKSALMTT + +D++G   + D+ TG  S
Sbjct  549   NIISGTSMSCPHVSGIAAMLRQARPGWSPAAIKSALMTTAFNVDSAG-DVIRDMSTGGAS  607

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   G+GHVDP  A +PGLVYD G +DYV FLC +GY +++IA+  R+  + DC  R  
Sbjct  608   TPFVRGAGHVDPNRALNPGLVYDAGTDDYVSFLCALGYTARQIAVLTRDGSVTDCSTRP-  666

Query  1813  GNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVF  1992
             G+ G LNYP+F+VVF +    +T +R V+NVG      Y  +V +P+ VRVTV P  L F
Sbjct  667   GSVGDLNYPAFSVVFGSGDDEVTQRRVVRNVGSNARATYTASVASPAGVRVTVEPPTLEF  726

Query  1993  TDRIDTLSYEVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
             +    T  Y VTF   + S     +FGS+ WSDG H VTSPIA++W     + +
Sbjct  727   SAAQQTQEYAVTFAPEQGSVAEKYTFGSIVWSDGEHKVTSPIAIAWSASQAAAM  780



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/718 (49%), Positives = 465/718 (65%), Gaps = 24/718 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTYE+  HGFS RLT ++A  L + PG++SV+ +   EL TTR+P+F
Sbjct  61    SSLKSVSDSAQMLYTYENAIHGFSTRLTLAEAKLLESQPGILSVMLELRYELHTTRTPEF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++L P SD  +++IIGVLD+G+WPE  SF D G  P+P+SW+ +CE G  F  
Sbjct  121   LGL-DKSADLLPQSDSVSEVIIGVLDTGVWPESKSFLDTGFGPVPSSWKGECESGTNFTT  179

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
              +CNRK+IGAR + RGYEA  G P+ +  E KS  D  GHGTH +S A GS VA+A++ G
Sbjct  180   KNCNRKLIGARFFARGYEATLG-PVDESKESKSPRDDDGHGTHTSSTAGGSFVADASLFG  238

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+AVYKVCW+G C ++DIL+ MD+A+ DGV+VLS+S+G     G   
Sbjct  239   YAAGTARGMAARARVAVYKVCWVGGCFSSDILAAMDKAIDDGVNVLSMSLG-----GSMS  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG+ VSC AGNSGP  Y+  N+APWI TVGA T+DR+FPA  +L
Sbjct  294   YYYRDSVAIGAFAAMEKGIFVSCSAGNSGPSSYSLSNVAPWITTVGAGTLDRDFPAFASL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQV-SMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ ++G SLY G    P ++   VY   A    N   C+ G L   +V GKIV C + 
Sbjct  354   GNGKNYSGVSLYKGDAILPGKLLPFVYAGNASNATNGNLCMMGALIPEQVAGKIVLCDRG  413

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  VK +GG+GM++SN    G ELVA+A ++P   V    GD I  Y+ +  
Sbjct  414   VNPR-VQKGAVVKAAGGLGMVLSNTDANGEELVADAHLLPATAVGQKGGDEIKKYLFSDS  472

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
               T  I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W G++ P+
Sbjct  473   KPTVNILFEGTKVGIQPS-PVVAAFSSRGPNSITPDILKPDMIAPGVNILAGWVGSVGPT  531

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D RR EFNI+SGTSM+CPHVSGLAA+++  +P WSPAAIKSALMTT Y    +G  
Sbjct  532   GLATDGRRVEFNIISGTSMSCPHVSGLAALIKAAHPDWSPAAIKSALMTTAYVTYKNGNK  591

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              L D+ TG  STP  HG+GHVDP +A +PGLVYD   +DY++FLC + Y + +I    R 
Sbjct  592   -LQDVATGKDSTPFDHGAGHVDPVSALNPGLVYDLTADDYLNFLCALNYSATEITSLARR  650

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTPS  1953
                 D   +   +   LNYPSFAV F +      I + RT+ NVG        +++Q+P 
Sbjct  651   KFTCDASKKY--SVTDLNYPSFAVNFGSGSADVVIKHSRTLTNVGAPGTYKVLISLQSP-  707

Query  1954  NVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V+V V P  L F    +  SY VTF   S+    ++FG + WS+G  +V SPIAVSW
Sbjct  708   GVKVAVEPETLSFRQANEKKSYTVTFTGSSMPAGTNTFGRIEWSNGKQIVGSPIAVSW  765



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/728 (50%), Positives = 468/728 (64%), Gaps = 35/728 (5%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+E+LY Y+ VAHGFSARLTP++A  LA   GV+SV P+   EL TTR+P+FLG
Sbjct  53    LRSVSGSAEVLYFYDTVAHGFSARLTPAEARALARRYGVLSVEPETRYELHTTRTPEFLG  112

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQF-PAT  363
             L  G   +  SSD   D+++GVLD+G+WPER SF D G  P+P SW+  CE G  F PA 
Sbjct  113   LDRGGGFV-TSSDSDGDVVVGVLDTGVWPERKSFDDAGFGPVPASWKGGCEEGKDFVPAA  171

Query  364   SCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvngh  537
             +CNRK++GAR++YRGYEA  G P+ +  E +S  D  GHGTH ++  AGSAV +A++ G+
Sbjct  172   ACNRKLVGARSFYRGYEASMG-PMDESKEARSPRDNDGHGTHTSTTVAGSAVPDASLLGY  230

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+++ AR+AVYKVCW+G C ++DIL+GMD+AV DG  VLSLS+G     G    
Sbjct  231   AAGTARGMSSRARVAVYKVCWVGGCFSSDILAGMDKAVEDGCGVLSLSLG-----GRVAD  285

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IAIGAF A++KGV VSC AGN+GP P +  N+APWI TVGA T+DR+FPA V LG
Sbjct  286   YYRDGIAIGAFTAMEKGVFVSCSAGNAGPVPTSLSNVAPWITTVGAGTLDRDFPAYVVLG  345

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYG----RRANSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG  +TG +LY G     + + +VY        N   C+ G L   KV GKIV C +  N
Sbjct  346   NGENYTGATLYGGDPLPSSPLELVYAGNVTNTTNGNLCMLGTLLPEKVAGKIVLCDRGIN  405

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
              + V +G+ V ++GG GM+++N    G ELVA+A ++P   V    G+ I  Y+ +  S 
Sbjct  406   -SRVQKGYVVSEAGGAGMVLANSAGNGEELVADAHLLPATGVGEKAGNAIRSYLFSDPSP  464

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA IVFRGT  G  PS P VAAFSSRGPN +T  ILKPD+IAPGVNILA WTGA+ P+  
Sbjct  465   TATIVFRGTKVGVRPS-PVVAAFSSRGPNTITRAILKPDLIAPGVNILAGWTGAVGPTGL  523

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D RRTEFN++SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y    SG S +
Sbjct  524   GMDARRTEFNVISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYAAYPSGDS-I  582

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             ID  TG  +TP   G+GHVDP  A DPGL+YD  V+DY+DFLC   Y   +IA   + S 
Sbjct  583   IDAATGRAATPFDLGAGHVDPPRAMDPGLIYDLTVDDYLDFLCASNYTPFRIASLTKRSN  642

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFK--------NNLQTITYKRTVKNVGKVKNVAYQVTV  1941
                C          LNYPSFAV F          +  T+ ++RT+ NVG      Y+ TV
Sbjct  643   FT-CDATRTYAVSDLNYPSFAVAFPATTNDVVVGDATTVKHRRTLTNVGGPGT--YKATV  699

Query  1942  QT-----PSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVT  2100
             +         V+V V P+ L FT+  +   Y V F +  Q + +  FG L WSDG H+V 
Sbjct  700   RAWAGTEAGGVKVAVEPSELSFTEVGERRGYTVRFSAAGQPSGTTGFGRLEWSDGEHVVA  759

Query  2101  SPIAVSWE  2124
             SP+A +W+
Sbjct  760   SPLAFTWK  767



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/721 (48%), Positives = 456/721 (63%), Gaps = 26/721 (4%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P ++      ++YTY++  HG +A+LT  +A +L    GV+++ PD   EL TTRSP FL
Sbjct  67    PEADADSEKRIIYTYQNAFHGVAAKLTEGEAKKLETEEGVVAIFPDTKYELHTTRSPTFL  126

Query  184   GLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             GL    + N+      G D+I+GVLD+GIWPE  SF D  + P+P  W+  CE+G  F  
Sbjct  127   GLEPEKAPNMWSEKLAGHDVIVGVLDTGIWPESESFKDVSMGPVPAHWKGACEIGTGFTK  186

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             + CN+K++GAR +Y GYEA  GR     E KSA D  GHGTH A+   GS V  AN+ G+
Sbjct  187   SHCNKKVVGARVFYHGYEAAIGRINEQKEFKSARDQDGHGTHTAATVGGSPVLGANLLGY  246

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A  ARIA YKVCW+G C ++DI+S +D+AVADGV+VLS+S+G     G    
Sbjct  247   ANGTARGMAPGARIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLG-----GGVSS  301

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +++ AFGA+++GV VSC AGN+GPDP +  N++PWI TVGASTIDR+FPA V LG
Sbjct  302   YYRDSLSVAAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTIDRDFPAQVKLG  361

Query  898   NGRTFTGTSLYFGIQP--SPNQVSMVYGRRANSR-----YCLPGQLDASKVRGKIVYCKQ  1056
             NG+  +G SLY G        Q  +VY    +SR      CL G LD   V GKIV C +
Sbjct  362   NGKIVSGVSLYKGQSALSFEKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVVCDR  421

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               +   V +G  V+ +GGVGMI++N      ELVA+  ++P   +   +G  I  YV+++
Sbjct  422   GLSPR-VQKGHVVRSAGGVGMILTNTEANREELVADCHLLPAVAIGEKEGKDIKSYVQSS  480

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
             +SATA + F+GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+ AI P
Sbjct  481   QSATATLAFKGTTLGIRPS-PVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGP  539

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             S    DNRR +FNI+SGTSM+CPHVSG+AA L+  +P WSPAAIKSALMTT Y LDN+ +
Sbjct  540   SGLKVDNRREKFNILSGTSMSCPHVSGIAAFLKSRHPEWSPAAIKSALMTTAYVLDNT-K  598

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
              TL D  T  PS+P+ HGSGH+DP  A DPGLVYD    DY +FLCT      ++ +F +
Sbjct  599   KTLRDASTAKPSSPYDHGSGHIDPIRALDPGLVYDIEPQDYFEFLCTQKLSPTQLRVFSK  658

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----ITYKRTVKNVGKVKNVAYQVTV  1941
              S    C   +L +PG LNYP+ + +F     T     +   RTV NVG   +  YQV V
Sbjct  659   YSNR-SC-THSLVSPGDLNYPAISSIFTQKTATSFSDPVIVHRTVTNVGP-PDSNYQVVV  715

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAVS  2118
                    V V P  L FT     LSY++TF   +RQ++  FGSL W DG H V SPI ++
Sbjct  716   SPFEGSSVKVEPETLNFTKTHQNLSYKITFTPRVRQTSPEFGSLVWKDGLHTVRSPIVIT  775

Query  2119  W  2121
             W
Sbjct  776   W  776



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/718 (50%), Positives = 461/718 (64%), Gaps = 26/718 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S++LLYTY +  HGFS RLTP +A  L   PGVISVLP+   EL TTRSP F
Sbjct  57    SSLRSVSESAQLLYTYNNAIHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLF  116

Query  181   LGLIS-GSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL    +++L P +   +D+++GVLD+G+WPE  SFSD G  P+P++W+  CE G  F 
Sbjct  117   LGLDEHNNADLFPQTGASSDVVVGVLDTGVWPESKSFSDNGFGPVPSTWKGGCEAGTNFT  176

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananv  528
             A+ CNRK+IGAR + RGYEA  G   VDE K   S  D  GHGTH +S AAGS V  A++
Sbjct  177   ASLCNRKLIGARFFARGYEATMGP--VDESKESRSPRDDDGHGTHTSSTAAGSVVEGASL  234

Query  529   nghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
              G A G ARG+   AR+AVYKVCWLG C ++DIL+ +DQA+ D V+VLS+S+G     G 
Sbjct  235   LGFASGTARGMDPRARVAVYKVCWLGGCFSSDILAAIDQAIEDNVNVLSMSLG-----GG  289

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
                Y  D +AIGAF A+++G+ VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA+ 
Sbjct  290   MSDYYRDGVAIGAFAAMERGIFVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAIA  349

Query  889   TLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQ  1056
              LGNG+ ++G SL+ G       +  +Y   A    N   C+ G L   KV+GKIV C +
Sbjct  350   ILGNGKNYSGVSLFKGDALPDKLLPFIYAGNASNATNGNLCMTGSLIPEKVKGKIVMCDR  409

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N   V +G  VK +GGVGMI++N    G ELVA+A M+P   V    GDII  YV   
Sbjct  410   GVNAR-VQKGDVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAGDIIRRYVLTD  468

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + TA ++ +GTV    PS P VAAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA  P
Sbjct  469   PNPTASVLIQGTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGP  527

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             +    D RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y     G+
Sbjct  528   TGLPSDPRRVGFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALMTTAYRSYKDGK  587

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
               ++D+ TG PST   HG+G+V PT A +PGLVYD    DY+ FLC + Y S +I    R
Sbjct  588   P-ILDIATGKPSTAFDHGAGYVSPTIATNPGLVYDLTTVDYLGFLCALNYTSSQIRSVSR  646

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
              +    C      +   LNYPSFAV    +     Y RTV +VG     +Y+V V + S 
Sbjct  647   RN--FTCDPSKTHSVADLNYPSFAVNVDGS-GAYKYTRTVTSVGGAG--SYKVKVISEST  701

Query  1957  -VRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V+++V+P  L F +  +  SY VTF   S + S  SFG++ WSDG H+V SP+A++W
Sbjct  702   AVKISVAPAVLNFKEVNEKKSYTVTFTVDSSKASGSSFGNIEWSDGKHVVGSPVAITW  759



>ref|XP_002864127.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40386.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/713 (49%), Positives = 463/713 (65%), Gaps = 26/713 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGS  201
             ++ +LYTY+   HG +ARLT  +A  L    GV++V+P+   EL TTRSP FLGL    S
Sbjct  36    NNRILYTYQTAFHGLAARLTDEEAERLEEEDGVVAVIPETRYELHTTRSPTFLGLERQES  95

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
               +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G +F   +CNRKI
Sbjct  96    ERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGACETGKRFLKRNCNRKI  155

Query  382   IGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +GAR +YRGYEA TG+  +DE    KS  D  GHGTH A+  AGS+V  AN+ G A G A
Sbjct  156   VGARVFYRGYEAATGK--IDEELEYKSPRDRDGHGTHTAATVAGSSVKGANLFGFAYGTA  213

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             RG+A  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D 
Sbjct  214   RGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGISTYSRDS  268

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             ++I  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V +G  RTF
Sbjct  269   LSIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKIGTLRTF  328

Query  913   TGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANIT  1071
              G SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C +     
Sbjct  329   KGVSLYKGRTVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDR-GVTP  387

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V +G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y   +K ATA
Sbjct  388   RVQKGQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGENEGKLIKQYAMTSKKATA  447

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + 
Sbjct  448   SLEILGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDMAPSSLSS  506

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN+ +  L D
Sbjct  507   DPRRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKP-LTD  565

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                  PS+P+ HG+GH+DP  A DPGLVYD G  +Y +FLCT      ++ +F ++S   
Sbjct  566   ASGAAPSSPYDHGAGHIDPLKAIDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRT  625

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
              C++    NPG LNYP+ + +F  N  ++ +T +RTV NVG   + +Y+V+V       V
Sbjct  626   -CKHTLAKNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHIS-SYKVSVSPFKGASV  683

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             TV P  L FT +   LSY VTF++ +R     FG L W   TH V SP+ ++W
Sbjct  684   TVQPKTLNFTSKHQKLSYTVTFRTRMRLKRPEFGGLVWKSSTHKVRSPVIITW  736



>gb|KHN45156.1| Subtilisin-like protease [Glycine soja]
Length=722

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/724 (49%), Positives = 467/724 (65%), Gaps = 33/724 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E LYTY+ VAHGFS RLT  +A  L+  PGV+SV+P+   EL TTR+P+F
Sbjct  14    SSLKSVSDSAERLYTYKKVAHGFSTRLTTQEAELLSKQPGVLSVIPEVRYELHTTRTPEF  73

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL +  + L  +S   +D+I+GVLD+G+WPE  SF D GL P+P+SW+ +CE G  F  
Sbjct  74    LGL-AKYTTLSLASGKQSDVIVGVLDTGVWPELKSFDDTGLEPVPSSWKGECERGKNFKP  132

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CN+K++GAR + RGYEA  G PI +  E KS  D  GHG+H ++ AAGSAV  A++ G
Sbjct  133   SNCNKKLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGSHTSTTAAGSAVFGASLFG  191

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+A YKVCWLG C  +DI +G+D+A+ DGV++LS+SIG     G   
Sbjct  192   FANGTARGMATQARVATYKVCWLGGCFTSDIAAGIDKAIEDGVNILSMSIG-----GGLM  246

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D IAIG F A   G++VS  AGN GP   T  N+APW+ TVGA TIDR+FPA +TL
Sbjct  247   DYYKDTIAIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWLTTVGAGTIDRDFPAYITL  306

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSR---YCLPGQLDASKVRGKIVYCKQLAN  1065
             GNG+ +TG SLY G  P  + + +VY   A+      C  G L A KV GKIV C +  N
Sbjct  307   GNGKIYTGVSLYNGKLPLNSPLPIVYAGNASEESQNLCTRGSLIAKKVAGKIVICDRGGN  366

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V++G  VK +GG+GMI+SN    G ELVA++ ++P A +     + +  YV +  + 
Sbjct  367   AR-VEKGLVVKSAGGIGMILSNNEDYGEELVADSYLLPAAALGQKSSNELKKYVFSFPNP  425

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA++ F GT  G  PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTGA+ P+  
Sbjct  426   TAKLGFGGTQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIAPGVNILAGWTGAVGPTGL  484

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D R  +FNI+SGTSM+CPHV+GLAA+L+ ++P WSPAAI+SALMTT Y    +G+ T+
Sbjct  485   AEDTRHVDFNIISGTSMSCPHVTGLAALLKGIHPEWSPAAIRSALMTTAYRTYKNGQ-TI  543

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG P+TP  +G+GHVDP  A DPGLVYDT V+DY+ F C + Y   +I L  R   
Sbjct  544   KDVATGLPATPFDYGAGHVDPVAAFDPGLVYDTTVDDYLSFFCALNYSPYQIKLVARRD-  602

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNL---------QTITYKRTVKNVGKVKNVAYQVT  1938
                C  R       LNYPSFAV F              T+ Y RT+ NVG      Y+V+
Sbjct  603   -FTCSKRKKYRVEDLNYPSFAVPFNTAYGVKGGSSKPATVQYTRTLTNVGAAGT--YKVS  659

Query  1939  V-QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA--DSFGSLRWSDGTHLVTSPI  2109
             V Q+P  V++ V P  L F    +  +Y VTF S  + +   SF  L WSDG H VTSPI
Sbjct  660   VSQSP--VKIVVQPQTLSFRGLNEKKNYTVTFMSSSKPSGTTSFAYLEWSDGKHKVTSPI  717

Query  2110  AVSW  2121
             A SW
Sbjct  718   AFSW  721



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/724 (49%), Positives = 462/724 (64%), Gaps = 31/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY +V HGFS  LT  +A  L   PGV+SVL +   EL TTR+P+F
Sbjct  58    SSLKSVSDSADMLYTYNNVIHGFSTSLTEKEAQFLKQQPGVLSVLQENRYELHTTRTPEF  117

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S  L P+SD  +++I+GVLD+G+WPE  S+ D GL  +P+SW+ +CEVG  F +
Sbjct  118   LGL-GRSDALFPASDKLSEVIVGVLDTGVWPESKSYDDAGLRRVPSSWKGECEVGKNFNS  176

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCN K+IGAR +  GYE   G PI +  E KS  D  GHGTH ++ AAGS V  A++ G
Sbjct  177   SSCNMKLIGARYFSAGYEEAFG-PIDEKVESKSPRDDDGHGTHTSTTAAGSTVVEASLFG  235

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+A YKVCWLG C  +DIL+G+D+A+ DGV VLSLSIG     G   
Sbjct  236   FASGTARGMATTARVATYKVCWLGGCFGSDILAGIDKAIDDGVDVLSLSIG-----GGLN  290

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIG F AV  G++VS  AGN GP   +  N+APW+ TVGA T+DR+FPA V+L
Sbjct  291   DYYRDTVAIGTFAAVAHGIVVSVSAGNGGPGSGSLSNVAPWLTTVGAGTLDRDFPAYVSL  350

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ + G SLY G   S   V +VYGR AN+      CLPG LD++KV GK+V C +  
Sbjct  351   GNGQKYKGVSLYSGKPLSEELVQIVYGRTANNSTNGNLCLPGSLDSAKVTGKLVVCDRGG  410

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N     +G  VK +GGVGMI+SN    G ELVA+A ++P   V    G++I  Y+++  +
Sbjct  411   NPR-AQKGQVVKDAGGVGMILSNTESYGEELVADAHLLPAVTVGQRTGNLIKTYLRSDAN  469

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I    T  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTG   P+ 
Sbjct  470   PTATITQGSTQLGIQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGRAGPTG  528

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                DNRR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y+    G+ T
Sbjct  529   LDTDNRRVSFNIVSGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTAYSTYKGGK-T  587

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG  +TP  +G+GHVDP  A +PGLVYD  V DY+ F C + Y + +I    +  
Sbjct  588   ISDISTGSSATPFDYGAGHVDPVAALEPGLVYDATVQDYISFFCALNYSASQIKTVTKGD  647

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFK---------NNLQTITYKRTVKNVGKVKNVAYQV  1935
                 C +    + G  NYPSFAV  +         +   T+ Y RT+ NVG  +   Y+V
Sbjct  648   --YTCDHTKKYSLGDFNYPSFAVPLETASSSEGGADASSTVKYTRTLTNVG--EPATYKV  703

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQ--SADSFGSLRWSDGTHLVTSPI  2109
             ++ +  +V+++V P  L F++  +  +Y VTF +  Q     SF  L WSDG H V+SPI
Sbjct  704   SISSDPSVKISVQPESLSFSEAYEKKTYTVTFTANSQPSGTTSFARLEWSDGKHAVSSPI  763

Query  2110  AVSW  2121
             A SW
Sbjct  764   AFSW  767



>ref|XP_003525925.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/724 (49%), Positives = 467/724 (65%), Gaps = 33/724 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E LYTY+ VAHGFS RLT  +A  L+  PGV+SV+P+   EL TTR+P+F
Sbjct  61    SSLKSVSDSAERLYTYKKVAHGFSTRLTTQEAELLSKQPGVLSVIPEVRYELHTTRTPEF  120

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL +  + L  +S   +D+I+GVLD+G+WPE  SF D GL P+P+SW+ +CE G  F  
Sbjct  121   LGL-AKYTTLSLASGKQSDVIVGVLDTGVWPELKSFDDTGLEPVPSSWKGECERGKNFKP  179

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CN+K++GAR + RGYEA  G PI +  E KS  D  GHG+H ++ AAGSAV  A++ G
Sbjct  180   SNCNKKLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGSHTSTTAAGSAVFGASLFG  238

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT AR+A YKVCWLG C  +DI +G+D+A+ DGV++LS+SIG     G   
Sbjct  239   FANGTARGMATQARVATYKVCWLGGCFTSDIAAGIDKAIEDGVNILSMSIG-----GGLT  293

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D IAIG F A   G++VS  AGN GP   T  N+APW+ TVGA TIDR+FPA +TL
Sbjct  294   DYYKDTIAIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWLTTVGAGTIDRDFPAYITL  353

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSR---YCLPGQLDASKVRGKIVYCKQLAN  1065
             GNG+ +TG SLY G  P  + + +VY   A+      C  G L A KV GKIV C +  N
Sbjct  354   GNGKIYTGVSLYNGKLPLNSPLPIVYAGNASEESQNLCTRGSLIAKKVAGKIVICDRGGN  413

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V++G  VK +GG+GMI+SN    G ELVA++ ++P A +     + +  YV +  + 
Sbjct  414   AR-VEKGLVVKSAGGIGMILSNNEDYGEELVADSYLLPAAALGQKSSNELKKYVFSFPNP  472

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA++ F GT  G  PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTGA+ P+  
Sbjct  473   TAKLGFGGTQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIAPGVNILAGWTGAVGPTGL  531

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
              +D R  +FNI+SGTSM+CPHV+GLAA+L+ ++P WSPAAI+SALMTT Y    +G+ T+
Sbjct  532   AEDTRHVDFNIISGTSMSCPHVTGLAALLKGIHPEWSPAAIRSALMTTAYRTYKNGQ-TI  590

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG P+TP  +G+GHVDP  A DPGLVYDT V+DY+ F C + Y   +I L  R   
Sbjct  591   KDVATGLPATPFDYGAGHVDPVAAFDPGLVYDTTVDDYLSFFCALNYSPYQIKLVARRD-  649

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNL---------QTITYKRTVKNVGKVKNVAYQVT  1938
                C  R       LNYPSFAV F              T+ Y RT+ NVG      Y+V+
Sbjct  650   -FTCSKRKKYRVEDLNYPSFAVPFNTAYGVKGGSSKPATVQYTRTLTNVGAAGT--YKVS  706

Query  1939  V-QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA--DSFGSLRWSDGTHLVTSPI  2109
             V Q+P  V++ V P  L F    +  +Y VTF S  + +   SF  L WSDG H VTSPI
Sbjct  707   VSQSP--VKIVVQPQTLSFRGLNEKKNYTVTFMSSSKPSGTTSFAYLEWSDGKHKVTSPI  764

Query  2110  AVSW  2121
             A SW
Sbjct  765   AFSW  768



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/710 (50%), Positives = 471/710 (66%), Gaps = 29/710 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++LY YE+   GFSA+L+  Q   L  V G +S  PD L+ L TT SP FLGL SG   L
Sbjct  74    QILYAYENAISGFSAKLSTKQLKSLETVDGFLSATPDELLTLHTTYSPHFLGLESGI-GL  132

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +++   D+I+GV+D+GIWPE  +F D G+ P+P+ W+  CE G +F  ++CN K+IGA
Sbjct  133   WDATNLAKDVIVGVIDTGIWPEHIAFQDTGMPPVPSRWKGGCEEGTKFSQSNCNNKLIGA  192

Query  391   RAYYRGYEAVTGR--PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             RA+++GYE+V GR    VD  +S  D  GHGTH AS AAG+ VANAN+ G ARG+A G+ 
Sbjct  193   RAFFKGYESVVGRINETVDY-RSPRDAQGHGTHTASTAAGNIVANANLFGLARGKAAGMR  251

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               +RIA YK CW   CS++DIL+ +D+AVADGV VLSLS+G     G ++PY  D +AI 
Sbjct  252   YTSRIAAYKACWSLGCSSSDILAAIDKAVADGVDVLSLSLG-----GSSRPYYRDTVAIA  306

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             +FGA Q GV VSC AGNSGP   T  N APWI+TV AS  DR FPA+V LGNG +F G+S
Sbjct  307   SFGATQSGVFVSCSAGNSGPSISTVDNTAPWIMTVAASYTDRSFPAIVKLGNGHSFEGSS  366

Query  925   LYFGIQPSPNQVSMVYGRRAN---SRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             LY G      Q+ +V+G+ A    + YC+ G L+   V+GKIV C++  N +   +G  V
Sbjct  367   LYSG--KGSKQLPLVFGKTAGVSGAEYCINGSLNRKLVKGKIVICQRGLN-SRTGKGEQV  423

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GG GM++ N   +G EL+A+A ++P A + A+ G  +  YV +TK  TA IVF+GTV
Sbjct  424   KLAGGAGMLLLNSDKEGEELIADAHVLPAATLGASAGKAVKKYVNSTKRPTASIVFKGTV  483

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              GN   AP +A+FSSRGP+ +  +++KPDV APGVNILAAW    +PS    D+RR  FN
Sbjct  484   FGNP--APVIASFSSRGPSLVGHDVIKPDVTAPGVNILAAWPATTSPSMLKSDDRRVLFN  541

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPST  1635
             I+SGTSM+CPHVSGLAA+L+ ++  WS AAIKSALMTT YTL+N  R++ I    G   T
Sbjct  542   IISGTSMSCPHVSGLAALLKSVHEDWSTAAIKSALMTTAYTLNN--RNSPIADVGGSSDT  599

Query  1636  P----HAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRN  1803
             P     A GSGHVDP +A+DPGL+YD    DY+D+LC++ Y S ++ALF   +    C N
Sbjct  600   PLATAFAFGSGHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQLALFAGGN--FTCPN  657

Query  1804  RNLGNPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
              +  +PG LNYPSFAV FK N++  ++ Y+R+V NVG      Y V V+ P+ V VT++P
Sbjct  658   PSAFHPGKLNYPSFAVNFKGNVKNMSLEYERSVTNVG-TSYCTYAVKVEEPNGVLVTITP  716

Query  1978  NRLVFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSWE  2124
               L F    + LSY+VTF SLR  S +SFGSL W  G + V SPIAV+W+
Sbjct  717   PILSFQKIGEILSYKVTFVSLRGASNESFGSLTWVSGKYAVKSPIAVTWQ  766



>ref|XP_010482516.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010482517.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=779

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/711 (49%), Positives = 459/711 (65%), Gaps = 26/711 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSN  207
              +LYTY+   HG +A+LT  +A  L    GV++V+P+   EL TTRSP FLGL    S  
Sbjct  77    RILYTYQTAFHGLAAQLTEEEAERLKEEDGVVAVIPETRYELHTTRSPTFLGLERQESEK  136

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+G
Sbjct  137   VWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVG  196

Query  388   ARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             AR +YRGYEA TG+  +DE    KS  D  GHGTH A+  AGS V  AN+ G A G ARG
Sbjct  197   ARVFYRGYEAATGK--IDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARG  254

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             ++  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D ++
Sbjct  255   MSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGISTYSRDSLS  309

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             I  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG  RTF G
Sbjct  310   IATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKG  369

Query  919   TSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIV  1077
              SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C +  +   V
Sbjct  370   VSLYKGRAVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPR-V  428

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y   ++ ATA +
Sbjct  429   QKGQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATL  488

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
                GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + D 
Sbjct  489   EVLGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDP  547

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN+ +  L D  
Sbjct  548   RRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKP-LTDAS  606

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
                PS+P+ HG+GH+DP  A DPGLVYD G  DY +FLCT      ++ +F ++S    C
Sbjct  607   GAAPSSPYDHGAGHIDPLKAIDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNR-SC  665

Query  1798  RNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             ++    NPG LNYP+ + +F  N  +++IT +RTV NVG     +Y+V+V       VTV
Sbjct  666   KHTLAKNPGNLNYPAISALFPENTRVKSITLRRTVTNVGP-HIASYKVSVSPFKGASVTV  724

Query  1972  SPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P  L FT +   LSY VTF + +R     FG L W   TH V SP+ ++W
Sbjct  725   QPKTLSFTSKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/712 (51%), Positives = 458/712 (64%), Gaps = 24/712 (3%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
             S ++ +LYTY+ + HG+SARLT ++A  L + PGV+ V P+   EL TTR+P+FLGL  G
Sbjct  61    SEAATVLYTYDTLVHGYSARLTRAEAEALESQPGVLIVNPEVRYELHTTRTPEFLGL-DG  119

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             +  L P S  G+D+IIGVLD+G+WPER S+ D G  P+P  W+ +CE G  F A+SCN+K
Sbjct  120   TDALFPQSSTGSDVIIGVLDTGVWPERPSYDDTGFGPVPAGWKGECEKGNDFNASSCNKK  179

Query  379   IIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGAR +  GYEA  G P+    E +S  D  GHGTH +S AAG AV  A++ G+A G A
Sbjct  180   LIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGTA  238

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             +G+A  AR+A YKVCW G C ++DIL  M+ AV DGV VLSLS+G     G    Y  D 
Sbjct  239   KGMAPRARVATYKVCWTGGCFSSDILKAMEAAVTDGVDVLSLSLG-----GGTADYYRDS  293

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IA+GAF A++KG+ VSC AGN+GP   T  N APWI TVGA TIDR+FPA VTLGNG+ +
Sbjct  294   IAVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAHVTLGNGKNY  353

Query  913   TGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             TG SLY G   S   V ++Y G  +NS   + C+ G L   KV GKIV C +  N   V 
Sbjct  354   TGVSLYSGKPLSTTPVPLIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNAR-VQ  412

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +GF VK  GG GMI++N    G ELVA+A ++P + V    G+ I DY  +   ATA IV
Sbjct  413   KGFIVKDVGGAGMILANTAANGEELVADAHILPGSGVGEKAGNAIRDYAMSDPKATATIV  472

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT  G  PS P VAAFSSRGPN +TP +LKPD+IAPGVNILAAW+G++ PS    D+R
Sbjct  473   FAGTKVGIQPS-PVVAAFSSRGPNTVTPSVLKPDIIAPGVNILAAWSGSVGPSGIPGDSR  531

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R  FNI+SGTSM+CPHVSGLAA+LR  +P WSPAAI+SALMTT Y    +G   ++D+ T
Sbjct  532   RVGFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNEYPNGDG-ILDVAT  590

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G P+TP   G+GHVDP  A DPGLVYD    DYVDFLC I Y   +IA   + S      
Sbjct  591   GRPATPLDVGAGHVDPAKAVDPGLVYDLTTADYVDFLCAINYGPMQIATLTKRSSDGCVA  650

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQV---TVQTPSNVRVTV  1971
             NR      ALNYPSFAV F     T+ + RTV NVG+     Y+V        + V+V+V
Sbjct  651   NRTYAE-SALNYPSFAVAFPAAGGTVKHTRTVTNVGQPGT--YKVTASAAAGSTAVKVSV  707

Query  1972  SPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P+ L F+   + LSY V+F   ++    + FG L WS   H+V SPIA +W
Sbjct  708   EPSTLSFSKAGEKLSYTVSFTAPAMASGTNGFGRLVWSSDHHVVASPIAATW  759



>ref|XP_010679580.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/727 (48%), Positives = 468/727 (64%), Gaps = 33/727 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S ++E++YTY + AHG++ RLT S+A  L+++PG+++VLP+   EL TTR+P F
Sbjct  54    SSLRHVSDTAEMIYTYSNAAHGYATRLTESEAESLSSLPGILAVLPETRYELHTTRTPSF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL     +    S+  +D+IIGVLD+G+WPE  SF D+G+ P+P++WR  C  G  F A
Sbjct  114   LGLDRTRDSF-TESESASDVIIGVLDTGVWPESKSFDDKGMGPVPSTWRGACMTGNNFSA  172

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             +SCN K+IGA+ + +GYEAV G      E KS  D  GHGTH AS AAGS V  A++ G+
Sbjct  173   SSCNLKLIGAQYFSQGYEAVVGSFDESRESKSPRDDDGHGTHTASTAAGSPVEGASLFGY  232

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A  AR+AVYKVCW G C ++DIL  +D+A+ D V+VLSLS+G     G    
Sbjct  233   APGTARGMAPRARVAVYKVCWTGGCFSSDILKAIDKAIEDNVNVLSLSLG-----GGTSE  287

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D +AIGAF A++ G++VSC AGN+GP  ++  N+APWI TVGA T+DR+FPAV ++ 
Sbjct  288   YYRDSVAIGAFAAMEHGILVSCSAGNAGPTAFSLSNVAPWITTVGAGTLDRDFPAVASVS  347

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ + G SL+ G       +  VY   A++      C+ G L   KV+GKIV C +  N
Sbjct  348   NGKKYAGVSLFRGESLPHGMLPAVYAGNASNATSGSLCMTGTLIPEKVKGKIVLCDRGVN  407

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  VK +GG+GMI++N    G ELVA+A ++P   V    GD I DYV +  + 
Sbjct  408   PR-VQKGAVVKAAGGLGMILANTEANGEELVADAHLLPATAVGQKSGDAIRDYVISDSNP  466

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA W+GA+ P+  
Sbjct  467   TATILFEGTKVGVQPS-PVVAAFSSRGPNAITPEILKPDMIAPGVNILAGWSGALGPTAV  525

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D RR EFNI+SGTSM+CPHVSGLA +++  +P WSPAAIKSALMTT Y    +G+  L
Sbjct  526   ATDMRRVEFNIISGTSMSCPHVSGLAGLVKGAHPDWSPAAIKSALMTTAYVTYKNGQR-L  584

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG PSTP  HG+GHVDP +A +PGLVYD   +DY+ FLC + Y   +I L  R   
Sbjct  585   QDVATGKPSTPLDHGAGHVDPISALNPGLVYDLTTDDYLAFLCALKYTPSQINLVARRKF  644

Query  1786  LVDC-RNRNLGNPGALNYPSFAVVFKNNLQT------------ITYKRTVKNVGKVKNVA  1926
             + D  +N +L +    NYPSFAV FK    T            + Y RT+ NVG   +  
Sbjct  645   ICDSDKNYSLSD---FNYPSFAVSFKTVPSTKAAGGPSHEPTVMKYTRTLTNVGPPGSYK  701

Query  1927  YQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVT  2100
               +T Q P  V+++V P  L F+   +  SY VTF + + ++D+  F  + WSDG H+V+
Sbjct  702   VTLTSQAP-EVKISVDPEVLSFSKVNEKKSYTVTFTAEQMASDTNKFARIEWSDGKHVVS  760

Query  2101  SPIAVSW  2121
             SPIA SW
Sbjct  761   SPIAFSW  767



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/716 (49%), Positives = 463/716 (65%), Gaps = 23/716 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S S+++LYTY +V HGFS RLT  +A  L   PGVISV P+   EL TTR+P+FLG
Sbjct  39    LKSVSPSADMLYTYNNVVHGFSTRLTDDEARSLQGQPGVISVWPELKYELHTTRTPEFLG  98

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
             L   +  L P +D  +D+++GVLD+G+WPE  SF+D GL P+P SW+  CE G  F ++ 
Sbjct  99    LGKSTDALFPETDSVSDVVVGVLDTGVWPESHSFADDGLGPVPASWKGFCEEGTNFTSSH  158

Query  367   CNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngha  540
             CNRK+IGAR + RGYEA  G PI    E KS  D  GHGTH AS AAGS V  A++ G A
Sbjct  159   CNRKLIGARFFSRGYEATLG-PIDASRESKSPRDDDGHGTHTASTAAGSVVEGASLFGFA  217

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT AR+AVYKVCWLG C ++DIL G+DQAV D V+VLS+S+G     G    Y
Sbjct  218   AGTARGMATRARVAVYKVCWLGGCFSSDILKGLDQAVEDNVNVLSMSLG-----GGMSEY  272

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +A+GAF A+QKG+ +S  AGN+GP  ++  N+APWI TVGA T+DR+FPA V+LG+
Sbjct  273   YRDSVAVGAFAAMQKGIFISSSAGNAGPSDFSLSNVAPWITTVGAGTLDRDFPAYVSLGS  332

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLANI  1068
             G+ ++G SLY G       + ++Y   A    N   C+ G L   KV GK+V C +  N 
Sbjct  333   GQNYSGVSLYKGDALPHGMLPLIYAGNASNATNGNLCMMGTLIPEKVAGKMVLCDRGLNA  392

Query  1069  TIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSAT  1248
               V +G  VK +GG+GM+++N    G ELVA+A ++P + V    G+ I  Y+ +  + T
Sbjct  393   R-VQKGAVVKAAGGLGMVLANTASNGEELVADAHLLPASCVGEKSGNAIKKYLFSDTNPT  451

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
               I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNI+A W+G + P+   
Sbjct  452   VTILFEGTKVGVQPS-PVVAAFSSRGPNLITPQILKPDIIAPGVNIIAGWSGKLGPTGLA  510

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
              D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y+    G+  L+
Sbjct  511   IDSRRVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYSSYKDGQ-ILL  569

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL  1788
             D+ TG PSTP  HG+GH DP  A DPGLVYD  V+DY+DFLC + Y   +I+   R    
Sbjct  570   DIATGKPSTPFDHGAGHADPVAALDPGLVYDLTVDDYLDFLCALNYTDDQISGLTRKEFS  629

Query  1789  VDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
              D + +   +   LNYPSFAV F++N       Y RT+ NVG        +  +T S V+
Sbjct  630   CDAKKKY--SVTDLNYPSFAVNFQSNGGSSVYNYSRTLTNVGPAGTYKLSLKSETQS-VK  686

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++V P  L F+   +  SY VTF    S+   + SFG + WSDG H+V SPIA SW
Sbjct  687   ISVEPETLSFSHANEKKSYTVTFTAVGSMSPDSKSFGRIEWSDGKHIVGSPIAFSW  742



>ref|XP_002283279.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=765

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/724 (49%), Positives = 462/724 (64%), Gaps = 30/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L   S S+++LYTY +V HGFS RLT  +A  L    G++SVLP+   EL TTR+P+F
Sbjct  54    SSLKTASSSADMLYTYNNVVHGFSTRLTTEEAELLRGQLGILSVLPEARYELHTTRTPEF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL    + L P +D  +++I+GVLD+G+WPE  SF D GL P+P+SW+ +CE G  FP 
Sbjct  114   LGLGKSVAFL-PQADSASEVIVGVLDTGVWPELKSFDDTGLGPVPSSWKGECETGKTFPL  172

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGAR + RGYE   G P+ +  E +S  D  GHG+H ++ A GSAV  A++ G
Sbjct  173   SSCNRKLIGARFFSRGYEVAFG-PVNETIESRSPRDDDGHGSHTSTTAVGSAVEGASLFG  231

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARG+AT+AR+A YKVCWLG C  +DI++ MD+AV DGV VLS+SIG     G   
Sbjct  232   FAAGTARGMATHARVAAYKVCWLGGCYGSDIVAAMDKAVQDGVDVLSMSIG-----GGLS  286

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +AIGAF A+++G++VSC AGN GP P +  N+APWI TVGA T+DR+FPA V L
Sbjct  287   DYTKDSVAIGAFRAMEQGILVSCSAGNGGPAPSSLSNVAPWITTVGAGTLDRDFPAFVML  346

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             G+G+ F+G SLY G   S + + +VY   A    N   C+P  L   KV GKIV C + +
Sbjct  347   GDGKKFSGVSLYSGKPLSDSLIPLVYAGNASSSPNGNLCIPDNLIPGKVAGKIVLCDRGS  406

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK++GGVGMI++N    G ELVA+A ++PTA V    GD I  Y+ +  +
Sbjct  407   NAR-VQKGIVVKEAGGVGMILTNTDLYGEELVADAHLLPTAAVGQKAGDSIKSYISSDPN  465

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
               A I   GT  G  PS P VA+FSSRGPN +TPEILKPD+IAPGVNILA WTGA+ P+ 
Sbjct  466   PMATIAPGGTQVGVQPS-PVVASFSSRGPNPVTPEILKPDIIAPGVNILAGWTGAVGPTG  524

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D R+  FNI+SGTSM+CPHVSGLAA+L+  +P W PAAIKSALMTT Y     G  T
Sbjct  525   LQVDTRKVSFNIISGTSMSCPHVSGLAALLKAAHPEWRPAAIKSALMTTAYHTYKGGE-T  583

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG P+TP  +G+GHV+P +A DPGLVYD  V+DY+ F C + Y   +I  F    
Sbjct  584   IQDVATGRPATPFDYGAGHVNPVSALDPGLVYDATVDDYLSFFCALNYKQDEIKRFTNRD  643

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKN---------NLQTITYKRTVKNVGKVKNVAYQV  1935
                D   +   +   LNYPSFAV  +           L  + Y RT+ NVG        V
Sbjct  644   FTCDMNKKY--SVEDLNYPSFAVPLQTASGKGGGSGELTVVKYTRTLTNVGTPATYKVSV  701

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             + Q  S+V+++V P  L F++  +  SY VTF   S+     SF  L WSDG H+V SP+
Sbjct  702   SSQI-SSVKISVEPESLTFSEPNEKKSYTVTFTASSMPSGMTSFAHLEWSDGKHIVGSPV  760

Query  2110  AVSW  2121
             A SW
Sbjct  761   AFSW  764



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/715 (49%), Positives = 454/715 (63%), Gaps = 24/715 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S ++E+LY Y+ VAHGFSARLTP++A  +   PGV+ V+ +   EL TTR+P+FLG
Sbjct  56    LRSVSDTAEILYAYDTVAHGFSARLTPAEARAMERRPGVLGVMAEARYELHTTRTPEFLG  115

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT-  363
             L   +    P S+  +D+++GVLD+G+WPER S+ D GL P+P SW+  CE G  F A  
Sbjct  116   L-DRTEGFIPQSNTTSDVVVGVLDTGVWPERKSYDDAGLGPVPASWKGACEEGKDFKAAN  174

Query  364   SCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngh  537
             +CNRK++GAR + +GYEA  G PI    E +S  D  GHGTH +S  AGSAV + +  G+
Sbjct  175   ACNRKLVGARFFSQGYEARMG-PINLTRESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGY  233

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG++T ARIAVYKVCWLG C  +DIL+ MD+A+ DG  VLSLS+G     G    
Sbjct  234   AAGTARGMSTRARIAVYKVCWLGGCFGSDILAAMDKAIEDGCGVLSLSLG-----GGMSD  288

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IA+GAF A+  GV+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V L 
Sbjct  289   YYRDNIAVGAFSAMAMGVVVSCSAGNAGPGASTLSNVAPWITTVGAGTLDRDFPANVLLS  348

Query  898   NGRTFTGTSLYFGIQPSPNQ-VSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             NG+ +TG SLY G +P P+  +  +Y   A    N   C+ G L   KV GKIV C +  
Sbjct  349   NGKNYTGVSLYSG-KPLPSSPLPFIYAGNATNTTNGNLCMTGTLLPDKVAGKIVLCDRGI  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  V+ +GG GMI++N    G ELVA+A ++P   V    GD I  Y+ +  +
Sbjct  408   NAR-VQKGSVVRDAGGAGMILANTAANGEELVADAHLLPATAVGEIAGDAIKSYLFSDPN  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I FRGT  G  PS P VAAFSSRGP+ +TP+ILKPD+IAPGVNILAAWTG++ P+ 
Sbjct  467   PTATIAFRGTKVGVKPS-PVVAAFSSRGPSAITPDILKPDLIAPGVNILAAWTGSVGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RRTEFNI+SGTSM+CPHVSGL A+L+  +P WSP AIKSALMTT Y     G   
Sbjct  526   QAADPRRTEFNIISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALMTTAYAA-YPGDGG  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             ++D+ TG  +TP   G+GHVDP  A DPGLVYD    DY+DFLC + Y   +IA   R +
Sbjct  585   ILDVATGRAATPFDFGAGHVDPPKALDPGLVYDLTTEDYLDFLCALNYTPLQIARLSRLT  644

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                 C  +       LNYPSFAV F     T+ + RT+ NVG      Y+ TV  P  V+
Sbjct  645   NYT-CDRQKAYEVSDLNYPSFAVAFATASTTVKHTRTLTNVGAPGT--YKATVSAPEGVK  701

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2121
             V V P  L F+   +  +Y VTF +  Q + S  FG L WSD  H+V SP+A SW
Sbjct  702   VVVEPTALTFSALGEKKNYTVTFSTASQPSGSTAFGRLEWSDAQHVVASPLAFSW  756



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/712 (49%), Positives = 461/712 (65%), Gaps = 29/712 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLYTYE    GF+  L+      L  V G +S +PD L  L TT SP FLGL +G S L
Sbjct  42    QLLYTYETSMFGFAVHLSKKHLKYLNQVDGFLSAIPDELSTLHTTYSPHFLGLRNGRS-L  100

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +S+   D+IIGVLDSGIWPE  SF D G++P+P+ W+  CE G +F +++CN+K+IGA
Sbjct  101   WSASNLATDVIIGVLDSGIWPEHISFQDSGMSPVPSHWKGVCEKGTKFSSSNCNKKLIGA  160

Query  391   RAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             R YY+GYE   G+ I +  +  S  D  GHGTH AS AAG  V NAN+ G ARG A G+ 
Sbjct  161   RTYYKGYEKFFGKKINETVDYLSPRDSEGHGTHTASTAAGRVVKNANLFGQARGTASGMR  220

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               +RIAVYKVCW   C+NAD+L+ MDQAV+DGV VLSLS+G        KP+  D IAI 
Sbjct  221   YTSRIAVYKVCWSSGCTNADVLAAMDQAVSDGVDVLSLSLG-----SIPKPFYSDSIAIA  275

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             +FGA +KGV V+C AGNSGP P T  N APWI TV AS+ DR FP  V LGNG+TF G+S
Sbjct  276   SFGATKKGVFVACSAGNSGPFPSTVGNGAPWITTVAASSTDRSFPTKVKLGNGKTFEGSS  335

Query  925   LYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
             LY G +   NQ+ +VYG+ A ++    YC+ G LD   V GKIV C++  N    ++G  
Sbjct  336   LYQGKKT--NQLPLVYGKSAGAKKEAQYCIGGSLDPKLVHGKIVACERGIN-GRTEKGEE  392

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GG GMI+ N  +QG EL A+  ++P   + A+    I  Y ++ K  TA I F GT
Sbjct  393   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASKTIRSYSQSVKKPTASISFMGT  452

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
               G+   AP +AAFSSRGP+ + P+++KPDV APGVNILAAW   I+PS    D R+  F
Sbjct  453   RFGDP--APVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPSKISPSFLMSDKRKVLF  510

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP-  1629
             NI+SGTSM+CPHVSG+AA+L+  +  WSPAAIKSALMTT YTL+N G + + D+ +    
Sbjct  511   NILSGTSMSCPHVSGIAALLKSFHKDWSPAAIKSALMTTAYTLNNKG-APISDMASDNSP  569

Query  1630  -STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNR  1806
              +TP A GSGHV+P NA+DPGLVYD    DY+++LC+I Y S +IAL  R   +  C  +
Sbjct  570   FATPFAFGSGHVNPVNASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFV--CSKK  627

Query  1807  NLGNPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              L   G LNYPSF+V+F  +    ++TY+R V NVG  ++ AY V ++ P+ V VTV P 
Sbjct  628   TLLQAGNLNYPSFSVLFGRSASNASVTYRRVVTNVGNPQS-AYAVKLEQPNGVSVTVEPR  686

Query  1981  RLVFTDRIDTLSYEVTFQSLRQS----ADSFGSLRWSDGTHLVTSPIAVSWE  2124
             +L F      LSY+VTF S+  +      SFGSL W  G + V SP+AV+W+
Sbjct  687   KLKFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLVWVSGKYKVRSPMAVTWK  738



>ref|XP_010442681.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=779

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/711 (49%), Positives = 459/711 (65%), Gaps = 26/711 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSN  207
              +LYTY+   HG +A+LT  +A  L    GV++V+P+   EL TTRSP FLGL    S  
Sbjct  77    RILYTYQTAFHGLAAQLTEEEAERLKEEDGVVAVIPETRYELHTTRSPTFLGLERQESEK  136

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+G
Sbjct  137   VWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVG  196

Query  388   ARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             AR +YRGYEA TG+  +DE    KS  D  GHGTH A+  AGS V  AN+ G A G ARG
Sbjct  197   ARVFYRGYEAATGK--IDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARG  254

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             ++  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D ++
Sbjct  255   MSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGISTYSRDSLS  309

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             I  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG  RTF G
Sbjct  310   IATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKG  369

Query  919   TSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIV  1077
              SLY G  +     Q  +VY GR A+S     +CL G LD   V GKIV C +  +   V
Sbjct  370   VSLYKGRAVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDQRHVAGKIVICDRGVSPR-V  428

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y   ++ ATA +
Sbjct  429   QKGQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATL  488

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
                GT+ G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + D 
Sbjct  489   EVLGTIIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDP  547

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN+ +  L D  
Sbjct  548   RRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKP-LTDAS  606

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
                PS+P+ HG+GH+DP  A DPGLVYD G  DY  FLCT      ++ +F ++S    C
Sbjct  607   GAAPSSPYDHGAGHIDPLKAIDPGLVYDIGPQDYFYFLCTQDLSPSQLKVFTKHSNR-SC  665

Query  1798  RNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             ++    NPG LNYP+ + +F  N  ++++T +RT+ NVG     +Y+V+V       VTV
Sbjct  666   KHTLAKNPGNLNYPAISALFPENTRVKSMTLRRTLTNVGP-HIASYKVSVSPFKGASVTV  724

Query  1972  SPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P  L FT +   LSY VTF + +R     FG L W   TH V SPI ++W
Sbjct  725   QPKTLNFTTKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPIIITW  775



>ref|XP_008792659.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/716 (50%), Positives = 466/716 (65%), Gaps = 28/716 (4%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
             S S E+LY+Y  VAHGFSA LTP++A+ L +  GV+SVL +   +L TTR+P+FLGL   
Sbjct  63    SDSVEILYSYNTVAHGFSAHLTPAEAAALESRDGVLSVLQEVRYKLHTTRTPEFLGL-DK  121

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             S ++ P  +  +D+++GVLD+G+WPER SF D G   +P+ W+  CE G  F  T+CNRK
Sbjct  122   SDDIFPQGNTASDVVVGVLDTGVWPERKSFDDTGFGAVPSWWKGACEEGKDFKGTACNRK  181

Query  379   IIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGAR + +GYEA  G PI D  E +S  D  GHGTH A+ AAGSAV + ++NG A G A
Sbjct  182   LIGARFFSKGYEASAG-PINDTRESRSPRDNEGHGTHTATTAAGSAVTDVSLNGFAAGTA  240

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             RG+AT AR+A YKVCW G C ++DIL+ MD+AV DG  VLSLS+G     G    Y +D 
Sbjct  241   RGMATRARVAAYKVCWAGGCFSSDILAAMDRAVEDGCQVLSLSLG-----GGMVDYYKDI  295

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             +AIGAF A++KGV+ S  AGN+GP   +  N+APW+ TVGA TIDR+FPA V LGNG+ +
Sbjct  296   VAIGAFNAMEKGVLTSFSAGNAGPFASSLSNVAPWMTTVGAGTIDRDFPAYVVLGNGKNY  355

Query  913   TGTSLYFGIQPSPNQ-VSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
             +G SLY G +P P+  +  VY   A    N   C+PG L   KV GKI+ C +   I  V
Sbjct  356   SGVSLYSG-KPLPSSPLPFVYAGNASNASNGNLCMPGTLMPKKVAGKIILCDR-GIIARV  413

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G+ V+++GG GM+++N    G ELVA+A ++P A V    GD +  Y+++ KS TA I
Sbjct  414   QKGYVVREAGGAGMVLANTDANGEELVADAHLLPAAGVGQKVGDAVRAYLRSDKSPTATI  473

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
             VF GT  G  PS P VAAFSSRGPN +TPEILKPD+IAPGVNILA WTG   P+  + D+
Sbjct  474   VFGGTKIGVRPS-PVVAAFSSRGPNAVTPEILKPDLIAPGVNILAGWTGVAGPTGLSVDS  532

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR EFNI+SGTSM+CPHVSGLAA+L+  +P WSPAA++SALMTT Y+    G   L+D+ 
Sbjct  533   RRVEFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAVRSALMTTAYSAYPGGDGGLLDVA  592

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             TG  + P  +G+GHVDP  AADPGLVYD    DY+DFLC + Y S +IA   + +    C
Sbjct  593   TGKAANPFDYGAGHVDPLRAADPGLVYDLTAEDYIDFLCALNYTSLQIAAVAKRTNYT-C  651

Query  1798  RNRNLGNPGALNYPSFAVVFKN------NLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
              +        LNYPSFAVVF+       ++ T+ + RTV NVG      Y+ T      V
Sbjct  652   DSTRTYAVSELNYPSFAVVFETASGTGGSVATVKHTRTVTNVGGPGT--YKSTAVAGGAV  709

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQ--SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +V V P  L F D+ +  S+ V+F   SL      FG L WSDG H+V SP+A +W
Sbjct  710   KVVVEPVELSFADKGEKRSFTVSFSSPSLPSRWSGFGRLEWSDGKHVVASPMAFTW  765



>gb|EYU25500.1| hypothetical protein MIMGU_mgv1a001697mg [Erythranthe guttata]
Length=771

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/718 (49%), Positives = 471/718 (66%), Gaps = 34/718 (5%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSN  207
             ++++YTY++V HG+S RLT  +A  L + PGV+ +  D + +L TTRSP+FLG+++  + 
Sbjct  67    ADIIYTYKNVIHGYSVRLTAEEAKSLEDKPGVLLIQEDVVYKLHTTRSPEFLGILNSDAL  126

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L P S   +++IIGVLD+G+WPE SSF D+GL P+P+ W+ +CE+   F ++SCNRK+IG
Sbjct  127   LLPESATTSNVIIGVLDTGVWPESSSFDDKGLEPVPSGWKGECELSKTFNSSSCNRKLIG  186

Query  388   ARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             AR + +GYEA  G PI +  E KS  D  GHGTH ++ A GSAV  AN+ G A G ARG+
Sbjct  187   ARFFSQGYEAAFG-PIDETVESKSPRDDDGHGTHTSTTAGGSAVVGANLFGFAAGTARGM  245

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A +AR+A YKVCW G C ++DIL+ M++A+ DGV +LSLS+G    +     Y  D +AI
Sbjct  246   ARHARLAAYKVCWRGGCISSDILAAMEKAIEDGVDILSLSLGGSLSD-----YFRDTVAI  300

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAF A  KG++VSC AGNSGP P +  N+APWI TVGA T+DREFP+ V+LGNG+ F G 
Sbjct  301   GAFAATAKGILVSCSAGNSGPSPESLSNVAPWITTVGAGTLDREFPSTVSLGNGKKFVGA  360

Query  922   SLYFGIQPSPNQ-VSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLANITIVDQG  1086
             SLY G +P P   + +VY R A    N   CL G L   KV+GKIV C +  +    ++G
Sbjct  361   SLYNG-KPLPGSLIPLVYARNASSASNGNLCLTGSLIPEKVKGKIVICDRGLSPR-AEKG  418

Query  1087  FAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFR  1266
               V+++GGVG+I+SN    G ELVA+A  IP+A V    GD I  YV +  + TA I   
Sbjct  419   LVVREAGGVGVILSNTYTYGEELVADAHFIPSAAVGQTAGDEIKKYVSSDPNPTATIASG  478

Query  1267  GTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRT  1446
             GT  G  PS P VA+FSSRGPN +TPEILKPD+IAPGVNILAAWTG + P+   +D RR 
Sbjct  479   GTQLGVQPS-PVVASFSSRGPNTITPEILKPDLIAPGVNILAAWTGNVGPTGLPEDTRRV  537

Query  1447  EFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGY  1626
             +FNI+SGTSM+CPHVSGLAA+++  +P WSPAAI+SALMTT Y+   +G+ T+ DL TG 
Sbjct  538   DFNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIRSALMTTAYSRYKNGK-TIQDLATGN  596

Query  1627  PSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNR  1806
             PSTP  +G+GHVDP +A DPGLVYD  V++YVDFLC I Y S  I +  +      C+  
Sbjct  597   PSTPFCYGAGHVDPVSALDPGLVYDASVDNYVDFLCAIKYSSSMIKILTKQD--YTCKAD  654

Query  1807  NLGNPGALNYPSFAVVFK----------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
                +   LNYPSFAV F+          N    + + RT+KNVG     +Y+ +V   S+
Sbjct  655   KEYSVANLNYPSFAVPFQTASGPNGGSTNASTVVKHTRTLKNVG--SPASYKASVSQESD  712

Query  1957  -VRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V++ V P  L F    +  SY VTF   S+     SF  L WSDG H+V SPI +SW
Sbjct  713   AVKIAVVPEVLDFGSSNEEKSYTVTFTASSMPSGTTSFAHLEWSDGKHVVGSPIVISW  770



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/712 (49%), Positives = 469/712 (66%), Gaps = 29/712 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLYTYE    GF+A L+      L  V G +S +PD L  L TT +P FLGL +G S L
Sbjct  45    QLLYTYETSMFGFAAHLSKKHLKYLNQVDGFLSAIPDELSTLHTTYTPHFLGLRNGRS-L  103

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +S+   D+IIGVLDSGIWPE  SF D G++P+P+ W+  CE G +F +++CN+K++GA
Sbjct  104   WSASNLATDVIIGVLDSGIWPEHISFQDSGMSPVPSHWKGVCEKGTKFSSSNCNKKLVGA  163

Query  391   RAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             RAYY+GYE   G+ I +  +  S  D  GHGTH AS +AG+ V NAN  G ARG A G+ 
Sbjct  164   RAYYKGYEIFFGKKINETVDYLSPRDSQGHGTHTASTSAGNVVKNANFFGQARGTACGMR  223

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               +RIAVYKVCW   C+NAD+L+ MDQAV+DGV VLSLS+G        KP+  D IAI 
Sbjct  224   YTSRIAVYKVCWSSGCTNADVLAAMDQAVSDGVDVLSLSLG-----SIPKPFYSDSIAIA  278

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             ++GA++KGV+V+C AGNSGP P T  N APWI+TV AS+ DR FP  V LGNG+TF G+S
Sbjct  279   SYGAIKKGVLVACSAGNSGPFPSTVGNGAPWIMTVAASSTDRSFPTKVKLGNGKTFKGSS  338

Query  925   LYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
             LY G +   NQ+ +VYG+ A ++    YC+ G LD   V GKIV C++  N    ++G  
Sbjct  339   LYQGKKT--NQLPLVYGKSAGAKKEAQYCIGGSLDPKLVHGKIVACERGIN-GRTEKGEE  395

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GG GMI+ N  +QG EL A+  ++P   + A+    I  Y ++ K  TA I F GT
Sbjct  396   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASKTIRSYSQSVKKPTASISFMGT  455

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
               G+   AP +AAFSSRGP+ + P+++KPDV APGVNILAAW   I+PS    D R+  F
Sbjct  456   RFGDP--APVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPTKISPSFLMSDKRKVLF  513

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP-  1629
             NI+SGTSM+CPHVSG+AA+L+ L+  WSPAAIKSALMTT YTL+N G + + D+ +    
Sbjct  514   NILSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKG-APISDMASNNSP  572

Query  1630  -STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNR  1806
              +TP A GSGHV+P +A+DPGLVYD    DY+++LC+I Y S +IAL  R   +  C  +
Sbjct  573   LATPFAFGSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFV--CSKK  630

Query  1807  NLGNPGALNYPSFAVVF-KNNLQ-TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              +   G LNYPSFAV+  K+ L  ++TY+R V NVGK ++ AY V ++ P+ V VTV P 
Sbjct  631   AVLQAGDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQS-AYAVKLEQPNGVSVTVEPR  689

Query  1981  RLVFTDRIDTLSYEVTFQSLRQS----ADSFGSLRWSDGTHLVTSPIAVSWE  2124
             +L F      LSY+VTF S+  +      SFGSL W  G + V SP+AV+W+
Sbjct  690   KLNFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMAVTWQ  741



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/712 (49%), Positives = 455/712 (64%), Gaps = 31/712 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLYTY    HGF+A L P +A  L     V+ V  + +  L TTR+P+FLGL   +   G
Sbjct  73    LLYTYTSAFHGFAAVLNPDEAEALRRSDPVLDVFEETVYSLHTTRTPEFLGL---NPEFG  129

Query  214   PSSDYGAD--------IIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSC  369
                 Y A         ++IGVLD+G+WPE  SF D G+  IP  WR +CE GP F    C
Sbjct  130   SWVGYSAHDLDQASNGVVIGVLDTGVWPESRSFDDTGMPEIPEKWRGECESGPDFDPKLC  189

Query  370   NRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaR  543
             N+K+IGAR++ +G++  +G    +  E  S  D+ GHGTH +S AAGSAV NA+  G+A 
Sbjct  190   NKKLIGARSFSKGFQMASGGGFSNKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYAT  249

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G ARG+AT AR+A YKVCW   C  +DIL+GMD+A+ DGV VLSLS+G     G + PY 
Sbjct  250   GTARGMATRARVATYKVCWSTGCFGSDILAGMDRAILDGVDVLSLSLG-----GGSAPYY  304

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
              D IAIGAF A++KG+ VSC AGNSGP   +  N+APWI+TVGA T+DR+FPA   LGNG
Sbjct  305   RDTIAIGAFSAMEKGIFVSCSAGNSGPTKASIANVAPWIMTVGAGTLDRDFPAYAALGNG  364

Query  904   RTFTGTSLYFGIQPSPNQVSMVY--GRRANSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
               FTG SLY G       +++VY  G  ++S  CLPG LD + VRGKIV C +  N   V
Sbjct  365   DRFTGVSLYSGEGMGTKPLALVYNKGNSSSSNLCLPGSLDPAIVRGKIVVCDRGVNAR-V  423

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
             ++G  V+ +GG GMI++N    G ELVA++ M+P   V    GD+I +YVK+ K+ TA +
Sbjct  424   EKGAVVRDAGGAGMILANTAASGEELVADSHMLPAMAVGRKTGDLIREYVKSDKNPTAVL  483

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
             VFRGTV G  PS P VAAFSSRGPN +TP+ILKPDVI PGVNILA W+ A+ P+   KD 
Sbjct  484   VFRGTVLGVRPS-PVVAAFSSRGPNTVTPQILKPDVIGPGVNILAGWSEAVGPTGLEKDP  542

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RRT+FNIMSGTSM+CPH+SGLAA+L+  +P WSP+AIKSALMTT Y +DN+    L D  
Sbjct  543   RRTQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNVDNTNLP-LRDAA  601

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
                 S P  HGSGHVDP  A  PGLVYD    +Y+ FLC++ Y    I   ++  P V+C
Sbjct  602   DNSLSNPWTHGSGHVDPQKAMSPGLVYDISTEEYIRFLCSLDYTVDHIQAIVKR-PSVNC  660

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
              +R   +PG LNYPSF+V+F +  +   Y R + NVG   ++ Y+V V  P++V VTV P
Sbjct  661   -SRKFSDPGQLNYPSFSVLFGDK-RVARYTRELTNVGTPGSI-YKVAVDGPASVAVTVKP  717

Query  1978  NRLVFTDRIDTLSYEVTFQSLR----QSADSFGSLRWSDGTHLVTSPIAVSW  2121
              RLVF    +   Y VTF + R     ++  FGS+ WS+  H V SP+  SW
Sbjct  718   TRLVFGAVGEKKRYTVTFSAKRGMSLATSSEFGSITWSNSEHSVRSPVVFSW  769



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/712 (49%), Positives = 469/712 (66%), Gaps = 29/712 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLYTYE    GF+A L+      L  V G +S +PD L  L TT +P FLGL +G S L
Sbjct  76    QLLYTYETSMFGFAAHLSKKHLKYLNQVDGFLSAIPDELSTLHTTYTPHFLGLRNGRS-L  134

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +S+   D+IIGVLDSGIWPE  SF D G++P+P+ W+  CE G +F +++CN+K++GA
Sbjct  135   WSASNLATDVIIGVLDSGIWPEHISFQDSGMSPVPSHWKGVCEKGTKFSSSNCNKKLVGA  194

Query  391   RAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             RAYY+GYE   G+ I +  +  S  D  GHGTH AS +AG+ V NAN  G ARG A G+ 
Sbjct  195   RAYYKGYEIFFGKKINETVDYLSPRDSQGHGTHTASTSAGNVVKNANFFGQARGTACGMR  254

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               +RIAVYKVCW   C+NAD+L+ MDQAV+DGV VLSLS+G        KP+  D IAI 
Sbjct  255   YTSRIAVYKVCWSSGCTNADVLAAMDQAVSDGVDVLSLSLG-----SIPKPFYSDSIAIA  309

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             ++GA++KGV+V+C AGNSGP P T  N APWI+TV AS+ DR FP  V LGNG+TF G+S
Sbjct  310   SYGAIKKGVLVACSAGNSGPFPSTVGNGAPWIMTVAASSTDRSFPTKVKLGNGKTFKGSS  369

Query  925   LYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANITIVDQGFA  1092
             LY G +   NQ+ +VYG+ A ++    YC+ G LD   V GKIV C++  N    ++G  
Sbjct  370   LYQGKKT--NQLPLVYGKSAGAKKEAQYCIGGSLDPKLVHGKIVACERGIN-GRTEKGEE  426

Query  1093  VKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGT  1272
             VK +GG GMI+ N  +QG EL A+  ++P   + A+    I  Y ++ K  TA I F GT
Sbjct  427   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASKTIRSYSQSVKKPTASISFMGT  486

Query  1273  VTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEF  1452
               G+   AP +AAFSSRGP+ + P+++KPDV APGVNILAAW   I+PS    D R+  F
Sbjct  487   RFGDP--APVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPTKISPSFLMSDKRKVLF  544

Query  1453  NIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYP-  1629
             NI+SGTSM+CPHVSG+AA+L+ L+  WSPAAIKSALMTT YTL+N G + + D+ +    
Sbjct  545   NILSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKG-APISDMASNNSP  603

Query  1630  -STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNR  1806
              +TP A GSGHV+P +A+DPGLVYD    DY+++LC+I Y S +IAL  R   +  C  +
Sbjct  604   LATPFAFGSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFV--CSKK  661

Query  1807  NLGNPGALNYPSFAVVF-KNNLQ-TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              +   G LNYPSFAV+  K+ L  ++TY+R V NVGK ++ AY V ++ P+ V VTV P 
Sbjct  662   AVLQAGDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQS-AYAVKLEQPNGVSVTVEPR  720

Query  1981  RLVFTDRIDTLSYEVTFQSLRQS----ADSFGSLRWSDGTHLVTSPIAVSWE  2124
             +L F      LSY+VTF S+  +      SFGSL W  G + V SP+AV+W+
Sbjct  721   KLKFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMAVTWQ  772



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/711 (49%), Positives = 461/711 (65%), Gaps = 32/711 (5%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG-------  198
             YTY    HGF+A L   +   L     V+ V  D +  L TTR+P FLGL S        
Sbjct  67    YTYTSSFHGFAAFLDSEEVELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGH  126

Query  199   -SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
              + +L  +S    D+IIGVLD+GIWPE  SF D G+  IP+ WR  CE GP F  + CN+
Sbjct  127   TTQDLNQASH---DVIIGVLDTGIWPESKSFDDTGMPEIPSRWRGGCEAGPDFSPSLCNK  183

Query  376   KIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvnghaRG  546
             K+IGAR++ +GY+  +G     +P+   SA D  GHGTH AS AAGS V NA++ G+ARG
Sbjct  184   KLIGARSFSKGYQMASGGGYFRKPRENQSARDQDGHGTHTASTAAGSHVPNASLLGYARG  243

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+A  AR+A YK CW   C  +DIL+GMD+A++DGV VLSLS+G     G + PY  
Sbjct  244   IARGMAPQARVAAYKTCWPTGCFGSDILAGMDRAISDGVDVLSLSLG-----GGSAPYYR  298

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAF A++KGV VSC AGNSGP+  +  N+APWI+TVGA T+DR+FPA V LGNG+
Sbjct  299   DTIAIGAFAAMEKGVFVSCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGK  358

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
              FTG SLY G       V++VY + +N  S  CLPG LD + VRGK+V C +  N   V+
Sbjct  359   RFTGVSLYSGQGMGNKAVALVYNKGSNTSSNMCLPGSLDPAVVRGKVVVCDRGINAR-VE  417

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  V+ +GG+GMI++N    G ELVA++ ++P   V    GD+I  YV++  + TA + 
Sbjct  418   KGGVVRDAGGIGMILANTAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLS  477

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT+    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAW+ +I P+    D R
Sbjct  478   FGGTILNVRPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKR  536

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             +T+FNIMSGTSM+CPH+SGLAA+L+  +P WSP+AIKSALMTT YT DN+  S+L D   
Sbjct  537   KTQFNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNT-NSSLRDAAG  595

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S P AHG+GHVDP  A  PGL+YD   NDY+ FLC++ Y    +   ++ S +  C 
Sbjct  596   GGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYIAFLCSLDYGIDHVQAIVKRSNIT-C-  653

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
             +R   +PG LNYPSF+VVF +  + + Y R V NVG   +V Y V    PS V+VTV P+
Sbjct  654   SRKFADPGQLNYPSFSVVFGSK-RVVRYTRIVTNVGAAGSV-YDVATTAPSVVKVTVKPS  711

Query  1981  RLVFTDRIDTLSYEVTFQSLRQSADS----FGSLRWSDGTHLVTSPIAVSW  2121
             +LVFT   +   Y VTF + R +A +    FGS+ WS+  H V SP++ +W
Sbjct  712   KLVFTKVGERKRYTVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAW  762



>gb|EMT11726.1| Subtilisin-like protease [Aegilops tauschii]
Length=781

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/725 (48%), Positives = 470/725 (65%), Gaps = 22/725 (3%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             P+   S +  +LY+Y H A GF+A+LT  QA++LA+   V++V+PD + +L TT +P FL
Sbjct  68    PVELSSPAPRVLYSYAHAATGFAAQLTGRQAAQLASSGSVLAVVPDVMQQLHTTLTPSFL  127

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPE-RSSFS-DRGLNPIPNSWRNKCEVGPQFP  357
             GL S SS L   S+   D+IIGV+D+G++PE R SF+ D  L P P+ +R +C  GP F 
Sbjct  128   GL-SPSSRLLKVSNGATDVIIGVIDTGVYPEGRKSFAADPSLPPPPSKFRGRCVSGPSFN  186

Query  358   ATS-CNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvng  534
             A++ CN K++GA+ ++ G EA  GR + ++  S +D  GHGTH +S A GS  A+A    
Sbjct  187   ASALCNNKLVGAKFFHMGLEAARGRALGEDSLSPLDTNGHGTHTSSTAGGSPAADAGFFD  246

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G+A G+A  ARIAVYK CW   C+++DIL+  D+A+ D V V+S+S+G     G A 
Sbjct  247   YAGGKAVGMAPGARIAVYKACWDEGCASSDILAAFDEAITDRVDVISVSLG---DTGLAD  303

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              +  D  A+GAF AV KG++VS  AGNSGP   TA+NIAPW LTVGAST++R FP  V L
Sbjct  304   NFYSDTTAVGAFRAVNKGIVVSASAGNSGPGDSTAVNIAPWFLTVGASTLNRRFPGDVIL  363

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             GNG TFTGT+LY G      ++ +VYG    S+ C  G+L  +KV GKIV+C +L     
Sbjct  364   GNGETFTGTTLYAGEPLGATKLPLVYGGDVGSKVCEEGKLKPTKVAGKIVFC-ELGVTAQ  422

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
               +G AVK +GG G I++  +  G +++ +  + P   V  A  + I  Y++   S TA 
Sbjct  423   AAKGQAVKLAGGAGAILTGAKEDGEQVITSPHVHPATDVPFAAAEKIKKYIRTQTSPTAT  482

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             IVFRGTV G++P +PR+A+FSSRGPNF  PEILKPDV APGV+ILAAWTGA +PSE   D
Sbjct  483   IVFRGTVVGSTPPSPRMASFSSRGPNFRAPEILKPDVTAPGVDILAAWTGANSPSELDFD  542

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR ++NI+SGTSM+CPHVSG+ A+LR+  P WSPAAIKSALMTT   +DN+G   + D+
Sbjct  543   TRRVKYNIISGTSMSCPHVSGIVALLRQARPEWSPAAIKSALMTTAQNVDNAG-GVIGDM  601

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              TG  STP A G+GH+DP +A DPGLVYD G  DY+ FLC +GY ++++A+F  ++    
Sbjct  602   STGEASTPFARGAGHIDPNSAVDPGLVYDAGTEDYITFLCALGYTAKQVAVFGSST---S  658

Query  1795  CRNRNLGNPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
             C      + G  NYP+F+VVF +N +   +T +R V+NVG      Y+V +  P  V VT
Sbjct  659   CSTHAGSSVGDHNYPAFSVVFTSNKKKAVVTQRRVVRNVGSDATTTYRVKITAPDGVLVT  718

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQSADS------FGSLRWSDGTHLVTSPIAVSWEGR  2130
             VSP  L F+    T  Y VTF   R+   S      FGS+ WSDG H VTSPIAV+W   
Sbjct  719   VSPETLRFSATQKTQGYVVTFA--REIGGSVTEKYTFGSIEWSDGEHTVTSPIAVTWPTN  776

Query  2131  SVSEL  2145
              V E+
Sbjct  777   QVEEM  781



>gb|EPS65791.1| hypothetical protein M569_08985, partial [Genlisea aurea]
Length=743

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/730 (48%), Positives = 473/730 (65%), Gaps = 37/730 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY    HGFSARLTP +A  +   PG++SV P+   EL TTR+P F
Sbjct  27    SSLRSVSESAEMLYTYSSALHGFSARLTPEEAIAMEARPGILSVHPETRYELHTTRTPLF  86

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P S+ G ++I+GVLD+G+WPE  SF+D G  P+P  W+ +CEVG  F A
Sbjct  87    LGLDRNAAML-PESESGNEVIVGVLDTGVWPESPSFADAGFGPVPAYWKGECEVGTNFSA  145

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvn  531
             +SCN+K+IGAR + RGYEA  G   VDE K   S  D  GHGTH +S AAGSAVA A++ 
Sbjct  146   SSCNKKLIGARFFARGYEATLGP--VDESKESRSPRDNDGHGTHTSSTAAGSAVAGASLF  203

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G+A G ARG+A  AR+A YKVCW+G C ++DIL+ MD+A+ D V+VLS+S+G     G  
Sbjct  204   GYAAGTARGMAPRARVAAYKVCWVGGCFSSDILAAMDKAIDDNVNVLSMSLG-----GGV  258

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y  D +AIGAF A++KG++VSC AGN+GP   +  N+APWI TVGA T+DR+FP+ V+
Sbjct  259   SDYYRDTVAIGAFAAMEKGILVSCSAGNAGPTASSLSNVAPWITTVGAGTLDRDFPSYVS  318

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQL  1059
             LGNG+ F+G SLY G       +  VY   A++      C+ G L   KV+ KIV C + 
Sbjct  319   LGNGKNFSGVSLYKGNSLPDKLLPFVYASAASNATSGNLCMTGTLIPEKVKDKIVLCDRG  378

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N   V +G  V+ +GG GMI++N    G ELVA+A ++P   V+ A G  + +Y+ +  
Sbjct  379   VNPR-VQKGAVVRAAGGAGMIMANTAANGAELVADAHLLPATAVSEASGQEMKNYLSSDS  437

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             + TA I+F GT  G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILA W+GA+ P+
Sbjct  438   NPTATILFEGTKVGIEPS-PVVAAFSSRGPNSITPGILKPDLIAPGVNILAGWSGAVGPT  496

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
               ++D+RR  FNI+SGTSM+CPHVSGLAA+++   P+WSPAAI+SALMTT+YT+  +G  
Sbjct  497   GLSEDSRRVNFNIISGTSMSCPHVSGLAALIKSARPNWSPAAIRSALMTTSYTVYKNGEP  556

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              + D+ TG PSTP  HG+GH DP +A DPGLVYD G +DY++FLC + Y   +I    R 
Sbjct  557   -IQDVATGKPSTPFDHGAGHADPVSALDPGLVYDIGTDDYLNFLCALNYTGSQINTVARR  615

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-------------ITYKRTVKNVGKVKN  1920
             +   D       +   LNYPSFAV   + +               + Y+RT+ NVG    
Sbjct  616   NYTCDAAAGTY-SVNDLNYPSFAVALDSPVTAPGGGSDAEKKPTVVKYRRTLTNVGIPGT  674

Query  1921  VAYQVTVQTPSN-VRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTH  2091
               Y+V++  P+  V+VTV P  L F+   +  SY  TF  + +  + + FG + WSDG H
Sbjct  675   --YRVSINLPTTAVKVTVEPPSLTFSQTDEKQSYTATFAAEPMPSNTNLFGRIEWSDGKH  732

Query  2092  LVTSPIAVSW  2121
             +V SP+A+SW
Sbjct  733   VVGSPVAISW  742



>ref|XP_007155854.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
 gb|ESW27848.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
Length=794

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/718 (48%), Positives = 470/718 (65%), Gaps = 25/718 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S++++YTY++  HG++ RLTP +A  L +  G+++VLP+   EL TTR+PQF
Sbjct  90    SSLKSVSNSAQMIYTYDNAIHGYATRLTPEEARLLESQTGILAVLPEMRYELHTTRTPQF  149

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+++ P S+  +D+++GVLD+G+WPE  SF D GL P+P+SW+ +CE G  F  
Sbjct  150   LGL-DKSADMFPESNSASDVVVGVLDTGVWPESKSFDDTGLGPVPSSWKGECETGTNFST  208

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +G EA+ G PI   +E +S  D  GHGTH AS AAGS V+ A++ G
Sbjct  209   SNCNRKLIGARFFAKGCEAMLG-PINETEESRSPRDDDGHGTHTASTAAGSVVSGASLFG  267

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT ARIA YKVCW G C ++DIL+ ++ A+ D V+VLSLS+G     G   
Sbjct  268   YASGTARGMATRARIAAYKVCWKGGCFSSDILAAIESAIQDNVNVLSLSLG-----GGMA  322

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V+L
Sbjct  323   DYYRDSVAIGAFSAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSL  382

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG  F+G SLY G     + +  VY   A    N   C+ G L   KV GKIV C +  
Sbjct  383   GNGLNFSGVSLYRGNALPDSPLPFVYAGNASNATNGNLCVTGTLSPEKVAGKIVLCDR-G  441

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
                 V +G  VK +G +GM++SN    G ELVA+A ++P + V    GD I  Y+     
Sbjct  442   LTARVQKGSVVKSAGALGMVLSNTAANGEELVADAHLLPASAVGEKAGDAIKKYLFTEAK  501

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W+ A+ P+ 
Sbjct  502   PTVSILFEGTKVGIQPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTG  560

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                DNRR +FNI+SGTSM+CPHVSGLAA+++ ++P WSPAA++SALMTT YT+  +G + 
Sbjct  561   LPVDNRRVDFNIISGTSMSCPHVSGLAALIKSVHPEWSPAAVRSALMTTAYTVYKTG-AK  619

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D  TG PSTP  HG+GHVDP  A +PGLVYD  V+DY+ FLC + Y + +I    +  
Sbjct  620   LQDSATGKPSTPFDHGAGHVDPVTALNPGLVYDLTVDDYLGFLCALNYSASEINTLAKRK  679

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQT--ITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
                +C      +   LNYPSFAV+F++   +  + + RT+ NVG        VT  T S 
Sbjct  680   --FECNAGKQYSVNDLNYPSFAVLFESGSGSGVVKHSRTLTNVGPAGTYKASVTSDTAS-  736

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSW  2121
             V+++V P  +   +  +  S+ VTF S   + D   +FG L WSDG H+V +PI+++W
Sbjct  737   VKISVDPQVVTLKEN-EKKSFVVTFSSSASAQDKVNAFGRLEWSDGKHVVATPISINW  793



>ref|XP_002301156.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
 gb|EEE80429.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
Length=779

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/725 (49%), Positives = 467/725 (64%), Gaps = 31/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY ++ HGFS +LTP +A  L    G++SVLP+ + +L TT +P+F
Sbjct  67    SSLKSVSESADMLYTYNNIIHGFSTQLTPDEAELLEKQSGILSVLPEMIYKLHTTHTPEF  126

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL    + L P+S   +++I+GVLD+G+WPE  SF D GL PIP++W+  C+VG  F +
Sbjct  127   LGLGKSDAVLLPASASLSEVIVGVLDTGVWPEIKSFGDTGLGPIPSTWKGSCQVGKNFNS  186

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGA+ + +GYEA  G PI +  E KS  D  GHGTH A+ AAGSAV+ A++ G
Sbjct  187   SSCNRKLIGAQYFSKGYEAAFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFG  245

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCWLG C ++DIL+ M++AVADGV+V+S+SIG     G   
Sbjct  246   YASGIARGMATEARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVMSMSIG-----GGLS  300

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A  +G++VSC AGN GP P +  N+APWI TVGA T+DR+FPA V+L
Sbjct  301   DYTRDTVAIGAFRAAAQGILVSCSAGNGGPSPGSLSNVAPWITTVGAGTLDRDFPAFVSL  360

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLA  1062
             G+G+ ++G SLY G   S + V +VY G  +NS     C+ G L  ++V GKIV C +  
Sbjct  361   GDGKKYSGISLYSGKPLSDSLVPLVYAGNVSNSTSGSLCMTGTLIPAQVAGKIVICDRGG  420

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V +G  VK SGG+GMI++N    G ELVA+A ++PTA V     + I +Y      
Sbjct  421   N-SRVQKGLVVKDSGGLGMILANTELYGEELVADAHLLPTAAVGLRTANAIKNYAFLDPK  479

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
                 I   GT  G  PS P VAAFSSRGPN +TPE+LKPD+IAPGVNILA WTG   P+ 
Sbjct  480   PMGTIASGGTKLGVEPS-PVVAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGGAGPTG  538

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T D R  EFNI+SGTSM+CPHVSGLAA+++  +  WSPAAIKSALMTT Y    +G + 
Sbjct  539   LTNDKRHVEFNIISGTSMSCPHVSGLAALIKAAHQDWSPAAIKSALMTTAYATYKNGEN-  597

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D+ TG PSTP  +G+GHV+P  A DPGLVYD  V+DY+ F C + Y +  I       
Sbjct  598   LLDVATGQPSTPFDYGAGHVNPVAALDPGLVYDATVDDYISFFCALNYSASDIKQITTKD  657

Query  1783  PLVDCRNR-NLGNPGALNYPSFAVVFKNN---------LQTITYKRTVKNVGKVKNVAYQ  1932
              + D   + +LG+   LNYPSF+V  +             T+ Y RT+ NVG        
Sbjct  658   FICDSSKKYSLGD---LNYPSFSVPLQTASGKEGGDGVKSTVKYTRTLTNVGAPATYKVS  714

Query  1933  VTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             +T QT S V++ V P  L F    +  SY VTF   S+    +SF  L WSDG H+V SP
Sbjct  715   MTSQTTS-VKMLVEPESLSFAKEYEKKSYTVTFTATSMPSGTNSFAHLEWSDGKHVVRSP  773

Query  2107  IAVSW  2121
             IA SW
Sbjct  774   IAFSW  778



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/715 (49%), Positives = 454/715 (63%), Gaps = 24/715 (3%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             L + S ++E+LY Y+ VAHGFSARLTP++A  +   PGV+ V+ +   EL TTR+P+FLG
Sbjct  56    LRSVSDTAEILYAYDTVAHGFSARLTPAEARAMERRPGVLGVMAEARYELHTTRTPEFLG  115

Query  187   LISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT-  363
             L   +    P S+  +D+++GVLD+G+WPER S+ D GL P+P SW+  CE G  F A  
Sbjct  116   L-DRTEGFIPQSNTTSDVVVGVLDTGVWPERKSYDDAGLGPVPASWKGACEEGKDFKAAN  174

Query  364   SCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvngh  537
             +CNRK++GAR + +GYEA  G PI    E +S  D  GHGTH +S  AGSAV + +  G+
Sbjct  175   ACNRKLVGARFFSKGYEARMG-PINLTKESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGY  233

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG++T ARIAVYKVCWLG C  +DIL+ MD+A+ DG  VLSLS+G     G    
Sbjct  234   AAGTARGMSTRARIAVYKVCWLGGCFGSDILAAMDKAIEDGCGVLSLSLG-----GGMSD  288

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IA+GAF A+  GV+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V L 
Sbjct  289   YYRDNIAVGAFSAMAMGVVVSCSAGNAGPGASTLSNVAPWITTVGAGTLDRDFPANVLLS  348

Query  898   NGRTFTGTSLYFGIQPSPNQ-VSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             NG+ +TG SLY G +P P+  +  +Y   A    N   C+ G L   KV GKIV C +  
Sbjct  349   NGKNYTGVSLYSG-KPLPSSPLPFIYAGNATNTTNGNLCITGTLLPDKVAGKIVLCDRGI  407

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  V+ +GG GMI++N    G ELVA+A ++P   V    GD I  Y+ +  +
Sbjct  408   NAR-VQKGLVVRDAGGAGMILANTAANGEELVADAHLLPATAVGEIAGDAIKSYLFSDPN  466

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA I FRGT  G  PS P VAAFSSRGP+ +TP+ILKPD+IAPGVNILAAWTG++ P+ 
Sbjct  467   PTATIAFRGTKVGVKPS-PVVAAFSSRGPSAITPDILKPDLIAPGVNILAAWTGSVGPTG  525

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RRTEFNI+SGTSM+CPHVSGL A+L+  +P WSP AIKSALMTT Y     G   
Sbjct  526   QAVDPRRTEFNIISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALMTTAYAA-YPGDGG  584

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             ++D+ TG  +TP   G+GHVDP  A DPGLVY+    DY+DFLC + Y   +IA   R +
Sbjct  585   ILDVATGRAATPFDFGAGHVDPPKALDPGLVYNLTNEDYLDFLCALNYTPLQIARLSRLT  644

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                 C  +       LNYPSFAV F     T+ + RT+ NVG      Y+ TV  P +V+
Sbjct  645   NYT-CDRQKAYEVSDLNYPSFAVAFATASTTVKHTRTLTNVGAPGT--YKATVSAPEDVK  701

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS--FGSLRWSDGTHLVTSPIAVSW  2121
             V V P  L F    +  +Y VTF +  Q + S  FG L WSD  H+V SP+A SW
Sbjct  702   VVVEPTALTFAALGEKKNYTVTFSTASQPSGSTAFGRLEWSDAQHVVASPLAFSW  756



>gb|KHN10472.1| Subtilisin-like protease [Glycine soja]
Length=711

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/720 (48%), Positives = 464/720 (64%), Gaps = 29/720 (4%)
 Frame = +1

Query  7     LSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLG  186
             + N  R   ++YTY++  HG +A+LT  +A +L    GV+++ P++  EL TTRSP FLG
Sbjct  1     MDNEER---IIYTYQNAFHGVAAKLTEEEAEKLEAEEGVVTIFPEKKYELHTTRSPTFLG  57

Query  187   LI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPAT  363
             L    S+N+      G D+I+GVLD+GIWPE  SF D GL P+P+ W+  CE+G  F  +
Sbjct  58    LEPEKSTNMWSEKLAGHDVIVGVLDTGIWPESESFKDVGLRPVPSHWKGTCEIGTGFTNS  117

Query  364   SCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngha  540
              CN+K++GAR +Y GYEA  GR     E KS  D  GHGTH A+   GS V  AN+ G+A
Sbjct  118   HCNKKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYA  177

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A   RIA YKVCW+G C ++DI+S +D+AVADGV+VLS+S+G     G    Y
Sbjct  178   NGTARGMAPGTRIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLG-----GGVSSY  232

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D +++ AFGA+++GV VSC AGNSGPDP +  N++PWI TVGAST+DR+FP+ V LGN
Sbjct  233   YRDSLSVAAFGAMERGVFVSCSAGNSGPDPASLTNVSPWITTVGASTMDRDFPSDVKLGN  292

Query  901   GRTFTGTSLYFG--IQPSPNQVSMVYGRRANSR-----YCLPGQLDASKVRGKIVYCKQL  1059
             G+   G SLY G  +     Q  +VY    +SR      CL G LD   V GKIV C + 
Sbjct  293   GKKIIGVSLYKGKNVLSIKKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRG  352

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              +  ++ +G  V+ +GGVGMI++N    G ELVA++ ++P   +   +G  +  YV ++K
Sbjct  353   LSPRVL-KGHVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSK  411

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             +ATA + F+GT+ G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+ AI PS
Sbjct  412   TATAALAFKGTILGIKPS-PVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPS  470

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 DNRR +FNI+SGTSM+CPHVSG+AA+++  +P WSPAAIKSALMTT+Y LDN+ + 
Sbjct  471   GLKIDNRRVKFNIVSGTSMSCPHVSGVAALVKSRHPEWSPAAIKSALMTTSYVLDNT-KK  529

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
             TL D  T  PS+P+ HG+GH+DP  A DPGLVYD    DY +FLCT      ++ +F + 
Sbjct  530   TLRDSSTAKPSSPYDHGAGHIDPIRALDPGLVYDMVPQDYFEFLCTQNLTPTQLKVFAKY  589

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----ITYKRTVKNVGKVKNVAYQVTVQ  1944
             S    CR+ +L + G LNYP+ + VF     T     +   R V NVG   +  Y V V 
Sbjct  590   SNR-SCRH-SLASSGDLNYPAISSVFTQKTTTSFPSPVILHRIVTNVGP-PDSKYHVVVS  646

Query  1945  TPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
                   + V P  L FT +   LSY++TF+  +RQ++  FGSL W DG H V SPI ++W
Sbjct  647   PFKGASIKVEPETLNFTRKHQKLSYKITFKPKVRQTSPEFGSLVWKDGFHTVRSPIVITW  706



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/710 (50%), Positives = 460/710 (65%), Gaps = 26/710 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGL-ISGSSN  207
              +LY+Y+   HG +A+L+  +  +L    GV++V P+   +L TTRSP FLGL    SS 
Sbjct  75    RILYSYQTAFHGVAAQLSEEEVKKLQERNGVLAVFPEIKYQLHTTRSPLFLGLDREDSSK  134

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             L        ++I+GVLD+GIWPE  SF+D G+  +P+ W+  CE G  F    C++KI+G
Sbjct  135   LWADRLSDHNVIVGVLDTGIWPESPSFNDSGMTSVPSHWKGVCETGRGFEKHHCSKKIVG  194

Query  388   ARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             AR ++RGYEA +G+     E KSA D  GHGTH A   AGS V  AN+ G+A G ARG+A
Sbjct  195   ARVFFRGYEAASGKINERGEFKSARDQDGHGTHTAGTVAGSVVRGANLLGYAYGTARGMA  254

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               AR+A YKVCW+G C ++DILS +DQAVADGV++LS+S+G     G    YN D ++I 
Sbjct  255   PGARVAAYKVCWVGGCFSSDILSAVDQAVADGVNILSISLG-----GGVSSYNRDSLSIA  309

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             AFGA++KGV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG G+  TG S
Sbjct  310   AFGAMEKGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVELGTGKIVTGAS  369

Query  925   LYFGIQ--PSPNQVSMVY-GRRAN----SRYCLPGQLDASKVRGKIVYCKQLANITIVDQ  1083
             LY G     +  Q  ++Y G  ++    S  CL G LD + V GKIV C +  +   V +
Sbjct  370   LYKGRMNLSTQKQYPLIYLGSNSSNLMPSSLCLDGTLDKASVAGKIVICDRGISPR-VQK  428

Query  1084  GFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVF  1263
             G  VK++GGVGMI++N    G ELVA++ ++P   V   +G  I  Y    +SATA + F
Sbjct  429   GQVVKEAGGVGMILTNTAANGEELVADSHLLPAVAVGEREGRAIKLYAAG-RSATATLRF  487

Query  1264  RGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRR  1443
              GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILA WTGA+ PS    D RR
Sbjct  488   LGTKLGIRPS-PVVAAFSSRGPNFLSLEILKPDMVAPGVNILAGWTGALGPSSLPIDQRR  546

Query  1444  TEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTG  1623
             T FNI+SGTSM+CPHVSG+AA+L+  +P WSPAAIKSALMTT Y  DN+ +S L D  + 
Sbjct  547   TNFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTYKS-LKDASSV  605

Query  1624  YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRN  1803
              PSTP+ HG+GHV+P  A DPGL+YD G  DY +FLCT      ++ +F + S    C +
Sbjct  606   TPSTPYDHGAGHVNPRKAVDPGLIYDIGAQDYFEFLCTQELSPSQLMVFGKFSNRT-C-H  663

Query  1804  RNLGNPGALNYPSFAVVF--KNNLQTITYKRTVKNVGK-VKNVAYQVTVQTPSNVRVTVS  1974
              +L NPG LNYP+ + VF  K  L  +T  RTV NVG  + N  Y V V       V V 
Sbjct  664   HSLANPGDLNYPAISAVFPEKTKLSMLTLHRTVTNVGSPISN--YHVVVSAFKGAVVKVE  721

Query  1975  PNRLVFTDRIDTLSYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             P RL FT +   LSY+VTF+++ RQ A  FGSL W DGTH V SPIA++W
Sbjct  722   PERLNFTSKNQKLSYKVTFKTVSRQKAPEFGSLIWKDGTHKVRSPIAITW  771



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/711 (49%), Positives = 461/711 (65%), Gaps = 32/711 (5%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG-------  198
             YTY    HGF+A L   +   L     V+ V  D +  L TTR+P FLGL S        
Sbjct  65    YTYTSSFHGFAAFLDSQEVELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGH  124

Query  199   -SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
              + +L  +S    D+IIGVLD+GIWPE  SF D G+  IP+ WR +CE GP F  + CN+
Sbjct  125   TTQDLNQASH---DVIIGVLDTGIWPESKSFDDTGMPEIPSRWRGECEAGPDFSPSLCNK  181

Query  376   KIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvnghaRG  546
             K+IGAR++ +GY+  +G     +P+   SA D  GHGTH AS AAGS VANA++ G+ARG
Sbjct  182   KLIGARSFSKGYQMASGGGYFRKPRENESARDQDGHGTHTASTAAGSHVANASLLGYARG  241

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+A  AR+A YK CW   C  +DIL+GMD+A+ DGV VLSLS+G     G + PY  
Sbjct  242   IARGMAPQARVAAYKTCWPTGCFGSDILAGMDRAIMDGVDVLSLSLG-----GGSAPYYR  296

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAF A++KGV VSC AGNSGP+  +  N+APWI+TVGA T+DR+FPA V LGNG+
Sbjct  297   DTIAIGAFAAMEKGVFVSCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGK  356

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
              FTG SLY G       V++VY + +N  S  CLPG L+ + VRGK+V C +  N   V+
Sbjct  357   RFTGVSLYSGQGMGNKAVALVYNKGSNTSSNMCLPGSLEPAVVRGKVVVCDRGINAR-VE  415

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  V+ +GG+GMI++N    G ELVA++ ++P   V    GD+I  YV++  + TA + 
Sbjct  416   KGGVVRDAGGIGMILANTAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLS  475

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT+    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAW+ +I P+    D R
Sbjct  476   FGGTILNVRPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKR  534

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             +T+FNIMSGTSM+CPH+SGLAA+L+  +P WSP+AIKSALMTT YT DN+  S+L D   
Sbjct  535   KTQFNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNT-NSSLRDAAG  593

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S P AHG+GHVDP  A  PGL+YD   NDYV FLC++ Y    +   ++ S +  C 
Sbjct  594   GGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNIT-C-  651

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
             +R   +PG LNYPSF+VVF +  + + Y R V NVG   +V Y V    P  V+VTV P+
Sbjct  652   SRKFADPGQLNYPSFSVVFGSK-RVVRYTRIVTNVGAAGSV-YDVATTAPPVVKVTVKPS  709

Query  1981  RLVFTDRIDTLSYEVTFQSLRQSADS----FGSLRWSDGTHLVTSPIAVSW  2121
             +LVFT   +   Y VTF + R +A +    FGS+ WS+  H V SP++ +W
Sbjct  710   KLVFTKVGERKRYTVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAW  760



>ref|XP_010443674.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
 ref|XP_010443682.1| PREDICTED: subtilisin-like protease isoform X3 [Camelina sativa]
Length=779

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/713 (49%), Positives = 460/713 (65%), Gaps = 26/713 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGS  201
             S  +LYTY+   HG +A+LT  +A +L    GV++V+P+   EL TTRSP FLGL    S
Sbjct  75    SDRILYTYQTAFHGLAAQLTEEEAEKLEEEDGVVAVIPETRYELHTTRSPTFLGLERQES  134

Query  202   SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKI  381
               +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI
Sbjct  135   ERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKI  194

Query  382   IGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +GAR +YRGYEA TG+  +DE    KS  D  GHGTH A+  AGS V  AN+ G A G A
Sbjct  195   VGARVFYRGYEAATGK--IDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTA  252

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             RG++  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D 
Sbjct  253   RGMSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGISTYSRDS  307

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             ++I  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG  RTF
Sbjct  308   LSIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTF  367

Query  913   TGTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANIT  1071
              G SLY G  +     Q  ++Y GR A+S     +CL G LD   V GKIV C +  +  
Sbjct  368   KGVSLYKGRAVLSKNKQYPLIYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPR  427

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V +G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y   ++ ATA
Sbjct  428   -VQKGQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATA  486

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + 
Sbjct  487   TLEVLGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSS  545

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN+ +  L D
Sbjct  546   DPRRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKP-LTD  604

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                  PS+P+ HG+GH+DP  A DPG VYD G  DY +FLCT      ++ +F ++S   
Sbjct  605   ASGAAPSSPYDHGAGHIDPLKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNR-  663

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
              C++    NPG LNYP+ + +F  N  ++++T +RTV NVG     +Y+V+V       V
Sbjct  664   SCKHTLAKNPGNLNYPAISALFPENTRVKSMTLRRTVTNVGP-HIASYKVSVSPFKGASV  722

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             TV P  L FT +   LSY VTF + +R     FG L W   TH V SP+ ++W
Sbjct  723   TVLPKTLNFTTKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_006587373.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/722 (48%), Positives = 465/722 (64%), Gaps = 26/722 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             SP ++      ++YTY++  HG +A+LT  +A +L    GV+++ P++  EL TTRSP F
Sbjct  66    SPEADMDNEERIIYTYQNAFHGVAAKLTEEEAEKLEAEEGVVTIFPEKKYELHTTRSPTF  125

Query  181   LGLI-SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL    S+N+      G D+I+GVLD+GIWPE  SF D GL P+P+ W+  CE+G  F 
Sbjct  126   LGLEPEKSTNMWSEKLAGHDVIVGVLDTGIWPESESFKDVGLRPVPSHWKGTCEIGTGFT  185

Query  358   ATSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvng  534
              + CN+K++GAR +Y GYEA  GR     E KS  D  GHGTH A+   GS V  AN+ G
Sbjct  186   NSHCNKKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLG  245

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A   RIA YKVCW+G C ++DI+S +D+AVADGV+VLS+S+G     G   
Sbjct  246   YANGTARGMAPGTRIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLG-----GGVS  300

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +++ AFGA+++GV VSC AGNSGPDP +  N++PWI TVGAST+DR+FP+ V L
Sbjct  301   SYYRDSLSVAAFGAMERGVFVSCSAGNSGPDPASLTNVSPWITTVGASTMDRDFPSDVKL  360

Query  895   GNGRTFTGTSLYFG--IQPSPNQVSMVYGRRANSR-----YCLPGQLDASKVRGKIVYCK  1053
             GNG+   G SLY G  +     Q  +VY    +SR      CL G LD   V GKIV C 
Sbjct  361   GNGKKIIGVSLYKGKNVLSIKKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVICD  420

Query  1054  QLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKN  1233
             +  +  ++ +G  V+ +GGVGMI++N    G ELVA++ ++P   +   +G  +  YV +
Sbjct  421   RGLSPRVL-KGHVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLS  479

Query  1234  TKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIA  1413
             +K+ATA + F+GT+ G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+ AI 
Sbjct  480   SKTATAALAFKGTILGIKPS-PVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIG  538

Query  1414  PSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSG  1593
             PS    DNRR +FNI+SGTSM+CPHVSG+AA+++  +P WSPAAIKSALMTT+Y LDN+ 
Sbjct  539   PSGLKIDNRRVKFNIVSGTSMSCPHVSGVAALVKSRHPEWSPAAIKSALMTTSYVLDNT-  597

Query  1594  RSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFL  1773
             + TL D  T  PS+P+ HG+GH+DP  A DPGLVYD    DY +FLCT      ++ +F 
Sbjct  598   KKTLRDSSTAKPSSPYDHGAGHIDPIRALDPGLVYDMVPQDYFEFLCTQNLTPTQLKVFA  657

Query  1774  RNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----ITYKRTVKNVGKVKNVAYQVT  1938
             + S    CR+ +L + G LNYP+ + VF     T     +   R V NVG   +  Y V 
Sbjct  658   KYSNR-SCRH-SLASSGDLNYPAISSVFTQKTTTSFPSPVILHRIVTNVGP-PDSKYHVV  714

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ-SLRQSADSFGSLRWSDGTHLVTSPIAV  2115
             V       + V P  L FT +   LSY++TF+  +RQ++  FG+L W DG H V SPI +
Sbjct  715   VSPFKGASIKVEPETLNFTRKHQKLSYKITFKPKVRQTSPEFGTLVWKDGFHTVRSPIVI  774

Query  2116  SW  2121
             +W
Sbjct  775   TW  776



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/717 (48%), Positives = 470/717 (66%), Gaps = 30/717 (4%)
 Frame = +1

Query  13    NHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
             N + + +LLY YE    GF+A+L+ +Q   L  V G +  +PD L+ L TT +PQFLGL 
Sbjct  64    NKTPTPQLLYIYETAISGFAAKLSTNQLKSLNQVDGFLFAIPDELLSLHTTHTPQFLGLQ  123

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCN  372
             +G   L  +S+  +D+I+G++D+GIWPE  SF D G++P+P+ W+  CE G +F  ++CN
Sbjct  124   NGK-GLWSASNSASDVIVGLVDTGIWPEHVSFQDSGMSPVPSRWKGTCEEGTKFSFSNCN  182

Query  373   RKIIGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaR  543
             +K+IGARA+ +GYEA+ GR  V+E    +S  D  GHGTH AS AAG+ V  A++ G A+
Sbjct  183   KKLIGARAFVQGYEAIVGR--VNETVDYRSPRDSNGHGTHTASTAAGNFVNQASLFGLAK  240

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G A G+   ARIA YK CW   C+N+D+++ +D AVADGV +LSLS+G     G +KPY 
Sbjct  241   GSASGMKYTARIAAYKACWTSGCANSDVMAAIDSAVADGVDILSLSLG-----GVSKPYY  295

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
             +D IAI +FGA+Q GV VSC AGNSGP   +  N APWI+TV AS  DR FP  V LG+G
Sbjct  296   KDNIAIASFGAIQHGVSVSCSAGNSGPSRSSVSNAAPWIMTVAASYSDRSFPTAVKLGDG  355

Query  904   RTFTGTSLYFGIQPSPNQVSMVYGRRANSR---YCLPGQLDASKVRGKIVYCKQLANITI  1074
             + F G+SLY G +    ++ +VY R A S+   YC  G L    V+GKIV C++    + 
Sbjct  356   QIFEGSSLYSGKKT--KRLPLVYNRTAGSQGAEYCFEGSLVKKLVKGKIVVCEE-GIYSR  412

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
              + G  VK++GG GM++ N   +G EL+A+A ++P   + A+    I  YV + K  +A 
Sbjct  413   TEVGDKVKKAGGAGMLLLNSEDEGEELLADAHILPATSLGASAAKAIRKYVGSAKKPSAL  472

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             IVF+GTV GN+  AP +AA SSRGPN   P+++KPDV APGV+ILAAW   I+PS    D
Sbjct  473   IVFQGTVYGNT--APVMAALSSRGPNSAGPDVIKPDVTAPGVDILAAWPPNISPSMLESD  530

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
             NR   FNI+SGTSM+CPHVSGLA++L+ ++  WSPAAIKSALMTT YTL+N G + + D+
Sbjct  531   NRSVLFNIISGTSMSCPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKG-APIADI  589

Query  1615  ---YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
                 T   +TP A GSGHVDP NAADPGLVYD    DY+ +LC++ Y+S +IALF     
Sbjct  590   GSTSTSKSATPFAFGSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVN  649

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                C    +  PG LNYPSF+V+F  + +  ++TYKRTVKNVGK+ +  Y V V+ P+ V
Sbjct  650   FT-CPKNAVLQPGDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPST-YAVQVKEPTGV  707

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA---DSFGSLRWSDGTHLVTSPIAVSW  2121
              VTV P  L F    + LSY+V+F +L   A    SFG+L W  G + V SPIAV+W
Sbjct  708   SVTVEPRSLGFKKMGEKLSYKVSFVALGGPALTNSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_006579930.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006579931.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006579932.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
Length=755

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/717 (48%), Positives = 464/717 (65%), Gaps = 25/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L   S S+E++YTY++  HG++ RLT  +A  L    G+++VLP+   EL TTR+P F
Sbjct  53    SSLKTVSDSAEIMYTYDNAIHGYATRLTAEEARLLETQAGILAVLPETRYELHTTRTPMF  112

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+++ P S  G+D+IIGVLD+G+WPE  SF D GL P+P++W+  CE G  F A
Sbjct  113   LGL-DKSADMFPESSSGSDVIIGVLDTGVWPESKSFDDTGLGPVPSTWKGACETGTNFTA  171

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +G EA+ G PI   +E +SA D  GHGTH AS AAGS V++A++ G
Sbjct  172   SNCNRKLIGARFFSKGVEAILG-PINETEESRSARDDDGHGTHTASTAAGSVVSDASLFG  230

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCW G C ++DIL+ +++A+ D V+VLSLS+G     G   
Sbjct  231   YASGTARGMATRARVAAYKVCWKGGCFSSDILAAIERAILDNVNVLSLSLG-----GGMS  285

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++ G++VSC AGN+GP PY+  N+APWI TVGA T+DR+FPA V L
Sbjct  286   DYYRDSVAIGAFSAMENGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVAL  345

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA-----NSRYCLPGQLDASKVRGKIVYCKQL  1059
             GNG  F+G SLY G     + +  VY         N   C+ G L   KV GKIV C + 
Sbjct  346   GNGLNFSGVSLYRGNAVPDSPLPFVYAGNVSNGAMNGNLCITGTLSPEKVAGKIVLCDR-  404

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
                  V +G  VK +G +GM++SN    G ELVA+A ++P   V    GD I  Y+ +  
Sbjct  405   GLTARVQKGSVVKSAGALGMVLSNTAANGEELVADAHLLPATAVGQKAGDAIKKYLFSDA  464

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
               T +I+F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W+ A+ P+
Sbjct  465   KPTVKILFEGTKLGIQPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPT  523

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 DNRR +FNI+SGTSM+CPHVSGLAA+++  +P WSPAA++SALMTT YT+  +G  
Sbjct  524   GLPVDNRRVDFNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALMTTAYTVYKTGEK  583

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              L D  TG PSTP  HGSGHVDP  A +PGLVYD  V+DY+ FLC + Y + +I    + 
Sbjct  584   -LQDSATGKPSTPFDHGSGHVDPVAALNPGLVYDLTVDDYLGFLCALNYSASEINTLAKR  642

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                  C      +   LNYPSFAV+F++    + + RT+ NVG        VT    S V
Sbjct  643   K--FQCDAGKQYSVTDLNYPSFAVLFESG-GVVKHTRTLTNVGPAGTYKASVTSDMAS-V  698

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQSL---RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +++V P  L F +  +  S+ VTF S    +Q  ++FG + WSDG H+V +PI+++W
Sbjct  699   KISVEPQVLSFKEN-EKKSFTVTFSSSGSPQQRVNAFGRVEWSDGKHVVGTPISINW  754



>ref|XP_010688373.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=813

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/724 (49%), Positives = 473/724 (65%), Gaps = 31/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + + S+++LYTY  V HGFS RLT  +A+ L N PG +S++P+   EL TTR+P F
Sbjct  103   SSLRSAADSAQMLYTYNSVIHGFSTRLTDEEATSLENQPGTLSLVPETRYELHTTRTPAF  162

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  L P+S    D+IIG++D+G+WPE  SF D GL+P+P+SW+ +CE G  F +
Sbjct  163   LGL-GINDKLLPTSTSQGDVIIGLIDTGVWPELKSFDDMGLDPVPSSWKGECEEGTNFKS  221

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK+IGAR + +GYEA+ G PI +  E KS  D  GHGTH A+ AAGSA  +AN+ G
Sbjct  222   SNCNRKLIGARFFCKGYEAILG-PIDESTESKSPRDDDGHGTHTATTAAGSATTSANLFG  280

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A +ARIA YK CWLG C  +DIL+ M++A+ D V +LS+SIG     G   
Sbjct  281   YASGTARGMAPHARIAAYKACWLGGCFTSDILAAMEKAIDDRVDILSMSIG-----GSIS  335

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +A+GAF A++KG++VSC AGN+GPD  +  N+APWI TVGA TIDR+FPA V L
Sbjct  336   EYYRDTVAVGAFTAMKKGILVSCSAGNAGPDSGSLSNLAPWITTVGAGTIDRDFPAYVIL  395

Query  895   GNGRTFTGTSLYFGIQPSPNQV-SMVYGRRANS----RYCLPGQLDASKVRGKIVYCKQL  1059
             G+GR FTG SLY G +P P+++ S+ Y  +A++     +C+ G L++  V+GKIV C + 
Sbjct  396   GDGRNFTGASLYSG-KPLPSKLLSLTYAGKASNMTSGSFCMTGSLNSEDVKGKIVVCDRG  454

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
              N + V +G  V+++GGVGMI++N    G ELVA+A +IP A +     + I  Y+ + +
Sbjct  455   GN-SRVQKGLVVRKAGGVGMILANTEAYGEELVADAHLIPAASLGLKGAEDIKKYISSGR  513

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
               TA I F GT  G  PS P VA+FSSRGPN LTPEILKPD+IAPGVNILA WTG + P+
Sbjct  514   KPTATIGFSGTELGVQPS-PVVASFSSRGPNPLTPEILKPDLIAPGVNILAGWTGKVGPT  572

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D R   FNI+SGTSM+CPH+SGLAA+++  +P WSPAAIKSALMTT YT   +G+ 
Sbjct  573   GLDGDTRHVSFNIISGTSMSCPHLSGLAALVKASHPEWSPAAIKSALMTTAYTAYKNGK-  631

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
             T+ID+ TG PSTP  +G+GHVDP  A DPGLVYD  V DYVDFLC + Y S +I      
Sbjct  632   TIIDVATGLPSTPFDYGAGHVDPIAALDPGLVYDATVKDYVDFLCALNYSSDQIK--HTT  689

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNN--------LQTITYKRTVKNVGKVKNVAYQV  1935
             +    C +      G LNYPS AV  +          + T+ Y RT+ NVG+       V
Sbjct  690   AEEYSCSSSKTYKLGDLNYPSLAVTLETTPENQDRKAMSTMKYTRTLTNVGRPATYKASV  749

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             + +T S ++V V P  L F    +  S+ VT    S+     SF  L WSDG H VTSPI
Sbjct  750   STRTAS-LKVIVEPESLSFNTINEKKSFTVTVSADSMPSGTSSFAHLTWSDGKHTVTSPI  808

Query  2110  AVSW  2121
             A +W
Sbjct  809   AFTW  812



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/713 (49%), Positives = 460/713 (65%), Gaps = 28/713 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS  204
             +  ++Y+YE   HGF+A+LT  +A  L ++PGV +VLP+ + +L TTRSP+FLG+    +
Sbjct  82    AERIIYSYETAFHGFAAKLTEDEAEMLQSIPGVAAVLPETVYQLHTTRSPRFLGITGKRN  141

Query  205   NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKII  384
              +  ++    D+I+G+LD+GIWPE  SFSDRG+ P+P  W+  CE+G  F A +CN+KI+
Sbjct  142   RIWSAALSDHDVIVGILDTGIWPESPSFSDRGMTPVPPRWKGGCEIGRGFTAKNCNQKIV  201

Query  385   GARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             GAR +YRGYE  +G   +DE    KS  D  GHGTH A+  AG+ V  AN+ G+ARG AR
Sbjct  202   GARIFYRGYEEASG--AIDEKSEFKSPRDQDGHGTHTAATVAGAPVRGANLLGYARGTAR  259

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A  AR+AVYKVCW G C ++DIL+ +D+AVADGV VLS+S+G     G    Y  D +
Sbjct  260   GMAPRARVAVYKVCWTGGCFSSDILAAVDRAVADGVDVLSISLG-----GGVSSYYRDSL  314

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             ++ AFGA++KGV V+C AGN GPDP +  N++PWI TVGAST+DR+FPA V LGNG   T
Sbjct  315   SVAAFGAMEKGVFVACSAGNGGPDPISLTNVSPWIATVGASTMDRDFPATVRLGNGMNLT  374

Query  916   GTSLYFG---IQPSPNQVSMVYGRRANS-----RYCLPGQLDASKVRGKIVYCKQLANIT  1071
             G SLY G   + P   Q  +VY     S       CL G LD   V GKIV C +  N  
Sbjct  375   GVSLYKGRRNLSPR-RQYPLVYMGGNTSIPDQKSLCLEGTLDPHVVAGKIVICDRGINPR  433

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK-NTKSAT  1248
              V +G  VK + GVGMI++N    G ELVA++ ++P   V  A G++I  Y K  +   T
Sbjct  434   -VQKGQVVKGARGVGMILANTAANGEELVADSHLLPAVAVGEAAGNVIKQYSKIGSHPTT  492

Query  1249  ARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSEST  1428
             A + F GT  G  PS P VAAFSSRGPN LT EILKPD++APGVNILAAW+G  +PS   
Sbjct  493   ATMAFEGTKVGIRPS-PVVAAFSSRGPNILTLEILKPDIVAPGVNILAAWSGDASPSSLL  551

Query  1429  KDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLI  1608
              D+RR +FNI+SGTSM+CPHV G+AA+L+  +P WSPAAIKSALMTT YT DN+ R  L 
Sbjct  552   ADHRRVKFNILSGTSMSCPHVGGVAALLKASHPDWSPAAIKSALMTTAYTHDNTFRP-LK  610

Query  1609  DLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPL  1788
             D  TG PS P+ HG+GH+ P  A DPGL+YD   +DY +FLCT      ++ +F ++S  
Sbjct  611   DAATGAPSNPYDHGAGHIRPAKAVDPGLIYDISPDDYFEFLCTQKLTPSQLKVFTKSSNR  670

Query  1789  VDCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
               C+ R L +PG LNYP+ + VF+      +T  RTV NVG   +  Y V V     V V
Sbjct  671   T-CKQR-LASPGDLNYPAISAVFREQPAPVLTLHRTVTNVGPPVST-YHVKVTPFRGVDV  727

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSW  2121
              V P  L FT +   LSY+VTF++   Q     G+L WSDG HLV SP+ ++W
Sbjct  728   AVEPKTLHFTHQNQKLSYKVTFRTKSPQPIPDLGALIWSDGIHLVRSPVVITW  780



>ref|XP_007160895.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
 gb|ESW32889.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
Length=777

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/723 (48%), Positives = 453/723 (63%), Gaps = 27/723 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY+HVAHGFS RLTP +A  LAN PG++SV P+   +L TTR+PQF
Sbjct  65    SSLKSVSASAEILYTYKHVAHGFSTRLTPKEAETLANQPGILSVTPEHRYKLHTTRTPQF  124

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+ L P+S+  + +IIGVLD+G+WPE  S  D GL P+P +W+ +CEVG    +
Sbjct  125   LGL-DQSTTLLPASEQQSQVIIGVLDTGVWPELKSLDDTGLGPVPATWKGECEVGNNMNS  183

Query  361   TSCNRKIIGARAYYRGYEAVTG-RPIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             + CNRK++GAR + +GYE+  G   +  E KSA D  GHG+H  + AAGS V  A++ G 
Sbjct  184   SHCNRKLVGARFFSKGYESALGPVDLSTESKSARDDEGHGSHTLTTAAGSVVPEASLFGL  243

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A  AR+A YKVCWLG C ++DI +G+D+A+ DGV+VLS+SIG     G    
Sbjct  244   ASGTARGMAAQARVAAYKVCWLGGCFSSDIAAGIDKAIEDGVNVLSMSIG-----GSLTE  298

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IAIG+F A   G++VS  AGN+GP   T  N++PW+ TVGA T+DR+FPA++TLG
Sbjct  299   YYRDIIAIGSFTATSHGILVSMSAGNAGPSSSTLSNVSPWVTTVGAGTLDRDFPALITLG  358

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVY-GRRANSR---YCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+T+ G SLY G     + + +VY G  +NS     CL   L   KV GKIV C++  N
Sbjct  359   NGKTYAGASLYNGKPVLDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGN  418

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V++G  VK +GG GMI++N    G ELV +  ++P A +      I+  Y  ++ + 
Sbjct  419   PR-VEKGLVVKLAGGAGMILANNEAFGEELVTDPHLLPAASLGQKSSQILKSYASSSANP  477

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA+I F GT     PS P VAAFSSRGPN LTP ILKPD IAPGVNILA WTGA+ P+  
Sbjct  478   TAKIAFLGTQLEVKPS-PVVAAFSSRGPNALTPNILKPDFIAPGVNILAGWTGAVGPTGL  536

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
             T D+R   FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT YT   +G + +
Sbjct  537   TADDRHVSFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALMTTAYTSYKNG-AAI  595

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             +D+ TG P+TP  +G+GHVDP  A DPGLVYD  V DY+ F C + Y S +I L  R   
Sbjct  596   LDVATGQPATPFDYGAGHVDPVAALDPGLVYDANVEDYLGFFCALNYTSFQIKLASRTD-  654

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFK---------NNLQTITYKRTVKNVGKVKNVAYQVT  1938
                C  +        NYPSFAV  +         +  +T+ Y R + NVG        V 
Sbjct  655   -FTCDPKKEYRVEDFNYPSFAVALETASGIGGGSDAPKTVKYSRVLTNVGAPGTYEASVV  713

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIA  2112
                 S V++ V P  L F    +  SY V+F   S+     SF  L W DG H V SPIA
Sbjct  714   ALGDSTVKIVVEPETLSFAQEYEKKSYTVSFTYTSMPSGTSSFARLEWKDGKHTVASPIA  773

Query  2113  VSW  2121
              SW
Sbjct  774   FSW  776



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/714 (49%), Positives = 458/714 (64%), Gaps = 32/714 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL-  210
             LLYTY    HGF+A L P +A  L +   V+ V  D + EL TTR P FLG ISG   L 
Sbjct  74    LLYTYTAAFHGFAATLDPDEADALRSSASVLGVYEDTVYELHTTRKPAFLG-ISGDLGLW  132

Query  211   --------GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
                     G    +G D+I+GVLD+G+WPE  SF D G+  +P  W+  CE GP F A S
Sbjct  133   DQQEGPNGGKRRAFG-DVIVGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSAKS  191

Query  367   CNRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvngh  537
             CN+K+IGAR + +G+   +G   +  PK   S  D  GHGTH AS AAGS VANA++ G+
Sbjct  192   CNKKLIGARFFSKGFRMASGSSFLKNPKEVESPRDRDGHGTHTASTAAGSQVANASLLGY  251

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A +AR+A YKVCW   C  ADIL+GMD+A+ DGV VLSLS+G     G   P
Sbjct  252   ASGTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLG-----GGIAP  306

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IAIGAF A+++G+ VSC AGNSGP   +  N+APWI+TVGA T+DR+FPA   LG
Sbjct  307   YYRDTIAIGAFTAMERGIFVSCSAGNSGPVKESLANVAPWIMTVGAGTLDRDFPAYALLG  366

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANIT  1071
             NG+ + G SLY G     N V ++Y + +N   + CLPG L+ +  RGK+V C +  N  
Sbjct  367   NGKRYAGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNAR  426

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G  V+ +GGVGMI++N    G ELVA++ +IP   V    GD+I +YVK+ +S TA
Sbjct  427   -VEKGQVVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIREYVKSDRSPTA  485

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              + FRGTV    PS P VAAFSSRGPN +T +ILKPDVI PGVNILA W+ A  P+    
Sbjct  486   VLSFRGTVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLES  544

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D R+T FNI+SGTSM+CPH+SG+AA+L+  +P+WSP+AIKSALMTT Y LDN+ RS L D
Sbjct  545   DTRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYDLDNT-RSPLRD  603

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                G  STP AHGSGHVDP  A  PGLVYD    DY+ FLC++ Y    +   ++  P V
Sbjct  604   AAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKR-PNV  662

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
              C +R   +PG LNYPSF+VVF N+ + + Y R + NVG   ++ Y V+V  PS V VTV
Sbjct  663   TC-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRELTNVGAAGSM-YNVSVTGPSTVGVTV  719

Query  1972  SPNRLVFTDRIDTLSYEVTFQSLR----QSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P +L+F    D + Y VTF S +     +   FGS+ WS+  + V SP+A +W
Sbjct  720   KPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  773



>ref|XP_010443668.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=779

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/711 (49%), Positives = 458/711 (64%), Gaps = 26/711 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSSN  207
              +LYTY+   HG +A+LT  +A  L    GV++V+P+   EL TTRSP FLGL    S  
Sbjct  77    RILYTYQTAFHGLAAQLTEEEAERLKEEDGVVAVIPETRYELHTTRSPTFLGLERQESEK  136

Query  208   LGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIG  387
             +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G  F   +CNRKI+G
Sbjct  137   VWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGTCETGKGFLKRNCNRKIVG  196

Query  388   ARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             AR +YRGYEA TG+  +DE    KS  D  GHGTH A+  AGS V  AN+ G A G ARG
Sbjct  197   ARVFYRGYEAATGK--IDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGTARG  254

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             ++  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D ++
Sbjct  255   MSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGISTYSRDSLS  309

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             I  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA V LG  RTF G
Sbjct  310   IATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKG  369

Query  919   TSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANITIV  1077
              SLY G  +     Q  ++Y GR A+S     +CL G LD   V GKIV C +  +   V
Sbjct  370   VSLYKGRAVLSKNKQYPLIYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPR-V  428

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G  VK++GG+GMI++N    G ELVA++ ++P   V   +G +I  Y   ++ ATA +
Sbjct  429   QKGQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATL  488

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
                GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAWTG +APS  + D 
Sbjct  489   EVLGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDP  547

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN+ +  L D  
Sbjct  548   RRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKP-LTDAS  606

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
                PS+P+ HG+GH+DP  A DPG VYD G  DY +FLCT      ++ +F ++S    C
Sbjct  607   GAAPSSPYDHGAGHIDPLKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNR-SC  665

Query  1798  RNRNLGNPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
             ++    NPG LNYP+ + +F  N  ++++T +RTV NVG     +Y+V+V       VTV
Sbjct  666   KHTLAKNPGNLNYPAISALFPENTRVKSMTLRRTVTNVGP-HIASYKVSVSPFKGASVTV  724

Query  1972  SPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P  L FT +   LSY VTF + +R     FG L W   TH V SP+ ++W
Sbjct  725   LPKTLNFTTKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPVIITW  775



>dbj|BAH20348.1| AT3G14067 [Arabidopsis thaliana]
Length=601

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/606 (55%), Positives = 416/606 (69%), Gaps = 16/606 (3%)
 Frame = +1

Query  361   TSCNRKIIGARAYYRGYEAV---TGRPIVDEPKSAIDMTGHGThvasiaagsavananvn  531
             +SCNRK+IGARA+YRGY      T +    E +S  D  GHGTH AS AAGS VANA++ 
Sbjct  1     SSCNRKLIGARAFYRGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLY  60

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
              +ARG A G+A+ ARIA YK+CW G C ++DIL+ MDQAVADGVHV+SLS+G     G A
Sbjct  61    QYARGTATGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVG---ASGSA  117

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
               Y+ D IAIGAFGA + G++VSC AGNSGP+P TA NIAPWILTVGAST+DREF A   
Sbjct  118   PEYHTDSIAIGAFGATRHGIVVSCSAGNSGPNPETATNIAPWILTVGASTVDREFAANAI  177

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANIT  1071
              G+G+ FTGTSLY G     +Q+S+VY     SR C PG+L++S V GKIV C +  N  
Sbjct  178   TGDGKVFTGTSLYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNAR  237

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G AVK +GG GMI++N    G EL A++ ++P  +V A  GD I DY+K + S TA
Sbjct  238   -VEKGSAVKLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTA  296

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
             +I F GT+ G SP +PRVAAFSSRGPN LTP ILKPDVIAPGVNILA WTG + P++   
Sbjct  297   KISFLGTLIGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDI  356

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR +FNI+SGTSM+CPHVSGLAA+LRK +P WSPAAIKSAL+TT Y ++NSG   + D
Sbjct  357   DPRRVQFNIISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALVTTAYDVENSGEP-IED  415

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
             L TG  S    HG+GHVDP  A +PGLVYD  V +YV FLC +GY+   I +FL++  L 
Sbjct  416   LATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVAFLCAVGYEFPGILVFLQDPTLY  475

Query  1792  D-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
             D C    L   G LNYPSF+VVF +  + + YKR VKNVG   +  Y+V V++P+NV + 
Sbjct  476   DACDTSKLRTAGDLNYPSFSVVFASTGEVVKYKRVVKNVGSNVDAVYEVGVKSPANVEID  535

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQS-------ADSFGSLRWSDGTHLVTSPIAVSWEG  2127
             VSP++L F+     L YEVTF+S+             FGS+ W+DG H+V SP+AV W  
Sbjct  536   VSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQ  595

Query  2128  RSVSEL  2145
              SV   
Sbjct  596   GSVQSF  601



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/712 (48%), Positives = 456/712 (64%), Gaps = 32/712 (4%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLIS--------  195
             YTY    HGF+A L P QA  L     VI V  D +  L TTR+P+FLGL +        
Sbjct  62    YTYTDAYHGFAASLDPDQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTELGLWAGH  121

Query  196   GSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
              + +L  +S+   D+IIGVLD+G+WPE  SF D G+  IP  WR +CE  P F AT CN+
Sbjct  122   STQDLNQASN---DVIIGVLDTGVWPESKSFDDTGMPEIPTKWRGQCESAPDFAATLCNK  178

Query  376   KIIGARAYYRGYEAVTGRPIVDEPKSAI---DMTGHGThvasiaagsavananvnghaRG  546
             K+IGAR++ +GY+  +G   + +P   +   D+ GHGTH +S AAGS VANA++ G+A G
Sbjct  179   KLIGARSFSKGYQMASGGSNLRKPSEVVSPRDIDGHGTHTSSTAAGSLVANASLLGYASG  238

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+A +AR+A YKVCW   C  +DI++GMD+A+ DGV VLSLS+G     G + PY  
Sbjct  239   TARGMAPHARVAAYKVCWSTGCFGSDIIAGMDRAIIDGVDVLSLSLG-----GGSAPYYR  293

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAF A+++G+ VSC AGNSGP   +  N APWI+TVGA T+DR+FPA   LGN  
Sbjct  294   DTIAIGAFTAMERGIFVSCSAGNSGPTKASLANTAPWIMTVGAGTLDRDFPAYALLGNKH  353

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
              FTG SLY G       V +VY + +N  S  CLPG L+   VRGK+V C +  N   V+
Sbjct  354   RFTGVSLYSGTGMGNKPVQLVYNKGSNGSSNLCLPGSLNPDLVRGKVVMCDRGVNAR-VE  412

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  V+ +GG+GMII+N    G ELVA++ ++P   V    GD I  Y ++  + TA I 
Sbjct  413   KGGVVRAAGGIGMIIANTAASGEELVADSHLLPAVAVGRKVGDQIRAYAQHDPNPTAVIT  472

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GTV    PS P VAAFSSRGPN + P+ILKPDVI PGVNILAAW+ AI P+    D R
Sbjct  473   FGGTVLNVRPS-PVVAAFSSRGPNTVIPQILKPDVIGPGVNILAAWSEAIGPTGLQDDKR  531

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             +++FNIMSGTSM+CPH+SGLAA+L+  +P WSP+A+KSALMTT YT DN+ +S L D   
Sbjct  532   KSQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNT-KSPLRDAAD  590

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S P  HGSGHVDP+ A  PGLVYDT   DY+ FLC++ Y ++ +   ++  P V C 
Sbjct  591   GTLSNPWGHGSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKR-PNVTCE  649

Query  1801  NRNLGNPGALNYPSFAVVF-KNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
              R   +PG LNYPSF++ F   N + + Y R + NVG   +V Y+ +V +PS VR  V P
Sbjct  650   -RKYSDPGQLNYPSFSIAFGSKNKRVVRYTRELTNVGAAGSV-YRASVTSPSTVRTVVKP  707

Query  1978  NRLVFTDRIDTLSYEVTFQSL----RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              RLVF +  +   Y VTF +L    + +   FGS+ W++  HLV SP+A +W
Sbjct  708   TRLVFNNVGEKQKYTVTFMALPGAEKTARSEFGSIVWANPQHLVKSPVAFAW  759



>ref|XP_009112374.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=758

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/717 (49%), Positives = 463/717 (65%), Gaps = 24/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ ++YTY +  HGF+ RLTP +A  L   PGVISV  ++  EL TTR+P F
Sbjct  55    SSLRSVSESAAMIYTYNNAIHGFATRLTPEEADSLMTQPGVISVRQEQRHELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  L P +   ++++IGVLDSG+WPE  SFSD G  PIP +W+  C+ G +F  
Sbjct  115   LGLDVHNGGLFPETSTSSNLVIGVLDSGVWPESKSFSDEGYGPIPPTWKGGCDAGTRFTM  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             + CNRK+IGAR + RGYEA+ G P+ +  E KS  D  GHGTH AS AAGS V  AN+ G
Sbjct  175   SLCNRKLIGARFFVRGYEAING-PVDESKESKSPRDDDGHGTHTASTAAGSVVEGANLLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ARGIA  AR+AVYKVCW   C ++DIL+G+D+A+ D V++LS+S+      G   
Sbjct  234   FANGTARGIAYRARVAVYKVCWQPGCFSSDILAGIDKAIEDNVNILSISL-----SGITT  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D IAIGAF A+++G+ VSC AGN GP P++  NIAPWI TVGA T+DR+FPA+  L
Sbjct  289   YYTDD-IAIGAFAAMERGIFVSCSAGNFGPSPFSVTNIAPWITTVGAGTLDRDFPALAIL  347

Query  895   GNGRTFTGTSLYFGIQPSPNQ-VSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQL  1059
             GNG+ +TG SL+ G    P + +  +Y   A+       C PG L   KV+GKIV C   
Sbjct  348   GNGKNYTGVSLFKGDDELPAKLLPFIYAGNASDDAIGYLCFPGTLIPEKVKGKIVMCDT-  406

Query  1060  ANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTK  1239
               +     G  VK +GG+GMII+N+  +G E+ A A  +P   V    GDII  YV    
Sbjct  407   GGVAPAMIGEVVKSAGGLGMIIANLAGRGEEVQAEAHFLPATAVGEKAGDIIRRYVLTDP  466

Query  1240  SATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPS  1419
             + TA IV +GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILAAWTG++ P+
Sbjct  467   NPTASIVIQGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGSLGPT  525

Query  1420  ESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRS  1599
                 D RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G  
Sbjct  526   GLASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYNTYKDGNP  585

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              +ID+ TG PSTP  HG+GHV PT A +PGL+YD    DY+DFLC + Y+S +I +  R 
Sbjct  586   -IIDISTGKPSTPFEHGAGHVSPTTAVNPGLIYDLTTVDYLDFLCALKYNSSQIGVVSRG  644

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
             +    C +    +   LNYPSFAV  + +  T  Y R V +VG   + + +VT +T + V
Sbjct  645   N--YTCDSSKTYSVADLNYPSFAVNVEGS-DTYKYTRPVTSVGGAGSYSVKVTSET-TAV  700

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             ++++ P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V SP+A+SW
Sbjct  701   KISIEPAVLNFREVNEKKSYSVTFTVDLSKPSGSNSFGSIEWSDGKHVVASPVAISW  757



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/714 (49%), Positives = 454/714 (64%), Gaps = 37/714 (5%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPS  219
             YTY    +GF+A L P QA  L     V+ V  D L  L TTRSPQFLG+   SS+ G S
Sbjct  64    YTYNTAYNGFAASLDPDQAQALRQSDAVLGVYEDTLYTLHTTRSPQFLGI---SSDFGLS  120

Query  220   SDYGA--------DIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
             + Y          D+IIGVLD+G+WPE  SF D  +  +P  WR +CE GP F    CN+
Sbjct  121   AGYSKLDFDKASLDVIIGVLDTGVWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKLCNK  180

Query  376   KIIGARAYYRGYEAVTG----RPIVDEPKSAIDMTGHGThvasiaagsavananvnghaR  543
             K+IGAR + +GY    G    +P  +EP+S  D  GHGTH AS AAG  VANA++ G+A 
Sbjct  181   KLIGARFFSKGYHMAGGSFSKKP--NEPESPRDYDGHGTHTASTAAGVPVANASLLGYAS  238

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G ARG+AT+AR+A YKVCW   C  +DIL+G+D+A+ DGV VLS+S+G     G + PY 
Sbjct  239   GVARGMATHARVATYKVCWKTGCFGSDILAGIDRAIQDGVDVLSMSLG-----GGSAPYY  293

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
              D IA+GAF A++KG++VSC AGNSGP   +  N+APWILTVGA T+DR+FPA V LGN 
Sbjct  294   RDTIAVGAFAAMEKGIVVSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNK  353

Query  904   RTFTGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANIT  1071
             +  TG SLY G       VS+VY + +N       CLPG L    VRGK+V C +  N  
Sbjct  354   KKATGVSLYSGNGMGNKPVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINAR  413

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G  V+ +GGVGMI++N    G ELVA++ ++P   +    GDI+ +Y K   + TA
Sbjct  414   -VEKGAVVRDAGGVGMILANTAASGEELVADSHLLPAVAIGRKMGDIVREYAKTVPNPTA  472

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              + F GTV    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAWT A  P+E  K
Sbjct  473   LLTFGGTVLNVRPS-PVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEK  531

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RRT+FNIMSGTSM+CPH+SG+AA+L+  +P WSP+AIKSALMTT Y +DN+ +S L D
Sbjct  532   DTRRTKFNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNT-KSPLHD  590

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                G  STP AHGSGHV+P  A  PGLVYD    DYV FLC++GY  + +   ++  P +
Sbjct  591   AADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKR-PNI  649

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
              C  R    PG LNYPSF+V+F +  + + Y R + NVG  +++ Y VT   PS V ++V
Sbjct  650   TC-TRKFNTPGELNYPSFSVLFGDQ-RVVRYTRELTNVGPARSL-YNVTADGPSTVGISV  706

Query  1972  SPNRLVFTDRIDTLSYEVTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P RL+F    +   Y VTF +     +    +FGS+ W +  H V SP+A SW
Sbjct  707   RPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSW  760



>dbj|BAJ93872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=780

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/725 (48%), Positives = 474/725 (65%), Gaps = 22/725 (3%)
 Frame = +1

Query  4     PLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFL  183
             PL     +  +LY+Y H A GF+ARLT  QA+ LA+   V++V+PD L EL TT +P FL
Sbjct  67    PLEMCRPAPRVLYSYGHAATGFAARLTARQAARLASSGSVLAVVPDELQELHTTLTPSFL  126

Query  184   GLISGSSNLGPSSDYGADIIIGVLDSGIWPE-RSSFS-DRGLNPIPNSWRNKCEVGPQFP  357
              L S SS L P+S   +D++IGV+D+G++PE R SF+ DR L P P  +R  C   P+F 
Sbjct  127   RL-SESSGLLPASGGASDVVIGVIDTGVYPEGRKSFAADRSLPPPPRRFRGGCVSTPEFN  185

Query  358   ATS-CNRKIIGARAYYRGYEAVT-GRPIVDEPKSA--IDMTGHGThvasiaagsavanan  525
             A++ CN K++GA+ + +G++AV  GR  V E +S   +D  GHGTHVAS AAGSAV +A+
Sbjct  186   ASAYCNGKLVGAKFFRKGHDAVLRGRREVGETESMSPLDTEGHGTHVASTAAGSAVLDAS  245

Query  526   vnghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEG  705
             + G+ +G A G A +ARI VYK CW G C+++D+L+  DQA+ADGV V+S S+G      
Sbjct  246   LYGYGKGRAVGAAPSARITVYKACWKG-CASSDVLAAFDQAIADGVDVISASLGTMK---  301

Query  706   FAKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAV  885
              A+ + +D  A+GAF AV KG++V+  AGNSGP   T +N+APW LTV ASTI+R+FPA 
Sbjct  302   -ARKFYKDTTAVGAFHAVSKGIVVAVSAGNSGPGESTVVNVAPWFLTVAASTINRQFPAD  360

Query  886   VTLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             V LGNG TF GTSLY G      ++ +VYG  A S  C  G+L+ + V GKIV C    N
Sbjct  361   VVLGNGETFIGTSLYAGKPLGATKLPLVYGGDAGSNICEAGKLNPTMVAGKIVLCDPGVN  420

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                 ++GFAVK +GG G ++ +   QG +   +A +IP + VT +  + I  Y++   S 
Sbjct  421   -GRTEKGFAVKLAGGAGAVLGSEEAQGEQARTSAHVIPISAVTFSAAEKIKKYLRTQASP  479

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
              A +VF GTV G SP +PR+A+FSSRGP+ L PEILKPDV APGV+ILAAWTGA +PS  
Sbjct  480   VATMVFHGTVVGRSPPSPRMASFSSRGPSRLVPEILKPDVTAPGVDILAAWTGATSPSLL  539

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D+RR  +NIMSGTS++CP VSG+AA+LR+  P WSPAAIKSALMTT Y +D++G + +
Sbjct  540   DGDSRRVLYNIMSGTSISCPQVSGIAALLRQARPEWSPAAIKSALMTTAYNMDSAG-AVI  598

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG  STP   G+GHVDP  AADPGLVYD G  DY+ FLC +GY ++++A+F   SP
Sbjct  599   EDMSTGKASTPFVRGAGHVDPNRAADPGLVYDAGTEDYIAFLCALGYSAEQMAVF---SP  655

Query  1786  LVDCRNR-NLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
               +C  R      G LNYP+F+ VF    + +T +R V+NVG      Y+  + +P+ V 
Sbjct  656   ATNCSTRAGTAAVGDLNYPAFSAVFGPEKRAVTQRRVVRNVGGNARATYRAKITSPAGVH  715

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLR----QSADSFGSLRWSDGTHLVTSPIAVSWEGR  2130
             VTV P +L F+    T  Y +TF            +FGS+ WSDG H VTSPIAV+W   
Sbjct  716   VTVKPQKLQFSATQGTQQYAITFAPRMFGNVTEKHTFGSIEWSDGEHSVTSPIAVTWPAS  775

Query  2131  SVSEL  2145
              V+++
Sbjct  776   QVADM  780



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/709 (50%), Positives = 465/709 (66%), Gaps = 26/709 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLY YE    GFSA+L+  Q   L  V G ++ +PD ++ L TT SPQFLGL SG   L
Sbjct  71    QLLYVYEKSISGFSAKLSKKQLESLKQVDGFLTAVPDEMLSLHTTHSPQFLGLKSGR-GL  129

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
                 +  +D+I+GV+D+GIWPE  SF D G+ P+P+ W+ KCE G +F  ++CNRKIIGA
Sbjct  130   WSGPNLTSDVIVGVIDTGIWPEHVSFRDSGMPPVPSRWKGKCEAGTKFARSNCNRKIIGA  189

Query  391   RAYYRGYEAVTGRPIVDEP-KSAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             R + +GYEA  G+    E  +SA D  GHGTH AS AAG+ V  AN+ G A+G A G++ 
Sbjct  190   RIFPKGYEAAAGKINEKEDYRSARDSQGHGTHTASTAAGNLVNGANLFGLAKGLAGGMSY  249

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGA  747
              +RIAVYK C++  CS++D+L+ +DQAV DGV VLSLS+G     G  KP+  D IAI A
Sbjct  250   GSRIAVYKACFMLGCSSSDVLAAIDQAVIDGVDVLSLSLG-----GLPKPFYIDNIAIAA  304

Query  748   FGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSL  927
             FGAVQ GV VSC AGNSGP   T  N APWI+TV AS++DR FP +V LGNG  F G SL
Sbjct  305   FGAVQHGVFVSCSAGNSGPLSSTVGNAAPWIMTVAASSLDRSFPTIVKLGNGHVFKGASL  364

Query  928   YFGIQPSPNQVSMVYGRRAN---SRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
             Y G +P+  Q+ +VYGR A    +++C    L +  V+GKIV C++  N    ++G  VK
Sbjct  365   YVG-KPT-MQLPLVYGRTAGGEGAQFCTNETLSSRLVKGKIVVCEKGIN-GRAEKGEQVK  421

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GMI+ N   +G EL A+A ++P   + A+ G  I  Y+  TK+ATA I F GTV 
Sbjct  422   LAGGAGMIMVNRVEEGDELYADAHVLPATSLGASAGIAIKKYINLTKTATASIKFEGTVY  481

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             GN   AP VAAFSSRGP+   P+I+KPDV APGV+ILAAW   I+PS    D R  +FNI
Sbjct  482   GNR--APVVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNI  539

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY--TGYPS  1632
             +SGTSM+CPHVSGLAA+L+ ++  WSPAAIKSALMTT YTLD   R+ + D    T   +
Sbjct  540   LSGTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKK-RTPIADAVSETSLSA  598

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   GSGHVDP  A+DPGL+YD    DY+ ++C++ Y+S +IAL LR +    C + + 
Sbjct  599   TPFVFGSGHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLREN--YTCPSHSF  656

Query  1813  GNPGALNYPSFAVVFKNNLQTI--TYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRL  1986
              + G LNYPSF+V+F +N Q +  T+KRTV NVG  ++  Y V V+TP  V VTV P  L
Sbjct  657   QSLGNLNYPSFSVLFDSNNQHLIQTFKRTVTNVGTPRST-YIVQVKTPYGVSVTVKPKIL  715

Query  1987  VFTDRIDTLSYEVTF--QSLRQSADS-FGSLRWSDGTHLVTSPIAVSWE  2124
              F  +   L Y+V F  +  R  ADS FGSL W   TH+V SPIAV+W+
Sbjct  716   KFHKKGQKLRYKVRFVTKGKRSPADSTFGSLTWISRTHIVRSPIAVTWQ  764



>ref|XP_007225532.1| hypothetical protein PRUPE_ppa025871mg [Prunus persica]
 gb|EMJ26731.1| hypothetical protein PRUPE_ppa025871mg [Prunus persica]
Length=765

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/725 (49%), Positives = 463/725 (64%), Gaps = 28/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY++V HGFS RLT  +A  L    G++SV+P+   EL TTR+PQF
Sbjct  50    SSLKSVSNSADMLYTYKNVIHGFSTRLTAEEAELLERQSGILSVMPELRYELHTTRTPQF  109

Query  181   LGLISG-SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LG++ G +  + P+S+    +IIGV+D+G+WPE  S+ D+GL P+P SWR +CE G  F 
Sbjct  110   LGMLGGINEAVFPASEKLGKVIIGVVDTGVWPEIKSYDDKGLGPVPRSWRGQCEEGKNFN  169

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvn  531
             ++SCNRK+IGAR + +GYEA    PI +  E +S  D+ GHGT  ++IAAGSAV  A++ 
Sbjct  170   SSSCNRKLIGARFFPKGYEASNLGPIDEKVESRSPRDVDGHGTQASTIAAGSAVPGASLY  229

Query  532   ghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFA  711
             G+A G ARG+AT AR+A YK CW G C ++DIL+ MD+AV DGVH+LS+SIG    E F 
Sbjct  230   GYASGTARGMATQARVATYKACWSGWCLSSDILAAMDKAVEDGVHILSVSIGRSQYEDF-  288

Query  712   KPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVT  891
                  D IAIGAF A+ KGV VSC AGN GP+  +  N APWI TVGA TIDR+FPA V+
Sbjct  289   ---YTDFIAIGAFSAMAKGVFVSCSAGNRGPEADSTSNNAPWITTVGAGTIDRDFPAHVS  345

Query  892   LGNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSRY-------CLPGQLDASKVRGKIVYC  1050
             LGNG+ + G S+Y G   S     +VY R A++         C P  L   KV GKIV C
Sbjct  346   LGNGKKYRGASIYSGTHLSSGLHPLVYARNASNSTSDSTSDPCAPDSLIPEKVFGKIVVC  405

Query  1051  KQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVK  1230
              Q    + VD+   VK++GG+GMI++++   G ELV ++ ++P  VV   +GD I  Y+ 
Sbjct  406   DQGGTYSRVDKSMVVKKAGGMGMILADIEGYGEELVVDSYVLPVVVVGQKEGDAIKRYIV  465

Query  1231  NTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAI  1410
             +  +  A      T  G  PS P VAAFSSRGPN +   +LKPD+IAPGVNILA WTGA+
Sbjct  466   SHDNPKATFSGGKTELGVEPS-PVVAAFSSRGPNPVALTVLKPDLIAPGVNILAGWTGAL  524

Query  1411  APSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNS  1590
              P+   +D RR  FNI SGTSM+CPHVSGLAA+L+  +P WSPAAIKSALMTT+Y    +
Sbjct  525   GPARRAEDTRRVSFNIFSGTSMSCPHVSGLAAVLKAAHPKWSPAAIKSALMTTSYATYKN  584

Query  1591  GRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALF  1770
             G + + D+ TG P+TP  +G+GHVDP  A DPGLVYD GV DY++FLC   Y S  I + 
Sbjct  585   G-APIKDVATGKPATPFDYGAGHVDPVAALDPGLVYDLGVKDYLNFLCAYRYTSSDIKIL  643

Query  1771  LRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN-----LQTITYKRTVKNVGKVKNVAYQV  1935
                     C +    + G LNYPSFAV    N       T  Y RT+ NVG      Y+V
Sbjct  644   THID--FTCDSSKNYSAGDLNYPSFAVSLNTNSGNWGAGTKIYTRTLTNVGTPGT--YKV  699

Query  1936  TVQTPS-NVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSP  2106
             +V TPS  V++ V P  L FT   +  +Y VTF   ++    ++F  L WSDG H+V+SP
Sbjct  700   SVSTPSPAVKILVEPKSLSFTRAYEKKTYTVTFVVSAMPSGTNNFTRLEWSDGKHIVSSP  759

Query  2107  IAVSW  2121
             IAVSW
Sbjct  760   IAVSW  764



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/711 (49%), Positives = 459/711 (65%), Gaps = 33/711 (5%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLYTY+    GF+A LTP +A  +     V+ V  D +  L TTR+P+FLGL   ++  G
Sbjct  70    LLYTYDAAYSGFAAALTPEEADSIRQSDSVLGVYEDTVYTLHTTRTPEFLGL---NTEPG  126

Query  214   PSSDYG--------ADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQF-PATS  366
             P + +          D+IIGVLD+G+WPE  SF+D G+  +P  WR +CE    F P   
Sbjct  127   PWTGHSLQELNKASQDVIIGVLDTGVWPESKSFADFGMPDVPTRWRGRCEAAGDFNPKIH  186

Query  367   CNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRG  546
             CN+K+IGAR + +G+  V+G     E +S  D  GHGTH AS AAGS V NA++ G+ARG
Sbjct  187   CNKKLIGARFFSKGHNIVSG---AKEAQSPRDNDGHGTHTASTAAGSQVQNASLLGYARG  243

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+AT+AR+A YKVCW   C  +DIL+ M++A+ DGV VLS+S+G     G + PY  
Sbjct  244   NARGMATHARLATYKVCWKSGCLGSDILAAMERAILDGVDVLSMSLG-----GGSAPYFR  298

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAF AV++G+ VSC AGNSGP   +  N+APWI+TVGA TIDR+FPA  TLGNG 
Sbjct  299   DTIAIGAFAAVERGIFVSCSAGNSGPTKESLANVAPWIMTVGAGTIDRDFPAFSTLGNGE  358

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRANS--RYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
              + G SLY G       V +VYG+ AN+    CLPG LD++ VRGK+V C +  +   V+
Sbjct  359   KYNGVSLYSGKGMGRKSVELVYGKNANTTGNLCLPGSLDSAAVRGKVVLCDRGISPR-VE  417

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  V+ +GGVGMI++N    G ELVA++ ++P   V    GD I  YVK  ++  A + 
Sbjct  418   KGMVVRDAGGVGMILANTAESGEELVADSHLLPAVAVGRKIGDEIRRYVKTARNPRASLS  477

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GTV    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAW+ A+ P+    D R
Sbjct  478   FAGTVVNVKPS-PVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWSQAVGPTGLDTDTR  536

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             +T+FNI+SGTSM+CPH+SGLAA+L+  +P+WSP+AIKSALMTT YT DN+  S L D   
Sbjct  537   KTQFNIISGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNA-NSPLRDAAD  595

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
                STP AHG+GHVDP  A  PGLVYD    DYV FLC++GY  + + +  ++ P + C 
Sbjct  596   YSLSTPWAHGAGHVDPHKALSPGLVYDATPEDYVSFLCSLGYTKEMVQIVAKH-PNITCS  654

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              R   +PG LNYPSF+V+F+     + Y R + NVG    + Y+V+V  P NV V+VSP+
Sbjct  655   KR-FHDPGQLNYPSFSVMFRKT-GVVRYSRELTNVGPA-GLTYRVSVDAPPNVEVSVSPS  711

Query  1981  RLVFTDRIDTLSYEVTFQSLRQSA----DSFGSLRWSDGTHLVTSPIAVSW  2121
              LVF +  D   + VTF   ++        FGS+ WS+  H V+SP+A SW
Sbjct  712   TLVFKNVGDKRRFRVTFVWKKEVGPVVRHGFGSIVWSNALHRVSSPVAYSW  762



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/709 (50%), Positives = 465/709 (66%), Gaps = 26/709 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLY YE    GFSA+L+  Q   L  V G ++ +PD ++ L TT SPQFLGL SGS  L
Sbjct  74    QLLYVYEKAISGFSAKLSKKQLELLKQVDGFLTAMPDEMLSLHTTHSPQFLGLKSGS-GL  132

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +S+  +D+I+GV+D+GIWPE  SF D G+ P+P+ W+ KCE G +F  ++CN+KIIGA
Sbjct  133   WSASNLTSDVIVGVIDTGIWPEHLSFRDSGMPPVPSRWKGKCEAGTRFSPSNCNKKIIGA  192

Query  391   RAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             R + +GYEA  G+    ++ +S  D  GHGTH AS AAG+ V  AN+ G  +G A G++ 
Sbjct  193   RIFSKGYEAAAGKINETEDYRSPRDSQGHGTHTASTAAGNLVMGANLFGLGKGLAGGMSY  252

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGA  747
              +RIAVYK C++  CS++DIL+ +DQAV DGV VLSLS+G     GF KP+  D IAI A
Sbjct  253   GSRIAVYKACYIQGCSSSDILAAIDQAVIDGVDVLSLSLG-----GFPKPFYADNIAIAA  307

Query  748   FGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSL  927
             FGAVQ GV VSC AGNSGP   +  N APWI+TV AS++DR FP  V LG+GR F G SL
Sbjct  308   FGAVQHGVFVSCSAGNSGPLSSSVGNAAPWIMTVAASSLDRSFPTTVKLGDGRVFKGASL  367

Query  928   YFGIQPSPNQVSMVYGRRAN---SRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
             Y G +P+  Q+ +VYGR A    + +C  G L +  V+GKIV C++  N    ++G  VK
Sbjct  368   YQG-KPT-KQLPLVYGRTAGGEGAEFCTNGTLSSRLVKGKIVVCEKGLNAR-AEKGEQVK  424

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GMI+ N   +G EL A+  ++P   + A+ G  I  Y+ +TK+ATA I F GTV 
Sbjct  425   IAGGAGMIMVNRDEEGEELYADPHVLPGTSLGASAGIAIKSYINSTKTATASIKFEGTVY  484

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             GN   AP VAAFSSRGP+   P+I+KPDV APGV+ILAAW   I+PS    D R   FNI
Sbjct  485   GNR--APIVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVLFNI  542

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY--TGYPS  1632
             +SGTSM+CPHVSGLAA+L+ ++  WSPAAIKSALMTT YTLD   R+ + D    T   +
Sbjct  543   LSGTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKE-RTPIADAVSETSISA  601

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   GSGHVDP  A++PGL+YD    DY+ ++C++ Y+S +IAL LR +    C +  L
Sbjct  602   TPFGIGSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLRKN--YTCPSHVL  659

Query  1813  GNPGALNYPSFAVVFKNNLQTI--TYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRL  1986
              +PG LNYPSFAV+F +  + +  T+KR+V NVG   +  Y V V TPS V VTV P  L
Sbjct  660   KSPGDLNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMST-YVVQVNTPSGVSVTVKPKIL  718

Query  1987  VFTDRIDTLSYE--VTFQSLRQSADS-FGSLRWSDGTHLVTSPIAVSWE  2124
              F  +   L Y+  V  +  R + DS FGSL W   TH+V SPIA++W+
Sbjct  719   KFQKKGQKLRYKMRVVARGKRSAGDSTFGSLVWFSRTHIVRSPIAITWQ  767



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/712 (49%), Positives = 457/712 (64%), Gaps = 32/712 (4%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGS------  201
             YTY    HGF+A L P QA  L     VI V  D +  L TTR+P+FLGL + S      
Sbjct  62    YTYTDAYHGFAASLDPDQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTESGLWAGH  121

Query  202   --SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
                +L  +S+   D+IIGVLD+G+WPE  SF D G+  IP  WR +CE  P F AT CN+
Sbjct  122   STQDLNQASN---DVIIGVLDTGVWPESKSFDDTGMPEIPTKWRGQCESAPDFAATLCNK  178

Query  376   KIIGARAYYRGYEAVTGRPIVDEPKSAI---DMTGHGThvasiaagsavananvnghaRG  546
             K+IGAR++ +GY+  +G   + +PK  +   D+ GHGTH +S AAGS VANA++ G+A G
Sbjct  179   KLIGARSFSKGYQMASGGSNLRKPKEVVSXRDIDGHGTHTSSTAAGSLVANASLLGYASG  238

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+A +AR+A YKVCW   C  +DI++GMD+A+ DGV VLSLS+G     G + PY  
Sbjct  239   TARGMAPHARVAAYKVCWSTGCFGSDIIAGMDRAIIDGVDVLSLSLG-----GGSAPYYR  293

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAF A+++G+ VSC AGNSGP   +  N APWI+TVGA T+DR+FPA   LGN  
Sbjct  294   DTIAIGAFTAMERGIFVSCSAGNSGPTEASLANTAPWIMTVGAGTLDRDFPAYALLGNKL  353

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
              FTG SLY G       V +VY + +N  S  CLPG L+   VRGK+V C +  N   V+
Sbjct  354   RFTGVSLYSGTGMGNKPVQLVYNKGSNGSSNLCLPGSLNPDLVRGKVVMCDRGVNAR-VE  412

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  V+ +GG+GMII+N    G ELVA++ ++P   V    GD I  Y ++  + TA I 
Sbjct  413   KGGVVRAAGGIGMIIANTAASGEELVADSHLLPAVAVGRKVGDQIRAYAQHDPNPTAVIT  472

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GTV    PS P VAAFSSRGPN + P+ILKPDVI PGVNILAAW+ AI P+   +D R
Sbjct  473   FGGTVLNVRPS-PVVAAFSSRGPNTVNPQILKPDVIGPGVNILAAWSEAIGPTGLEEDKR  531

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             +++FNIMSGTSM+CPH+SGLAA+L+  +P WSP+A+KSALMTT YT DN+  S L D   
Sbjct  532   KSQFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNT-NSPLRDAAD  590

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G  S P AHGSGHVDP+ A  PGLVYDT   DY+ FLC++ Y ++ +   ++  P V C 
Sbjct  591   GTLSNPWAHGSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKR-PNVTCA  649

Query  1801  NRNLGNPGALNYPSFAVVF-KNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSP  1977
              R   +PG LNYPSF++VF   N + + Y R + NVG   +V Y+ +V +PS VR  V P
Sbjct  650   -RKYSDPGQLNYPSFSIVFGSKNKRVVRYTRELTNVGAAGSV-YRASVTSPSTVRTIVKP  707

Query  1978  NRLVFTDRIDTLSYEVTFQSL----RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              RLVF +  +   Y VTF +L    + +   FGS+ W++  H V SP+  +W
Sbjct  708   TRLVFNNVGEKQKYTVTFVALPGAXKTARSEFGSIVWANPQHQVKSPVTFAW  759



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/709 (50%), Positives = 465/709 (66%), Gaps = 26/709 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLY YE    GFSA+L+  Q   L  V G ++ +PD ++ L TT SPQFLGL SGS  L
Sbjct  76    QLLYVYEKAISGFSAKLSKKQLELLKQVDGFLTAMPDEMLSLHTTHSPQFLGLKSGS-GL  134

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               +S+  +D+I+GV+D+GIWPE  SF D G+ P+P+ W+ KCE G +F  ++CN+KIIGA
Sbjct  135   WSASNLTSDVIVGVIDTGIWPEHLSFRDSGMPPVPSRWKGKCEAGTRFSPSNCNKKIIGA  194

Query  391   RAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIAT  567
             R + +GYEA  G+    ++ +S  D  GHGTH AS AAG+ V  AN+ G  +G A G++ 
Sbjct  195   RIFSKGYEAAAGKINETEDYRSPRDSQGHGTHTASTAAGNLVMGANLFGLGKGLAGGMSY  254

Query  568   NARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGA  747
              +RIAVYK C++  CS++DIL+ +DQAV DGV VLSLS+G     GF KP+  D IAI A
Sbjct  255   GSRIAVYKACYIQGCSSSDILAAIDQAVIDGVDVLSLSLG-----GFPKPFYADNIAIAA  309

Query  748   FGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSL  927
             FGAVQ GV VSC AGNSGP   +  N APWI+TV AS++DR FP  V LG+GR F G SL
Sbjct  310   FGAVQHGVFVSCSAGNSGPLSSSVGNAAPWIMTVAASSLDRSFPTTVKLGDGRVFKGASL  369

Query  928   YFGIQPSPNQVSMVYGRRAN---SRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVK  1098
             Y G +P+  Q+ +VYGR A    + +C  G L +  V+GKIV C++  N    ++G  VK
Sbjct  370   YQG-KPT-KQLPLVYGRTAGGEGAEFCTNGTLSSRLVKGKIVVCEKGLNAR-AEKGEQVK  426

Query  1099  QSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVT  1278
              +GG GMI+ N   +G EL A+  ++P   + A+ G  I  Y+ +TK+ATA I F GTV 
Sbjct  427   IAGGAGMIMVNRDEEGEELYADPHVLPGTSLGASAGIAIKSYINSTKTATASIKFEGTVY  486

Query  1279  GNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNI  1458
             GN   AP VAAFSSRGP+   P+I+KPDV APGV+ILAAW   I+PS    D R   FNI
Sbjct  487   GNR--APIVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVLFNI  544

Query  1459  MSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY--TGYPS  1632
             +SGTSM+CPHVSGLAA+L+ ++  WSPAAIKSALMTT YTLD   R+ + D    T   +
Sbjct  545   LSGTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKE-RTPIADAVSETSISA  603

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP   GSGHVDP  A++PGL+YD    DY+ ++C++ Y+S +IAL LR +    C +  L
Sbjct  604   TPFGIGSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLRKN--YTCPSHVL  661

Query  1813  GNPGALNYPSFAVVFKNNLQTI--TYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRL  1986
              +PG LNYPSFAV+F +  + +  T+KR+V NVG   +  Y V V TPS V VTV P  L
Sbjct  662   KSPGDLNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMST-YVVQVNTPSGVSVTVKPKIL  720

Query  1987  VFTDRIDTLSYE--VTFQSLRQSADS-FGSLRWSDGTHLVTSPIAVSWE  2124
              F  +   L Y+  V  +  R + DS FGSL W   TH+V SPIA++W+
Sbjct  721   KFQKKGQKLRYKMRVVARGKRSAGDSTFGSLVWFSRTHIVRSPIAITWQ  769



>ref|XP_010692334.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=777

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/725 (48%), Positives = 464/725 (64%), Gaps = 37/725 (5%)
 Frame = +1

Query  13    NHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
               S + ELLYTYE    GF+A+LT  Q   L ++ GV+SV PD ++ L TT S  FLGL 
Sbjct  69    EESLAPELLYTYETTMSGFAAKLTTKQYRSLTDIDGVLSVAPDMMLSLHTTYSTHFLGLE  128

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCN  372
              G   L   S   +D+I+GVLD+GIWPE  SF D+GL  +P+ W+  CE G  F AT+CN
Sbjct  129   PGR-GLWNKSSLVSDVIVGVLDTGIWPEHISFQDKGLTQVPSRWKGTCEKGTNFSATNCN  187

Query  373   RKIIGARAYYRGYEAVTGRPI-VDEPKSAIDMTGHGThvasiaagsavananvnghaRGE  549
             +K+IGA+A+++GYEA+ GR    DE +SA D  GHGTH AS AAG+A+  A++ G A+G 
Sbjct  188   KKLIGAKAFFKGYEAINGRINGTDEFRSARDSNGHGTHTASTAAGNAIPGASLFGMAKGI  247

Query  550   ARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNED  729
             A G+   +RIA YKVCW   C+++DIL+ +DQAVADGV VLSLS+G     G  +PY +D
Sbjct  248   ASGMRFTSRIAAYKVCWGRGCASSDILAAIDQAVADGVDVLSLSLG-----GLPRPYYQD  302

Query  730   PIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRT  909
              +AI AFGA+QKGV  SC AGNSGP P T  N+APW++TV AS +DR FP  V L NG+T
Sbjct  303   SMAIAAFGAMQKGVFFSCSAGNSGPIPSTVGNMAPWMMTVAASYVDRVFPTKVKLSNGKT  362

Query  910   FTGTSLYFGIQPSPNQVSMVY-----GRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             FTG+SLY  +     Q+ +VY     G+RA   +C+ G L +S V+GKIV C + +N   
Sbjct  363   FTGSSLY-SVAKKTKQLPLVYKETAGGKRA--EFCINGSLSSSLVKGKIVLCDRGSN-GR  418

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
              ++GF VK +GG GMI+ N   QG EL A++ ++P   V A+    I +Y    K++TA 
Sbjct  419   TEKGFVVKSAGGAGMILLNSPTQGEELFADSHVLPATTVGASAAKAIKEYYILNKNSTAS  478

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             I F GT  G    AP VAAFSSRGP+ + P ++KPD+ APGVNILAAW   I+P+E   D
Sbjct  479   ISFYGTRYG--ARAPVVAAFSSRGPSLVDPYVIKPDITAPGVNILAAWPPTISPTELKND  536

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
             NRR +FNI+SGTSM+CPH+SG+AA+++ ++  WSPAAIKSA+MT+ YT DN G   + D 
Sbjct  537   NRRVQFNIVSGTSMSCPHLSGIAALVKSVHKDWSPAAIKSAIMTSAYTHDNKGH-LISDA  595

Query  1615  YTGYPS---TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             Y    +   TP A GSGHVDP  A+DPGLVYD    DY+ +LC+I Y + ++ +  R   
Sbjct  596   YVSKSTKFATPFAFGSGHVDPERASDPGLVYDISGEDYLHYLCSINYTNAQLTILARKK-  654

Query  1786  LVDCRNRNLG---NPGALNYPSFAVV---FKNNLQTITYKRTVKNVGKVKNVAYQVTVQT  1947
                C +   G    PG LNYP+FAVV   F+    T+TYKRTV NVG  K ++Y+V V  
Sbjct  655   -YSCPSEKQGKSLQPGDLNYPAFAVVFDAFQRGKTTLTYKRTVTNVGTPK-ISYKVFVIK  712

Query  1948  PSNVRVTVSPNRLVFTDRIDTLSYEVTFQ------SLRQSADSFGSLRWSDGTHLVTSPI  2109
             P NV++ V P  L F    +  SY V+F       + R     FGSL W    + V SPI
Sbjct  713   PKNVKINVKPKVLTFKKLGEKQSYSVSFTGSGANITSRSGVSLFGSLMWMGAHYSVRSPI  772

Query  2110  AVSWE  2124
             AV+W+
Sbjct  773   AVTWQ  777



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/719 (49%), Positives = 464/719 (65%), Gaps = 26/719 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S++++Y+Y+ V HGFSARLT  +A  L    G+++V+P+   EL TTR+P+F
Sbjct  62    SSLKSVSGSAQMIYSYDTVVHGFSARLTAEEAGSLEARHGILAVMPELRYELHTTRTPEF  121

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   SS+L P+S+   ++++GVLD+G+WPE  SF D GL  +P+ WR  CE G  F A
Sbjct  122   LGL-DKSSSLLPASESVNEVVVGVLDTGVWPESKSFDDTGLGAVPSGWRGACESGTNFTA  180

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
              +CNRK+IGAR + +GYEA  G   +  E KSA D  GHGTH AS AAGSAV  A++ G+
Sbjct  181   ANCNRKLIGARFFSKGYEATMGPIDVSKESKSARDDDGHGTHTASTAAGSAVDGASLFGY  240

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+AT AR+A YKVCWLG C ++DIL+ M++AV DGV+VLSLS+G     G +  
Sbjct  241   APGTARGMATRARVAAYKVCWLGGCFSSDILAAMEKAVVDGVNVLSLSLG-----GGSPD  295

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             +  D +AIGAF A +KG+ VSC AGN+GP   +  N+APWI TVGA T+DR+FPA VTLG
Sbjct  296   FYRDSVAIGAFAAAEKGIFVSCSAGNAGPSSMSLSNVAPWIATVGAGTLDRDFPAYVTLG  355

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYG----RRANSRYCLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ F+G SLY G       +  VY        N   C+ G LD +KV+GKIV C +  N
Sbjct  356   NGKNFSGVSLYSG-NSKGTLLPFVYAGNVSNATNGNLCMMGTLDPAKVKGKIVLCDRGVN  414

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +G  V+ +GG GM+++N    G ELVA+A ++P   V    GD I  Y+ +  + 
Sbjct  415   AR-VQKGSVVQLAGGAGMVLANTAANGEELVADAHLLPATAVGEKSGDAIKSYLFSDPNP  473

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA I+F GT  G  PS P VAAFSSRGPN +TP +LKPD+IAPGVNILA WTG I P+  
Sbjct  474   TATILFEGTKVGIQPS-PVVAAFSSRGPNSITPAVLKPDMIAPGVNILAGWTGGIGPTGL  532

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D+RR  FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT Y    +G   L
Sbjct  533   AVDDRRVAFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYVAYKNG-GKL  591

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
              D+ TG  STP  HG+GHVDP +A +PGLVYD  V DY+ FLC + Y S +I    R + 
Sbjct  592   QDVATGKDSTPFDHGAGHVDPVSALNPGLVYDLTVEDYLGFLCGLNYTSSQINTLARRNY  651

Query  1786  LVD-CRNRNLGNPGALNYPSFAVVFKNNL---QTITYKRTVKNVGKVKNVAYQVTVQTPS  1953
               D  ++ +L +   LNYPSFA  F +      TI Y RT+ NVG      Y+ T  + S
Sbjct  652   TCDPSKSYSLYD---LNYPSFAASFDSTSGGPTTIKYTRTLTNVGAATGT-YKATASSGS  707

Query  1954  -NVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
               +++ V P+ L F+   +  S+ VT    ++  S ++FG L WSDG   V SP+A SW
Sbjct  708   AGLKIAVVPDTLSFSKAGEKKSFTVTVTGSAMPASTNAFGQLEWSDGKQTVRSPMAFSW  766



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/583 (56%), Positives = 402/583 (69%), Gaps = 14/583 (2%)
 Frame = +1

Query  424   GRPIVD--EPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIATNARIAVYKVC  597
             GRP+ +  E KS  D  GHGTH AS AAGS V +A++   A+GEARG+A  ARIA YK+C
Sbjct  2     GRPMDESAESKSPRDTEGHGTHTASTAAGSVVQDASLFEFAKGEARGMAVKARIAAYKIC  61

Query  598   WLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIGAFGAVQKGVIV  777
             W   C ++DIL+ MDQAVADGV ++SLS+G     G A  Y+ D IAIGAFGA+  GV+V
Sbjct  62    WSLGCFDSDILAAMDQAVADGVDIISLSVG---ATGLAPRYDHDSIAIGAFGAMDHGVLV  118

Query  778   SCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTSLYFGIQPSPNQ  957
             SC AGNSGPDP TA+NIAPWILTVGASTIDREFPA V LG+GR F G S+Y G       
Sbjct  119   SCSAGNSGPDPLTAVNIAPWILTVGASTIDREFPADVVLGDGRIFGGVSIYSGDPLKDTN  178

Query  958   VSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAVKQSGGVGMIISNVR  1137
             + +VY     SR+C  G+L+ S+V GKIV C +  N   V++G AVK + G GMI++N  
Sbjct  179   LPLVYAGDCGSRFCFTGKLNPSQVSGKIVICDRGGNAR-VEKGTAVKMALGAGMILANTG  237

Query  1138  HQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTVTGNSPSAPRVAAFS  1317
               G EL+A++ ++P  +V    GD I +YVK+    TA I FRGTV G SP AP+VAAFS
Sbjct  238   DSGEELIADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIAFRGTVIGTSPPAPKVAAFS  297

Query  1318  SRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFNIMSGTSMACPHVSG  1497
             SRGPN LTPEILKPDVIAPGVNILA WTG+ AP++   D RR EFNI+SGTSM+CPHVSG
Sbjct  298   SRGPNHLTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPRRVEFNIISGTSMSCPHVSG  357

Query  1498  LAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNA  1677
             LAA+LRK YP W+PAAIKSALMTT Y LDNSG + + DL TG  S+P  HG+GHVDP  A
Sbjct  358   LAALLRKAYPKWTPAAIKSALMTTAYNLDNSGNN-IADLATGNQSSPFIHGAGHVDPNRA  416

Query  1678  ADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF  1857
               PGLVYD   NDY+ FLC IGYD+++IA+F+R    VDC    L  PG LNYP+F+VVF
Sbjct  417   LYPGLVYDIDANDYISFLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVF  476

Query  1858  K------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSY  2019
                    +    I  KR VKNVG   N  Y+V V  P  + V VSP +LVF+    T SY
Sbjct  477   NFDHDPVHQGNEIKLKRVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASY  536

Query  2020  EVTFQSLRQSADS-FGSLRWSDGTHLVTSPIAVSWEGRSVSEL  2145
             EV+F S+     S FGS+ WSDGTH+V SP+AV +   +VS +
Sbjct  537   EVSFTSVESYIGSRFGSIEWSDGTHIVRSPVAVRFHQDAVSSI  579



>ref|XP_006401917.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
 gb|ESQ43370.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
Length=779

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/713 (49%), Positives = 460/713 (65%), Gaps = 27/713 (4%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI-SGSS  204
             + +LYTY+   HG +ARL+  +A  L    GV+SV+P+   EL TTRSP FLGL    S 
Sbjct  75    NRILYTYQTAFHGLAARLSEEEAERLEEEAGVVSVIPETRYELHTTRSPTFLGLERQESE  134

Query  205   NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKII  384
              +        D+++GVLD+GIWPE  SF+D G++P+P++WR  CE G +F   +CNRKI+
Sbjct  135   RVLAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVPSTWRGACETGKRFLRRNCNRKIV  194

Query  385   GARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             GAR +Y+GYEA TG+  +DE    +S  D  GHGTH A+  AGS V  AN+ G A G AR
Sbjct  195   GARVFYKGYEAATGK--IDEEVEYRSPRDKDGHGTHTAATVAGSPVRGANLFGFAYGTAR  252

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A  AR+A YKVCW+G C ++DILS +DQAVADGV VLS+S+G     G    Y+ D +
Sbjct  253   GMAPRARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLG-----GGISTYSRDSL  307

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             AI  FGA++ GV VSC AGN GPDP +  N++PWI TVGAST+DR+FPA + LG  R F 
Sbjct  308   AIATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATMKLGTKRIFK  367

Query  916   GTSLYFG--IQPSPNQVSMVY-GRRANS----RYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G SLY G        Q  +VY GR A+S     +CL G LD   V GKIV C +      
Sbjct  368   GVSLYKGRTALSRNKQYPLVYLGRNASSPDPTSFCLDGSLDRHNVAGKIVICDR-GVTPR  426

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V +G  VK++GG+GM+++N    G ELVA++ ++P   V   +G +I  Y   +K ATA 
Sbjct  427   VQKGQVVKRAGGIGMVLTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSKKATAT  486

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             +   GT  G  PS P VAAFSSRGPNFL+ EILKPD++APGVNILAAW+G +APS  + D
Sbjct  487   LEILGTRIGIKPS-PVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSD  545

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR +FNI+SGTSM+CPHVSG+AA++R  +P WSPAAIKSALMTT Y  DN+ +  L D 
Sbjct  546   PRRVKFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTFKP-LTDA  604

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
                 PS+P+ HG+GH++P  A DPGL+YD G  DY DFLCT      ++ +F ++S    
Sbjct  605   SGAAPSSPYDHGAGHINPLKAIDPGLIYDIGPQDYFDFLCTQELSPSQLKVFTKHSNR-S  663

Query  1795  CRNRNLG-NPGALNYPSFAVVFKNN--LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
             C++   G NPG LNYP+ + +F  N  ++++T +RTV NVG     +Y+V+V       V
Sbjct  664   CKHSLAGNNPGNLNYPAISALFPENTHVKSMTLRRTVTNVGP-HIASYKVSVSPFKGASV  722

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQS-LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             TV P  L FT +   LSY VTF++ LR     FG L W   TH V SP+ ++W
Sbjct  723   TVQPKTLNFTRKHQKLSYTVTFRTKLRLKRPEFGGLLWKSATHRVRSPVIITW  775



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/713 (50%), Positives = 454/713 (64%), Gaps = 24/713 (3%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
             S ++ +LYTY  + HG+SARLT ++A+ L + PGVI V P+   EL TTR+P+FLGL  G
Sbjct  64    SDAATVLYTYSTLLHGYSARLTRAEAAALESQPGVIVVNPEVRYELHTTRTPEFLGL-DG  122

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             +  L P S  G D+++GVLD+G+WPER S+ D G  P+P  W+ KCE G  F A++CN+K
Sbjct  123   TDALFPQSGTGTDVVVGVLDTGVWPERPSYDDTGFGPVPAGWKGKCEDGNDFNASACNKK  182

Query  379   IIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGAR +  GYEA  G P+    E +S  D  GHGTH +S AAG AV  A++ G+A G A
Sbjct  183   LIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGTA  241

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             +G+A  AR+A YKVCW+G C ++DIL  M+ AV DGV VLSLS+G    E     Y  D 
Sbjct  242   KGMAPRARVATYKVCWVGGCFSSDILKAMEVAVTDGVDVLSLSLGGGTAE-----YYRDS  296

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IA+GAF A++KG+ VSC AGN+GP   T  N APWI TVGA TIDR+FPA VTLGNG+ +
Sbjct  297   IAVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAYVTLGNGKNY  356

Query  913   TGTSLYFGIQPSPNQ-VSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLANITIV  1077
             TG SLY G +P P   +  +Y G  +NS   + C+ G L   KV GKIV C +  N   V
Sbjct  357   TGVSLYSG-KPLPTTPMPFIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNAR-V  414

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +GF VK +GG GM+++N    G ELVA+A ++P + V    G+ + DY  +   ATA I
Sbjct  415   QKGFVVKDAGGAGMVLANTAANGEELVADAHVLPGSGVGEKAGNAMRDYAMSDPKATATI  474

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
             VF GT  G  PS P VAAFSSRGPN +T  +LKPD+IAPGVNILAAW+G++ PS    D 
Sbjct  475   VFAGTKVGVKPS-PVVAAFSSRGPNTVTSSVLKPDIIAPGVNILAAWSGSVGPSGLPGDG  533

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             RR  FNI+SGTSM+CPHVSGLAA+LR  +P WSPAAI+SALMTT Y     G + ++D+ 
Sbjct  534   RRVGFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNEYPGGGNGILDVA  593

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             TG P+TP   G+GHVDP  A DPGLVYD    DYVDFLC   Y++ +IA   R      C
Sbjct  594   TGRPATPLDVGAGHVDPAKAVDPGLVYDIAAADYVDFLCANNYEAAQIAALTRQHASEGC  653

Query  1798  RNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGK---VKNVAYQVTVQTPSNVRVT  1968
                      ALNYPSF+V F     T  + RTV NVG+    K  A      TP  V VT
Sbjct  654   SANRTYAVTALNYPSFSVAFPAAGGTAKHTRTVTNVGQPGTYKVAASAAAGGTP--VTVT  711

Query  1969  VSPNRLVFTDRIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             V P+ L F+   +  SY V+F +  +    + FG L WS   H+V SPIA +W
Sbjct  712   VEPSTLSFSRAGEKQSYTVSFTAGGMPSGTNGFGRLVWSSDHHVVASPIAATW  764



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/715 (49%), Positives = 464/715 (65%), Gaps = 33/715 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY +  HGF+ RLTP +A  L   PGVISV  ++  EL TTR+P F
Sbjct  55    SSLKSASESAEMLYTYNNAIHGFATRLTPEEADSLMVQPGVISVQSEQQYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P +   +D++IGVLD+G+WPE  SFSD G  P+P++W+ +CE G  F A
Sbjct  115   LGLEVHNAGLFPETGAASDVVIGVLDTGVWPESKSFSDEGYGPVPSTWKGECETGTNFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvngha  540
             + CNRK+IGAR +            V E +S  D  GHGTH AS AAGS V  AN+ G A
Sbjct  175   SLCNRKLIGARFF------------VTESRSPRDDDGHGTHTASTAAGSVVEGANLLGFA  222

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A  AR+AVYKVCW  TC  +D+L+G+D+A+ D V+VLS+S+G + ++     Y
Sbjct  223   NGTARGMAYRARVAVYKVCWKPTCFGSDVLAGIDKAIEDNVNVLSISLGRRRRD-----Y  277

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
             N + IAIGAF A+++G+ VSC AGN GP P++  N+APWI TVGA T+DR+FPA+VTLGN
Sbjct  278   NNE-IAIGAFSAMERGIFVSCSAGNDGPSPFSLSNVAPWITTVGAGTLDRDFPALVTLGN  336

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRANSR-----YCLPGQLDASKVRGKIVYCKQLAN  1065
             G+ +TG SL+         +  VY   A++      +C PG L   KV+GKIV C++  N
Sbjct  337   GKNYTGVSLFKEDDLPSKLLPFVYAGNASNNATYGNFCFPGTLIPEKVKGKIVMCEKGVN  396

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
             +  V++G  VK +GG+GMI++N  ++G E  ANA ++P   V     DII  Y     + 
Sbjct  397   VR-VEKGEVVKAAGGLGMILANTAYEGEERTANAFLLPATTVGEKASDIIRHYALTDPNP  455

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA IVF+GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA+ PS  
Sbjct  456   TASIVFQGTVVNVQPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGAVGPSGL  514

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               D RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y+    G+  +
Sbjct  515   ASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYSTYKDGQP-I  573

Query  1606  IDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSP  1785
             ID+ T  PSTP  HG+GHV PT   +PGL+YD    DY+ FLC + Y+S  I +  R + 
Sbjct  574   IDIATVTPSTPFGHGAGHVSPTTTVNPGLIYDLTTVDYLGFLCALKYNSSLIRIISRGN-  632

Query  1786  LVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
                C      +   LNYPSFAV    +  T  Y RTV NVG   + + +VT +T + V++
Sbjct  633   -YACDPSKTYSVADLNYPSFAVNVDGS-DTYKYTRTVTNVGGAGSYSVKVTSET-TAVKI  689

Query  1966  TVSPNRLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +V P  L F +  +  SY VTF    S    + SFGS+ WSDG H+V SP+A+SW
Sbjct  690   SVEPAILNFKEVNEKKSYSVTFTVDSSKPSGSSSFGSIEWSDGKHVVASPVAISW  744



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/714 (49%), Positives = 453/714 (63%), Gaps = 37/714 (5%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPS  219
             YTY     GF+A L P QA  L     V+ V  D L  L TTRSPQFLG+   SS+ G S
Sbjct  83    YTYNTAYDGFAASLDPDQAQALRQSDAVLGVYEDTLYTLHTTRSPQFLGI---SSDFGLS  139

Query  220   SDYGA--------DIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
             + Y          D+IIGVLD+G+WPE  SF D  +  +P  WR +CE GP F    CN+
Sbjct  140   AGYSKLDFDKASLDVIIGVLDTGVWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKLCNK  199

Query  376   KIIGARAYYRGYEAVTG----RPIVDEPKSAIDMTGHGThvasiaagsavananvnghaR  543
             K+IGAR + +GY    G    +P  +EP+S  D  GHGTH AS AAG  VANA++ G+A 
Sbjct  200   KLIGARFFSKGYHMAGGSFSKKP--NEPESPRDYDGHGTHTASTAAGVPVANASLLGYAS  257

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G ARG+AT+AR+A YKVCW   C  +DIL+G+D+A+ DGV VLS+S+G     G + PY 
Sbjct  258   GVARGMATHARVATYKVCWKTGCFGSDILAGIDRAIQDGVDVLSMSLG-----GGSAPYY  312

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
              D IA+GAF A++KG++VSC AGNSGP   +  N+APWILTVGA T+DR+FPA V LGN 
Sbjct  313   RDTIAVGAFAAMEKGIVVSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNK  372

Query  904   RTFTGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANIT  1071
             +  TG SLY G       VS+VY + +N       CLPG L    VRGK+V C +  N  
Sbjct  373   KKATGVSLYSGNGMGNKPVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINAR  432

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G  V+ +GGVGMI++N    G ELVA++ ++P   +    GDI+ +Y K   + TA
Sbjct  433   -VEKGAVVRDAGGVGMILANTAASGEELVADSHLLPAVAIGRKMGDIVREYAKTVPNPTA  491

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              + F GTV    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAWT A  P+E  K
Sbjct  492   LLTFGGTVLNVRPS-PVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEK  550

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RRT+FNIMSGTSM+CPH+SG+AA+L+  +P WSP+AIKSALMTT Y +DN+ +S L D
Sbjct  551   DTRRTKFNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNT-KSPLHD  609

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                G  STP AHGSGHV+P  A  PGLVYD    DYV FLC++GY  + +   ++  P +
Sbjct  610   AADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKR-PNI  668

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
              C  R    PG LNYPSF+V+F +  + + Y R + NVG  +++ Y VT   PS V ++V
Sbjct  669   TC-TRKFNTPGELNYPSFSVLFGDQ-RVVRYTRELTNVGPARSL-YNVTADGPSTVGISV  725

Query  1972  SPNRLVFTDRIDTLSYEVTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P RL+F    +   Y VTF +     +    +FGS+ W +  H V SP+A SW
Sbjct  726   RPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSW  779



>emb|CDY22001.1| BnaC09g01070D [Brassica napus]
Length=734

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/716 (48%), Positives = 449/716 (63%), Gaps = 47/716 (7%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ELLYTY    HGFS RLTP +A  L   PGVISVLP++  EL TTR+P F
Sbjct  55    SSLRSVSESAELLYTYNSAIHGFSTRLTPEEADSLMTHPGVISVLPEKRYELDTTRTPHF  114

Query  181   LGLISGSSNLGP-SSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL   ++ L P ++   +DI++GV DSG+WPE  SF+D G  PIP +W+  C+ G  F 
Sbjct  115   LGLDVHNAGLFPETTGASSDIVVGVFDSGVWPESKSFADEGYGPIPPTWKGGCDTGTNFT  174

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             A+ CNRK++GAR + RGYE + G   VDE   +ID+ G                      
Sbjct  175   ASLCNRKLVGARFFARGYEEINGP--VDE---SIDLLGFA--------------------  209

Query  538   aRGEARGIATNARIAVYKVCW-LGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
               G ARG+A+ AR+A+YKVCW  G C ++DIL+GMD+A+ D V+V+S+SI        A 
Sbjct  210   -NGTARGVASRARVAIYKVCWRYGGCLSSDILAGMDKAIEDNVNVMSISI-----SEIAV  263

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A+++G+ VSC AGN GP  Y+  N+APWI TVGA TIDR+FPA+V L
Sbjct  264   DYYGDIMAIGAFAAMERGIFVSCSAGNRGPSSYSVRNVAPWITTVGAGTIDRDFPALVIL  323

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ +TG SL+ G    P  +S VY   A++      C P  L   KV+GKIV C+   
Sbjct  324   GNGQNYTGASLFKGDALPPKLLSFVYAGNASNNDTGNLCYPETLIPEKVKGKIVMCEDGG  383

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V +G  VK +GG+GMI+ N    G EL A A ++P A V    GD+I +YV    +
Sbjct  384   N-SRVHKGEVVKAAGGLGMILPNTADDGEELQAVAYLLPAATVGQKAGDVIRNYVLTDPN  442

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TARIV +GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILA WTG  +P+ 
Sbjct  443   PTARIVIQGTVVNVQPS-PVLAAFSSRGPNPVTPNILKPDLIAPGVNILAGWTGVASPTR  501

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y     G+  
Sbjct  502   LDSDTRRVEFNILSGTSMSCPHVSGLAALLKSVHPQWSPAAIRSALMTTAYKSYKDGKQ-  560

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             +ID+ T  PSTP  HG+GHV PT A +PGL+YD    DY+DFLC + Y +  I +  R +
Sbjct  561   IIDIATVTPSTPLGHGAGHVSPTTATNPGLIYDLTAVDYLDFLCAMDYTASDIEIVSRRN  620

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                 C      +   LNYPSFA V+ +      Y RTV +VG     + +VT +T + V+
Sbjct  621   --YTCDPSKAYSVADLNYPSFA-VYVDVAGEYKYTRTVTSVGGAGTYSVKVTSETRA-VK  676

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             + V P  L F +  +  SY VTF    S    ++SFGS+ WSDG H+V+SP+AVSW
Sbjct  677   ILVEPAVLNFKEVNEKKSYAVTFTVDLSKPSGSNSFGSIEWSDGKHVVSSPVAVSW  732



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/723 (48%), Positives = 466/723 (64%), Gaps = 32/723 (4%)
 Frame = +1

Query  13    NHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
             + S  + +LY Y+ V HGFSA+LT + A  + N+ G ++V PD L  L TTR+P FLGL 
Sbjct  65    SKSDPAAMLYMYDTVMHGFSAKLTSTGAQAMENIDGCLAVFPDSLSRLHTTRTPDFLGLN  124

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNP-IPNSWRNKCEVGPQFPATSC  369
             S    L P S YG D+I+G+LD+G+WPE  SFSD GL   +P  W+ +CEVG  F A+ C
Sbjct  125   S-IDGLWPQSHYGEDVIVGLLDTGVWPESKSFSDEGLTSRVPAKWKGECEVGSDFNASHC  183

Query  370   NRKIIGARAYYRGYEAVTGRPIVDEP-KSAIDMTGHGThvasiaagsavananvnghaRG  546
             N K+IGAR + +GYEA+ GR    E  +S  D  GHGTH +S AAGS V  A++ G ARG
Sbjct  184   NNKLIGARYFVKGYEAMYGRIDKKEDYRSPRDADGHGTHTSSTAAGSEVPGASLFGFARG  243

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARGIAT AR+AVYKVCW  TC N+D+L+GM+ AVADGV +LSLS+G+ +      PY  
Sbjct  244   TARGIATKARLAVYKVCWAVTCVNSDVLAGMEAAVADGVDLLSLSLGIVDD----VPYYH  299

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGA GA++KGV VSC AGN+GP  Y   N APWI TVGASTIDREFPA V LGNG+
Sbjct  300   DTIAIGALGAIEKGVFVSCSAGNAGP--YAIFNTAPWITTVGASTIDREFPAPVVLGNGK  357

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANITI  1074
             ++ G+SL      +  Q+ +VYG+ A+S+    +C+ G LD   VRGKIV C  L     
Sbjct  358   SYMGSSLDKDKTLAKEQLPLVYGKTASSKQYANFCIDGSLDPDMVRGKIVLC-DLEEGGR  416

Query  1075  VDQGFAVKQSGGVGMII-SNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
             +++G  V+++GG GMI+ S  + + Y     ++++P  +V    G+ I  Y+  T++  A
Sbjct  417   IEKGLVVRRAGGAGMILASQFKEEDYS-ATYSNLLPATMVDLKAGEYIKAYMNTTRNPLA  475

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              I   G        AP V AFSSRGPN + PEILKPD++APGVNILAAWTG  +P+    
Sbjct  476   TIKTEGLTVIGKARAPVVIAFSSRGPNRVAPEILKPDLVAPGVNILAAWTGHTSPTGLIS  535

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RR +FNI+SGTSM+CPHV+G+AA++R  +P+W+PAAIKSALMT++   DN  +S + D
Sbjct  536   DKRRVDFNIISGTSMSCPHVAGIAALIRSAHPAWTPAAIKSALMTSSALFDNR-KSPISD  594

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
               T  P+   A G+GHV+P  A DPGLVYD G++DYV FLC++ Y ++ I +  +N+   
Sbjct  595   SITALPADALAMGAGHVNPNAALDPGLVYDLGIDDYVSFLCSLNYTAKHIQILTKNATSC  654

Query  1792  -DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
                R+R    PG LNYPSF+VVFK        +RTV NVG   +V Y++ V++P NV V 
Sbjct  655   PKLRSR----PGDLNYPSFSVVFKPRSLVRVTRRTVTNVGGAPSV-YEMAVESPENVNVI  709

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLRQSADS------FGSLRW---SDGTHLVTSPIAVSW  2121
             V P  L FT + +  +Y V F+S   S +       FG + W     GT +V SP+A++W
Sbjct  710   VEPRTLAFTKQNEKATYTVRFESKIASDNKSKRHRGFGQILWKCVKGGTQVVRSPVAIAW  769

Query  2122  EGR  2130
             + +
Sbjct  770   KDK  772



>ref|XP_011017137.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/724 (48%), Positives = 464/724 (64%), Gaps = 29/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+++LYTY ++ HGFS +LTP +A  L    G++SVLP+ + +L TT +P+F
Sbjct  67    SSLKSVSESADMLYTYNNIIHGFSTQLTPEEAELLEKQSGILSVLPEMIYKLHTTHTPEF  126

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL    + L P+S   +++I+GVLD+G+WPE  SF D GL PIP++W+  CEVG  F +
Sbjct  127   LGLGKSDAVLLPASASLSEVIVGVLDTGVWPEIKSFDDTGLGPIPSTWKGSCEVGKNFNS  186

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             +SCNRK+IGA+ + +GYEA  G PI +  E KS  D  GHGTH A+ AAGSAV+ A++ G
Sbjct  187   SSCNRKLIGAQYFSKGYEASFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFG  245

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+A YKVCWLG C ++DIL+ M++AVADGV+V+S+SIG     G   
Sbjct  246   YASGIARGMATEARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVMSMSIG-----GGLS  300

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A  +G++VSC AGN GP P +  N+APWI TVGA T+DR+FPA V+L
Sbjct  301   DYTRDTVAIGAFRAAAQGILVSCSAGNGGPSPGSLSNVAPWITTVGAGTLDRDFPAYVSL  360

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLA  1062
             GNGR  +G SLY G   S + + +VY G  +NS     C+ G L  ++V GKIV C +  
Sbjct  361   GNGRKHSGISLYSGKPLSDSLMPLVYAGNVSNSTSGSLCMIGTLIPAQVAGKIVICDRGG  420

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V +G  VK SGG+GMI++N    G ELVA+A ++PTA V     + I +Y      
Sbjct  421   N-SRVQKGLVVKDSGGLGMILANTELYGEELVADAHLLPTAAVGLRTANAIKNYAFLDPK  479

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
                 I   GT  G  PS P VAAFSSRGPN +TPE+LKPD+IAPGVNILA WTG   P+ 
Sbjct  480   PVGTIASGGTKLGVEPS-PVVAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGGAGPTG  538

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              T D R  EFNI+SGTSM+CPHVSGLAA+++  +  WSPAAIKSALMTT Y    +G + 
Sbjct  539   LTNDKRHVEFNIISGTSMSCPHVSGLAALIKAAHQDWSPAAIKSALMTTAYATYKNGEN-  597

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             ++D+ TG PSTP  +G+GHV+P  A DPGLVYD  V+DY+ F C + Y +  I   + N 
Sbjct  598   ILDVATGQPSTPFDYGAGHVNPVAALDPGLVYDATVDDYISFFCALNYSASDIKQ-ITNK  656

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNN---------LQTITYKRTVKNVGKVKNVAYQV  1935
               + C +    + G LNYPSF+V  +              + Y RT+ NVG        +
Sbjct  657   DFI-CNSSKEYSLGDLNYPSFSVPLQTASGKEGGAGMKSRVKYTRTLTNVGAPATYKVSM  715

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             T QT S V++   P  L F    +  SY VTF   S+    +SF  L WSDG H+V SPI
Sbjct  716   TSQTTS-VKMLAEPESLSFAKEYEKKSYTVTFTATSMPSGTNSFAHLEWSDGKHVVRSPI  774

Query  2110  AVSW  2121
             A SW
Sbjct  775   AFSW  778



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/712 (50%), Positives = 454/712 (64%), Gaps = 23/712 (3%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
             S ++ +LYTY  + HG+SARLT ++A+ L + PGV+ V P+   EL TTR+ +FLGL  G
Sbjct  64    SDAATVLYTYNTLLHGYSARLTRAEAAALESQPGVLVVNPEVRYELHTTRTWEFLGL-DG  122

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
             +  L P S  G+D+I+GVLD+G+WPER S+ D G  P+P  W+ KCE G  F AT+CN+K
Sbjct  123   TDALFPQSGTGSDVIVGVLDTGVWPERPSYDDTGFGPVPAGWKGKCEDGNDFNATACNKK  182

Query  379   IIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGAR +  GYEA  G P+    E +S  D  GHGTH +S AAG AV  A++ G+A G A
Sbjct  183   LIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGTA  241

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             +G+A  AR+A YKVCW+G C ++DIL  M+ AV DGV VLSLS+G    E     Y  D 
Sbjct  242   KGMAPRARVATYKVCWVGGCFSSDILKAMEVAVTDGVDVLSLSLGGGTAE-----YYRDS  296

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             IA+GAF A++KG+ VSC AGN+GP   T  N APWI TVGA TIDR+FPA V LGNG+ +
Sbjct  297   IAVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAYVMLGNGKNY  356

Query  913   TGTSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             TG SLY G       V  +Y G  +NS   + C+ G L   KV GKIV C +  N   V 
Sbjct  357   TGVSLYSGKLLPTTPVPFIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNAR-VQ  415

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +GF VK +GG GM+++N    G ELVA+A ++P + V    G+ + DY  +   ATA IV
Sbjct  416   KGFVVKDAGGAGMVLANTAANGEELVADAHVLPGSGVGEKAGNAMRDYAMSDPKATATIV  475

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT  G  PS P VAAFSSRGPN +T  ILKPDVIAPGVNILAAW+G++ PS    D+R
Sbjct  476   FAGTKVGIKPS-PVVAAFSSRGPNTVTSSILKPDVIAPGVNILAAWSGSVGPSGLPGDSR  534

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R  FNI+SGTSM+CPHVSGLAA+LR  +P WSPAAI+SALMTT Y  D  G + ++D+ T
Sbjct  535   RVGFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYN-DYPGGAGILDVAT  593

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
             G P+TP   G+GHVDP  A DPGLVYD    DY+DFLC   Y+  +IA   R  P   C 
Sbjct  594   GRPATPLDVGAGHVDPAKAVDPGLVYDITAADYIDFLCANNYEPAQIAALTRQHPSEGCS  653

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN---VRVTV  1971
                     ALNYPSF+V F     T+ + RTV NVG+     Y+VT    +    V V+V
Sbjct  654   ANRTYTVTALNYPSFSVAFPAAGGTVKHTRTVTNVGQPGT--YKVTASAAAGSAPVTVSV  711

Query  1972  SPNRLVFTDRIDTLSYEVTFQS--LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P+ L F+   +  SY V+F +  +    + FG L WS   H+V SPIA +W
Sbjct  712   EPSTLSFSKAGEKQSYTVSFTAGGMASGTNGFGRLVWSSDHHVVASPIAATW  763



>dbj|BAJ96698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/717 (49%), Positives = 457/717 (64%), Gaps = 29/717 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS  204
             ++++LY Y+ V HGFSARLT  +AS++A + GV++V P+   EL TTR+P+FLGL +G+ 
Sbjct  66    AAKMLYAYDTVLHGFSARLTEQEASDMAGMEGVLAVNPETRYELHTTRTPEFLGL-AGNE  124

Query  205   NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKII  384
              L P S    D+++GVLD+G+WPE  S+ D GL  +P+SW+  C  G  F +++CNRK+I
Sbjct  125   GLFPQSGTAGDVVVGVLDTGVWPESKSYDDAGLGEVPSSWKGTCMAGADFNSSACNRKLI  184

Query  385   GARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARG  558
             GAR + RGYEA   RP+    E +S  D  GHGTH +S AAG+AVA+A++ G A G ARG
Sbjct  185   GARFFNRGYEAAM-RPMDTSRESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGTARG  243

Query  559   IATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIA  738
             +A  AR+AVYKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G +  Y  D +A
Sbjct  244   MAPKARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGSADYARDSVA  298

Query  739   IGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTG  918
             IGAF A+++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V LGNG+ +TG
Sbjct  299   IGAFAAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYTG  358

Query  919   TSLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLANITIVDQG  1086
              SLY G  P      ++Y G  +NS     C+PG L   KV+GKIV C +  +   V +G
Sbjct  359   VSLYAGKAPPTTPTPLIYAGNASNSTSGNLCMPGTLSPEKVQGKIVVCDRGISAR-VQKG  417

Query  1087  FAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFR  1266
             F V+ +GG GM+++N    G ELVA+A ++P A V   +G  I  Y+ +    TA IV  
Sbjct  418   FVVRDAGGAGMVLANTAANGQELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIA  477

Query  1267  GTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRT  1446
             GT     PS P VAAFSSRGPN +TPEILKPD+I PGVNILAAWTG   P+    D RR 
Sbjct  478   GTQVNVRPS-PLVAAFSSRGPNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRV  536

Query  1447  EFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR-STLIDLYTG  1623
              FNI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y+    G  S ++D  TG
Sbjct  537   SFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYSTYTGGAGSPILDAATG  596

Query  1624  YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRN  1803
               +TP  +G+GHVDPT A +PGLVYD G  DYVDFLC + Y    IA   R S    C  
Sbjct  597   AAATPFDYGAGHVDPTRAVEPGLVYDLGTGDYVDFLCALKYTPNMIAALAR-SKAYGCAA  655

Query  1804  RNLGNPGALNYPSFAVVFK--------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNV  1959
                 +   LNYPSF+V +         +   T+T+ RT+ NVG         +V   S V
Sbjct  656   NKTYSVSNLNYPSFSVAYSTANGEAGDSGATTVTHTRTLTNVGAAGTYKVDASVSM-SGV  714

Query  1960  RVTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSW  2121
              V V P  L FT   +  SY V+F + +        FG L WSDG H V SPIA++W
Sbjct  715   TVDVKPTELEFTAIGEKKSYTVSFTAAKSQPSGTAGFGRLVWSDGKHTVASPIALTW  771



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/714 (49%), Positives = 454/714 (64%), Gaps = 37/714 (5%)
 Frame = +1

Query  40    YTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLGPS  219
             YTY    +GF+A L P QA  L     V+ V  D L  L TTRSPQFLG+   SS+ G  
Sbjct  64    YTYNTAYNGFAASLDPDQAQALRQSDAVLGVYEDTLYTLHTTRSPQFLGI---SSDFGLL  120

Query  220   SDYGA--------DIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNR  375
             + Y          D+IIGVLD+G+WPE  SF D  +  +P  WR +CE GP F    CN+
Sbjct  121   AGYSKLDFDKASLDVIIGVLDTGVWPESKSFDDSAMPEVPTKWRGQCESGPDFSPKLCNK  180

Query  376   KIIGARAYYRGYEAVTG----RPIVDEPKSAIDMTGHGThvasiaagsavananvnghaR  543
             K+IGAR + +GY    G    +P  +EP+S  D  GHGTH AS AAG  VANA++ G+A 
Sbjct  181   KLIGARFFSKGYHMAGGSFSKKP--NEPESPRDYDGHGTHTASTAAGVPVANASLLGYAS  238

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G ARG+AT+AR+A YKVCW   C  +DIL+G+D+A+ DGV VLS+S+G     G + PY 
Sbjct  239   GVARGMATHARVATYKVCWKTGCFGSDILAGIDRAIQDGVDVLSMSLG-----GGSAPYY  293

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
              D IA+GAF A++KG++VSC AGNSGP   +  N+APWILTVGA T+DR+FPA V LGN 
Sbjct  294   RDTIAVGAFAAMEKGIVVSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNK  353

Query  904   RTFTGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANIT  1071
             +  TG SLY G       VS+VY + +N       CLPG L    VRGK+V C +  N  
Sbjct  354   KKATGVSLYSGNGMGNKPVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINAR  413

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G  V+ +GGVGMI++N    G ELVA++ ++P   +    GDI+ +Y K   + TA
Sbjct  414   -VEKGAVVRDAGGVGMILANTAASGEELVADSHLLPAVAIGRRMGDIVREYAKTVPNPTA  472

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              + F GTV    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAWT A  P+E  K
Sbjct  473   LLTFGGTVLNVRPS-PVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEK  531

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D RRT+FNIMSGTSM+CPH+SG+AA+L+  +P WSP+AIKSALMTT Y +DN+ +S L D
Sbjct  532   DTRRTKFNIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNT-KSPLHD  590

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                G  STP AHGSGHV+P  A  PGLVYD    DY+ FLC++GY  + +   ++  P +
Sbjct  591   AADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYIAFLCSLGYTIEHVKAIVKR-PNI  649

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
              C  R    PG LNYPSF+V+F +  + + Y R + NVG  +++ Y VTV  PS V ++V
Sbjct  650   TC-TRKFNTPGELNYPSFSVLFGDQ-RVVRYTRELTNVGPARSL-YNVTVDGPSTVGISV  706

Query  1972  SPNRLVFTDRIDTLSYEVTFQS----LRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P RL+F    +   Y VTF +     +    +FGS+ W +  H V SP+A SW
Sbjct  707   RPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSW  760



>dbj|BAJ86110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/716 (49%), Positives = 455/716 (64%), Gaps = 27/716 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS  204
             ++++LY Y+ V HGFSARLT  +AS++A + GV++V P+   EL TTR+P+FLGL +G+ 
Sbjct  66    AAKMLYAYDTVLHGFSARLTEQEASDMAGMEGVLAVNPETRYELHTTRTPEFLGL-AGNE  124

Query  205   NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKII  384
              L P S    D+++GVLD+G+WPE  S+ D GL  +P+SW+  C  G  F +++CNRK+I
Sbjct  125   GLFPQSGTAGDVVVGVLDTGVWPESKSYDDAGLGEVPSSWKGTCMAGADFNSSACNRKLI  184

Query  385   GARAYYRGYEAVTG-RPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGI  561
             GAR + RGYEA  G      E +S  D  GHGTH +S AAG+AVA+A++ G A G ARG+
Sbjct  185   GARFFNRGYEAAMGPMDTSRESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGTARGM  244

Query  562   ATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAI  741
             A  AR+AVYKVCWLG C ++DIL+GMD AVADG  VLSLS+G     G +  Y  D +AI
Sbjct  245   APKARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLG-----GGSADYARDSVAI  299

Query  742   GAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGT  921
             GAF A+++ V+VSC AGN+GP   T  N+APWI TVGA T+DR+FPA V LGNG+ +TG 
Sbjct  300   GAFAAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYTGV  359

Query  922   SLYFGIQPSPNQVSMVY-GRRANS---RYCLPGQLDASKVRGKIVYCKQLANITIVDQGF  1089
             SLY G  P      ++Y G  +NS     C+PG L   KV+GKIV C +  +   V +GF
Sbjct  360   SLYAGKAPPTTPTPLIYAGNASNSTSGNLCMPGTLSPEKVQGKIVVCDRGISAR-VQKGF  418

Query  1090  AVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRG  1269
              V+ +GG GM+++N    G ELVA+A ++P A V   +G  I  Y+ +    TA IV  G
Sbjct  419   VVRDAGGAGMVLANTAANGQELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIAG  478

Query  1270  TVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTE  1449
             T     PS P VAAFSSRGPN +TPEILKPD+I PGVNILAAWTG   P+    D RR  
Sbjct  479   TQVNVRPS-PLVAAFSSRGPNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRVS  537

Query  1450  FNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR-STLIDLYTGY  1626
             FNI+SGTSM+CPHVSGLAA+LR  +P WSPAA++SALMTT Y+    G  S ++D  TG 
Sbjct  538   FNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALMTTAYSTYTGGAGSPILDAATGA  597

Query  1627  PSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNR  1806
              +TP  +G+GHVDPT A +PGLVYD G  DYVDFLC + Y    IA   R S    C   
Sbjct  598   AATPFDYGAGHVDPTRAVEPGLVYDLGTGDYVDFLCALKYTPNMIAALAR-SKAYGCAAN  656

Query  1807  NLGNPGALNYPSFAVVFK--------NNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVR  1962
                +   LNYPSF+V +         +   T+T+ RT+ NVG         +V   S V 
Sbjct  657   KTYSVSNLNYPSFSVAYSTANGEAGDSGATTVTHTRTLTNVGAAGTYKVDASVSM-SGVT  715

Query  1963  VTVSPNRLVFTDRIDTLSYEVTFQSLRQSAD---SFGSLRWSDGTHLVTSPIAVSW  2121
             V V P  L FT   +  SY V+F + +        FG L WSDG H V SPIA++W
Sbjct  716   VDVKPTELEFTAIGEKKSYTVSFTAAKSQPSGTAGFGRLVWSDGKHTVASPIALTW  771



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/710 (49%), Positives = 456/710 (64%), Gaps = 32/710 (5%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNLG  213
             LLYTY+   HG++A L P +   L     V+ V  D +  L TTR+P+FLGL SG   LG
Sbjct  64    LLYTYDVAYHGYAAALIPEEVESLRQSESVVGVYEDTIYSLHTTRTPEFLGLDSG---LG  120

Query  214   PSSDYG--------ADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQF-PATS  366
             P + +          D+IIGVLD+G+WPE  SF D  +  +P  WR +CE    F P   
Sbjct  121   PWAGHSLQELNQASQDVIIGVLDTGVWPESKSFIDADMPDVPARWRGECEAAHDFNPKIH  180

Query  367   CNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRG  546
             CN+K+IGAR + RGY   +G      P+   D  GHGTH AS AAGS V NA++ G+ARG
Sbjct  181   CNKKLIGARFFSRGYSVASGEKEAHSPR---DTDGHGTHTASTAAGSQVVNASLLGYARG  237

Query  547   EARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
              ARG+AT+AR+A Y+VCW   C  +DIL+ M++A+ DGV VLS+S+G     G + PY  
Sbjct  238   TARGMATHARLATYRVCWKTGCLGSDILAAMERAILDGVDVLSMSLG-----GGSAPYFR  292

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             D IAIGAF A++KG++VSC AGNSGP   +  N+APWI+TVGA TIDR+FPA   LGNG+
Sbjct  293   DTIAIGAFAAMEKGILVSCSAGNSGPTKESLANVAPWIMTVGAGTIDRDFPAFAILGNGK  352

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRANS--RYCLPGQLDASKVRGKIVYCKQLANITIVD  1080
              +TG SLY G       V +VY + +NS    CL G LD + VRGK+V C +  +   V+
Sbjct  353   KYTGVSLYSGKGIGRRMVELVYNKGSNSSSNMCLAGSLDPATVRGKVVVCDRGISPR-VE  411

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  V+++GGVGMI++N    G ELVA++ ++P   V    GD+I  YVK  K+ T  + 
Sbjct  412   KGAVVREAGGVGMILANTAASGEELVADSHLLPAVAVGRKAGDMIRQYVKTAKNPTVMMG  471

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GTV    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAW+ A+ PS   KD R
Sbjct  472   FAGTVVNVKPS-PVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWSRALGPSGLDKDTR  530

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             +T+FNIMSGTSM+CPH+SGLAA+L+  +P+WSP+AIKSALMTT YTLDN+  S L D   
Sbjct  531   KTQFNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTLDNA-NSPLRDAAD  589

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
                STP AHG+GHV+P  A  PGLVYD    DYV FLC++ Y  + I    +  P + C 
Sbjct  590   YSLSTPWAHGAGHVNPHKALSPGLVYDATPEDYVAFLCSLRYTVEMIQAIAKR-PNITCA  648

Query  1801  NRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPN  1980
              R   +PG LNYPSF+V+F  + + + Y R + NVG   +V Y V+V+ P  V V+V P+
Sbjct  649   -RKFRDPGQLNYPSFSVLFGKS-RIVKYSRELTNVGAAGSV-YLVSVEAPPTVAVSVKPS  705

Query  1981  RLVFTDRIDTLSYEVTF---QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             +LVF +  D   Y VTF   +S+   + +FGS+ W +    V SP+A SW
Sbjct  706   KLVFKNVGDKQRYTVTFTSKKSVNPVSHAFGSITWKNAQDQVKSPVAFSW  755



>emb|CDY18651.1| BnaA09g07440D [Brassica napus]
Length=751

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/720 (48%), Positives = 455/720 (63%), Gaps = 37/720 (5%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY    HGF+ RLTP +A  L   PGVISV P++  EL TTR+P F
Sbjct  55    SSLKSASESAEMLYTYNSAIHGFATRLTPEEADSLMTQPGVISVQPEQQYELHTTRTPLF  114

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L P +   +D++IGVLDSG+WPE  SFSD G  P+P +W+ +CE G  F A
Sbjct  115   LGLDVHNAGLFPETGAASDVVIGVLDSGVWPESKSFSDEGYGPVPTTWKGECEAGTNFTA  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananvngha  540
             + CNRK+IGAR +Y   +         E +S  D  GHGTH AS AAGS V  AN+ G A
Sbjct  175   SHCNRKLIGARFFYGPVDE------SKESRSPRDDDGHGTHTASTAAGSIVEGANLLGFA  228

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A  AR+AVYKVCW   C ++D+L+G+D+A+ D V+VLSLS+G + ++      
Sbjct  229   NGTARGMAYRARVAVYKVCWKPKCFSSDVLAGIDKAIEDNVNVLSLSLGKRKRD------  282

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               + IA+GAF A++KG+ VSC AGN GP P +  N+APWI TVGA TIDR+FP +VTLGN
Sbjct  283   YTNHIAMGAFSAMEKGIFVSCSAGNDGPSPSSLSNVAPWITTVGAGTIDRDFPTLVTLGN  342

Query  901   GRTFTGTSLYF--GIQPSPNQVSMVYGRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G+++ G SL+    + P     +  YG+      CL G L   KV GKIV C++  N   
Sbjct  343   GKSYIGASLFKKDALPPKLASNNATYGKS-----CLSGTLIPEKVYGKIVMCEKGEN-GR  396

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
              ++G  VK +GG+GMI++N   +G EL A A ++P   V    GDII  YV    + T  
Sbjct  397   AEKGEVVKAAGGIGMILANRASRGEELAAYAHVLPATNVGQKAGDIIRRYVMTDPNPTVS  456

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             IV +GTV    PS P +AAFSSRGPN +TP ILKPD+IAPGVNILAAWTGA+ PS    D
Sbjct  457   IVIQGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGALGPSGLASD  515

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              RR EFNI+SGTSM+CPHVSGLAA+L+ ++P WSPAAI+SALMTT Y+    G+  L+D+
Sbjct  516   TRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYSTYKDGQP-LLDI  574

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
              T  PSTP  HG+GHV P  A  PGL+YD    DY+DFLC + Y+  +I    R      
Sbjct  575   ATVKPSTPFGHGAGHVSPAMAISPGLIYDLTTEDYIDFLCALKYNQSQIIKVSRGD--YT  632

Query  1795  CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVS  1974
             C      +   LNYPSFAV    +  T  Y RTV NVG   + + +V  +T + V+++V 
Sbjct  633   CDPSKTYSVADLNYPSFAVNVDKS-DTYKYTRTVTNVGGAGSYSVKVISET-TEVKISVE  690

Query  1975  PNRLVFTDRIDTLSYEVT----------FQSLRQSA-DSFGSLRWSDGTHLVTSPIAVSW  2121
             P  L F +  +  SYEVT          F S R S  +SFGS+ WSDG H+V SP+A+SW
Sbjct  691   PAVLTFKEVNEKKSYEVTFTVNSSKPPRFSSFRPSGFNSFGSIEWSDGKHVVASPVAISW  750



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/714 (49%), Positives = 458/714 (64%), Gaps = 32/714 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL-  210
             LLYTY    HGF+A L P +A  L +   V+ V  D + EL TTR+P FLG ISG   L 
Sbjct  77    LLYTYTAAFHGFAATLDPDEADALRSSASVLGVYEDTVYELHTTRTPAFLG-ISGDLGLW  135

Query  211   --------GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATS  366
                     G    +G D+I+GVLD+G+WPE  SF D G+  +P  W+  CE GP F A S
Sbjct  136   DPQEGPNGGKRRAFG-DVIVGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSAKS  194

Query  367   CNRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvngh  537
             CN+K+IGAR + +G+   +G   +  P+   S  D  GHGTH AS AAGS VANA++ G+
Sbjct  195   CNKKLIGARFFSKGFRMASGSSFLKNPQEVESPRDRDGHGTHTASTAAGSPVANASLLGY  254

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G ARG+A +AR+A YKVCW   C  ADIL+GMD+A+ DGV VLSLS+G     G   P
Sbjct  255   ASGTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLG-----GGIAP  309

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IAIGAF A+++G+ VSC AGNSGP   +  N+APWI+TVGA T+DR+FPA   LG
Sbjct  310   YYRDTIAIGAFTAMERGIFVSCSAGNSGPVKESLANVAPWIMTVGAGTLDRDFPAYALLG  369

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANIT  1071
             NG+ + G SLY G     N V ++Y + +N   + CLPG L+ +  RGK+V C +  N  
Sbjct  370   NGKRYAGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNAR  429

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V++G  V+ +GGVGMI++N    G ELVA++ +IP   V    GD+I +Y K+ +S TA
Sbjct  430   -VEKGQVVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIREYAKSDRSPTA  488

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              + FRGTV    PS P VAAFSSRGPN +T +ILKPDVI PGVNILA W+ A  P+    
Sbjct  489   VLSFRGTVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLES  547

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D R+T FNI+SGTSM+CPH+SG+AA+L+  +P+WSP+AIKSALMTT Y LDN+ RS L D
Sbjct  548   DTRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYDLDNT-RSPLRD  606

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
                G  STP AHGSGHVDP  A  PGLVYD    DY+ FLC++ Y    +   ++  P V
Sbjct  607   AAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKR-PNV  665

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTV  1971
              C +R   +PG LNYPSF+VVF N+ + + Y R + NVG   ++ Y V+V  PS V VTV
Sbjct  666   TC-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRELTNVGAAGSM-YNVSVTGPSTVGVTV  722

Query  1972  SPNRLVFTDRIDTLSYEVTFQSLR----QSADSFGSLRWSDGTHLVTSPIAVSW  2121
              P +L+F    D + Y VTF S +     +   FGS+ WS+  + V SP+A +W
Sbjct  723   KPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  776



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/713 (48%), Positives = 459/713 (64%), Gaps = 30/713 (4%)
 Frame = +1

Query  28    SELLYTYEHVAHGFSARLTPSQA-SELANVPGVISVLPDRLVELQTTRSPQFLGL-----  189
             S LLYTY    HGFSA LT S+A S L +   ++ V  D L  L TTR+P+FLGL     
Sbjct  57    SSLLYTYTTSFHGFSAYLTSSEAESLLRDSDSILDVFEDPLYTLHTTRTPEFLGLNSEFG  116

Query  190   ISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSC  369
             +  + +L  +S+    +IIGVLD+G+WPE  SF D  +  IP+ WR +CE G  F +  C
Sbjct  117   VYTNQDLVSASN---GVIIGVLDTGVWPESKSFDDTDMPEIPSKWRGECESGSDFDSKLC  173

Query  370   NRKIIGARAYYRGYEAVTGRPIVDEPKSAI---DMTGHGThvasiaagsavananvngha  540
             N+K+IGAR++ +G++  +G       + ++   D+ GHGTH ++ AAGSAV NA+  G+A
Sbjct  174   NKKLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYA  233

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+AT AR+A YKVCW   C  +DIL+ MD+A+ DGV VLSLS+G     G + PY
Sbjct  234   AGTARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLG-----GGSAPY  288

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D IAIG+F A++KGV VSC AGNSGP   +  N+APW++TVGA T+DR+FPA   LGN
Sbjct  289   YRDTIAIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGN  348

Query  901   GRTFTGTSLYFGIQPSPNQVSMVY--GRRANSRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G+  TG SLY G+      + +VY  G  ++S  CLPG LD+S VRGKIV C +  N   
Sbjct  349   GKRLTGVSLYSGVGMGTKPLELVYNQGNSSSSNLCLPGSLDSSIVRGKIVVCDRGVNAR-  407

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V++G  V+ +GG+GMI++N    G ELVA++ ++P   V    GD++ +YVK+  + TA 
Sbjct  408   VEKGAVVRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTAV  467

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             +VF+GTV    PS P VAAFSSRGPN +TPEILKPDVI PGVNILA W+ AI P+   KD
Sbjct  468   LVFKGTVLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKD  526

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
             +RRT+FNIMSGTSM+CPH+SGLA +L+  +P WSP+AIKSALMTT Y LDN+  S L D 
Sbjct  527   SRRTQFNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNT-NSPLHDA  585

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
                  S PHAHGSGHVDP  A  PGLVYD    +Y+ FLC++ Y    I   ++ S  V+
Sbjct  586   ADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRSS-VN  644

Query  1795  CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVS  1974
             C  +   +PG LNYPSF+V+F    + + Y R V NVG   +V Y+V V     V ++V 
Sbjct  645   C-TKKFSDPGQLNYPSFSVLFGGK-RVVRYTREVTNVGAANSV-YKVMVNGAPTVEISVK  701

Query  1975  PNRLVFTDRIDTLSYEVTFQSLR----QSADSFGSLRWSDGTHLVTSPIAVSW  2121
             P++L F    +   Y VTF S +     +   FGS+ W +  H V SP+A SW
Sbjct  702   PSKLTFKRVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSW  754



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/719 (49%), Positives = 461/719 (64%), Gaps = 21/719 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+ +LYTY+ + HG+SARLT ++A  L   PGV+ V P+   EL TTR+P+F
Sbjct  56    SSLQSVSDSAAVLYTYDTLLHGYSARLTRAEAEALEAQPGVLLVNPETRYELHTTRTPEF  115

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  L P S   +D+++GVLD+G+WPER+S+ D G  P+P  W+ KCE G  F A
Sbjct  116   LGLDGRTDALFPQSGTASDVVVGVLDTGVWPERASYDDAGFGPVPTGWKGKCEEGNDFNA  175

Query  361   TSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananvngh  537
             ++CN+K+IGAR +  GYEA  G   +  E +S  D  GHGTH +S AAGSAV  A++ G+
Sbjct  176   SACNKKLIGARFFLTGYEASKGPVDVSKESRSPRDNDGHGTHTSSTAAGSAVRGADLLGY  235

Query  538   aRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKP  717
             A G A+G+A  AR+A YKVCW+G C ++DIL GM+ AVADGV VLSLS+G     G    
Sbjct  236   ASGTAKGMAPRARVATYKVCWVGGCFSSDILKGMEVAVADGVDVLSLSLG-----GGTSD  290

Query  718   YNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLG  897
             Y  D IA+GAF A++KG+ VSC AGN+GP   +  N APWI TVGA T+DR+FPA VTLG
Sbjct  291   YYRDSIAVGAFSAMEKGIFVSCSAGNAGPGAASLTNGAPWITTVGAGTLDRDFPAHVTLG  350

Query  898   NGRTFTGTSLYFGIQPSPNQVSMVY-GRRANSRY---CLPGQLDASKVRGKIVYCKQLAN  1065
             NG+ +TG SLY G Q     V  VY G  +NS     C+ G L   KV GKIV C +  N
Sbjct  351   NGKNYTGVSLYSGKQLPTTPVPFVYAGNASNSSMGALCMTGSLIPEKVAGKIVLCDRGTN  410

Query  1066  ITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
                V +GF VK +GG GM+++N    G ELVA+A ++P + V    G+ +  Y  +  + 
Sbjct  411   AR-VQKGFVVKDAGGAGMVLANTAANGEELVADAHILPGSGVGEKAGNAMRTYASSDPNP  469

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             TA IVF GT  G  PS P VAAFSSRGPN +TP +LKPD+IAPGVNILAAW+G+I PS  
Sbjct  470   TANIVFAGTKVGIQPS-PVVAAFSSRGPNTVTPGVLKPDLIAPGVNILAAWSGSIGPSGI  528

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSG--RS  1599
               DNRR+ FNI+SGTSM+CPHVSGLAA+LR  +  W+PAAI+SALMTT YT+  +G   +
Sbjct  529   AGDNRRSSFNIISGTSMSCPHVSGLAALLRSAHQDWTPAAIRSALMTTAYTVYPNGNYNN  588

Query  1600  TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRN  1779
              ++D+ TG P+TP   G+GHVDP+ A DPGLVYD    DYVDFLC I Y   ++A   ++
Sbjct  589   GILDVATGRPATPLDIGAGHVDPSKAVDPGLVYDITAADYVDFLCAINYGPAQVAALAKH  648

Query  1780  SPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN-  1956
             S    C         ALNYPSF+V          + RTV NVG+     Y+VT    +  
Sbjct  649   STADRCSANRTYAVTALNYPSFSVTLPAAGGAEKHTRTVTNVGQPGT--YKVTASAAAGG  706

Query  1957  --VRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSA--DSFGSLRWSDGTHLVTSPIAVSW  2121
               V V+V P+ L FT   +  SY V+F +  + +  + FG L WS   H+V SPI V+W
Sbjct  707   TPVSVSVEPSTLSFTKAGEKKSYTVSFAAGGKPSGTNGFGRLVWSSDHHVVASPIVVTW  765



>gb|KEH35793.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/723 (48%), Positives = 464/723 (64%), Gaps = 29/723 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S ++E +YTY+HVAHGFS RLT  +A  L   PG++SV+PD   EL TTR+P+F
Sbjct  47    SSLKSVSDTAETMYTYKHVAHGFSTRLTTQEADLLTKQPGILSVIPDVRYELHTTRTPEF  106

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   +  L PSS   +++I+GV+D+G+WPE  SF D GL P+P SW+ +CE G  F +
Sbjct  107   LGL-EKTITLLPSSGKQSEVIVGVIDTGVWPELKSFDDTGLGPVPKSWKGECETGKTFNS  165

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CN+K++GAR + +GYEA  G PI +  E KS  D  GHG+H ++ AAGSAVA A++ G
Sbjct  166   SNCNKKLVGARFFAKGYEAAFG-PIDENTESKSPRDDDGHGSHTSTTAAGSAVAGASLFG  224

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G A+G+AT AR+A YKVCWLG C  +DI + +D+A+ DGV+VLS+SIG     G   
Sbjct  225   FASGTAKGMATQARVAAYKVCWLGGCFTSDIAAAIDKAIEDGVNVLSMSIG-----GGLT  279

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +A+G F A++ G++VS  AGN GP   +  N+APWI TVGA TIDR+FPA +TL
Sbjct  280   DYYKDTVAMGTFAAIEHGILVSSSAGNGGPSKASLANVAPWITTVGAGTIDRDFPAYITL  339

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYG----RRANSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG  + G SLY G  P  + + +VY     + ++   C    L  SKV GKIV C +  
Sbjct  340   GNGNRYNGVSLYNGKLPPNSPLPLVYAANVSQDSSDNLCSTDSLIPSKVSGKIVICDRGG  399

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N    ++   VK++GG+GMI++N +  G ELVA++ ++P A +     + I  Y  +  +
Sbjct  400   NPR-AEKSLVVKRAGGIGMILANNQDYGEELVADSFLLPAAALGEKASNEIKKYASSAPN  458

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA+I F GT  G  PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA W+G + P+ 
Sbjct  459   PTAKIAFGGTRFGVQPS-PVVAAFSSRGPNILTPKILKPDLIAPGVNILAGWSGKVGPTG  517

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              + D R   FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT+Y    +G+ T
Sbjct  518   LSVDTRHVSFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTSYGTYKNGQ-T  576

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG P+TP  +GSGHVDP  A DPGLVYD   +DY++FLC + Y+S +I L  R  
Sbjct  577   IKDVATGIPATPLDYGSGHVDPVAALDPGLVYDATTDDYLNFLCALNYNSFQIKLVARRE  636

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF--------KNNLQTITYKRTVKNVGKVKNVAYQVT  1938
                 C  R       LNYPSF+V F         +N   + YKR + NVG        V+
Sbjct  637   --FTCDKRIKYRVEDLNYPSFSVPFDTASGRGSSHNPSIVQYKRILTNVGAPSTYKVSVS  694

Query  1939  VQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIA  2112
              Q+P + ++ V P  L F +  +  SY VTF   S+     SF  L WSDG H VTSPIA
Sbjct  695   SQSPLD-KIVVEPQTLSFKELNEKKSYTVTFTSHSMPSGTTSFAHLEWSDGKHKVTSPIA  753

Query  2113  VSW  2121
              SW
Sbjct  754   FSW  756



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/721 (49%), Positives = 454/721 (63%), Gaps = 25/721 (3%)
 Frame = +1

Query  1     SPLSNHSRSSE-LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQ  177
             +P S    +SE ++Y+YE   HGF+ARL   +A  L    GV++V P+ +  L TTRSP 
Sbjct  69    TPQSEDEDASERIIYSYETAFHGFAARLIEEEAQRLEEGYGVLAVYPETVYHLHTTRSPM  128

Query  178   FLGLISGSSNLGPSSDY--GADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQ  351
             FLGL +  S     SD     D+++GVLD+GIWPE +SF+D G+ P+P  W+  CE G  
Sbjct  129   FLGLETEDSTSTVWSDTLSDHDVVVGVLDTGIWPESASFNDTGMKPVPAQWKGACETGRG  188

Query  352   FPATSCNRKIIGARAYYRGYEAVTGR-PIVDEPKSAIDMTGHGThvasiaagsavananv  528
             F   +CN+KIIGAR +YRGYEA +G+    DE KS  D  GHGTH A+  AGS V  AN+
Sbjct  189   FTTDNCNKKIIGARIFYRGYEAASGKINEQDEYKSPRDQDGHGTHTAATVAGSPVEGANL  248

Query  529   nghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
              G+ARG ARG+A  AR+A YKVCWL  C ++DILS +D+AVADGV+VLS+S+G     G 
Sbjct  249   LGYARGTARGMAPRARVAAYKVCWLDGCFSSDILSAVDRAVADGVNVLSISLG-----GG  303

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
                Y  D ++I  F A++KGV VSC AGN GPDP +  N++PW++TVGAST+DR+FP+ V
Sbjct  304   VSSYYRDSLSIATFVAMEKGVFVSCSAGNGGPDPISLTNVSPWVITVGASTMDRDFPSTV  363

Query  889   TLGNGRTFTGTSLYFGIQ--PSPNQVSMVY-----GRRANSRYCLPGQLDASKVRGKIVY  1047
              LGNG   +G SLY G +   +  Q  + Y          S  CL G LD   V GKIV 
Sbjct  364   KLGNGHLSSGVSLYKGRRNLSAKKQYPLAYMGSNSSSPDPSSLCLEGTLDPRTVAGKIVI  423

Query  1048  CKQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYV  1227
             C +  N   V++G  VK +GGVGMI+SN    G ELVA++ ++P   V A  G  I  Y 
Sbjct  424   CDRGVNPR-VEKGQVVKSAGGVGMILSNTAANGEELVADSHLLPAVAVGAEAGKAIKRYA  482

Query  1228  KNTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGA  1407
                   TA +   GT     PS P VAAFSSRGPNFLT EILKPDV+APGVNILAAWTG 
Sbjct  483   LTNSRPTATLAILGTKLSIRPS-PVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWTGK  541

Query  1408  IAPSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDN  1587
               PS    D RR  FNI+SGTSM+CPHVSG+AA+L+  +P WSPAAIKS+LMTT Y  DN
Sbjct  542   AGPSGLPTDRRRVRFNILSGTSMSCPHVSGVAALLKAKHPEWSPAAIKSSLMTTAYIHDN  601

Query  1588  SGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIAL  1767
             + R+ L D  TG PS P  HG+GH++P  A DPGL+YD GV DY +FLCT      ++ +
Sbjct  602   T-RNPLKDASTGKPSNPFGHGAGHLNPLKALDPGLIYDMGVQDYFEFLCTQKLTPMQLKV  660

Query  1768  FLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYKRTVKNVGKVKNVAYQVTV  1941
             F ++S    C +  L NPG LNYP+ + VF  ++++  +T  RTV NVG   +  Y   V
Sbjct  661   FTKSSNR-SC-HHTLANPGDLNYPAISAVFPEQHSISLLTLHRTVTNVGSPVST-YHARV  717

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSL-RQSADSFGSLRWSDGTHLVTSPIAVS  2118
                    V+V P  L FT +   L+Y++TF +  RQS   FG+L WSDG H V SPI ++
Sbjct  718   SQFKGASVSVEPKTLQFTSKHRKLAYKITFTTKSRQSMPEFGNLIWSDGIHKVRSPIVIT  777

Query  2119  W  2121
             W
Sbjct  778   W  778



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/712 (49%), Positives = 460/712 (65%), Gaps = 27/712 (4%)
 Frame = +1

Query  25    SSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS  204
             +  ++Y+YE+  HGF+A+LT  +A +L ++PGV +VLP+ +  L TTRSP+FLG+   S+
Sbjct  112   AERIIYSYENAFHGFAAKLTEDEAEKLESIPGVATVLPETIYRLHTTRSPEFLGITGESN  171

Query  205   NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKII  384
             ++  ++    D+I+G+LD+GIWPE  SFSD G+  +P  WR  CE G  F A +CN+K++
Sbjct  172   SMWSAALSDHDVIVGILDTGIWPESPSFSDGGMTAVPPRWRGACETGRGFTAKNCNQKLV  231

Query  385   GARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaRGEAR  555
             GAR +YRGYEA +G   +DE    KS  D  GHGTH A+  AG+ V  AN+ G+ARG AR
Sbjct  232   GARIFYRGYEASSG--AIDERSEFKSPRDQDGHGTHTAATVAGAPVRGANLLGYARGTAR  289

Query  556   GIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPI  735
             G+A  AR+AVYKVCW G C ++DIL+ +D+AVADGV VLS+S+G     G    Y  D +
Sbjct  290   GMAPRARVAVYKVCWTGGCFSSDILAAVDRAVADGVDVLSISLG-----GGISTYYRDSL  344

Query  736   AIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFT  915
             ++ AFGA++ GV V+C AGN GP+P +  N++PWI TVGAST+DR+FPA V LGNG   T
Sbjct  345   SVAAFGAMEMGVFVACSAGNGGPEPISLTNVSPWIATVGASTMDRDFPAPVRLGNGMNLT  404

Query  916   GTSLYFG---IQPSPNQVSMVYGRRANS-----RYCLPGQLDASKVRGKIVYCKQLANIT  1071
             G SLY G   + P   Q  +VY     S       CL G LD   V GKIV C +  +  
Sbjct  405   GVSLYKGRRNLSPR-RQYPLVYMGGNTSIPDPRSLCLEGTLDPHVVAGKIVVCDRGISPR  463

Query  1072  IVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATA  1251
              V +G  VK +GG+GMI++N    G ELVA++ ++P   V  A G  I  Y       TA
Sbjct  464   -VQKGQVVKDAGGLGMILANTDANGEELVADSHLLPAVAVGEAAGKAIKQYSNVGSHPTA  522

Query  1252  RIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTK  1431
              + F GT  G  PS P VAAFSSRGPN LT EILKPDV+APGVNILAAW+G  +PS    
Sbjct  523   TMTFEGTKVGIRPS-PVVAAFSSRGPNILTLEILKPDVVAPGVNILAAWSGDASPSSLLA  581

Query  1432  DNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLID  1611
             D+RR  FNI+SGTSM+CPHV G+AA+L+  +P WSP+AIKSALMTT YT DN+ R  L D
Sbjct  582   DHRRVRFNILSGTSMSCPHVGGVAALLKASHPDWSPSAIKSALMTTAYTHDNTFRP-LKD  640

Query  1612  LYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLV  1791
               TG PSTP+ HG+GH+ P  A DPGL+YD   +DY +FLCT      ++ +F ++S   
Sbjct  641   AATGAPSTPYDHGAGHIRPAKAVDPGLIYDISPDDYFEFLCTQKLTPLQLKVFSKSSNRT  700

Query  1792  DCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVT  1968
              C++R L +PG LNYP+ + VF+      +T  RTV NVG   +  Y V V     V V 
Sbjct  701   -CKHR-LASPGDLNYPAISAVFREQPAPALTLHRTVTNVGPPVST-YHVRVTPFRGVDVA  757

Query  1969  VSPNRLVFTDRIDTLSYEVTFQSLR-QSADSFGSLRWSDGTHLVTSPIAVSW  2121
             V P  L FT +   LSY+VTF++   Q    FG+L WSDG HLV SP+AV+W
Sbjct  758   VEPKTLHFTHQNQKLSYKVTFRTKSPQPMPGFGALIWSDGIHLVRSPVAVTW  809



>ref|XP_002272965.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
 ref|XP_010661615.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/712 (49%), Positives = 468/712 (66%), Gaps = 30/712 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLYTYE    GF+A+L+  Q   L  V G +S +PD L+ L TT SPQFLGL  G   L
Sbjct  72    QLLYTYETAMTGFAAKLSIKQLQALDKVEGFLSAVPDELLSLHTTHSPQFLGLHKGK-GL  130

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
               + +   D+IIG++DSGIWPE  SF D G++P+P+ W+  CE G +F +++CN+K+IGA
Sbjct  131   WSTHNLATDVIIGIIDSGIWPEHVSFHDWGMSPVPSKWKGACEEGTKFTSSNCNKKLIGA  190

Query  391   RAYYRGYEAVTGR--PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             RA+++GYEA  GR    VD  +SA D  GHGTH AS AAG  VA A++ G A+G A G+ 
Sbjct  191   RAFFKGYEARAGRINETVDY-RSARDSQGHGTHTASTAAGDMVAGASIFGMAKGSASGMM  249

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               +RIA YKVC++  C+N+DIL+ +DQAV+DGV +LSLS+G     G ++PY  D +AI 
Sbjct  250   YTSRIAAYKVCYIQGCANSDILAAIDQAVSDGVDILSLSLG-----GASRPYYSDSLAIA  304

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             +FGAVQ GV+VSC AGNSGP   T  N APWI+T+ AS++DR FP +V LGNG T+ G S
Sbjct  305   SFGAVQNGVLVSCSAGNSGPSSSTVSNSAPWIMTIAASSLDRSFPTIVKLGNGETYHGAS  364

Query  925   LYFGIQPSPNQVSMVYGRRANSR---YCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             LY G +P+ +++ + YG  A S+   YC  G L    ++GKIV C++  N   V +G  V
Sbjct  365   LYSG-KPT-HKLLLAYGETAGSQGAEYCTMGTLSPDLIKGKIVVCQRGIN-GRVQKGEQV  421

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             + +GG GM++ N   QG EL+A+A ++P   + A+    I  Y  ++++ TA IVF+GTV
Sbjct  422   RMAGGAGMLLLNTEDQGEELIADAHILPATSLGASAAKSIIKYA-SSRNPTASIVFQGTV  480

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              GN   AP +AAFSSRGP    P ++KPDV APGVNILA+W   ++P+    DNR   FN
Sbjct  481   YGNP--APVMAAFSSRGPASEGPYVIKPDVTAPGVNILASWPPTVSPTRLNTDNRSVLFN  538

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT-GYPS  1632
             I+SGTSM+CPHVSGLAA+L+ ++  WSPAAIKSALMTT YTLDN  R+++ D+ + G P+
Sbjct  539   IVSGTSMSCPHVSGLAALLKAVHKDWSPAAIKSALMTTAYTLDNK-RASISDMGSGGSPA  597

Query  1633  TPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNL  1812
             TP A GSGHV+P  A+DPGL+YD   +DY++ LC++ Y S +IAL  R      C N  L
Sbjct  598   TPFACGSGHVNPEKASDPGLIYDITTDDYLNHLCSLNYTSSQIALVSRGISFT-CPNDTL  656

Query  1813  G-NPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNR  1983
                PG LNYPS AV+F  N Q  + TYKRTV NVG+  +  Y   VQ P  V V V P+ 
Sbjct  657   HLQPGDLNYPSLAVLFNGNAQNNSATYKRTVTNVGQPTST-YVAQVQEPDGVSVMVEPSV  715

Query  1984  LVFTDRIDTLSYEVTFQSL-----RQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
             L F      LSY+V+F ++        + SFGSL W    H V SPIA++W+
Sbjct  716   LKFRKFNQRLSYKVSFVAMGAASASVPSSSFGSLVWVSKKHRVRSPIAITWQ  767



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/710 (48%), Positives = 456/710 (64%), Gaps = 27/710 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSS---  204
             LLYTY+   HGF+A L P QA  L     VI V  D +  L TTR+P+FLGL + +    
Sbjct  66    LLYTYDTAYHGFAASLDPDQAETLRQSESVIGVYEDTVYNLHTTRTPEFLGLETANGFWA  125

Query  205   --NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
               +L   +    D+I+GVLD+G+WPE  SF+D G+  IP+ WR +CE G  F    CN+K
Sbjct  126   GHSLQDLNQASNDVIVGVLDTGVWPESKSFNDAGMPEIPSRWRGECESGVDFSPKLCNKK  185

Query  379   IIGARAYYRGYEAVTGRPIVDEPKSAI---DMTGHGThvasiaagsavananvnghaRGE  549
             +IGAR++ +GY   +G   + +P+ A    D  GHGTH +S AAGS VANA++ G+A G 
Sbjct  186   LIGARSFSKGYRMASGGGFMKKPREAESPRDQDGHGTHTSSTAAGSLVANASLLGYASGT  245

Query  550   ARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNED  729
             ARG+A +AR+A YKVCW   C  +DIL+GMD+A+ DGV V+SLS+G     G + PY  D
Sbjct  246   ARGMAPHARVATYKVCWTSGCFGSDILAGMDRAILDGVDVMSLSLG-----GGSAPYFRD  300

Query  730   PIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRT  909
              IAIGAF A+++G+ VSC AGNSGP   +  N APW++TVGA T+DR+FPA   LGN   
Sbjct  301   TIAIGAFTAMERGIFVSCSAGNSGPSRASLANTAPWVMTVGAGTLDRDFPAYAVLGNQNK  360

Query  910   FTGTSLYFGIQPSPNQVSMVYGRRANS--RYCLPGQLDASKVRGKIVYCKQLANITIVDQ  1083
             FTG SLY G       V + Y + +NS    CLPG L    VRGK+V C +  N   V++
Sbjct  361   FTGVSLYSGTGMGTKPVGLFYNKGSNSSSNLCLPGSLRPEAVRGKVVVCDRGVNAR-VEK  419

Query  1084  GFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVF  1263
             G  V+ +GGVGMI++N    G E+VA++ ++P   V    GD+I +Y +   + TA I F
Sbjct  420   GGVVRAAGGVGMILANTAASGEEMVADSHLLPAVAVGRKVGDMIREYAQTDPNPTAVISF  479

Query  1264  RGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRR  1443
              GTV    PS P VAAFSSRGPN +TP+ILKPDVI PGVNILAAW+ AI P+   +D R+
Sbjct  480   GGTVLNVRPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSEAIGPTGLEEDTRK  538

Query  1444  TEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYTG  1623
             ++FNIMSGTSM+CPH+SGLAA+L+  +P+WSP+AIKSALMTT YT DN+ ++ L D   G
Sbjct  539   SQFNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNT-KAPLSDAAGG  597

Query  1624  YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRN  1803
               S P AHGSGHVDP+ A  PGLVYD    +YV FLC++GY  Q++    +++  V C  
Sbjct  598   QFSNPWAHGSGHVDPSRAVSPGLVYDISSVEYVAFLCSLGYTIQQVQSIAKSN--VTCA-  654

Query  1804  RNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNR  1983
             R   +PG LNYPSF+VVF N  + + Y R + NVG  +++ Y+V V  P  VR  V P+ 
Sbjct  655   RKYSDPGQLNYPSFSVVFGNK-RVVRYTRELTNVGTARSL-YKVIVSGPPGVRTIVKPSS  712

Query  1984  LVFTDRIDTLSYEVTFQSL----RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             L F    +   Y VTF S     R S   FGS+ W++  HLV SP+A +W
Sbjct  713   LFFATVGEKKKYTVTFVSAKSGSRTSRAEFGSIVWANTLHLVKSPVAFAW  762



>ref|XP_004509085.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/719 (48%), Positives = 463/719 (64%), Gaps = 25/719 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTYE+  HG+S RLT  +A  L +  G+++V+P+   EL TTR+P F
Sbjct  54    SSLQSVSESAEMLYTYENAIHGYSTRLTAEEARLLESQTGILAVVPEVKYELHTTRTPLF  113

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+++ P S+ G++++IGVLD+G+WPE  SF D G  P+P SW+  CE G  F  
Sbjct  114   LGL-DKSADMFPESNSGSEVVIGVLDTGVWPESKSFDDTGFGPVPASWKGACETGTNFTT  172

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CN+K+IGAR + +G EA+ G PI +  E KS  D  GHGTH +S AAGS V  A++ G
Sbjct  173   SNCNKKLIGARYFSKGVEAMLG-PIDETTESKSPRDDDGHGTHTSSTAAGSVVTGASLFG  231

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+AVYKVCW G C ++DIL+ +D+A++D V+VLSLS+G     G   
Sbjct  232   YASGTARGMATRARVAVYKVCWKGGCFSSDILAAIDKAISDNVNVLSLSLG-----GGMS  286

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  287   DYYRDSVAIGAFAAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPAYVSL  346

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG  ++G SLY G     + +  +Y   A    N   C+ G L    V GKIV C +  
Sbjct  347   GNGLNYSGVSLYRGNALPDSPLPFIYAGNATNATNGNLCMTGSLSPDMVAGKIVLCDRGM  406

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             +   V +G  VK +GG+GM++SN    G ELVA+  ++P   V    GD I  YV +   
Sbjct  407   SAR-VQKGAVVKAAGGLGMVLSNTAANGEELVADTHLLPATAVGEKAGDAIKKYVFSDAK  465

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T +I+F GT  G  PS P VAAFSSRGPN +TP ILKPD+IAPGVNILA W+ A+ P+ 
Sbjct  466   PTVKILFEGTKVGVQPS-PVVAAFSSRGPNSITPSILKPDLIAPGVNILAGWSKAVGPTG  524

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              + D RR +FNI+SGTSM+CPHVSGLAA ++  +P WSPAA++SALMTT YT   +G   
Sbjct  525   LSVDERRVDFNIISGTSMSCPHVSGLAAFIKSAHPEWSPAAVRSALMTTAYTAYKNGLK-  583

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D  TG  STP  HGSGHVDP  A +PGLVYD  V+DY+ FLC + Y + +I    R  
Sbjct  584   LQDSATGKYSTPFDHGSGHVDPVAALNPGLVYDLTVDDYLGFLCALNYTASEITALARRK  643

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKN--NLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
                D   +   +   LNYPSFAVVF +      + ++R + NVG   N    VT  TPS 
Sbjct  644   FQCDAGKKY--SVADLNYPSFAVVFDSMGGANVVKHRRILTNVGPAGNYKASVTSDTPS-  700

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
             V+++V P  L F +  +  ++ VTF    S  Q  +SFG L W++G  +V SPI++SW+
Sbjct  701   VKISVDPEVLNFKEN-EKKAFTVTFTSSGSTPQRVNSFGRLEWTNGKSVVGSPISISWD  758



>ref|XP_002533857.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF28521.1| Cucumisin precursor, putative [Ricinus communis]
Length=753

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/717 (49%), Positives = 460/717 (64%), Gaps = 31/717 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             ++L+ Y+ V HGFSA +TP  AS L+  P +++VL D   +L TTRSPQFLGL      L
Sbjct  42    QILHVYDAVFHGFSASITPDHASTLSQHPSILTVLEDHRRQLHTTRSPQFLGL-RNQRGL  100

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
                SDYG+D+IIGV D+G+WPER SFSD  L P+P  W+  CE G +F A +CN+K+IGA
Sbjct  101   WSESDYGSDVIIGVFDTGVWPERRSFSDVNLGPVPTRWKGVCESGVKFTAKNCNKKLIGA  160

Query  391   RAYYRGYEA-------VTGRPIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGE  549
             R + +G+EA       ++G     E KS  D  GHGTH AS AAG     A++ G+A G 
Sbjct  161   RFFIKGHEAAARSAGPISGINETVEFKSPRDADGHGTHTASTAAGRHSFRASMAGYAAGI  220

Query  550   ARGIATNARIAVYKVCWLGT-CSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNE  726
             A+G+A  AR+AVYKVCW  + C ++DIL+  D AVADGV V+S+SIG    +G + PY  
Sbjct  221   AKGVAPKARLAVYKVCWKNSGCFDSDILAAFDAAVADGVDVISISIG--GGDGISSPYYL  278

Query  727   DPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGR  906
             DPIAIGA+ A  +GV VS  AGN GP+  +  N+APW++TVGA TIDR FPA V LGNGR
Sbjct  279   DPIAIGAYAAASRGVFVSSSAGNDGPNLMSVTNLAPWVVTVGAGTIDRNFPADVILGNGR  338

Query  907   TFTGTSLYFGIQPSPNQVSMVYGRRA---NSRYCLPGQLDASKVRGKIVYCKQLANITIV  1077
               +G SLY G+  +     +VY  ++   ++  C+   LD + VRGKIV C + ++    
Sbjct  339   RLSGVSLYSGLPLNGKMYPLVYPGKSGMLSASLCMENSLDPAIVRGKIVICDRGSSPRAA  398

Query  1078  DQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARI  1257
              +G  VK++GGVGMI++N    G  LV +A +IP   V + + D +  YV NT+  TA I
Sbjct  399   -KGLVVKKAGGVGMILANAISNGEGLVGDAHLIPACAVGSDEADAVKAYVSNTRYPTATI  457

Query  1258  VFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDN  1437
              F+GTV G  P AP VA+FS RGPN L PEILKPD+IAPGVNILAAWT A+ P+    D+
Sbjct  458   DFKGTVLGIKP-APVVASFSGRGPNGLNPEILKPDLIAPGVNILAAWTDAVGPTGLDSDS  516

Query  1438  RRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLY  1617
             R+TEFNI+SGTSMACPHVSG AA+L+  +P+WS AAI+SA+MTT  TLDN  RS + D  
Sbjct  517   RKTEFNILSGTSMACPHVSGAAALLKSAHPNWSAAAIRSAMMTTANTLDNLNRS-MTDEA  575

Query  1618  TGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDC  1797
             TG   +P+  G+GH++   A DPGLVYD   NDYV+FLC IGY  + I +  R    V+C
Sbjct  576   TGKACSPYDFGAGHLNLDRAMDPGLVYDITNNDYVNFLCGIGYSPKAIQVITRTP--VNC  633

Query  1798  -RNRNLGNPGALNYPSFAVVFKNNLQTITYK---RTVKNVGKVKNVAYQVTVQTPSNVRV  1965
                R L  PG LNYPS A +F  + + +T K   RT  NVG V N  Y+  ++ P  V V
Sbjct  634   PMKRPL--PGNLNYPSIAALFPTSAKGVTSKAFIRTATNVGPVVNAVYRAIIEAPKGVTV  691

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQS------LRQSADSFGSLRWSDGTHLVTSPIAVS  2118
             TV P++LVF   +   S+ VT  +      +  S   FGS+ WS+G H+V SPI V+
Sbjct  692   TVKPSKLVFNQAVKKRSFVVTLTADTRNLMVDDSGALFGSVTWSEGMHVVRSPIVVT  748



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/726 (48%), Positives = 460/726 (63%), Gaps = 32/726 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S+S+ +LYTY  V HG+S +LT  +A  L   PG++SV  + + EL TTRSP F
Sbjct  53    SSLKSVSKSANVLYTYNSVIHGYSTQLTADEAKALEQQPGILSVHEEVIYELHTTRSPTF  112

Query  181   LGLISGSS-NLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFP  357
             LGL    S +  P ++  +++IIGVLD+G+WPE  SF D GL P+P SW+ KC+ G  F 
Sbjct  113   LGLEGHESRSFFPQTEARSEVIIGVLDTGVWPESKSFDDTGLGPVPASWKGKCQTGKNFD  172

Query  358   ATSCNRKIIGARAYYRGYEAVTGRPIVDE---PKSAIDMTGHGThvasiaagsavananv  528
             A+SCNRK+IGAR + +GYEA  G   +DE    KS  D  GHGTH A+ AAGS V  A++
Sbjct  173   ASSCNRKLIGARFFSQGYEAAFGA--IDETIESKSPRDDEGHGTHTATTAAGSVVTGASL  230

Query  529   nghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
              G+A G ARG+A++AR+A YKVCW G C ++DIL+GMDQAV DGV+VLSLS+G     G 
Sbjct  231   LGYATGTARGMASHARVAAYKVCWTGGCFSSDILAGMDQAVIDGVNVLSLSLG-----GT  285

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
                Y+ D +AIGAF A  +G+ VSC AGN GP   T  N+APWI TVGA T+DREFPA +
Sbjct  286   ISDYHRDIVAIGAFSAASQGIFVSCSAGNGGPSSGTLSNVAPWITTVGAGTMDREFPAYI  345

Query  889   TLGNGRTFTGTSLYFGIQPSPNQVSMVYG----RRANSRYCLPGQLDASKVRGKIVYCKQ  1056
              +GNG    G SLY G     + + +VY     + +N   C  G L   KV GKIV C +
Sbjct  346   GIGNGEKLNGVSLYSGKALLSSVMPLVYAGNVSQSSNGNLCTSGSLIPEKVAGKIVVCDR  405

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               N     +G  VK +GG+GMI++N    G ELVA+A +IPTA V    G++I  Y+ + 
Sbjct  406   GMNAR-AQKGLVVKDAGGIGMILANTDTYGDELVADAHLIPTAAVGQTAGNLIKQYIASN  464

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + TA I F GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA WTG + P
Sbjct  465   SNPTATIAFGGTKLGVQPS-PVVAAFSSRGPNPITPDILKPDLIAPGVNILAGWTGKVGP  523

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             +   +D R   FNI+SGTSM+CPHVSGLAA+L+  +P WSPAAI+SALMTT+Y+   +G+
Sbjct  524   TGLQEDTRNVGFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTSYSTYKNGK  583

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
              T+ D+ TG  STP  +G+GHV+PT A +PGLVYD  V+DY++FLC + Y    I +  +
Sbjct  584   -TIEDVATGMSSTPFDYGAGHVNPTAAVNPGLVYDLTVDDYINFLCALDYSPSMIKVIAK  642

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFK--------NNLQTIT-YKRTVKNVGKVKNVAY  1929
                 + C          LNYPSF++  +        ++  T+T Y RT+ NVG       
Sbjct  643   RD--ISCDKNKEYRVADLNYPSFSIPMETAWGEHADSSTPTVTRYTRTLTNVGNPATYKA  700

Query  1930  QVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQ--SADSFGSLRWSDGTHLVTS  2103
              V+ +T   V++ V P  L F+ + +  +Y VTF +  +     SF  L WSDG H+V S
Sbjct  701   SVSSET-QEVKILVEPQTLTFSRKNEKKTYTVTFTASSKPSGTTSFARLEWSDGQHVVAS  759

Query  2104  PIAVSW  2121
             PIA SW
Sbjct  760   PIAFSW  765



>ref|XP_003538797.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/726 (47%), Positives = 480/726 (66%), Gaps = 29/726 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S + + S S+E+LYTY++  HG S RLT  +A  L +  G++ VLP+++ +  TTR+P+F
Sbjct  59    SIMKSISNSTEMLYTYDNTIHGLSTRLTLEEARLLKSQTGILKVLPEKIYKPLTTRTPKF  118

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL    +++ P S+  +DI+IG+LD+G+WPE  SF D GL PIP+SW+ KCE G  F  
Sbjct  119   LGL-DKIADMFPKSNEASDIVIGLLDTGVWPESKSFEDTGLGPIPSSWKGKCESGDNFTT  177

Query  361   TSCNRKIIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvng  534
              +CN+K+IGAR + +GYEA  G P+   ++ +S  D  GHGTH AS AAGSAV  A++ G
Sbjct  178   LNCNKKLIGARFFLKGYEASMG-PLNATNQFRSPRDADGHGTHTASTAAGSAVKGASLFG  236

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A+ AR+AVYKVCW  TC+ +DIL+ MD A++D V+V+S S+G     G A 
Sbjct  237   YASGTARGMASRARVAVYKVCWGDTCAVSDILAAMDAAISDNVNVISASLG-----GGAI  291

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y+E+ +AIGAF A++KG++VSC AGN+GPD  +  NIAPW++TVGA T+DR+FP  V L
Sbjct  292   DYDEENLAIGAFAAMEKGIVVSCAAGNTGPDSSSLQNIAPWMITVGAGTLDRDFPVNVNL  351

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ ++G S+Y G       V ++Y   A+++     C    LD  KV+GKIV C +  
Sbjct  352   GNGQNYSGVSIYDGKFSRHTLVPLIYAGNASAKIGAELCETDSLDPKKVKGKIVLCDR-G  410

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N + V++G  VK +GGVGM+++N    G ELVA+A ++PT  V    G +I  Y+++ + 
Sbjct  411   NSSRVEKGLVVKSAGGVGMVLANSESDGEELVADAHLLPTTAVGFKAGKLIKLYLQDARK  470

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T+R++F GT  G  PS P VAAFSSRGPN +TPE+LKPD IAPGVNILAA+T  + P+ 
Sbjct  471   PTSRLMFEGTKVGIEPS-PVVAAFSSRGPNPITPEVLKPDFIAPGVNILAAFTKLVGPTN  529

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
               +D+RR +FNI+SGTSMACPH SG+AA+++  +P WSPAAI+SALMTT YT  N+G+  
Sbjct  530   LDQDDRRVDFNIISGTSMACPHASGIAALIKSFHPDWSPAAIRSALMTTAYTTYNNGKK-  588

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L+D  T  PSTP   G+GHV+P  A +PGLVYD  V+DY++FLC + Y   +I +  R  
Sbjct  589   LLDSATNGPSTPFEVGAGHVNPVAALNPGLVYDLAVDDYLNFLCALNYTPDRIEVVARRK  648

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNL-----QTITYKRTVKNVGKVKNVAYQVTVQT  1947
                 C      +   LNYPSF VVFK  +       + +KRT+ NVG        VTV  
Sbjct  649   --FRCNAHKHYSVTDLNYPSFGVVFKPKVGGSGATIVKHKRTLTNVGDAGTYKVSVTVDI  706

Query  1948  PSNVRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS---FGSLRWSDGTHLVTSPIAVS  2118
              S+V++ V PN L F ++ +  SY +TF        S   FG L WS+G ++V SPI+++
Sbjct  707   -SSVKIAVEPNVLSF-NKNEKKSYTITFTVSGPPPPSNFGFGRLEWSNGKNVVGSPISIT  764

Query  2119  WE-GRS  2133
             WE GR+
Sbjct  765   WESGRA  770



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/725 (48%), Positives = 470/725 (65%), Gaps = 31/725 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E++Y Y +V HGFS RLT  +A  L   PG+++V+P+ + EL TTRSP+F
Sbjct  49    SSLRSVSDSAEMIYAYNNVVHGFSTRLTAEEAQRLEAQPGILAVVPEMIYELHTTRSPEF  108

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++NL P S+  +++IIGVLD+GI PE  SF D GL P+P+SW+ +CE G  F A
Sbjct  109   LGL-DKNANLYPESNSVSEVIIGVLDTGISPESKSFDDTGLGPVPSSWKGECESGTNFSA  167

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CNRK++GAR + +GYEA  G PI +  E +S  D  GHGTH AS AAGS V NA++ G
Sbjct  168   SNCNRKLVGARFFSKGYEATLG-PIDESKESRSPRDDDGHGTHTASTAAGSVVENASLFG  226

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+A  AR+A YKVCW G C ++DI++ +D+AV D V+VLS+S+G     G   
Sbjct  227   YASGTARGMAARARVAAYKVCWAGGCFSSDIVAAIDKAVDDNVNVLSMSLG-----GGVS  281

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +A GAF A++KG++VSC AGN+GP P++  N +PWI TVGA T+DR+FPA V+L
Sbjct  282   DYYKDSVATGAFAAMEKGILVSCSAGNAGPSPFSLSNTSPWITTVGAGTLDRDFPAYVSL  341

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             G+ + F+G SLY G       +  +Y   A    N   C+ G L   KV GK+V+C +  
Sbjct  342   GDAKNFSGVSLYRGKSLPGTLLPFIYAANASNSGNGNLCMTGTLIPEKVAGKVVFCDRGV  401

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM+++N    G ELVA++ ++P   V    GD I  Y+ +  S
Sbjct  402   NPR-VQKGAVVKAAGGIGMVLANTAANGEELVADSHLLPATAVGQKSGDTIRKYLVSDPS  460

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TP++LKPD+IAPGVNILA W+ ++ PS 
Sbjct  461   PTVTILFEGTKLGIEPS-PVVAAFSSRGPNSITPQLLKPDIIAPGVNILAGWSKSVGPSG  519

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D+RR +FNI+SGTSM+CPHVSGLAA+++  +P WSPAAI+SALMTT YT   +G+  
Sbjct  520   LAIDDRRVDFNIISGTSMSCPHVSGLAALIKGAHPDWSPAAIRSALMTTAYTAYKNGQK-  578

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+DY++FLC + Y   +I    R  
Sbjct  579   IQDIATGKPSTPFDHGAGHVDPVSALNPGLVYDLTVDDYLNFLCALNYTPSQINSLARKD  638

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT-------YKRTVKNVGKVKNVAYQVTV  1941
                D + +   N   LNYPSFAVVF+  L           + RT+ NVG        +T 
Sbjct  639   FTCDSKKKYSVND--LNYPSFAVVFEGVLGGGGSGSSVVKHTRTLTNVGSPGTYKVSITS  696

Query  1942  QTPSNVRVTVSPNRLVFTDRIDTLSY-----EVTFQSLRQSADSFGSLRWSDGTHLVTSP  2106
             +T S V+++V P  L FT   D  SY       T  +   SA++FG + WSDG H+V SP
Sbjct  697   ETKS-VKISVEPESLSFTGANDKKSYTVTFTTTTSSAAPTSAEAFGRIEWSDGKHVVGSP  755

Query  2107  IAVSW  2121
             IA SW
Sbjct  756   IAFSW  760



>gb|KHN12975.1| Subtilisin-like protease [Glycine soja]
Length=751

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/720 (47%), Positives = 477/720 (66%), Gaps = 29/720 (4%)
 Frame = +1

Query  19    SRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG  198
             S S+E+LYTY++  HG S RLT  +A  L +  G++ VLP+++ +  TTR+P+FLGL   
Sbjct  46    SNSTEMLYTYDNTIHGLSTRLTLEEARLLKSQTGILKVLPEKIYKPLTTRTPKFLGL-DK  104

Query  199   SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRK  378
              +++ P S+  +DI+IG+LD+G+WPE  SF D GL PIP+SW+ KCE G  F   +CN+K
Sbjct  105   IADMFPKSNEASDIVIGLLDTGVWPESKSFEDTGLGPIPSSWKGKCESGDNFTTLNCNKK  164

Query  379   IIGARAYYRGYEAVTGRPI--VDEPKSAIDMTGHGThvasiaagsavananvnghaRGEA  552
             +IGAR + +GYEA  G P+   ++ +S  D  GHGTH AS AAGSAV  A++ G+A G A
Sbjct  165   LIGARFFLKGYEASMG-PLNATNQFRSPRDADGHGTHTASTAAGSAVKGASLFGYASGTA  223

Query  553   RGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDP  732
             RG+A+ AR+AVYKVCW  TC+ +DIL+ MD A++D V+V+S S+G     G A  Y+E+ 
Sbjct  224   RGMASRARVAVYKVCWGDTCAVSDILAAMDAAISDNVNVISASLG-----GGAIDYDEEN  278

Query  733   IAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTF  912
             +AIGAF A++KG++VSC AGN+GPD  +  NIAPW++TVGA T+DR+FP  V LGNG+ +
Sbjct  279   LAIGAFAAMEKGIVVSCAAGNTGPDSSSLQNIAPWMITVGAGTLDRDFPVNVNLGNGQNY  338

Query  913   TGTSLYFGIQPSPNQVSMVYGRRANSR----YCLPGQLDASKVRGKIVYCKQLANITIVD  1080
             +G S+Y G       V ++Y   A+++     C    LD  KV+GKIV C +  N + V+
Sbjct  339   SGVSIYDGKFSRHTLVPLIYAGNASAKIGAELCETDSLDPKKVKGKIVLCDR-GNSSRVE  397

Query  1081  QGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIV  1260
             +G  VK +GGVGM+++N    G ELVA+A ++PT  V    G +I  Y+++ +  T+R++
Sbjct  398   KGLVVKSAGGVGMVLANSESDGEELVADAHLLPTTAVGFKAGKLIKLYLQDARKPTSRLM  457

Query  1261  FRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNR  1440
             F GT  G  PS P VAAFSSRGPN +TPE+LKPD IAPGVNILAA+T  + P+   +D+R
Sbjct  458   FEGTKVGIEPS-PVVAAFSSRGPNPITPEVLKPDFIAPGVNILAAFTKLVGPTNLDQDDR  516

Query  1441  RTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDLYT  1620
             R +FNI+SGTSMACPH SG+AA+++  +P WSPAAI+SALMTT YT  N+G+  L+D  T
Sbjct  517   RVDFNIISGTSMACPHASGIAALIKSFHPDWSPAAIRSALMTTAYTTYNNGKK-LLDSAT  575

Query  1621  GYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCR  1800
               PSTP   G+GHV+P  A +PGLVYD  V+DY++FLC + Y   +I +  R      C 
Sbjct  576   NGPSTPFEVGAGHVNPVAALNPGLVYDLAVDDYLNFLCALNYTPDRIEVVARRK--FRCN  633

Query  1801  NRNLGNPGALNYPSFAVVFKNNL-----QTITYKRTVKNVGKVKNVAYQVTVQTPSNVRV  1965
                  +   LNYPSF VVFK  +       + +KRT+ NVG        VTV   S+V++
Sbjct  634   AHKHYSVTDLNYPSFGVVFKPKVGGSGATIVKHKRTLTNVGDAGTYKVSVTVDI-SSVKI  692

Query  1966  TVSPNRLVFTDRIDTLSYEVTFQSLRQSADS---FGSLRWSDGTHLVTSPIAVSWE-GRS  2133
              V PN L F ++ +  SY +TF        S   FG L WS+G ++V SPI+++WE GR+
Sbjct  693   AVEPNVLSF-NKNEKKSYTITFTVSGPPPPSNFGFGRLEWSNGKNVVGSPISITWESGRA  751



>gb|KDP28707.1| hypothetical protein JCGZ_14478 [Jatropha curcas]
Length=739

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/711 (49%), Positives = 450/711 (63%), Gaps = 29/711 (4%)
 Frame = +1

Query  31    ELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISGSSNL  210
             +LLY YE V  GFSA+L+  Q   L+   G IS +PD ++ L TT SPQFLGL +G    
Sbjct  45    QLLYVYETVMSGFSAKLSKEQVKALSKTNGFISAIPDEMLTLHTTHSPQFLGLENGKGLW  104

Query  211   GPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCNRKIIGA  390
              P S   +D+IIGVLD+GIWPE  SF D GL+ +P+ W+  CE G +F +++CNRKIIGA
Sbjct  105   SPPS-LASDVIIGVLDTGIWPEHVSFQDTGLSAVPSKWKGICETGTKFSSSNCNRKIIGA  163

Query  391   RAYYRGYEAVTGR--PIVDEPKSAIDMTGHGThvasiaagsavananvnghaRGEARGIA  564
             RA+++GYE+V GR    VD  +S  D  GHGTH AS A G+ + NA+  G A G A G+ 
Sbjct  164   RAFFKGYESVVGRINETVDY-RSPRDSQGHGTHTASTAGGNLIYNASFFGLANGAAAGMK  222

Query  565   TNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYNEDPIAIG  744
               ARIAVYKVCW   C+N D+L+ +DQAV DGV VLSLS+G     G AKP+  D +AI 
Sbjct  223   YTARIAVYKVCWPLGCTNTDLLAAIDQAVNDGVDVLSLSLG-----GTAKPFYADNVAIA  277

Query  745   AFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNGRTFTGTS  924
             +FGA Q GV VSC AGNSGP   T  N APWI+TV AS  DR FP  V LGNG+TF G+S
Sbjct  278   SFGATQNGVFVSCSAGNSGPSRSTVDNTAPWIMTVAASYTDRSFPTTVKLGNGQTFVGSS  337

Query  925   LYFGIQPSPNQVSMVYGRRANS---RYCLPGQLDASKVRGKIVYCKQLANITIVDQGFAV  1095
             LY G   S  Q+ + YG  A S   +YC+ G L  + V+GKIV C++   I    +G  V
Sbjct  338   LYSG--KSTKQLVIAYGETAGSQSAKYCVRGSLKKTLVKGKIVICER-GMIGRTAKGEQV  394

Query  1096  KQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATARIVFRGTV  1275
             K +GG GMII N  +QG E  A+  ++P   + A+ G  I  YV +T+  TA I FRGT 
Sbjct  395   KLAGGAGMIIVNTENQGEEFFADPHILPATSLGASAGKAIKFYVNSTRQPTASISFRGTT  454

Query  1276  TGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKDNRRTEFN  1455
              GN   AP +AAFSSRGP+ + P+++KPDV APGVNILAAW+   +PS    D R   FN
Sbjct  455   YGNP--APVMAAFSSRGPSAVGPDVIKPDVTAPGVNILAAWSPVSSPSLLKSDKRSVMFN  512

Query  1456  IMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL--YTGYP  1629
             I+SGTSM+CPHVSGLAA+L+ ++  WSPAAIKSA+MT+ Y +DN   + + D        
Sbjct  513   IISGTSMSCPHVSGLAALLKSVHKDWSPAAIKSAIMTSAYVVDNR-NAPVADFGANNSAS  571

Query  1630  STPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRN  1809
             +TP   GSGHVDP  AADPGL+Y+    DY+++LC++ Y S +I    R      C N  
Sbjct  572   ATPFVLGSGHVDPEKAADPGLIYNITTEDYLNYLCSLSYTSAQITQVSRRR--FSCPNNT  629

Query  1810  LGNPGALNYPSFAVVFKNNLQTI--TYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVSPNR  1983
             +  PG LNYPSFAV F+ N Q I  T+KR V NVG    + Y V V+ P+ V + + P  
Sbjct  630   ILQPGHLNYPSFAVNFEGNAQNITRTHKRRVTNVGP-SLITYVVQVEEPNGVSIIIEPKI  688

Query  1984  LVFTDRIDTLSYEVTFQSL----RQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
             L F    + LSY VTF SL     + + SFGSL W  G + V SPIA+SW+
Sbjct  689   LSFRKLREELSYNVTFVSLGVRDTRESHSFGSLVWVSGKYKVRSPIAISWQ  739



>ref|XP_004501532.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/724 (47%), Positives = 463/724 (64%), Gaps = 30/724 (4%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E+LYTY+HVAHGFS RLT  +A  L   PG++SV+P+   EL TTR+P+F
Sbjct  66    SSLKSVSESAEMLYTYKHVAHGFSTRLTTQEAELLTKQPGILSVIPEVRYELHTTRTPEF  125

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   ++ L  S    +++I+GV+D+G+WPE  SF D  L P+P+SW+ +CE G  F +
Sbjct  126   LGL-EKTTTLLVSYGKQSEVIVGVIDTGVWPELKSFDDTKLGPVPSSWKGECETGKNFNS  184

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
             ++CN+K++GAR + +GYEA  G PI +  E KS  D  GHG+H ++ AAGSAVA A++ G
Sbjct  185   SNCNKKLVGARFFAKGYEAAFG-PIDETAESKSPRDDDGHGSHTSTTAAGSAVAGASLFG  243

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
              A G ++G+AT AR+A YK CWLG C  +DI++G+D+A+ DGV++LS+SIG     G   
Sbjct  244   FASGTSKGMATQARVATYKACWLGGCFTSDIVAGIDKAIEDGVNILSMSIG-----GNLM  298

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y ED +A+G F A++ G++VS  AGN GP   T  N+APWI TVGA T+DR+FPA +TL
Sbjct  299   DYYEDTVAMGTFAAMEHGILVSSSAGNGGPSQATLANVAPWITTVGAGTLDRDFPAYITL  358

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYG----RRANSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG+ + G SLY G  P  + + +VY     + ++   C    L  SKV GKIV C +  
Sbjct  359   GNGKRYNGVSLYDGKLPPDSPLPLVYAANVSQDSSGNLCTTDSLIPSKVSGKIVICDRGG  418

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V++   VK +GG+GMI++N +  G ELVA++ ++P   +     + +  YV +  +
Sbjct  419   NPR-VEKSLVVKLAGGIGMILANNQDYGEELVADSYLLPAGALGEKASNEVKKYVFSAPN  477

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              TA+IVF GT  G  PS P VAAFSSRGPN LTP+ILKPD+IAPGVNILA WTG + P+ 
Sbjct  478   PTAKIVFGGTELGVQPS-PVVAAFSSRGPNTLTPKILKPDLIAPGVNILAGWTGKVGPTG  536

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              + D R   FNI+SGTSM+CPHVSGL+A+L+  +P W+PAAI+SALMTT+Y     G+ T
Sbjct  537   LSVDTRHVSFNIISGTSMSCPHVSGLSALLKGAHPEWTPAAIRSALMTTSYRTYKDGQ-T  595

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             + D+ TG P+TP  +G+GHVDP  A DPGLVYD  V+DY+ FLC + Y S +I L  R  
Sbjct  596   IKDVATGTPATPFDYGAGHVDPVAALDPGLVYDASVDDYLSFLCALKYTSFQIKLVARRE  655

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVF---------KNNLQTITYKRTVKNVGKVKNVAYQV  1935
                 C  R       LNYPSFAV F              T+ YKR + NVG        V
Sbjct  656   --FTCDKRIKYRVEDLNYPSFAVPFDTASGIRGGSQKTSTVQYKRVLTNVGTPSTYKVSV  713

Query  1936  TVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPI  2109
             + Q+P  V++ V P  L F +  +   Y VTF   S+     SF  L WSDG H VTSPI
Sbjct  714   SSQSPL-VKIMVEPQTLSFKELYEKKGYTVTFTSHSMPSGTTSFAHLEWSDGKHKVTSPI  772

Query  2110  AVSW  2121
             A SW
Sbjct  773   AFSW  776



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/721 (49%), Positives = 459/721 (64%), Gaps = 34/721 (5%)
 Frame = +1

Query  13    NHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
             + + S  LLY+Y     GF+A+L   QA  L     V+ V  D L  L TTR+PQFLGL 
Sbjct  70    DETDSDPLLYSYTTAYTGFAAKLNTQQAETLLQNDDVLGVYEDTLYHLHTTRTPQFLGLE  129

Query  193   SGS--------SNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGP  348
             + +          L  +S    D+IIGVLD+G+WPE  SF+D GL  IP  WR  CE  P
Sbjct  130   TQTGLWEGHRTQELDQASH---DVIIGVLDTGVWPESLSFNDAGLPEIPTRWRGACENAP  186

Query  349   QFPATSCNRKIIGARAYYRGYEAVTGRPIVDEPKSAIDMTGHGThvasiaagsavananv  528
              F ++ CNRK+IGAR++ RG+   +G     E  S  D  GHGTH AS AAG+ V NA+ 
Sbjct  187   DFNSSVCNRKLIGARSFSRGFHMASGNGADREIVSPRDSDGHGTHTASTAAGAHVGNASF  246

Query  529   nghaRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGF  708
              G+A G ARG+A  AR+A YKVCW   C  +DIL+GMD+A+ DGV VLSLS+G     G 
Sbjct  247   LGYATGTARGMAPQARVAAYKVCWKDGCFASDILAGMDRAIQDGVDVLSLSLG-----GG  301

Query  709   AKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVV  888
             + PY  D IAIGAF AV++G+ VS  AGNSGP   +  N+APWI+TVGA T+DR+FPA  
Sbjct  302   SAPYFHDTIAIGAFAAVERGIFVSASAGNSGPTRASLANVAPWIMTVGAGTLDRDFPAYA  361

Query  889   TLGNGRTFTGTSLYFGIQPSPNQVSMVY----GRRANSRYCLPGQLDASKVRGKIVYCKQ  1056
             TLGN + F G SLY G       VS+VY    G   ++  C+ G L+ + VRGK+V C +
Sbjct  362   TLGNKKRFLGVSLYSGKGMGNKPVSLVYFKGTGSNQSASICMAGSLEPAMVRGKVVVCDR  421

Query  1057  LANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNT  1236
               +   V++G  VK++GG+GMI++N    G ELVA++ ++P   V    GD I  YV + 
Sbjct  422   GISAR-VEKGRVVKEAGGIGMILANTAASGEELVADSHLLPAVAVGRIIGDQIRKYVSSD  480

Query  1237  KSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAP  1416
              + T  + F GTV    PS P VAAFSSRGPN +T EILKPDVI PGVNILA W+ A+ P
Sbjct  481   LNPTTVLSFGGTVLNVRPS-PVVAAFSSRGPNMITKEILKPDVIGPGVNILAGWSEAVGP  539

Query  1417  SESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGR  1596
             S   +D R+T+FNIMSGTSM+CPH+SGLAA+L+  +P+WSP+AIKSALMTT Y  DNS +
Sbjct  540   SGLAEDTRKTKFNIMSGTSMSCPHISGLAALLKAAHPTWSPSAIKSALMTTAYNHDNS-K  598

Query  1597  STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
             S L D   G  STP AHG+GHV+P  A  PGLVYD    DY+ FLC++ Y+S++I L ++
Sbjct  599   SPLRDAADGSFSTPLAHGAGHVNPQKALSPGLVYDASTKDYITFLCSLNYNSEQIQLIVK  658

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
               P V+C  +   NPG LNYPSF+VVF +  + + Y R V NVG+  +V Y V V  PS+
Sbjct  659   R-PSVNC-TKKFANPGQLNYPSFSVVFSSK-RVVRYTRIVTNVGEAGSV-YNVVVDVPSS  714

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQSLRQSADS------FGSLRWSDGTHLVTSPIAVS  2118
             V +TV P+RLVF    +   Y VTF S ++ AD+      FGS+ WS+  H V SPIA +
Sbjct  715   VGITVKPSRLVFEKVGERKRYTVTFVS-KKGADASKVRSGFGSILWSNAQHQVRSPIAFA  773

Query  2119  W  2121
             W
Sbjct  774   W  774



>ref|XP_002533167.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF29226.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=760

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/717 (48%), Positives = 465/717 (65%), Gaps = 23/717 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S++++YTYE+  HGFS RLT  +A  L   PG++SVLP+   EL TTR+P+F
Sbjct  56    SSLKSVSDSAQMIYTYENAIHGFSTRLTSEEAELLQAQPGILSVLPELRYELHTTRTPEF  115

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S++  P SD   D+++GVLD+G+WPE  SF+D G+ PIP++W+ +CE G  F  
Sbjct  116   LGL-DKSADFFPESDSVGDVVVGVLDTGVWPESKSFADTGMGPIPSTWKGQCETGTNFTT  174

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
              +CNRK+IGAR +  GYEA  G P+ +  E KS  D  GHGTH AS AAGS V  A++ G
Sbjct  175   ANCNRKLIGARFFANGYEATLG-PVDESKESKSPRDDDGHGTHTASTAAGSLVEGASLLG  233

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+AVYKVCW+G C ++DIL  MD+A+ DGV+VLS+S+G     G   
Sbjct  234   YASGTARGMATRARVAVYKVCWIGGCFSSDILKAMDKAIEDGVNVLSMSLG-----GGMS  288

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y +D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  289   DYFKDSVAIGAFAAMEKGILVSCSAGNAGPTSYSLSNVAPWITTVGAGTLDRDFPAFVSL  348

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNGR ++G SL+ G       +  +Y   A    N   C+   L   KV GKIV C +  
Sbjct  349   GNGRNYSGVSLFKGSSLPGKLLPFIYAGNASNSTNGNLCMMDSLIPEKVAGKIVLCDRGV  408

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK++GG+GM+++N    G ELVA+A ++P   V   +G+ I  Y+ +  +
Sbjct  409   NAR-VQKGAVVKEAGGLGMVLANTPANGEELVADAHLLPATSVGEKNGNAIKSYLSSDPN  467

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T  I+F GT  G  PS P VAAFSSRGPN +TP++LKPD+IAPGVNILA W+GA+ P+ 
Sbjct  468   PTVTILFEGTKVGIQPS-PVVAAFSSRGPNSITPQVLKPDMIAPGVNILAGWSGAVGPTG  526

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
              + D RR +FNI+SGTSM+CPHVSGLAA+L+  +P W+PAAI+SALMTT Y    +GR+ 
Sbjct  527   LSTDTRRVDFNIISGTSMSCPHVSGLAALLKAAHPDWTPAAIRSALMTTAYVSYKNGRN-  585

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D  +G  STP  HG+GHVDP +A +PGLVYD   +DY+ FLC + Y + +I    R  
Sbjct  586   LQDSASGKDSTPFDHGAGHVDPVSALNPGLVYDLTADDYLSFLCALNYTAAEITSLARKR  645

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKN--NLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
                D   +   N   LNYPSFAV F +        Y RT+ NVG        ++ Q    
Sbjct  646   FTCDSSKKYSLND--LNYPSFAVNFDSIGGASVAKYTRTLTNVGTAGTYKASISGQA-LG  702

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTF--QSLRQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             V+++V P  L F    +  SY VTF   S+  + ++F  L WSDG H+V SPIAVSW
Sbjct  703   VKISVEPETLSFIQANEKKSYTVTFTGSSMPTNTNAFARLEWSDGKHVVGSPIAVSW  759



>ref|XP_009593174.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/732 (49%), Positives = 466/732 (64%), Gaps = 37/732 (5%)
 Frame = +1

Query  4     PLSNHSRSSE------LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTT  165
             P   H  SSE      +L+ Y++V HGFSA L+PSQA+ +   P +++   DR  +L TT
Sbjct  48    PTHYHWYSSEFTEPVNILHVYDNVFHGFSASLSPSQAASILQHPSILAAFEDRRRQLHTT  107

Query  166   RSPQFLGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVG  345
             RSPQFLGL      L   SDYG+D+I+GVLD+GIWPER SFSD  L P+P  W+  C+ G
Sbjct  108   RSPQFLGL-RNQKGLWSESDYGSDVIVGVLDTGIWPERRSFSDLNLGPVPTHWKGVCQTG  166

Query  346   PQFPATSCNRKIIGARAYYRGYEAVTGRPIVD--------EPKSAIDMTGHGThvasiaa  501
              +F A +CNRKIIGAR + +G+EA  G   +         E KS  D  GHGTH AS AA
Sbjct  167   DKFTAKNCNRKIIGARFFSKGHEAAPGFGGIGGGGINDTVEFKSPRDADGHGTHTASTAA  226

Query  502   gsavananvnghaRGEARGIATNARIAVYKVCWLGT-CSNADILSGMDQAVADGVHVLSL  678
             G     A+++G+A G A+G+A  AR+AVYKVCW  + C ++DIL+  D AV+DGV V+S+
Sbjct  227   GRHAFRASMSGYASGIAKGVAPKARLAVYKVCWKNSGCFDSDILAAFDAAVSDGVDVISI  286

Query  679   SIGLKNKEGFAKPYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGAS  858
             SIG    +G + PY  DPIAIGA+GAV +GV VS  AGN GP+  +  N+APW+ TVGA 
Sbjct  287   SIG--GGDGISSPYYLDPIAIGAYGAVSRGVFVSSSAGNDGPNGMSVTNLAPWLTTVGAG  344

Query  859   TIDREFPAVVTLGNGRTFTGTSLYFGIQPSPNQVSMVYGRRA---NSRYCLPGQLDASKV  1029
             TIDR FPA V LGNGR  +G SLY G   +    ++VY  ++   ++  C+   LD   V
Sbjct  345   TIDRNFPAEVILGNGRKLSGVSLYAGKPLNGKMYAVVYPGKSGVLSASLCMENSLDPHLV  404

Query  1030  RGKIVYCKQLANITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGD  1209
             RGKIV C + +N  +  +G  V ++GGVGMI++N    G  LV +A +IPT  V A +GD
Sbjct  405   RGKIVICDRGSNPRVA-KGLVVNKAGGVGMILANGVSNGEGLVGDAHLIPTCAVGANEGD  463

Query  1210  IIYDYVKNTKSATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNIL  1389
              I  Y+ +  +A+A I F GTV G  P AP VA+FS RGPN L PEILKPD+IAPGVNIL
Sbjct  464   AIKSYIASNPTASATINFHGTVIGVKP-APVVASFSGRGPNGLNPEILKPDLIAPGVNIL  522

Query  1390  AAWTGAIAPSESTKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTT  1569
             AAWT A+ P+    DNR+ EFNI+SGTSMACPHVSG AA+L+  +P WSPAAI+SA+MTT
Sbjct  523   AAWTDAVGPTGLDLDNRKAEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMMTT  582

Query  1570  TYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYD  1749
                +DN     + D  TG P+TP+ +G+GH++   A DPGLVYD    DYV FLC I Y 
Sbjct  583   ASLVDNR-LQPMTDEATGKPATPYDYGAGHLNLDLALDPGLVYDLANEDYVSFLCAIEYG  641

Query  1750  SQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI---TYKRTVKNVGKVKN  1920
              + I +  + SP V+C  +    P  LNYPS A +F    + +   T+ RTV NVG   N
Sbjct  642   PKTIQVITK-SP-VNCPMKK-PLPENLNYPSIAALFSTAARGVSSKTFFRTVTNVGDT-N  697

Query  1921  VAYQVTVQTPSNVRVTVSPNRLVFTDRIDTLSYEVTFQ------SLRQSADSFGSLRWSD  2082
               Y+V ++ P  VRV+V P++LVF++++  LSY VT         L  S   FGSL W D
Sbjct  698   AEYRVKIEAPKGVRVSVKPDKLVFSEKVRKLSYYVTITVDSKNLVLNDSGAVFGSLSWID  757

Query  2083  GTHLVTSPIAVS  2118
             G H+V SPI V+
Sbjct  758   GKHVVRSPIVVT  769



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/720 (48%), Positives = 469/720 (65%), Gaps = 36/720 (5%)
 Frame = +1

Query  13    NHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLI  192
             N + + +LLY YE    GF+A+L+ +Q   L  V G +   PD L+ L TT +PQFLGL 
Sbjct  64    NKTPTPQLLYIYETAISGFAAKLSTNQLKSLNQVDGFLFATPDELLSLHTTHTPQFLGLQ  123

Query  193   SGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSCN  372
             +G   L  +S+  +D+I+G++D+GIWPE  SF D G++ +P+ W+  CE G +F  ++CN
Sbjct  124   NGK-GLWSASNSASDVIVGLVDTGIWPEHVSFQDSGMSRVPSRWKGTCEEGTRFSFSNCN  182

Query  373   RKIIGARAYYRGYEAVTGRPIVDEP---KSAIDMTGHGThvasiaagsavananvnghaR  543
             +K+IGARA+ +GYEA+ GR  V+E    +S  D  GHGTH AS AAG+ V  A++ G A+
Sbjct  183   KKLIGARAFVQGYEAIVGR--VNETVDYRSPRDSNGHGTHTASTAAGNFVNQASLFGLAK  240

Query  544   GEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPYN  723
             G A G+   ARIA YK CW   C+N+D+++ ++ AVADGV +LSLS+G     G +KPY 
Sbjct  241   GSASGMKYTARIAAYKACWTLGCANSDVMAAIESAVADGVDILSLSLG-----GVSKPYY  295

Query  724   EDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGNG  903
             +D IAI +FGA+Q GV VSC AGNSGP   +  N APWI+TV AS  DR FP  V LG+G
Sbjct  296   KDNIAIASFGAIQHGVSVSCSAGNSGPSRSSVSNAAPWIMTVAASYSDRSFPTAVKLGDG  355

Query  904   RTFTGTSLYFGIQPSPNQVSMVYGRRANSR---YCLPGQLDASKVRGKIVYCKQLANITI  1074
             + F G+SLY G +    Q+ +VY R A S+   YC  G L    V+GKIV C+      I
Sbjct  356   QIFEGSSLYSGKKT--KQLPLVYNRTAGSQGAEYCFEGSLVKKLVKGKIVVCEG----GI  409

Query  1075  VDQ---GFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSA  1245
               Q   G  VK++GG GM++ N   +G EL+A+A ++P   + A+    I  YV + K  
Sbjct  410   YSQTGVGEKVKKAGGAGMLLLNSEDEGEELLADAHILPATSLGASAAKAIRKYVGSAKKP  469

Query  1246  TARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSES  1425
             +A IVF+GTV GN+  AP +AAFSSRGPN   P+++KPDV APGV+ILAAW   I+PS  
Sbjct  470   SALIVFQGTVYGNT--APVMAAFSSRGPNSAGPDVIKPDVTAPGVDILAAWPPNISPSML  527

Query  1426  TKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTL  1605
               DNR   FNI+SGTSM+CPHVSGLA++L+ ++  WSPAAIKSALMTT YTL+N G + +
Sbjct  528   ESDNRSVLFNIISGTSMSCPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKG-API  586

Query  1606  IDL---YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLR  1776
              D+    T   +TP A GSGHVDP NAADPGLVYD    DY+ +LC++ Y+S +IALF  
Sbjct  587   ADIGSTSTSKSATPFAFGSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSS  646

Query  1777  NSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYKRTVKNVGKVKNVAYQVTVQTP  1950
                    +N  L  PG LNYPSF+V+F  + +  ++TYKRTVKNVGK+ +  Y V V+ P
Sbjct  647   GVNFTCPKNAVL-QPGDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPST-YAVQVKEP  704

Query  1951  SNVRVTVSPNRLVFTDRIDTLSYEVTFQSL---RQSADSFGSLRWSDGTHLVTSPIAVSW  2121
             + V VTV P  L F    + LSY+V+F +L     +  SFG+L W  G + V SPIAV+W
Sbjct  705   TGVSVTVEPRSLRFKKMGEKLSYKVSFVALGGPTLTNSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/713 (49%), Positives = 455/713 (64%), Gaps = 30/713 (4%)
 Frame = +1

Query  34    LLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQFLGLISG-----  198
             LLYTY    HGF+A L P +A  L +   V+ V  D + EL TTR+P FLG+        
Sbjct  73    LLYTYTAAFHGFAATLDPDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISDDLGLWD  132

Query  199   ---SSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPATSC  369
                  N G    +G D+I+GVLD+G+WPE  SF D G+  +P  W+  CE GP F   SC
Sbjct  133   PHEGPNGGKRRAFG-DVIVGVLDTGVWPESKSFDDAGMPELPARWKGACESGPDFSTKSC  191

Query  370   NRKIIGARAYYRGYEAVTGRPIVDEPK---SAIDMTGHGThvasiaagsavananvngha  540
             N+K+IGAR + +G+   +G   +  PK   S  D  GHGTH AS AAGS VANA++ G+A
Sbjct  192   NKKLIGARFFSKGFRMASGSNFLKNPKEVESPRDRDGHGTHTASTAAGSPVANASLLGYA  251

Query  541   RGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAKPY  720
              G ARG+A +AR+A YKVCW   C  ADIL+GMD+A+ DGV VLSLS+G     G   PY
Sbjct  252   SGTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLG-----GGIAPY  306

Query  721   NEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTLGN  900
               D IAIGAF A+++G+ VSC AGNSGP   +  N+APWI+TVGA T+DR+FPA   LGN
Sbjct  307   YRDTIAIGAFTAMERGIFVSCSAGNSGPAKESLANVAPWIMTVGAGTLDRDFPAYALLGN  366

Query  901   GRTFTGTSLYFGIQPSPNQVSMVYGRRAN--SRYCLPGQLDASKVRGKIVYCKQLANITI  1074
             G+ + G SLY G     N V ++Y + +N   + CLPG L+ +  RGK+V C +  N   
Sbjct  367   GKRYAGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNAR-  425

Query  1075  VDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKSATAR  1254
             V++G  V+ +GGVGMI++N    G ELVA++ +IP   V    GD+I  YVK+ +S TA 
Sbjct  426   VEKGQVVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIRKYVKSDRSPTAV  485

Query  1255  IVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSESTKD  1434
             + FRGTV    PS P VAAFSSRGPN +T +ILKPDVI PGVNILA W+ A  P+    D
Sbjct  486   LSFRGTVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESD  544

Query  1435  NRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRSTLIDL  1614
              R+T FNI+SGTSM+CPH+SG+AA+L+  +P+WSP+AIKSALMTT Y LDN+G S L D 
Sbjct  545   TRKTLFNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYNLDNTG-SPLRDA  603

Query  1615  YTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVD  1794
               G  STP AHGSGHVDP  A  PGLVYD    DY+ FLC++ Y    +   ++  P V 
Sbjct  604   AGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKR-PNVT  662

Query  1795  CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVGKVKNVAYQVTVQTPSNVRVTVS  1974
             C +R   +PG LNYPSF+VVF N+ + + Y R + NVG   ++ Y V+V  PS V VTV 
Sbjct  663   C-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRELTNVGAAGSM-YNVSVTGPSTVGVTVK  719

Query  1975  PNRLVFTDRIDTLSYEVTFQSLR----QSADSFGSLRWSDGTHLVTSPIAVSW  2121
             P +L+F    D + Y VTF S +     +   FGS+ WS+  + V SP+A +W
Sbjct  720   PMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  772



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/719 (48%), Positives = 462/719 (64%), Gaps = 25/719 (3%)
 Frame = +1

Query  1     SPLSNHSRSSELLYTYEHVAHGFSARLTPSQASELANVPGVISVLPDRLVELQTTRSPQF  180
             S L + S S+E++YTYE+  HGFS RLTP +A  L +  G+++VLP+   EL TTR+PQF
Sbjct  53    SSLQSVSDSAEMMYTYENAIHGFSTRLTPEEARLLESQTGILAVLPEVKYELHTTRTPQF  112

Query  181   LGLISGSSNLGPSSDYGADIIIGVLDSGIWPERSSFSDRGLNPIPNSWRNKCEVGPQFPA  360
             LGL   S+++ P S  G ++++GVLD+G+WPE  SF+D G  PIP +W+  CE G  F A
Sbjct  113   LGL-DKSADMFPESSSGNEVVVGVLDTGVWPESKSFNDAGFGPIPTTWKGACESGTNFTA  171

Query  361   TSCNRKIIGARAYYRGYEAVTGRPIVD--EPKSAIDMTGHGThvasiaagsavananvng  534
              +CN+K+IGAR + +G EA+ G PI +  E KS  D  GHGTH +S AAGS V +A++ G
Sbjct  172   ANCNKKLIGARFFSKGVEAMLG-PIDETTESKSPRDDDGHGTHTSSTAAGSVVPDASLFG  230

Query  535   haRGEARGIATNARIAVYKVCWLGTCSNADILSGMDQAVADGVHVLSLSIGLKNKEGFAK  714
             +A G ARG+AT AR+AVYKVCW G C ++DIL+ +D+A++D V+VLSLS+G     G   
Sbjct  231   YASGTARGMATRARVAVYKVCWKGGCFSSDILAAIDKAISDNVNVLSLSLG-----GGMS  285

Query  715   PYNEDPIAIGAFGAVQKGVIVSCGAGNSGPDPYTAINIAPWILTVGASTIDREFPAVVTL  894
              Y  D +AIGAF A++KG++VSC AGN+GP  Y+  N+APWI TVGA T+DR+FPA V+L
Sbjct  286   DYFRDSVAIGAFSAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPASVSL  345

Query  895   GNGRTFTGTSLYFGIQPSPNQVSMVYGRRA----NSRYCLPGQLDASKVRGKIVYCKQLA  1062
             GNG  ++G SLY G     + + ++Y   A    N   C+ G L    V GKIV C +  
Sbjct  346   GNGLNYSGVSLYRGNALPESPLPLIYAGNATNATNGNLCMTGTLSPELVAGKIVLCDRGM  405

Query  1063  NITIVDQGFAVKQSGGVGMIISNVRHQGYELVANADMIPTAVVTAADGDIIYDYVKNTKS  1242
             N   V +G  VK +GG+GM++SN    G ELVA+  ++P   V   +G+ I  Y+ +   
Sbjct  406   NAR-VQKGAVVKAAGGLGMVLSNTAANGEELVADTHLLPATAVGEREGNAIKKYLFSEAK  464

Query  1243  ATARIVFRGTVTGNSPSAPRVAAFSSRGPNFLTPEILKPDVIAPGVNILAAWTGAIAPSE  1422
              T +IVF+GT  G  PS P VAAFSSRGPN +TP+ILKPD+IAPGVNILA W+ A+ P+ 
Sbjct  465   PTVKIVFQGTKVGVEPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTG  523

Query  1423  STKDNRRTEFNIMSGTSMACPHVSGLAAMLRKLYPSWSPAAIKSALMTTTYTLDNSGRST  1602
                D RR +FNI+SGTSM+CPHVSGLAA+++  +P WSPAA++SALMTT Y    +G   
Sbjct  524   LAVDERRVDFNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALMTTAYIAYKNGNK-  582

Query  1603  LIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNS  1782
             L D  TG  STP  HGSGHVDP  A +PGLVYD   +DY+ FLC + Y + +I    R  
Sbjct  583   LQDSATGKSSTPFDHGSGHVDPVAALNPGLVYDLTADDYLGFLCALNYTATQITSLARRK  642

Query  1783  PLVDCRNRNLGNPGALNYPSFAVVFKN--NLQTITYKRTVKNVGKVKNVAYQVTVQTPSN  1956
                D   +   +   LNYPSFAVVF        + + R + NVG        VT  +  N
Sbjct  643   FQCDAGKKY--SVSDLNYPSFAVVFDTMGGANVVKHTRILTNVGPAGTYKASVTSDS-KN  699

Query  1957  VRVTVSPNRLVFTDRIDTLSYEVTFQ---SLRQSADSFGSLRWSDGTHLVTSPIAVSWE  2124
             V++TV P  L F    +  S+ VTF    S  Q  + FG L W++G ++V SPI++SW+
Sbjct  700   VKITVEPEELSFKAN-EKKSFTVTFTSSGSTPQKLNGFGRLEWTNGKNVVGSPISISWD  757



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6737972942452