BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25048_g2_i1 len=2222 path=[8129:0-637 13542:638-722 13627:723-746
19794:747-776 13678:777-801 19852:802-810 19861:811-843
19894:844-900 9033:901-929 9061:930-999 7111:1000-1037
9167:1038-1083 7902:1084-1199 9327:1200-1268 1284:1269-1292
9419:1293-1398 1414:1399-1442 9568:1443-1779 9905:1780-1805
9930:1806-2221]

Length=2222
                                                                      Score     E

ref|XP_011099559.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               901   0.0     
ref|XP_011097190.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          900   0.0     
ref|XP_009598968.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               896   0.0     
ref|XP_009786212.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               895   0.0     
gb|EPS61116.1|  hypothetical protein M569_13682                         892   0.0     
emb|CDP02779.1|  unnamed protein product                                892   0.0     
gb|KDP29403.1|  hypothetical protein JCGZ_18324                         886   0.0     
ref|XP_004232364.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               881   0.0     
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                                 880   0.0     
ref|XP_006363119.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          879   0.0     
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          879   0.0     
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                          879   0.0     
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                              879   0.0     
ref|XP_009597817.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          878   0.0     
ref|XP_004135090.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    877   0.0     
ref|XP_009784659.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          877   0.0     
ref|XP_008446598.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               876   0.0     
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          875   0.0     
gb|ABA01490.1|  3-ketoacyl-CoA synthase                                 874   0.0     Gossypium hirsutum [American cotton]
gb|ACT21783.1|  CER6                                                    874   0.0     Solanum lycopersicum
ref|XP_002315942.1|  ECERIFERUM 6 family protein                        873   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               872   0.0     
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                               872   0.0     
ref|XP_003555901.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          871   0.0     
ref|XP_003536684.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               869   0.0     
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          866   0.0     
ref|XP_008389290.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          866   0.0     
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               866   0.0     
ref|XP_003637444.1|  3-ketoacyl-CoA synthase                            863   0.0     
ref|XP_002283730.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               863   0.0     Vitis vinifera
ref|XP_011007926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               863   0.0     
ref|XP_004497096.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          863   0.0     
ref|XP_003531926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          861   0.0     
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               861   0.0     
ref|XP_002531630.1|  acyltransferase, putative                          860   0.0     Ricinus communis
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               859   0.0     
ref|XP_002311457.1|  hypothetical protein POPTR_0008s11920g             859   0.0     Populus trichocarpa [western balsam poplar]
gb|EYU34398.1|  hypothetical protein MIMGU_mgv1a005204mg                857   0.0     
ref|XP_007142908.1|  hypothetical protein PHAVU_007G027100g             857   0.0     
gb|KDO69954.1|  hypothetical protein CISIN_1g011007mg                   855   0.0     
ref|XP_002888670.1|  hypothetical protein ARALYDRAFT_894621             853   0.0     
ref|XP_004299082.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          852   0.0     
ref|XP_006437664.1|  hypothetical protein CICLE_v10031329mg             851   0.0     
ref|XP_011099560.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          849   0.0     
ref|NP_177020.1|  3-ketoacyl-CoA synthase 6                             848   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAM65060.1|  very-long-chain fatty acid condensing enzyme CUT1       848   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307339.1|  hypothetical protein CARUB_v10008957mg             847   0.0     
gb|AAL50069.1|  At1g68530/T26J14_10                                     847   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KFK41273.1|  hypothetical protein AALP_AA2G108700                    846   0.0     
gb|EYU44641.1|  hypothetical protein MIMGU_mgv1a005164mg                846   0.0     
ref|XP_009105040.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               844   0.0     
ref|XP_006302169.1|  hypothetical protein CARUB_v10020179mg             844   0.0     
ref|NP_173916.1|  3-ketoacyl-CoA synthase 5                             843   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391129.1|  hypothetical protein EUTSA_v10018446mg             843   0.0     
ref|XP_009356710.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          843   0.0     
gb|AAM67234.1|  fatty acid condensing enzyme CUT1, putative             842   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415873.1|  hypothetical protein EUTSA_v10007453mg             841   0.0     
emb|CDY04232.1|  BnaC06g25830D                                          841   0.0     
ref|XP_002890689.1|  hypothetical protein ARALYDRAFT_472828             840   0.0     
ref|XP_010511851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          839   0.0     
ref|XP_010499108.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               839   0.0     
gb|AIE57499.1|  KCS6                                                    838   0.0     
ref|XP_010477925.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          838   0.0     
ref|XP_010415473.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               838   0.0     
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          837   0.0     
ref|XP_002282526.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               835   0.0     Vitis vinifera
ref|XP_003614634.1|  3-ketoacyl-CoA synthase                            833   0.0     
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          833   0.0     
gb|AAO42223.1|  putative fatty acid condensing enzyme CUT1              832   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527537.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          828   0.0     
gb|KFK44525.1|  hypothetical protein AALP_AA1G267900                    828   0.0     
emb|CDP00616.1|  unnamed protein product                                828   0.0     
ref|XP_010551269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               827   0.0     
ref|XP_009115318.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               826   0.0     
gb|KHN11421.1|  3-ketoacyl-CoA synthase 6                               823   0.0     
emb|CDY42109.1|  BnaA09g28510D                                          825   0.0     
ref|XP_007153392.1|  hypothetical protein PHAVU_003G031300g             826   0.0     
gb|KHN05569.1|  3-ketoacyl-CoA synthase 6                               821   0.0     
ref|XP_004135091.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    816   0.0     
ref|XP_010692961.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          817   0.0     
ref|XP_006841272.1|  hypothetical protein AMTR_s00135p00117490          817   0.0     
ref|XP_008802438.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          811   0.0     
ref|XP_010926125.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          810   0.0     
ref|XP_009390849.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          806   0.0     
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          805   0.0     
ref|XP_010103772.1|  3-ketoacyl-CoA synthase 6                          803   0.0     
ref|XP_009390357.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          800   0.0     
ref|XP_004985167.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          797   0.0     
ref|NP_001049406.1|  Os03g0220100                                       796   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009777704.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          795   0.0     
ref|XP_002465630.1|  hypothetical protein SORBIDRAFT_01g042600          793   0.0     Sorghum bicolor [broomcorn]
ref|XP_006651174.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          793   0.0     
ref|NP_001130497.1|  uncharacterized protein LOC100191595               791   0.0     Zea mays [maize]
ref|XP_008668455.1|  PREDICTED: uncharacterized protein LOC100191...    790   0.0     
ref|XP_008775195.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    790   0.0     
ref|XP_009605061.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          789   0.0     
ref|XP_003558474.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          786   0.0     
gb|EMT20723.1|  3-ketoacyl-CoA synthase 6                               785   0.0     
gb|ABG35744.1|  putative very long chain fatty acid condensing en...    785   0.0     Hordeum vulgare [barley]
ref|XP_006344141.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          781   0.0     
gb|ABY82171.2|  3-ketoacyl-CoA synthase I                               781   0.0     Triticum aestivum [Canadian hard winter wheat]
gb|AHX25585.1|  3-ketoacyl-CoA synthase 6                               775   0.0     
gb|AIV98044.1|  3-ketoacyl-CoA synthase                                 772   0.0     
ref|XP_004238923.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          774   0.0     
ref|XP_011076851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          774   0.0     
ref|XP_009414779.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          768   0.0     
ref|XP_002271250.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               765   0.0     Vitis vinifera
ref|XP_009380079.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          765   0.0     
ref|XP_006344142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          764   0.0     
ref|XP_010910111.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          759   0.0     
emb|CDP00615.1|  unnamed protein product                                756   0.0     
emb|CAN63425.1|  hypothetical protein VITISV_040442                     756   0.0     Vitis vinifera
ref|XP_004238922.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               756   0.0     
ref|XP_008660394.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          753   0.0     
ref|XP_010681548.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          739   0.0     
ref|XP_008801160.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               735   0.0     
ref|XP_009391408.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               733   0.0     
ref|XP_009762000.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          731   0.0     
gb|EYU26766.1|  hypothetical protein MIMGU_mgv1a005018mg                725   0.0     
ref|XP_010265150.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          722   0.0     
ref|XP_006842379.1|  hypothetical protein AMTR_s00079p00192440          711   0.0     
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947              699   0.0     
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692             699   0.0     
ref|XP_009399728.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          684   0.0     
ref|XP_007222962.1|  hypothetical protein PRUPE_ppa006758mg             674   0.0     
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               676   0.0     
gb|AAP74371.1|  FAE1                                                    677   0.0     Marchantia polymorpha
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g             672   0.0     Populus trichocarpa [western balsam poplar]
emb|CDP07508.1|  unnamed protein product                                671   0.0     
ref|XP_010932594.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          670   0.0     
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          670   0.0     
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          669   0.0     
ref|XP_006341948.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          669   0.0     
ref|XP_004238271.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               669   0.0     
ref|XP_007200967.1|  hypothetical protein PRUPE_ppa004500mg             668   0.0     
ref|XP_009627040.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               669   0.0     
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          668   0.0     
ref|XP_010248169.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          669   0.0     
ref|XP_010243778.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               669   0.0     
ref|XP_002305431.1|  hypothetical protein POPTR_0004s16290g             668   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          668   0.0     
ref|XP_009406296.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          668   0.0     
ref|XP_011083903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               666   0.0     
ref|XP_010690872.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               665   0.0     
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1    665   0.0     
ref|XP_004289669.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          665   0.0     
ref|XP_009760261.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               665   0.0     
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                            663   0.0     
ref|XP_008236905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          662   0.0     
gb|KDP46259.1|  hypothetical protein JCGZ_10099                         662   0.0     
ref|XP_010489197.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          662   0.0     
ref|XP_008805392.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          663   0.0     
ref|XP_008377297.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          660   0.0     
gb|AGH32920.1|  ketoacyl-CoA synthase                                   660   0.0     
ref|XP_010467354.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          660   0.0     
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          660   0.0     
gb|KDP38510.1|  hypothetical protein JCGZ_04435                         659   0.0     
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          659   0.0     
ref|XP_002884160.1|  hypothetical protein ARALYDRAFT_900287             658   0.0     
ref|XP_010516877.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    658   0.0     
ref|XP_006409460.1|  hypothetical protein EUTSA_v10022654mg             657   0.0     
ref|XP_006416504.1|  hypothetical protein EUTSA_v10007370mg             657   0.0     
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          656   0.0     
ref|XP_006299088.1|  hypothetical protein CARUB_v10015226mg             657   0.0     
ref|NP_179223.1|  3-ketoacyl-CoA synthase 9                             657   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          656   0.0     
ref|NP_173376.1|  3-ketoacyl-CoA synthase 4                             655   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               654   0.0     Vitis vinifera
gb|AGK29994.1|  3-ketoacyl-CoA synthase 4                               654   0.0     
ref|XP_006304681.1|  hypothetical protein CARUB_v10011929mg             654   0.0     
ref|XP_010104374.1|  3-ketoacyl-CoA synthase 4                          654   0.0     
ref|XP_002509491.1|  acyltransferase, putative                          653   0.0     Ricinus communis
ref|XP_007042184.1|  3-ketoacyl-CoA synthase 4                          653   0.0     
gb|KFK41268.1|  hypothetical protein AALP_AA2G107900                    653   0.0     
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g             652   0.0     
ref|XP_002510394.1|  acyltransferase, putative                          652   0.0     Ricinus communis
gb|KFK44079.1|  hypothetical protein AALP_AA1G213300                    652   0.0     
ref|XP_008357196.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          651   0.0     
ref|XP_009365554.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          651   0.0     
ref|XP_008388058.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          651   0.0     
ref|XP_002890341.1|  hypothetical protein ARALYDRAFT_472173             649   0.0     
ref|XP_009341963.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          649   0.0     
ref|XP_010263648.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          649   0.0     
ref|XP_010254814.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          649   0.0     
ref|XP_009364915.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          649   0.0     
ref|XP_007160751.1|  hypothetical protein PHAVU_001G014100g             649   0.0     
gb|ACQ41892.1|  3-ketoacyl-CoA synthase                                 649   0.0     Camellia oleifera [abura-tsubaki]
ref|XP_009416553.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          649   0.0     
emb|CDX71278.1|  BnaC07g05570D                                          648   0.0     
ref|XP_001757568.1|  predicted protein                                  648   0.0     
ref|XP_009389417.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          648   0.0     
ref|XP_007222865.1|  hypothetical protein PRUPE_ppa004284mg             647   0.0     
ref|XP_006423278.1|  hypothetical protein CICLE_v10028243mg             646   0.0     
ref|XP_008800772.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          645   0.0     
ref|XP_010539905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               646   0.0     
ref|XP_008444712.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          646   0.0     
gb|EPS60765.1|  hypothetical protein M569_14036                         645   0.0     
ref|XP_010924276.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          645   0.0     
gb|KDO49072.1|  hypothetical protein CISIN_1g010687mg                   645   0.0     
ref|XP_008378462.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          645   0.0     
ref|XP_010459615.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          645   0.0     
ref|XP_004152699.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          645   0.0     
emb|CDY46211.1|  BnaA07g03590D                                          644   0.0     
emb|CDY21665.1|  BnaA09g44160D                                          644   0.0     
ref|XP_009117539.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               644   0.0     
ref|XP_001758798.1|  predicted protein                                  644   0.0     
ref|XP_010477163.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          644   0.0     
ref|XP_010088926.1|  3-ketoacyl-CoA synthase 4                          644   0.0     
ref|XP_006847589.1|  hypothetical protein AMTR_s00014p00234760          643   0.0     
gb|ABS18382.1|  3-ketoacyl-CoA synthase                                 643   0.0     Eranthis hyemalis
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          643   0.0     
ref|XP_001753137.1|  predicted protein                                  642   0.0     
ref|XP_010498362.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               642   0.0     
emb|CDO97044.1|  unnamed protein product                                642   0.0     
emb|CDX81929.1|  BnaC08g36720D                                          642   0.0     
ref|NP_001267518.1|  uncharacterized protein LOC100797855               641   0.0     
ref|XP_009121221.1|  PREDICTED: 3-ketoacyl-CoA synthase 9               641   0.0     
gb|AGK29996.1|  3-ketoacyl-CoA synthase 18                              640   0.0     
ref|XP_009112385.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    639   0.0     
gb|AGK30005.1|  3-ketoacyl-CoA synthase                                 639   0.0     
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          636   0.0     
ref|XP_010548057.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          636   0.0     
gb|KDO84579.1|  hypothetical protein CISIN_1g010193mg                   637   0.0     
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              635   0.0     
ref|XP_006435002.1|  hypothetical protein CICLE_v10000889mg             635   0.0     
ref|XP_001753229.1|  predicted protein                                  636   0.0     
ref|XP_010548056.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          635   0.0     
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    635   0.0     
gb|EMS60006.1|  3-ketoacyl-CoA synthase 6                               632   0.0     
ref|XP_007017550.1|  3-ketoacyl-CoA synthase 4                          634   0.0     
ref|XP_002321310.2|  very-long-chain fatty acid condensing enzyme...    635   0.0     Populus trichocarpa [western balsam poplar]
ref|NP_001130638.1|  g14A                                               632   0.0     Zea mays [maize]
gb|ACO72624.1|  g14a                                                    630   0.0     Zea mays [maize]
ref|XP_003637542.1|  Beta-ketoacyl-CoA synthase                         631   0.0     
gb|ACO72625.1|  g14a                                                    630   0.0     Zea mays [maize]
gb|ACO72623.1|  g14a                                                    630   0.0     Zea mays [maize]
ref|XP_009601634.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         631   0.0     
ref|XP_009779614.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         629   0.0     
ref|XP_002284986.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              629   0.0     Vitis vinifera
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              629   0.0     
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         629   0.0     
ref|XP_009607438.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         629   0.0     
gb|AGK29998.1|  3-ketoacyl-CoA synthase 9                               628   0.0     
ref|NP_001146356.1|  uncharacterized protein LOC100279934               627   0.0     Zea mays [maize]
ref|XP_009149432.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               628   0.0     
ref|XP_007154946.1|  hypothetical protein PHAVU_003G160400g             627   0.0     
gb|AFW81175.1|  acyltransferase                                         627   0.0     
ref|XP_009801870.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         627   0.0     
ref|NP_001056354.1|  Os05g0568000                                       627   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009630522.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          627   0.0     
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg             626   0.0     
ref|XP_006655600.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          625   0.0     
ref|XP_004498007.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         625   0.0     
ref|XP_006353644.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         626   0.0     
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         625   0.0     
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         625   0.0     
gb|EAY99068.1|  hypothetical protein OsI_21025                          625   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860          625   0.0     Sorghum bicolor [broomcorn]
ref|NP_001130522.1|  uncharacterized protein LOC100191621               625   0.0     Zea mays [maize]
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         625   0.0     
ref|XP_007013326.1|  3-ketoacyl-CoA synthase                            624   0.0     
gb|AFK39024.1|  unknown                                                 624   0.0     
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         624   0.0     
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               624   0.0     
ref|XP_007034926.1|  3-ketoacyl-CoA synthase                            624   0.0     
ref|XP_004293205.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          624   0.0     
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         624   0.0     
gb|AGK30016.1|  3-ketoacyl-CoA synthase                                 623   0.0     
ref|XP_009347466.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         623   0.0     
ref|XP_004495403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         623   0.0     
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                    623   0.0     
ref|XP_004241809.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         623   0.0     
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         622   0.0     
ref|XP_002324276.1|  hypothetical protein POPTR_0018s01300g             623   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009336207.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               620   0.0     
ref|XP_011015110.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         622   0.0     
ref|XP_007143888.1|  hypothetical protein PHAVU_007G110500g             622   0.0     
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         622   0.0     
ref|XP_007145927.1|  hypothetical protein PHAVU_007G279500g             622   0.0     
ref|XP_011026502.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         622   0.0     
gb|EPS63750.1|  hypothetical protein M569_11032                         621   0.0     
gb|AGK29990.1|  3-ketoacyl-CoA synthase 11                              621   0.0     
gb|EYU21941.1|  hypothetical protein MIMGU_mgv1a004813mg                621   0.0     
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         621   0.0     
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                    621   0.0     
emb|CDO99138.1|  unnamed protein product                                621   0.0     
ref|XP_004965965.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         621   0.0     
dbj|BAJ90995.1|  predicted protein                                      619   0.0     
ref|XP_009348198.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         620   0.0     
ref|XP_011091085.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              620   0.0     
dbj|BAF98214.1|  CM0216.300.nc                                          620   0.0     
ref|XP_002977865.1|  hypothetical protein SELMODRAFT_443640             619   0.0     
ref|XP_007204837.1|  hypothetical protein PRUPE_ppa004269mg             620   0.0     
ref|XP_002960812.1|  hypothetical protein SELMODRAFT_437285             619   0.0     
ref|XP_007013801.1|  3-ketoacyl-CoA synthase                            619   0.0     
dbj|BAJ94420.1|  predicted protein                                      619   0.0     
ref|XP_008242707.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              619   0.0     
ref|XP_002979460.1|  hypothetical protein SELMODRAFT_444233             619   0.0     
dbj|BAJ89275.1|  predicted protein                                      617   0.0     
ref|XP_006854931.1|  hypothetical protein AMTR_s00052p00130070          619   0.0     
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg             618   0.0     
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         617   0.0     
gb|KDP32347.1|  hypothetical protein JCGZ_13272                         617   0.0     
gb|AAO48425.1|  beta-ketoacyl-CoA-synthase                              618   0.0     
ref|XP_004247624.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         617   0.0     
dbj|BAJ98276.1|  predicted protein                                      617   0.0     
ref|XP_008385932.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              617   0.0     
ref|XP_003524525.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         616   0.0     
ref|XP_011019752.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              616   0.0     
emb|CDP03396.1|  unnamed protein product                                616   0.0     
gb|EPS57140.1|  hypothetical protein M569_17681                         615   0.0     
gb|ACC60973.1|  beta-ketoacyl-CoA synthase                              615   0.0     
ref|XP_003549787.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         616   0.0     
ref|XP_010918127.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         616   0.0     
ref|XP_008219888.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         616   0.0     
gb|AGK30001.1|  3-ketoacyl-CoA synthase                                 615   0.0     
gb|KDP40263.1|  hypothetical protein JCGZ_02261                         616   0.0     
ref|XP_006656205.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         616   0.0     
ref|XP_011088403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...    615   0.0     
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         615   0.0     
ref|XP_010102812.1|  3-ketoacyl-CoA synthase 11                         615   0.0     
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         615   0.0     
gb|AGK29991.1|  3-ketoacyl-CoA synthase 7                               615   0.0     
ref|XP_002308642.1|  hypothetical protein POPTR_0006s26530g             615   0.0     
ref|XP_009804708.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         615   0.0     
dbj|BAK06985.1|  predicted protein                                      613   0.0     
ref|XP_010914942.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         614   0.0     
ref|XP_009374066.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              615   0.0     
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                    614   0.0     
gb|AGK29989.1|  3-ketoacyl-CoA synthase 2                               615   0.0     
dbj|BAJ93555.1|  predicted protein                                      614   0.0     
ref|XP_010670713.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         614   0.0     
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          614   0.0     
ref|XP_002284751.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              613   0.0     
emb|CDP04806.1|  unnamed protein product                                613   0.0     
gb|KHG17042.1|  3-ketoacyl-CoA synthase 17 -like protein                614   0.0     
gb|KHG01499.1|  3-ketoacyl-CoA synthase 11 -like protein                613   0.0     
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                              613   0.0     
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    613   0.0     
ref|XP_003571537.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              613   0.0     
ref|XP_006362163.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         613   0.0     
ref|XP_008792115.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         612   0.0     
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         612   0.0     
gb|EMS50435.1|  3-ketoacyl-CoA synthase 4                               612   0.0     
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                              612   0.0     
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg             612   0.0     
gb|KDO80366.1|  hypothetical protein CISIN_1g008975mg                   613   0.0     
ref|XP_010925263.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         612   0.0     
ref|XP_004953823.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          610   0.0     
ref|XP_006451013.1|  hypothetical protein CICLE_v10007916mg             613   0.0     
ref|XP_006581119.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          608   0.0     
gb|ABV60087.1|  beta-ketoacyl-CoA synthase                              612   0.0     
gb|KHG21958.1|  3-ketoacyl-CoA synthase 11 -like protein                612   0.0     
ref|XP_010432405.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      609   0.0     
ref|XP_002283935.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              610   0.0     
ref|XP_008800778.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          606   0.0     
ref|XP_011027418.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         610   0.0     
gb|AGK29988.1|  3-ketoacyl-CoA synthase 1                               611   0.0     
ref|XP_008361241.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              610   0.0     
ref|XP_009601390.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    610   0.0     
ref|XP_009601391.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    609   0.0     
ref|XP_009334788.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         609   0.0     
emb|CDX76286.1|  BnaA08g11140D                                          607   0.0     
emb|CDY46243.1|  BnaC03g66040D                                          607   0.0     
ref|XP_009385808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         608   0.0     
ref|XP_003609222.1|  Beta-ketoacyl-coa synthase family protein          607   0.0     
ref|XP_010533183.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    608   0.0     
ref|XP_004170552.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         607   0.0     
ref|XP_004508544.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    607   0.0     
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g             607   0.0     
gb|EAZ00421.1|  hypothetical protein OsI_22442                          606   0.0     
ref|XP_006398946.1|  hypothetical protein EUTSA_v10013296mg             607   0.0     
ref|NP_195177.1|  3-ketoacyl-CoA synthase 17                            606   0.0     
ref|XP_008368384.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         607   0.0     
ref|XP_002312562.1|  hypothetical protein POPTR_0008s15990g             607   0.0     
ref|XP_009394797.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         607   0.0     
ref|XP_009767720.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         607   0.0     
gb|ABK24632.1|  unknown                                                 607   0.0     
ref|XP_004508545.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    606   0.0     
ref|XP_010024057.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         607   0.0     
ref|XP_004951508.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         620   0.0     
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         606   0.0     
ref|NP_001057327.1|  Os06g0260500                                       605   0.0     
ref|NP_001048023.2|  Os02g0731900                                       605   0.0     
gb|AGT15995.1|  fatty acid elongase                                     606   0.0     
ref|XP_010049954.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              605   0.0     
gb|ACC95444.1|  beta-ketoacyl-CoA synthase                              605   0.0     
ref|XP_010557584.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    605   0.0     
ref|XP_009407649.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         605   0.0     
ref|XP_008785403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         604   0.0     
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         604   0.0     
ref|XP_010557583.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    604   0.0     
gb|AHX25587.1|  3-ketoacyl-CoA synthase 11                              604   0.0     
gb|AFW87109.1|  putative fatty acid elongase isoform 1                  604   0.0     
gb|EMT15934.1|  3-ketoacyl-CoA synthase 11                              604   0.0     
ref|XP_010091264.1|  3-ketoacyl-CoA synthase 11                         604   0.0     
ref|XP_003563984.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          603   0.0     
ref|XP_002437234.1|  hypothetical protein SORBIDRAFT_10g023290          604   0.0     
ref|XP_002453517.1|  hypothetical protein SORBIDRAFT_04g007190          603   0.0     
ref|XP_009595982.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         603   0.0     
ref|XP_008464980.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              603   0.0     
ref|XP_008796071.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         603   0.0     
gb|AAP74370.1|  FAE3                                                    603   0.0     
ref|XP_002517035.1|  acyltransferase, putative                          603   0.0     
gb|EAZ01557.1|  hypothetical protein OsI_23590                          603   0.0     
ref|XP_004251585.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    602   0.0     
ref|XP_009108847.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      600   0.0     
gb|EMT10755.1|  3-ketoacyl-CoA synthase 6                               602   0.0     
gb|ACY78677.1|  fatty acid elongase                                     602   0.0     
gb|AGK29992.1|  3-ketoacyl-CoA synthase 19                              602   0.0     
ref|NP_001266579.1|  fatty acid elongase                                602   0.0     
ref|XP_010447067.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      600   0.0     
gb|ACJ85761.1|  unknown                                                 601   0.0     
ref|XP_002438192.1|  hypothetical protein SORBIDRAFT_10g009410          600   0.0     
ref|NP_001057996.1|  Os06g0598800                                       601   0.0     
ref|XP_010098974.1|  3-ketoacyl-CoA synthase 11                         601   0.0     
ref|NP_180232.1|  3-ketoacyl-CoA synthase 11                            600   0.0     
gb|EMT24470.1|  3-ketoacyl-CoA synthase 11                              601   0.0     
ref|XP_002878994.1|  hypothetical protein ARALYDRAFT_901443             600   0.0     
ref|XP_006293527.1|  hypothetical protein CARUB_v10024547mg             600   0.0     
ref|XP_004287376.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         600   0.0     
gb|ACR36808.1|  unknown                                                 600   0.0     
ref|XP_006647846.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          598   0.0     
ref|XP_007222815.1|  hypothetical protein PRUPE_ppa004243mg             600   0.0     
ref|XP_002529366.1|  acyltransferase, putative                          598   0.0     
gb|AFK48523.1|  unknown                                                 599   0.0     
ref|XP_009381261.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         599   0.0     
ref|XP_009792392.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         598   0.0     
gb|EAY99126.1|  hypothetical protein OsI_21086                          599   0.0     
ref|XP_006420077.1|  hypothetical protein CICLE_v10004736mg             599   0.0     
ref|XP_006378366.1|  hypothetical protein POPTR_0010s08990g             599   0.0     
ref|XP_006647059.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         598   0.0     
ref|NP_001056391.1|  Os05g0574600                                       598   0.0     
ref|XP_010313709.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    598   0.0     
ref|XP_004146292.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         598   0.0     
ref|XP_006356047.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         598   0.0     
ref|XP_006284916.1|  hypothetical protein CARUB_v10006212mg             596   0.0     
ref|NP_001151591.1|  fatty acid elongase                                598   0.0     
ref|XP_011088405.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...    595   0.0     
ref|XP_006489489.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         597   0.0     
ref|XP_004961143.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         597   0.0     
ref|NP_001105135.1|  fatty acid elongase1                               597   0.0     
gb|EYU34550.1|  hypothetical protein MIMGU_mgv1a004667mg                597   0.0     
ref|XP_010274236.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         597   0.0     
ref|XP_003570501.2|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          595   0.0     
ref|XP_010069186.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         597   0.0     
gb|KDO53945.1|  hypothetical protein CISIN_1g009935mg                   596   0.0     
ref|XP_004499254.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          596   0.0     
gb|EMS65062.1|  3-ketoacyl-CoA synthase 11                              595   0.0     
ref|XP_006387707.1|  hypothetical protein POPTR_0658s00200g             596   0.0     
ref|XP_001778803.1|  predicted protein                                  596   0.0     
ref|XP_010683564.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         596   0.0     
ref|XP_010417808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              595   0.0     
ref|XP_010473048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    595   0.0     
gb|ACO72627.1|  truncated g14a                                          593   0.0     
ref|XP_001757962.1|  predicted protein                                  595   0.0     
ref|XP_009122553.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              595   0.0     
ref|XP_002869143.1|  3-ketoacyl-CoA synthase 2                          593   0.0     
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                              592   0.0     
gb|KFK42764.1|  hypothetical protein AALP_AA1G036700                    594   0.0     
emb|CDX70186.1|  BnaA10g25350D                                          593   0.0     
gb|EYU26763.1|  hypothetical protein MIMGU_mgv1a027040mg                594   0.0     
ref|XP_004306622.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          594   0.0     
ref|XP_006412219.1|  hypothetical protein EUTSA_v10025028mg             592   0.0     
ref|XP_004965180.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          592   0.0     
emb|CDX98800.1|  BnaC09g50350D                                          593   0.0     
ref|XP_008796426.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         592   0.0     
ref|XP_008650048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         592   0.0     
ref|XP_002892201.1|  hypothetical protein ARALYDRAFT_470398             592   0.0     
ref|XP_008391016.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like i...    592   0.0     
ref|XP_008352048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         591   0.0     
ref|XP_002969546.1|  hypothetical protein SELMODRAFT_91671              590   0.0     
ref|XP_006366859.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         590   0.0     
ref|XP_002970815.1|  hypothetical protein SELMODRAFT_94459              590   0.0     
gb|ABK96299.1|  unknown                                                 590   0.0     
ref|XP_010932851.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         590   0.0     
gb|KHN15129.1|  3-ketoacyl-CoA synthase 11                              587   0.0     
ref|XP_011030604.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         589   0.0     
ref|XP_009349773.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         587   0.0     
gb|AAU95453.1|  At1g04220                                               587   0.0     
ref|XP_004141352.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         588   0.0     
ref|XP_004134106.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like         587   0.0     
ref|XP_002529975.1|  acyltransferase, putative                          587   0.0     
ref|NP_171918.1|  3-ketoacyl-CoA synthase 2                             587   0.0     
ref|XP_008452803.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    587   0.0     
ref|XP_004165059.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    586   0.0     
gb|AFW76936.1|  hypothetical protein ZEAMMB73_155419                    585   0.0     
gb|EMT13284.1|  3-ketoacyl-CoA synthase 6                               583   0.0     
ref|XP_010692792.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         585   0.0     
emb|CDY26665.1|  BnaA06g13570D                                          584   0.0     
ref|XP_004168381.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like         585   0.0     
ref|NP_001046250.1|  Os02g0205500                                       585   0.0     
gb|EAY84941.1|  hypothetical protein OsI_06307                          585   0.0     
ref|XP_002264721.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               585   0.0     
gb|AAL67132.1|  putative beta-ketoacyl-CoA synthase                     585   0.0     
emb|CDY29431.1|  BnaA06g13650D                                          583   0.0     
ref|XP_008438597.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         583   0.0     
ref|XP_003563983.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          583   0.0     
ref|XP_009351389.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          585   0.0     
gb|ABF51009.1|  putative very long chain fatty acid condensing en...    582   0.0     



>ref|XP_011099559.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Sesamum indicum]
Length=496

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/492 (86%), Positives = 461/492 (94%), Gaps = 2/492 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N  SSVKLKYVKLGYQYLVNHILT LL+P+M GV +E+LR GPEEI++    + +  +L+
Sbjct  7     NFSSSVKLKYVKLGYQYLVNHILTFLLIPIMLGVFLEILRLGPEEILLLW--NFLHFDLV  64

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
              VL SS  ++F+AT+Y+MSKPRSIYLVDY+CYKPPVTCRVPFSTFMEHSRL LKDNPKSV
Sbjct  65    QVLCSSFLVIFIATVYVMSKPRSIYLVDYSCYKPPVTCRVPFSTFMEHSRLILKDNPKSV  124

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             +FQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFS ID+LM+KT ++ KDI
Sbjct  125   DFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSTIDSLMEKTGIRPKDI  184

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
             DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VHPNS
Sbjct  185   DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNS  244

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
             NALV+STEIITPNYYKGSERAMLLPNCLFRMG AAIL+SNKRRDS RAKY+L+HVVRTHK
Sbjct  245   NALVISTEIITPNYYKGSERAMLLPNCLFRMGAAAILLSNKRRDSARAKYKLVHVVRTHK  304

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+DDKAYRCVYEQEDP+GKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL
Sbjct  305   GADDKAYRCVYEQEDPEGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  364

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             IGRK+FNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGN
Sbjct  365   IGRKMFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGN  424

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSSLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW DCID
Sbjct  425   TSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWQDCID  484

Query  636   RYPVHIPEIVKL  601
             RYPVHIPEIVKL
Sbjct  485   RYPVHIPEIVKL  496



>ref|XP_011097190.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/498 (86%), Positives = 463/498 (93%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             ES P F+N  SVKLKYVKLGYQYLVNHILT LL+P++  + +E+LR GPEEIV +I +S 
Sbjct  3     ESLPSFSN--SVKLKYVKLGYQYLVNHILTFLLIPIIIALAVEILRLGPEEIV-KIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ VL SS  +VF+AT+Y MSKPRSIYLVDYACYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LQFDLVQVLCSSFLVVFIATVYFMSKPRSIYLVDYACYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSV FQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFS ID+LM+KT 
Sbjct  119   DNPKSVHFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSCIDSLMQKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             +K KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   IKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNALV+STEIITPNYYKGSERAMLLPNCLFRMGGAAIL+SNK RDS RAKY+L+H
Sbjct  239   QVHPNSNALVISTEIITPNYYKGSERAMLLPNCLFRMGGAAILLSNKSRDSRRAKYKLVH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKAY+CVYEQEDP+GKVGINLSKDLM+IAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAYKCVYEQEDPEGKVGINLSKDLMLIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMT
Sbjct  359   LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DGP
Sbjct  419   LHRFGNTSSSSLWYELGYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPVDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W+DCI+RYPVHIPEIVKL
Sbjct  479   WVDCIERYPVHIPEIVKL  496



>ref|XP_009598968.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana tomentosiformis]
Length=496

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/498 (87%), Positives = 460/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E  P F+N  SVKLKYVKLGYQYLVNHILT LLVP+M GVTIEVLR GPEE+ +RI +S 
Sbjct  3     EVVPSFSN--SVKLKYVKLGYQYLVNHILTFLLVPIMVGVTIEVLRLGPEEL-LRIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F+AT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLLQILCSSFLIIFIATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D LMKKT 
Sbjct  119   DNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSAVDDLMKKTR  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAIL+S+KRRD  RAKYRLMH
Sbjct  239   QVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILLSSKRRDRYRAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKA++CV+EQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAFKCVFEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFL TLI RKIFNPK KPYIPDFKQAFEHFCIHAGGRAVIDELQK LQLS+EHVEASRMT
Sbjct  359   LFLLTLISRKIFNPKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKKLQLSAEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K   DGP
Sbjct  419   LHRFGNTSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTSTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPVHIPEIVKL
Sbjct  479   WQDCIDRYPVHIPEIVKL  496



>ref|XP_009786212.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana sylvestris]
Length=496

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/498 (87%), Positives = 459/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E  P F+N  SVKLKYVKLGYQYLVNHILT LLVP+M GVTIEVLR GPEE+ + I +S 
Sbjct  3     EVVPSFSN--SVKLKYVKLGYQYLVNHILTFLLVPIMVGVTIEVLRLGPEEL-LSIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F+AT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLLQILCSSFPIIFIATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSAID LMKKT 
Sbjct  119   DNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSAIDDLMKKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAIL+SNKRRD  RAKYRLMH
Sbjct  239   QVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILLSNKRRDRYRAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRT KG+DDKA++CV+EQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTQKGADDKAFKCVFEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFL TLI RK FNPK KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMT
Sbjct  359   LFLLTLISRKFFNPKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DGP
Sbjct  419   LHRFGNTSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPVHIPEIVKL
Sbjct  479   WQDCIDRYPVHIPEIVKL  496



>gb|EPS61116.1| hypothetical protein M569_13682, partial [Genlisea aurea]
Length=504

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/488 (86%), Positives = 455/488 (93%), Gaps = 1/488 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLGYQYLVNHILT LL+P+MAG  +E+LR GP EI+  + +S++ L+ + +L 
Sbjct  18    SVKLKYVKLGYQYLVNHILTFLLIPIMAGAAVEILRLGPHEIIA-VWNSLLRLDAVQILC  76

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+  ++F+ATLY+ SKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL LKDNPKSV+FQM
Sbjct  77    SAFLIIFIATLYVTSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNPKSVDFQM  136

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGEETCLP AIHYIPPKP M+AARGEAE VIFS+IDALMKKT +K KDIDILI
Sbjct  137   RILERSGLGEETCLPPAIHYIPPKPNMEAARGEAEVVIFSSIDALMKKTGIKPKDIDILI  196

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM+VNKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VHPNS ALV
Sbjct  197   VNCSLFSPTPSLSAMIVNKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALV  256

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             +STEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNKRRD GRAKYRL+HVVRTHKG+DD
Sbjct  257   ISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDGGRAKYRLVHVVRTHKGADD  316

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KAY+CVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL TLIGRK
Sbjct  317   KAYKCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLVTLIGRK  376

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSSS
Sbjct  377   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSS  436

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL Y+E+K RMKKGDR+WQIAFGSGFKCNSAVWKCN  +K P DGPW DCI+RYPV
Sbjct  437   SLWYELAYVEAKNRMKKGDRVWQIAFGSGFKCNSAVWKCNTTVKNPVDGPWSDCIERYPV  496

Query  624   HIPEIVKL  601
             HIPEIVKL
Sbjct  497   HIPEIVKL  504



>emb|CDP02779.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/495 (86%), Positives = 459/495 (93%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  SSVKLKYVKLGYQYLVNHILT LLVP+MAGV +E+LR GPEE++   +   +  
Sbjct  6     PDFS--SSVKLKYVKLGYQYLVNHILTFLLVPIMAGVVLEILRLGPEEMLNIWRS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ VL SS  ++F+AT+Y MSKPRS+YLVDYACYKPPVTCRVPFSTFMEHSRL LKD+P
Sbjct  62    DLLQVLCSSFLIIFIATVYFMSKPRSVYLVDYACYKPPVTCRVPFSTFMEHSRLILKDSP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSV+FQMRILERSGLGEETCLP AIHYIPP PTM+ AR EAE VIF+AID+LMKKT LK 
Sbjct  122   KSVDFQMRILERSGLGEETCLPPAIHYIPPNPTMEDARAEAETVIFAAIDSLMKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAG+ISIDLARDLL V+
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGIISIDLARDLLQVY  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNS ALVVSTEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SNKRR+  RAKYRL+HVVR
Sbjct  242   PNSYALVVSTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNKRREKSRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
             FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIE+KGRMKKG R+WQIAFGSGFKCNSAVWKCNR +K P +GPW D
Sbjct  422   FGNTSSSSLWYELNYIEAKGRMKKGARVWQIAFGSGFKCNSAVWKCNRTIKAPMEGPWQD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>gb|KDP29403.1| hypothetical protein JCGZ_18324 [Jatropha curcas]
Length=496

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/495 (85%), Positives = 459/495 (93%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHIL LLL+PVM G++IEVLR GP+EI+   K   +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILYLLLIPVMVGISIEVLRLGPDEILNLWKS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPR+I+LVDYACYKPPVTCRVPFSTFMEHSRL LKD P
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRTIFLVDYACYKPPVTCRVPFSTFMEHSRLILKDKP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFQKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMIINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R    RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSQQWRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCVYE+ED +GKVGINLSKDLM IAGEALKSNITTIGPLVLPASEQ+LFL
Sbjct  302   THKGADDKAYRCVYEEEDKEGKVGINLSKDLMAIAGEALKSNITTIGPLVLPASEQILFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
             FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL+YIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR++K P DGPW D
Sbjct  422   FGNTSSSSLWYELSYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPLDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>ref|XP_004232364.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=496

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/498 (85%), Positives = 457/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E  P F+N  SVKLKYVKLGYQYLVN+ LT L+VP+MA + I+VL+ GPEEIV  I +S 
Sbjct  3     EPVPNFSN--SVKLKYVKLGYQYLVNNFLTFLIVPIMAALIIQVLKLGPEEIV-SIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F+AT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLLQILCSSFLIIFIATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+ AR EAE VIFSAID LMKKT 
Sbjct  119   DNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMETARNEAEVVIFSAIDDLMKKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDIL+VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILVVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              V PNS ALVVSTEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNKR+DS RAKYRLMH
Sbjct  239   QVLPNSCALVVSTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRKDSARAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKA++CV++QEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAFKCVFQQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFLFTLIGRKIFNPKWK YIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMT
Sbjct  359   LFLFTLIGRKIFNPKWKAYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LH+FGNTSSSSLWYE++YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +K P DGP
Sbjct  419   LHKFGNTSSSSLWYEMSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPV IPEIVKL
Sbjct  479   WDDCIDRYPVFIPEIVKL  496



>gb|ACZ51240.1| 3-ketoacyl-CoA synthase [Arachis hypogaea]
Length=496

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/495 (84%), Positives = 460/495 (93%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHI+TL LVP+M GV+IE+LR GP+EI + + +S +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHIITLTLVPIMLGVSIEILRLGPQEI-LNLWNS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+ +L S+  ++FVAT+Y MSKPR+IYLVDYAC+KPPVTCRVPF+TFMEHSRL LK+NP
Sbjct  62    NLVQILCSAFLIIFVATVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITT+GPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCN+ +K P DGPW D
Sbjct  422   FGNTSSSSLWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTPIDGPWTD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPEIVKL
Sbjct  482   CIDRYPVHIPEIVKL  496



>ref|XP_006363119.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
 gb|ACF17125.1| CER6 [Solanum tuberosum]
Length=496

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/498 (85%), Positives = 457/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E  P F+N  SVKLKYVKLGYQYLVN+ LT L+VP+MA + I+VL+ GPEEI + I +S 
Sbjct  3     EPVPNFSN--SVKLKYVKLGYQYLVNNFLTFLIVPIMAALIIQVLKLGPEEI-LSIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  +VF+AT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLLQILCSSFLIVFIATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+ AR EAE VIFSAID LM+KT 
Sbjct  119   DNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMETARNEAEVVIFSAIDDLMQKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              V PNS ALVVSTEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNKR+DS RAKYRLMH
Sbjct  239   QVVPNSCALVVSTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRKDSRRAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKA++CV++QEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAFKCVFQQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFLFTLIGRKIFNPKWK YIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMT
Sbjct  359   LFLFTLIGRKIFNPKWKAYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LH+FGNTSSSSLWYE++YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +K P DGP
Sbjct  419   LHKFGNTSSSSLWYEMSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPV IPEIVKL
Sbjct  479   WDDCIDRYPVFIPEIVKL  496



>ref|XP_006346917.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=496

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/498 (85%), Positives = 455/498 (91%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E  P F+N  SVKLKYVKLGYQYLVNHILT LLVP++ GVTIEVLR GP+E+ + I +S 
Sbjct  3     EVVPNFSN--SVKLKYVKLGYQYLVNHILTFLLVPIIIGVTIEVLRIGPQEL-LNIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +++ +L SS  ++ +AT+Y MSKPRS YLVDY+CYKPPV CRVPFSTFMEHSRL LK
Sbjct  59    LHFDVLQMLCSSFLIISIATVYFMSKPRSTYLVDYSCYKPPVVCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSVEFQMRILERSGLGEETCLP  IHYIPP PTM+AARGEAEEVIF+ ID LM KT 
Sbjct  119   DNPKSVEFQMRILERSGLGEETCLPRPIHYIPPTPTMEAARGEAEEVIFTTIDDLMNKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNS ALV+STEIITPNYYKGSERAMLLPNCLFRMGGAAIL+SNKRRD  RAKYRLMH
Sbjct  239   QVHPNSYALVISTEIITPNYYKGSERAMLLPNCLFRMGGAAILLSNKRRDRYRAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKA++CV+EQEDPQGKVG+NLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAFKCVFEQEDPQGKVGVNLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LF  TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMT
Sbjct  359   LFQLTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYE++YIE+KGRMK+GDR+WQIAFGSGFKCNSAVWKCNR +K P DGP
Sbjct  419   LHRFGNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W  CID+YPVHIP+IVKL
Sbjct  479   WQHCIDKYPVHIPDIVKL  496



>ref|XP_007044356.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
 gb|EOY00188.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
Length=496

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/495 (84%), Positives = 458/495 (93%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  SSVKLKYVKLGYQYLVNHILTL L+PVMAG+ +EVLR GP+EIV  + +S +  
Sbjct  6     PDFS--SSVKLKYVKLGYQYLVNHILTLTLIPVMAGILVEVLRLGPKEIV-NLWNS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPRSIYLVDYACYKPPVTCRVPF+TFMEHSRL L +NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRSIYLVDYACYKPPVTCRVPFATFMEHSRLILSNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRRSERWRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRM LHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMALHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYE++YIE+KGRMK+GDRIWQIAFGSGFKCNSAVWKCNR +K P DGPW D
Sbjct  422   FGNTSSSSLWYEMSYIEAKGRMKRGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>gb|AGK29999.1| 3-ketoacyl-CoA synthase 13 [Gossypium raimondii]
Length=492

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/495 (85%), Positives = 456/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+PVMAGV IEVLR GP EIV  + +S +  
Sbjct  2     PHFSN--SVKLKYVKLGYQYLVNHILTLTLIPVMAGVLIEVLRLGPAEIV-NLWNS-LHF  57

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L S  F++FVAT+Y MSKPRSIYLVDYACYKPPVTCRVPF+TFMEHSRLNL +NP
Sbjct  58    DLVQILCSCFFIIFVATVYFMSKPRSIYLVDYACYKPPVTCRVPFATFMEHSRLNLSNNP  117

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  118   KSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKP  177

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  178   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  237

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  238   PNSNAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVR  297

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +G VGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  298   THKGADDKAYRCVFEEEDKEGNVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  357

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  358   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  417

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW D
Sbjct  418   FGNTSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWAD  477

Query  645   CIDRYPVHIPEIVKL  601
             CI RYPVHIPE+VKL
Sbjct  478   CIHRYPVHIPEVVKL  492



>ref|XP_009597817.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana tomentosiformis]
Length=496

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/498 (85%), Positives = 458/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E+ P  +N  SVKLKYVKLGYQYLVN+ LT LLVP+MAGVT+++++ GPEEI + I +S 
Sbjct  3     ETVPNLSN--SVKLKYVKLGYQYLVNNFLTFLLVPIMAGVTLQLIKLGPEEI-LSIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +LI +L SS  ++F+AT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLIQILCSSFLIIFIATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNP+SV+FQMRILERSGLGEETCLP A HYIPP PTM++AR EAE VIFSAID LMKKT 
Sbjct  119   DNPESVKFQMRILERSGLGEETCLPPACHYIPPTPTMESARNEAEVVIFSAIDNLMKKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              V PNS+ALVVSTEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNKR+DS RAKYRLMH
Sbjct  239   QVLPNSSALVVSTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRKDSSRAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKAYRCV+EQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAYRCVFEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFLFTLIGRKIFNPKWK YIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMT
Sbjct  359   LFLFTLIGRKIFNPKWKAYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSDEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYE++YIE+KGRM+KGDRIWQIAFGSGFKCNSAVWKCNR +K   DGP
Sbjct  419   LHRFGNTSSSSLWYEMSYIEAKGRMRKGDRIWQIAFGSGFKCNSAVWKCNRTIKTGTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPV IP+IVKL
Sbjct  479   WEDCIDRYPVFIPKIVKL  496



>ref|XP_004135090.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159295.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 gb|KGN52079.1| hypothetical protein Csa_5G609650 [Cucumis sativus]
Length=496

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/495 (84%), Positives = 457/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  +SVKLKYVKLGYQYLVNHILTL L+PVM  + I+VLR GP+EI+   K   +  
Sbjct  6     PDFS--TSVKLKYVKLGYQYLVNHILTLTLIPVMLAIFIQVLRMGPDEILNLWKS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +LI +L SS F++FVAT+Y MSKPR+I+LVDYAC+KPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    DLIQILCSSFFIIFVATVYFMSKPRTIFLVDYACFKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+DAL +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E++D +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEQDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             +GNTSSSSLWYEL YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCN+ +K P DGPW D
Sbjct  422   WGNTSSSSLWYELGYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPIDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>ref|XP_009784659.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana sylvestris]
Length=496

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/498 (85%), Positives = 458/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E+ P  +N  SVKLKYVKLGYQYLVN+ LT LLVP+MAGVT+++++ GPEEI + I +S 
Sbjct  3     ETVPNLSN--SVKLKYVKLGYQYLVNNFLTFLLVPIMAGVTLQLIKLGPEEI-LSIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +LI +L SS  ++FVAT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLIQILCSSFLIIFVATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNP+SV+FQMRILERSGLGEETCLP A HYIPP PTM++AR EAE VIFSAID LMKKT 
Sbjct  119   DNPESVKFQMRILERSGLGEETCLPPACHYIPPTPTMESARTEAEVVIFSAIDNLMKKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              V PNS+ALVVSTEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNKR+DS RAKYRLMH
Sbjct  239   QVLPNSSALVVSTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRKDSSRAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKAYRCV+EQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAYRCVFEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFLFTLIGRKIFNPKWK YIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMT
Sbjct  359   LFLFTLIGRKIFNPKWKAYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSDEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYE++Y+E+KGRM+KGDR+WQIAFGSGFKCNSAVWKCNR +K   DGP
Sbjct  419   LHRFGNTSSSSLWYEMSYMEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRTIKTGTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPV IP+IVKL
Sbjct  479   WEDCIDRYPVFIPKIVKL  496



>ref|XP_008446598.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Cucumis melo]
Length=496

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/495 (84%), Positives = 457/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  +SVKLKYVKLGYQYLVNHILTL L+PVM  + +EVLR GP+EI+   K   +  
Sbjct  6     PDFS--TSVKLKYVKLGYQYLVNHILTLTLIPVMLAIFLEVLRMGPDEILNLWKS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +LI +L SS F++FVAT+Y MSKPR+I+LVDYAC+KPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    DLIQILCSSFFIIFVATVYFMSKPRTIFLVDYACFKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+DAL +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E++D +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEQDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             +GNTSSSSLWYEL YIE+KGRM+KGDRIWQIAFGSGFKCNSAVWKCN+ +K P DGPW D
Sbjct  422   WGNTSSSSLWYELAYIEAKGRMRKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPVDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>ref|XP_004233492.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=496

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/495 (84%), Positives = 453/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQY+VNHILT LLVP + GVTIE+LR GPE++ + I +S +  
Sbjct  6     PNFSN--SVKLKYVKLGYQYIVNHILTFLLVPTIIGVTIELLRIGPEDL-LNIWNS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
               + +L SS  ++ +AT+Y MSKPRSIYLVDY+CYKPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    NALQILSSSFLIISIATVYFMSKPRSIYLVDYSCYKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP + HYIPP PTMDAARGEAEEVIF++ID LM KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPHSTHYIPPTPTMDAARGEAEEVIFTSIDDLMNKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNS ALV+STEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNK+RD  RAKYRLMHVVR
Sbjct  242   PNSYALVISTEIITPNYYRGSERAMLLPNCLFRMGGAAILLSNKKRDQYRAKYRLMHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKA++CV+EQED QGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAFKCVFEQEDSQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYE++YIE+K RMK+GDR+WQIAFGSGFKCNSAVWKCNR +  P DGPW D
Sbjct  422   FGNTSSSSLWYEMSYIEAKRRMKRGDRVWQIAFGSGFKCNSAVWKCNRTINTPNDGPWQD  481

Query  645   CIDRYPVHIPEIVKL  601
             CID+YPVHIPEIVKL
Sbjct  482   CIDKYPVHIPEIVKL  496



>gb|ABA01490.1| 3-ketoacyl-CoA synthase [Gossypium hirsutum]
Length=492

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/495 (84%), Positives = 451/495 (91%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+PVMAGV IEVLR GP  IV       +  
Sbjct  2     PHFSN--SVKLKYVKLGYQYLVNHILTLTLIPVMAGVLIEVLRLGPAGIVSLWNS--LHF  57

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+H+L S  F++FVAT+Y MSKPRSIYLVDYACYKPPVTCRVPF+TFMEHSRLNL +NP
Sbjct  58    DLVHILCSCFFIIFVATVYFMSKPRSIYLVDYACYKPPVTCRVPFATFMEHSRLNLSNNP  117

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  118   KSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKP  177

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KD+DILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  178   KDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  237

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  238   PNSNAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNRRSERWRAKYRLVHVVR  297

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +G VGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  298   THKGADDKAYRCVFEEEDKEGNVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  357

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  358   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  417

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW D
Sbjct  418   FGNTSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWAD  477

Query  645   CIDRYPVHIPEIVKL  601
             CI  YP HIPE+VKL
Sbjct  478   CIQGYPAHIPEVVKL  492



>gb|ACT21783.1| CER6 [Solanum lycopersicum]
Length=496

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/498 (85%), Positives = 455/498 (91%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E+ P F N  SVKLKYVKLGYQYLVN+ LT L+VP+MA + I+VL+ GPEEIV  I +S 
Sbjct  3     EAVPNFCN--SVKLKYVKLGYQYLVNNFLTFLIVPIMAALIIQVLKLGPEEIV-SIWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F+AT+Y MSKPRSIYLVDY+CYK PVTCRVPFSTFMEHSRL LK
Sbjct  59    LHFDLLQILCSSFLIIFIATVYFMSKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             DNPKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+ AR EAE VIFSAID LMKKT 
Sbjct  119   DNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMETARNEAEVVIFSAIDDLMKKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDIL+VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILVVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              V PNS ALVVSTEIITPNYY+GSERAMLLPNCLFRMGGAAIL+SNKR+DS RAKYRLMH
Sbjct  239   QVLPNSCALVVSTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRKDSARAKYRLMH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKA++CV++QEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAFKCVFQQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFLFTLIGRKIFNPKWK YIPDFKQAFEH CIHAGGRAVIDELQKNLQLS+EHVEAS+MT
Sbjct  359   LFLFTLIGRKIFNPKWKAYIPDFKQAFEHSCIHAGGRAVIDELQKNLQLSAEHVEASKMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LH+FGNTS SSLWYE++YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +K P DGP
Sbjct  419   LHKFGNTSPSSLWYEMSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPV IPEIVKL
Sbjct  479   WDDCIDRYPVFIPEIVKL  496



>ref|XP_002315942.1| ECERIFERUM 6 family protein [Populus trichocarpa]
 gb|ABK94727.1| unknown [Populus trichocarpa]
 gb|EEF02113.1| ECERIFERUM 6 family protein [Populus trichocarpa]
Length=496

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/495 (84%), Positives = 452/495 (91%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVK+KYVKLGYQYLVNHIL LLL+PVM G+ IEVLR GP+EI+   +   +  
Sbjct  6     PDFSN--SVKIKYVKLGYQYLVNHILYLLLIPVMVGILIEVLRLGPDEILSLWRS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
               + +L SS  ++F+AT+Y MSKPR+IYLVDYACYKPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    NTVQILCSSFLIIFIATVYFMSKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARD+L VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R     AKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSHRWLAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+EQED +GKVGINLSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEQEDKEGKVGINLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE+KGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P D PW D
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDSPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>ref|XP_010066726.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Eucalyptus grandis]
 gb|KCW64742.1| hypothetical protein EUGRSUZ_G02324 [Eucalyptus grandis]
Length=496

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/497 (83%), Positives = 455/497 (92%), Gaps = 4/497 (1%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             S P F+N  SVKLKYVKLGYQYLVNHI+ L LVPVMAGV +EVLR GP+EI+   +   +
Sbjct  4     SLPDFSN--SVKLKYVKLGYQYLVNHIIPLTLVPVMAGVLMEVLRLGPDEILGLWRS--L  59

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
               +L+ +L S+  ++FVAT+Y MSKPR+I+LVDYACYKPPVTCRVPFSTFMEHSRLNLKD
Sbjct  60    HFDLVQILCSAFLIIFVATVYFMSKPRTIFLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  119

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
              PKSVEFQMRILERSGLGEETCLP AIHYIPP PTM++ARGEAE VIFS +D+L +KT L
Sbjct  120   KPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMESARGEAELVIFSVMDSLFQKTGL  179

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARD+L 
Sbjct  180   KPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISLDLARDILQ  239

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VHPNSNA++VSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R D  RAKYRL+HV
Sbjct  240   VHPNSNAVIVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSDRRRAKYRLVHV  299

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTHKG+DDKAYRCVYE+ED +GK GI+LSKDLM IAGEALKSNITTIGPLVLPASEQLL
Sbjct  300   VRTHKGADDKAYRCVYEEEDKEGKAGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLL  359

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             FL TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTL
Sbjct  360   FLLTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTL  419

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYEL YIE+KGRM+KG+R+WQIAFGSGFKCNSAVWKCNR +K P DGPW
Sbjct  420   HRFGNTSSSSLWYELGYIEAKGRMRKGNRVWQIAFGSGFKCNSAVWKCNRTIKTPIDGPW  479

Query  651   LDCIDRYPVHIPEIVKL  601
              DCIDRYPVHIPE+VKL
Sbjct  480   ADCIDRYPVHIPEVVKL  496



>gb|AGK30000.1| 3-ketoacyl-CoA synthase 5 [Gossypium raimondii]
Length=496

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/497 (84%), Positives = 459/497 (92%), Gaps = 4/497 (1%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             +SP F+  SSVKLKYVKLGYQY+V+H LTLLLVPVM G+ IEV+R GPEEIV  + +S +
Sbjct  4     ASPDFS--SSVKLKYVKLGYQYVVDHFLTLLLVPVMVGILIEVVRLGPEEIV-NLWNS-L  59

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
               +LI +L SS F++F+AT+Y MSKPR IYLVDYACYKPPVTCRVPF+TFMEHSRL L +
Sbjct  60    HFDLIQILCSSFFIIFIATVYFMSKPRCIYLVDYACYKPPVTCRVPFATFMEHSRLILSN  119

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
             NPKSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L KKT L
Sbjct  120   NPKSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAEVVIFSAMDSLFKKTGL  179

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL 
Sbjct  180   KPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQ  239

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VHPNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HV
Sbjct  240   VHPNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHV  299

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTHKG+DD+AYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLP SEQLL
Sbjct  300   VRTHKGADDRAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPGSEQLL  359

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             FL TLIGRK+FNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTL
Sbjct  360   FLLTLIGRKVFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTL  419

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYE++Y+E+KGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +KKP DGPW
Sbjct  420   HRFGNTSSSSLWYEMSYLEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKKPTDGPW  479

Query  651   LDCIDRYPVHIPEIVKL  601
              DCI RYPVHIPE+VKL
Sbjct  480   EDCIHRYPVHIPEVVKL  496



>ref|XP_003555901.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
Length=496

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/489 (84%), Positives = 453/489 (93%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +SVKLKYVKLGYQYLVNHIL+L L+P+M  + IEVLR GP+EI +++  S +  +L+ +L
Sbjct  10    NSVKLKYVKLGYQYLVNHILSLTLIPIMISIFIEVLRLGPDEI-LKLWHS-LHFDLVQIL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++F++T+Y MSKPR+IYLVDYAC+KPPVTCRVPF+TFMEHSRL LKDNPKSVEFQ
Sbjct  68    CSSFLIIFISTVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L  KT LK KDIDIL
Sbjct  128   MRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  188   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAV  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEIITPNYY+G ERAMLLPNCLFRMGGAAIL+SN+  +  RAKYRL+HVVRTHKG+D
Sbjct  248   VVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAYRCV+E+ED +GKVGI+L KDLM IAGEALKSNITT+GPLVLPASEQLLFL TLIGR
Sbjct  308   DKAYRCVFEEEDKEGKVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSS
Sbjct  368   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYELNYIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR++K P DGPW DCIDRYP
Sbjct  428   SSLWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYP  487

Query  627   VHIPEIVKL  601
             VHIPEIVKL
Sbjct  488   VHIPEIVKL  496



>ref|XP_003536684.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Glycine max]
Length=496

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/495 (83%), Positives = 453/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+P+M  + +E+LR GPEEI+       + L
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILTLTLIPMMIAIFMEILRLGPEEILNLWHS--LHL  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L S+  ++F+AT+Y MSKPR+IYLVDYAC+KPPVTCRVPF+TFMEHSRL LKDNP
Sbjct  62    DLVQILCSAFLIIFIATVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L  KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFNKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G ERAMLLPNCLFRMGGAAIL+SN+  +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+L KDLM IAGEALKSNITT+GPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEEDREGKVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR++K P DGPW D
Sbjct  422   FGNTSSSSLWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPV IPEIVKL
Sbjct  482   CIDRYPVDIPEIVKL  496



>ref|XP_009356269.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/495 (82%), Positives = 456/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+P+MAG+ +EVLR GP+E+ +++ DS +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILTLTLIPIMAGILLEVLRLGPDEL-LKLWDS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPRS+YLVDYAC+KPPVTCRVPFSTFMEHSRLNL +NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRSVYLVDYACFKPPVTCRVPFSTFMEHSRLNLSNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+ ARGEAE VIFSA+D+L +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPNPTMETARGEAELVIFSAMDSLFEKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G ERAMLLPNCLFRMGGAA+L+SN++ +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAALLLSNRKSEHRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
             FTLIGRKI NPKWKPYIPDF++AFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHR
Sbjct  362   FTLIGRKILNPKWKPYIPDFREAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +   +DGPW D
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTITTTSDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CID+YPVHIPE+VKL
Sbjct  482   CIDKYPVHIPEVVKL  496



>ref|XP_008389290.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Malus domestica]
Length=496

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/489 (83%), Positives = 452/489 (92%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +SVKLKYVKLGYQYLVNHILTL L+P+MAG+ +EVLR GP+E+ +++ DS +  +L+ +L
Sbjct  10    NSVKLKYVKLGYQYLVNHILTLTLIPIMAGILLEVLRLGPDEL-LKLWDS-LHFDLVQIL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++F+AT+Y MSKPRSIYLVDYAC+KPPVTCRVPFSTFMEHSRLNL +NPKSVEFQ
Sbjct  68    CSSFLIIFIATVYFMSKPRSIYLVDYACFKPPVTCRVPFSTFMEHSRLNLSNNPKSVEFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L +KT LK KDIDIL
Sbjct  128   MRILERSGLGEETCLPPAIHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VHPNSNA+
Sbjct  188   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAV  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+HVVRTHKG+D
Sbjct  248   VVSTEIITPNYYQGNERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAYRCV+E+ED +G VGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFLFTLIGR
Sbjct  308   DKAYRCVFEEEDKEGNVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI NPKWKPYIPDF++AFEHFCIHAGGRAVIDELQKNLQLS EH EASRMTLHRFGNTSS
Sbjct  368   KILNPKWKPYIPDFREAFEHFCIHAGGRAVIDELQKNLQLSXEHCEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +   +DGPW DCID YP
Sbjct  428   SSLWYELGYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTITTTSDGPWADCIDNYP  487

Query  627   VHIPEIVKL  601
             VHIPE+VKL
Sbjct  488   VHIPEVVKL  496



>ref|XP_008243224.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Prunus mume]
Length=496

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/495 (82%), Positives = 459/495 (93%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+P+MAG+ +EVLR GP+EI +++  S +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILTLTLIPIMAGIFLEVLRLGPDEI-LKLWTS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPR+++LVDYAC+KPPVTCRVPFSTFMEHSRL L +NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRTVFLVDYACFKPPVTCRVPFSTFMEHSRLILSNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTMDAARGEAE VIFSA+DAL +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPNPTMDAARGEAELVIFSAMDALFEKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNI+S+NLSGMGCSAG+ISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIRSFNLSGMGCSAGVISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAALLLSNRRSERRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKGSDDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITT+GPLVLPASEQLLFL
Sbjct  302   THKGSDDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKI NPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHR
Sbjct  362   LTLIGRKIVNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE+KGRM+KGDR+WQIAFGSGFKCNSAVWKCNR+++KP++GPW D
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRSIEKPSEGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>ref|XP_003637444.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH44222.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/495 (83%), Positives = 457/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  SSVKLKYVKLGYQYLVNHI+TL L+P+M GV+IE++R GP EI+     + ++L
Sbjct  6     PDFS--SSVKLKYVKLGYQYLVNHIITLTLIPIMIGVSIELIRLGPNEILN--LWNSLNL  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+ +L SS  ++F+AT+Y MSKPR+IYLVDYAC+KPPVTCRVPF+TFMEHSRL LK+NP
Sbjct  62    NLVQILCSSFLVIFIATVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP +IHYIPPKPTM++ARGEAE VIFSA+D+L +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPSIHYIPPKPTMESARGEAELVIFSAMDSLFEKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAI++SN+  +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAIMLSNRTTEKRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG DDKAY+CV+E+ED +GKVGI+L KDLM IAGEALKSNITT+GPLVLPASEQLLFL
Sbjct  302   THKGGDDKAYKCVFEEEDKEGKVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   ITLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR++K P DGPW D
Sbjct  422   FGNTSSSSLWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPIDGPWTD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPEIVKL
Sbjct  482   CIDRYPVHIPEIVKL  496



>ref|XP_002283730.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
 emb|CAN74750.1| hypothetical protein VITISV_023219 [Vitis vinifera]
Length=492

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/492 (84%), Positives = 454/492 (92%), Gaps = 2/492 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N  +SVKLKYVKLGYQYLVNHILT LL+P+M GV IE+L  GP++I   I +S +   L+
Sbjct  3     NFSTSVKLKYVKLGYQYLVNHILTFLLIPIMVGVVIELLSLGPDQI-YEIWNS-LHFNLL  60

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
              VL SS F++F+AT+Y MSKPRSIYLVDYAC+KPPVTCRVPF+TFMEHSRL   DNPKSV
Sbjct  61    QVLCSSFFIIFIATVYFMSKPRSIYLVDYACFKPPVTCRVPFATFMEHSRLINSDNPKSV  120

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQMRILERSGLGEETCLPAA HYIPPKPTM+A+RGEAE VIFSAID L+KKT +K KDI
Sbjct  121   EFQMRILERSGLGEETCLPAANHYIPPKPTMEASRGEAELVIFSAIDDLLKKTGIKTKDI  180

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
             DILIVNCSLFSPTPSLSAMV+NKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VHPNS
Sbjct  181   DILIVNCSLFSPTPSLSAMVINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNS  240

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              ALV+STEIITPNYY G++RAMLLPNCLFRMG AAIL+SN+RR+  RAKYRL+H+VRTHK
Sbjct  241   YALVISTEIITPNYYSGNQRAMLLPNCLFRMGAAAILLSNRRRERRRAKYRLVHLVRTHK  300

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+DDKAYRCVYE+EDPQGKVGI+LSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL
Sbjct  301   GADDKAYRCVYEEEDPQGKVGISLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  360

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             IGRKIFNPKWKPYIPDFK+AFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN
Sbjct  361   IGRKIFNPKWKPYIPDFKEAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  420

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSSLWYE++YIE+KGRMKKG+R+WQIAFGSGFKCNSAVWKCNR +  P DGPW DCID
Sbjct  421   TSSSSLWYEMSYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWKCNRTITTPTDGPWADCID  480

Query  636   RYPVHIPEIVKL  601
             RYPV+IPEIVKL
Sbjct  481   RYPVYIPEIVKL  492



>ref|XP_011007926.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Populus euphratica]
Length=495

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/493 (83%), Positives = 448/493 (91%), Gaps = 4/493 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVK+KYVKLGYQYLVNHIL LLL+PVM GV IEVLR GP+EI+   +   +  
Sbjct  6     PDFSN--SVKIKYVKLGYQYLVNHILYLLLIPVMVGVLIEVLRLGPDEILSLWRS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             + + +L SS  ++F+AT+Y MSKPR+IYLVDYACYKPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    DTVQILCSSFLVIFIATVYFMSKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSV+FQMR+LERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  122   KSVDFQMRVLERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLISIDLARD+L VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMIINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSN +VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R     AKYRL+HVVR
Sbjct  242   PNSNVVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRSHRWFAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DD AYRCVYEQED +GKVGINLSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDIAYRCVYEQEDKEGKVGINLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVE SRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEPSRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE+KGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P D PW D
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDSPWAD  481

Query  645   CIDRYPVHIPEIV  607
             CIDRYPVHIPE+V
Sbjct  482   CIDRYPVHIPEVV  494



>ref|XP_004497096.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cicer arietinum]
Length=496

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/495 (83%), Positives = 457/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  SSVKLKYVKLGYQYLVNHI+TL L+P+M GV+IE++R GP+EI+  + +S +++
Sbjct  6     PDFS--SSVKLKYVKLGYQYLVNHIITLTLIPIMLGVSIELIRLGPDEII-NLWNS-LNI  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+ +L S   ++F++T+Y MSKPR+IYLVDYAC+KPPVTCRVPF+TFMEHSRL LK+NP
Sbjct  62    NLVQILCSCFLVIFISTVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEET LP AIHYIPPKPTM++ARGEAE VIFSA+D+L+ KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETSLPPAIHYIPPKPTMESARGEAELVIFSAMDSLLNKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILI+NCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIINCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SN+  +S RAKYRL+HVVR
Sbjct  242   PNSNAIVVSTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRGSESKRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG DDKA+RCV+E+ED +GKVGI+LSKDLM IAGEALKSNITT+GPLVLPASEQLLFL
Sbjct  302   THKGGDDKAFRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DG W D
Sbjct  422   FGNTSSSSLWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPVDGAWSD  481

Query  645   CIDRYPVHIPEIVKL  601
             CI RYPVHIPEIVKL
Sbjct  482   CIHRYPVHIPEIVKL  496



>ref|XP_003531926.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
 gb|KHN14249.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=496

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/495 (81%), Positives = 457/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKY KL YQYLVNHI TL L+P+M G++IE LR GP+EI + + +S + +
Sbjct  6     PDFSN--SVKLKYAKLSYQYLVNHIKTLTLIPIMLGISIETLRLGPDEI-LNLWNS-LHV  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+ +  S+  L+ +AT+Y MSKPR+I+LVDYAC+KPPVTCRVPF+TFMEHSRL LK+NP
Sbjct  62    NLVQIFLSTFLLIIIATIYFMSKPRTIFLVDYACFKPPVTCRVPFATFMEHSRLILKNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE V+FSA+D+L KKT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAEHVVFSAVDSLFKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA++VSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN++++  RAKYRL+HVVR
Sbjct  242   PNSNAVIVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRKQERKRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKGS++KA+RCV+E+ED +GKVGI+LSKDLM IAGEALKSNIT++GPLVLPASEQLLFL
Sbjct  302   THKGSNEKAFRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITSMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNP+WKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPRWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIESKGRMK+GDR+WQIAFGSGFKCNSAVW+CNR+++ P DGPW D
Sbjct  422   FGNTSSSSLWYELNYIESKGRMKRGDRVWQIAFGSGFKCNSAVWRCNRSIQTPFDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPEIVKL
Sbjct  482   CIDRYPVHIPEIVKL  496



>ref|XP_009356268.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Pyrus x bretschneideri]
Length=496

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/495 (82%), Positives = 456/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SV+LKYVKLGYQ+LVNHILTL L+P+MAG+ +EVLR GP+E+ +++ DS +  
Sbjct  6     PDFSN--SVRLKYVKLGYQFLVNHILTLTLIPIMAGILLEVLRLGPDEL-LKLWDS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPRS+YLVDYAC+KPPVTCRVPFSTFMEHSRLNL +NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRSVYLVDYACFKPPVTCRVPFSTFMEHSRLNLSNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+ ARGEAE VIFSA+D+L +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPNPTMEDARGEAELVIFSAMDSLFEKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARD+L VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAY+CV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYKCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
             FTLIGRKI NPKWKPYIPDF+ AFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHR
Sbjct  362   FTLIGRKILNPKWKPYIPDFRLAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +   +DGPW D
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTITTTSDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CID+YPVHIPE+VKL
Sbjct  482   CIDKYPVHIPEVVKL  496



>ref|XP_002531630.1| acyltransferase, putative [Ricinus communis]
 gb|EEF30758.1| acyltransferase, putative [Ricinus communis]
Length=488

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/495 (83%), Positives = 449/495 (91%), Gaps = 12/495 (2%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHIL LLL+PVM GV+IEVLR GPEE V+ + +S +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILYLLLIPVMVGVSIEVLRLGPEE-VLNLWNS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             + + +L SS  ++F+AT+Y MSKPR+IYLVDYACYKPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    DFVQILCSSFLIIFIATVYFMSKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE VIFSA+D+L KKT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL++N+R    RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLTNRRSHRSRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCVYE+ED +GKVGINLSKDLM IAGEALKSNITTIGP          FL
Sbjct  302   THKGADDKAYRCVYEEEDKEGKVGINLSKDLMAIAGEALKSNITTIGPXX--------FL  353

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
             FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLH+
Sbjct  354   FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHK  413

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL+YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCN+ +K P DGPW D
Sbjct  414   FGNTSSSSLWYELSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTPTDGPWAD  473

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  474   CIDRYPVHIPEVVKL  488



>ref|XP_008339680.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Malus domestica]
Length=496

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/495 (82%), Positives = 454/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+P+MAG+ +EVLR  P+E+ +++ DS +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILTLTLIPIMAGILLEVLRLSPDEL-LKLWDS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPR IYLVDYAC+KPPV CRVPFSTFMEHSRL L +NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRPIYLVDYACFKPPVMCRVPFSTFMEHSRLILSNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPXAIHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAY+CV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYKCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKI NPKWKPYIPDF+QAFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHR
Sbjct  362   ITLIGRKILNPKWKPYIPDFRQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE+KGRM+KGDR+WQIAFGSGFKCNSAVWKCNR +K  +DGPW D
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRAIKTASDGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>ref|XP_002311457.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
 gb|EEE88824.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
Length=496

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/495 (82%), Positives = 450/495 (91%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N   VKLKYVKLGYQYLVNHIL LL +PVM G+ IEVLR GP+E++   +   +  
Sbjct  6     PDFSN--PVKLKYVKLGYQYLVNHILYLLWIPVMVGILIEVLRLGPDEVLSLWRS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  +V +A +Y MSKPR+IYLVDYACYKPPVTCRVPFSTFMEHSRL LKDNP
Sbjct  62    DLVQILCSSFLIVLIAIVYFMSKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP +IHYIPPKPTM+AARGEAE VIFSA+D+L KKT +K 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPSIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGIKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMIINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PN+NA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGG+AIL+SN+R     AKYRL+HVVR
Sbjct  242   PNANAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGSAILLSNRRSHRWSAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG DDKAYRCV+E+ED +GKVGINLSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGVDDKAYRCVFEEEDREGKVGINLSKDLMTIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TL+GRKIFNPKWKP+IPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLVGRKIFNPKWKPFIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL YIE KGRM++G+R+WQIAFGSGFKCNSAVWKCNR +K P DGPW+D
Sbjct  422   FGNTSSSSLWYELGYIEEKGRMRRGNRVWQIAFGSGFKCNSAVWKCNRTIKTPVDGPWVD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPE+VKL
Sbjct  482   CIDRYPVHIPEVVKL  496



>gb|EYU34398.1| hypothetical protein MIMGU_mgv1a005204mg [Erythranthe guttata]
Length=493

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/490 (84%), Positives = 445/490 (91%), Gaps = 5/490 (1%)
 Frame = -3

Query  2061  VKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFS  1882
             V  KYVKL YQY+VNHILT LL+P MA    E+LR GP+EI+   +   +  + I  L +
Sbjct  6     VPAKYVKLAYQYIVNHILTFLLLPTMAAAAAELLRLGPDEILSAFRS--LHFDPIQTLCT  63

Query  1881  SLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMR  1702
             S  ++FVAT+Y MSKPRSIYLVDYACYKPPVT RVPFSTFMEHSRLNLK+NPKSV+FQMR
Sbjct  64    SFLIIFVATVYFMSKPRSIYLVDYACYKPPVTFRVPFSTFMEHSRLNLKENPKSVDFQMR  123

Query  1701  ILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIV  1522
             ILERSGLGEETCLP AIHYIPP PTMDAARGEAE VIFS ID+LM+KT LK KDIDILIV
Sbjct  124   ILERSGLGEETCLPPAIHYIPPTPTMDAARGEAELVIFSTIDSLMEKTNLKPKDIDILIV  183

Query  1521  NCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVV  1342
             NCSLFSPTPSLSAM+VNKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNS AL+V
Sbjct  184   NCSLFSPTPSLSAMIVNKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSRALIV  243

Query  1341  STEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNK-RRDSGRAKYRLMHVVRTHKGSDD  1165
             STEIITPNYYKGSERAMLLPNCLFRMGGAAIL+SNK RRD+ R+KY+L+HVVRTHKG+DD
Sbjct  244   STEIITPNYYKGSERAMLLPNCLFRMGGAAILLSNKRRRDAARSKYKLVHVVRTHKGADD  303

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KAY+CVYEQEDP+GKVGINLSKDLM+IAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK
Sbjct  304   KAYKCVYEQEDPEGKVGINLSKDLMLIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  363

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSSS
Sbjct  364   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSS  423

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLK--KPADGPWLDCIDRY  631
             SLWYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR ++     DGPW DCI RY
Sbjct  424   SLWYELGYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTVRIDSDGDGPWQDCIHRY  483

Query  630   PVHIPEIVKL  601
             PVHIPE+VKL
Sbjct  484   PVHIPEVVKL  493



>ref|XP_007142908.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
 gb|ESW14902.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
Length=496

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/495 (83%), Positives = 455/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+  +SVKLKYVKLGYQYLVNHILTL L+P++  + IEVLR GP EI + + +S +  
Sbjct  6     PDFS--TSVKLKYVKLGYQYLVNHILTLTLIPIIIAIFIEVLRLGPAEI-LSLWNS-LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L S+  ++F+AT+Y MSKPR+IYLVDYAC+KPPVTCRVPF+TFMEHSRL LKDNP
Sbjct  62    DLLQILCSAFLIIFIATVYFMSKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP +IHYIPPKPTM+AARGEAE VIFSA+D+L  KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPSIHYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+  +  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRSNERRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+L KDLM IAGEALKSNITT+GPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEEDKEGKVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYELNYIESKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRN+K P DG W D
Sbjct  422   FGNTSSSSLWYELNYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRNIKTPVDGAWSD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPEIVKL
Sbjct  482   CIDRYPVHIPEIVKL  496



>gb|KDO69954.1| hypothetical protein CISIN_1g011007mg [Citrus sinensis]
Length=496

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/498 (83%), Positives = 456/498 (92%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             ++ P F+N  SVKLKYVKLGYQYLVNHIL LLLVP+M  + IEVLR GP+EI+   K   
Sbjct  3     QTLPDFSN--SVKLKYVKLGYQYLVNHILYLLLVPIMVAILIEVLRLGPDEILNLWKS--  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F+AT+Y MSKPR +YLVDYACYKPPVTCRVPF+TFMEHSRL LK
Sbjct  59    LHFDLVQILCSSFLIIFIATVYFMSKPRHVYLVDYACYKPPVTCRVPFATFMEHSRLILK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             +NPKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L++KT 
Sbjct  119   NNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAELVIFSAMDSLLQKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+RR+  RAKYRL+H
Sbjct  239   QVHPNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRRNRSRAKYRLVH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQL
Sbjct  299   VVRTHKGADDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFL TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMT
Sbjct  359   LFLMTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYE++YIE KGRMKKGDR+WQIAFGSGFKCNSAVWKCN+ +K   D P
Sbjct  419   LHRFGNTSSSSLWYEMSYIEEKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTTTDNP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPVHIPEIVKL
Sbjct  479   WSDCIDRYPVHIPEIVKL  496



>ref|XP_002888670.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64929.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/501 (80%), Positives = 452/501 (90%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M +   P F+  SSVKLKYVKLGYQYLVNH L+ LL+P+MA V +E+LR GPEEI + + 
Sbjct  1     MPQAPMPEFS--SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +L+ VL SS F++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LQFDLVQVLCSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
             NLKDNPKSVEFQMRILERSGLGEETCLP AIHYIPP PTMDAAR EA+ VIF+A+D L K
Sbjct  117   NLKDNPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFTAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT LK KD+DILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLKPKDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYY+G+ERAMLLPNCLFRMG AAI +SN+R D  RAKY+
Sbjct  237   DLLQVHPNSNAIIVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LSHLVRTHRGADDKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLTSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL+YIESKG+M++GDR+WQIAFGSGFKCNSAVWKCNR +K P 
Sbjct  417   RMTLHRFGNTSSSSLWYELSYIESKGKMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_004299082.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/497 (81%), Positives = 451/497 (91%), Gaps = 6/497 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNH LTL LVP+MAG+ +EV+R GP E++     S + L
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHFLTLALVPIMAGIFLEVIRIGPGEVLNLW--SSLHL  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPRSI+LVDYACYKPPVTCRVPFSTFMEHSRL L +NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRSIFLVDYACYKPPVTCRVPFSTFMEHSRLILSNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP+PTM+AARGEAE VIFSA+D+L +KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPQPTMEAARGEAELVIFSAMDSLFEKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G ERAMLLPNCLFRMGGAAIL+SN+R +S RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNRRSESRRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKA+RCV+E+ED +GKVGI+L KDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAFRCVFEEEDREGKVGISLQKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRK+ NPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHR
Sbjct  362   LTLIGRKLVNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA--DGPW  652
             FGNTSSSSLWYEL YIE+KGRM+KGDR+WQIAFGSGFKCNSAVWKCNR +K     D PW
Sbjct  422   FGNTSSSSLWYELGYIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRTIKTAENDDSPW  481

Query  651   LDCIDRYPVHIPEIVKL  601
              DCI+RYPVHIP++VKL
Sbjct  482   ADCIERYPVHIPDVVKL  498



>ref|XP_006437664.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
 ref|XP_006484467.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Citrus sinensis]
 gb|ESR50904.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
Length=496

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/495 (83%), Positives = 453/495 (92%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHIL LLLVP+M  + IEVLR GP EI+   K   +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILYLLLVPIMVAILIEVLRLGPYEILNLWKS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L SS  ++F+AT+Y MSKPR +YLVDYACYKPPVTCRVPF+TFMEHSRL LK+NP
Sbjct  62    DLVQILCSSFLIIFIATVYFMSKPRHVYLVDYACYKPPVTCRVPFATFMEHSRLILKNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVEFQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFSA+D+L++KT LK 
Sbjct  122   KSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAELVIFSAMDSLLQKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAM++N+YKLRSNIKS+NLSGMGCSAGLISIDLARDLL VH
Sbjct  182   KDIDILIVNCSLFSPTPSLSAMLINQYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+RR+  RAKYRL+HVVR
Sbjct  242   PNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNRRRNRSRAKYRLVHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  302   THKGADDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHR
Sbjct  362   MTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYE++YIE KGRMKKGDR+WQIAFGSGFKCNSAVWKCN+ +K   D PW D
Sbjct  422   FGNTSSSSLWYEMSYIEEKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTTTDNPWSD  481

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPEIVKL
Sbjct  482   CIDRYPVHIPEIVKL  496



>ref|XP_011099560.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=497

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/499 (82%), Positives = 447/499 (90%), Gaps = 5/499 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             E  P F+  SSVKLKYVKLGYQYLVNHI T  L+P+M GV +EVLR GPEEI++      
Sbjct  3     EIVPKFS--SSVKLKYVKLGYQYLVNHIFTFFLIPIMLGVLLEVLRLGPEEILLFWNS--  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ VL SS  L+ +AT+Y MSK RSIYLVD++C KPPVTCRVPFS FMEHSRL  K
Sbjct  59    LYFDLVQVLCSSFLLIIIATVYFMSKARSIYLVDFSCCKPPVTCRVPFSKFMEHSRLIHK  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
              N KS++FQMRILERSGLGEETC+P A+HYIPP PT  AAR EAE VIFSAID+LM+KT 
Sbjct  119   GNTKSIDFQMRILERSGLGEETCVPPAMHYIPPTPTTGAARDEAEAVIFSAIDSLMEKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             ++ K+IDILIVNCS+FSPTPSLSAMVVNKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL
Sbjct  179   IRPKNIDILIVNCSVFSPTPSLSAMVVNKYKLRSNIKSFNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIIT-PNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLM  1198
              VH NS ALV+STEI+T PNYYKGSERAMLLPNCLFRMG AAIL+SNK RDS RAKY+L+
Sbjct  239   QVHHNSYALVISTEILTSPNYYKGSERAMLLPNCLFRMGAAAILLSNKWRDSARAKYKLL  298

Query  1197  HVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQ  1018
             HVVRTHKG+DDKAYRCVYEQED +GKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQ
Sbjct  299   HVVRTHKGADDKAYRCVYEQEDNEGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQ  358

Query  1017  LLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRM  838
             LLFLFTLIGRK+FNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRM
Sbjct  359   LLFLFTLIGRKMFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRM  418

Query  837   TLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADG  658
             TLHRFGNTSSSSLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P DG
Sbjct  419   TLHRFGNTSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDG  478

Query  657   PWLDCIDRYPVHIPEIVKL  601
             PW DCIDRYPVHIPEIVKL
Sbjct  479   PWQDCIDRYPVHIPEIVKL  497



>ref|NP_177020.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
 sp|Q9XF43.1|KCS6_ARATH RecName: Full=3-ketoacyl-CoA synthase 6; Short=KCS-6; AltName: 
Full=Cuticular protein 1; AltName: Full=Very long-chain fatty 
acid condensing enzyme 6; Short=VLCFA condensing enzyme 
6 [Arabidopsis thaliana]
 gb|AAD37122.1|AF129511_1 very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
 gb|AAG52390.1|AC011915_4 very-long-chain fatty acid condensing enzyme (CUT1); 56079-54227 
[Arabidopsis thaliana]
 gb|AEE34804.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
Length=497

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/501 (80%), Positives = 449/501 (90%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M +   P F+  SSVKLKYVKLGYQYLVNH L+ LL+P+MA V +E+LR GPEEI + + 
Sbjct  1     MPQAPMPEFS--SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +L+ VL SS F++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LQFDLVQVLCSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              LKD PKSVEFQMRILERSGLGEETCLP AIHYIPP PTMDAAR EA+ VIF A+D L K
Sbjct  117   ILKDKPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT LK KD+DILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLKPKDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYY+G+ERAMLLPNCLFRMG AAI +SN+R D  RAKY+
Sbjct  237   DLLQVHPNSNAIIVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LSHLVRTHRGADDKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLTSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL+YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P 
Sbjct  417   RMTLHRFGNTSSSSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>gb|AAM65060.1| very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
Length=492

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/489 (81%), Positives = 444/489 (91%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH L+ LL+P+MA V +E+LR GPEEI + + +S +  +L+ VL
Sbjct  6     SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEI-LNVWNS-LQFDLVQVL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS F++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL LKD PKSVEFQ
Sbjct  64    CSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTMDAAR EA+ VIF A+D L KKT LK KD+DIL
Sbjct  124   MRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAI  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G+ERAMLLPNCLFRMG AAI +SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW DCIDRYP
Sbjct  424   SSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_006307339.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
 gb|EOA40237.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
Length=492

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/489 (80%), Positives = 447/489 (91%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH LTLL++P++A V IE+LR GP+EI+  +  S +  EL+H+L
Sbjct  6     SSVKLKYVKLGYQYLVNHFLTLLMIPIIATVGIELLRMGPQEILSVL--SSLHFELLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++AR EA+ VIF+A++ L KKT LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYIPPAPTMESARNEAQMVIFTAMEDLFKKTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLIS+D+ARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSFNLSGMGCSAGLISVDVARDLLQVHPNSNAV  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAA+L+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CV E+ED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKSYYCVMEEEDKEGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQK+LQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKCNR +K P DGPW DCIDRYP
Sbjct  424   SSLWYELSYIEAQGRMKRSDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWSDCIDRYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>gb|AAL50069.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
 gb|AAM16230.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
Length=497

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/501 (80%), Positives = 448/501 (89%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M +   P F+  SSVKLKYVKLGYQYLVNH L+ LL+P+MA V +E+LR GPEEI + + 
Sbjct  1     MPQAPMPEFS--SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +L+ VL SS  ++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LQFDLVQVLCSSFLVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              LKD PKSVEFQMRILERSGLGEETCLP AIHYIPP PTMDAAR EA+ VIF A+D L K
Sbjct  117   ILKDKPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT LK KD+DILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLKPKDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYY+G+ERAMLLPNCLFRMG AAI +SN+R D  RAKY+
Sbjct  237   DLLQVHPNSNAIIVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LSHLVRTHRGADDKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLTSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL+YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P 
Sbjct  417   RMTLHRFGNTSSSSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>gb|KFK41273.1| hypothetical protein AALP_AA2G108700 [Arabis alpina]
Length=497

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/501 (80%), Positives = 448/501 (89%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M +   P F+  SSVKLKYVKLGYQYLVNH L+ LL+P+MA V +E+LR GPEEI + + 
Sbjct  1     MPQAPMPEFS--SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +L+ VL SS F++F++T+Y MSKPR++YLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LHFDLVQVLCSSFFVIFISTVYFMSKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              LKD PKSVEFQMRILERSGLGEETCLP AIHYIPP PTMD AR EA+ VIF+A+D L K
Sbjct  117   ILKDKPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDEARSEAQMVIFTAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT LK KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLKPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYYKG+ERAMLLPNCLFRMG AAI +SN+  D  RAKY+
Sbjct  237   DLLQVHPNSNAIIVSTEIITPNYYKGNERAMLLPNCLFRMGAAAIHMSNRNSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK+Y CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LCHLVRTHRGADDKSYYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLSSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL+YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P 
Sbjct  417   RMTLHRFGNTSSSSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>gb|EYU44641.1| hypothetical protein MIMGU_mgv1a005164mg [Erythranthe guttata]
Length=495

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/501 (82%), Positives = 449/501 (90%), Gaps = 6/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M E ++   N+ ++VKLKYVKL YQYLVNHILTL     +  + + +LR GP EI + + 
Sbjct  1     MPETTAAPPNSPTTVKLKYVKLVYQYLVNHILTL----ALIPLLLSLLRVGPTEI-LSLY  55

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S + L  + +L S+   V ++T+Y MSKPRSIYLVDY+CYKPPVTCRVPFSTFMEHSRL
Sbjct  56    NS-LHLNPVQILCSAFLAVLISTVYFMSKPRSIYLVDYSCYKPPVTCRVPFSTFMEHSRL  114

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              L  NPKSV+FQMRILERSGLGEETCLP AIHYIPP PTM+AARGEAE VIFS+ID+LM 
Sbjct  115   ILNQNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAELVIFSSIDSLMH  174

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT +K KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR
Sbjct  175   KTGIKPKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  234

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNALVVSTEIITPNYY+GSERAMLLPNCLFRMGGAA+L+SNKRRD+ RAKYR
Sbjct  235   DLLQVHPNSNALVVSTEIITPNYYQGSERAMLLPNCLFRMGGAAVLLSNKRRDAARAKYR  294

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L+HVVRTHKG+DDKAY CVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS
Sbjct  295   LVHVVRTHKGADDKAYTCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  354

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL TLIGRKIFNPKWK YIPDFK AFEHFCIHAGGRAVIDELQ+NLQLS+EHVEAS
Sbjct  355   EQLLFLLTLIGRKIFNPKWKAYIPDFKLAFEHFCIHAGGRAVIDELQRNLQLSAEHVEAS  414

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K PA
Sbjct  415   RMTLHRFGNTSSSSLWYELGYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPA  474

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCI RYPVHIPEIVKL
Sbjct  475   DGPWTDCIHRYPVHIPEIVKL  495



>ref|XP_009105040.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Brassica rapa]
 emb|CDY07381.1| BnaA07g24600D [Brassica napus]
Length=497

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/501 (79%), Positives = 451/501 (90%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M++ + P F+  SSVKLKYVKLGYQYLVNH L+LLL+P+MA + +E+LR GPE+I + + 
Sbjct  1     MSQATMPDFS--SSVKLKYVKLGYQYLVNHFLSLLLIPIMAIIAVELLRMGPEDI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +++ VL SS  ++F++T+Y MSKPR++YLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LHFDIVQVLCSSFLVIFISTVYFMSKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              LKD+PKSVEFQMRILERSGLGEETCLP AIHYIPP PTMD AR EA+ VIF+A+D L K
Sbjct  117   ILKDSPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDEARSEAQMVIFTAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT L  KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLLPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYYKG+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+
Sbjct  237   DLLQVHPNSNAVIVSTEIITPNYYKGNERAMLLPNCLFRMGSAAILMSNRRSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK++ CVYEQED +GK+GINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LCHLVRTHRGADDKSFYCVYEQEDREGKIGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFN KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLLSLIGRKIFNLKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P 
Sbjct  417   RMTLHRFGNTSSSSLWYELCYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_006302169.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
 gb|EOA35067.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
Length=498

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/489 (81%), Positives = 445/489 (91%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH L+ LL+P+MA V +E+LR GPEEI + + +S +  +L+ VL
Sbjct  12    SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEI-LNVWNS-LEFDLVQVL  69

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS F++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL LKD PKSVEFQ
Sbjct  70    CSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQ  129

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTMDAAR EA+ VIF+A+D L +KT LK KD+DIL
Sbjct  130   MRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFTAMDDLFEKTGLKPKDVDIL  189

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  190   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAI  249

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  250   IVSTEIITPNYYQGNERAMLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGAD  309

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  310   DKSFFCVYEQEDREGHVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGR  369

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPK KPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  370   KIFNPKLKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  429

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW DCIDRYP
Sbjct  430   SSLWYELSYIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  489

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  490   VFIPEVVKL  498



>ref|NP_173916.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
 sp|Q9C6L5.1|KCS5_ARATH RecName: Full=3-ketoacyl-CoA synthase 5; Short=KCS-5; AltName: 
Full=Very long-chain fatty acid condensing enzyme 5; Short=VLCFA 
condensing enzyme 5 [Arabidopsis thaliana]
 gb|AAG50800.1|AC079281_2 fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
 gb|AEE30626.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
Length=492

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/489 (80%), Positives = 442/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYL+N+ LTLLL+PV+A V IE+LR GPEEI+  +    +  EL+H+L
Sbjct  6     SSVKLKYVKLGYQYLINNFLTLLLIPVIATVAIELLRMGPEEILSVLNS--LHFELLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++AR EA+ VIF+A++ L K T LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSA LIS+D+ARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNSNAI  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CV EQED  G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKSYNCVMEQEDKNGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKCNR +K P DG W DCI+RYP
Sbjct  424   SSLWYELSYIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_006391129.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
 gb|ESQ28415.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
Length=497

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/501 (79%), Positives = 449/501 (90%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M +   P F+  SSVKLKYVKLGYQYLVNH L+LLL+P+MA + +E+LR GPEEI + + 
Sbjct  1     MPQAPLPEFS--SSVKLKYVKLGYQYLVNHFLSLLLIPIMAVIAVELLRMGPEEI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +L+ VL SS F++F++T+Y MSKPR++YLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LHFDLVQVLCSSFFVIFISTVYFMSKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              LKD PKSVEFQMRILERSGLGEETCLP AIHYIPP PTM+ AR EA+ VIF+A+D L K
Sbjct  117   ILKDKPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMEEARSEAQMVIFTAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT L  KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLMPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYYKG+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+
Sbjct  237   DLLQVHPNSNAIIVSTEIITPNYYKGNERAMLLPNCLFRMGSAAILMSNRRSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK+Y CVYEQED +G +GINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LCHLVRTHRGADDKSYYCVYEQEDKEGNIGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLTSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL+YIE+KGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K   
Sbjct  417   RMTLHRFGNTSSSSLWYELSYIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTTN  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_009356710.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/489 (81%), Positives = 447/489 (91%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +SVKLKYVKLGYQYLVNHILTL L+P+MAG+ +EVLR GP+E+ +++ DS +   L+ +L
Sbjct  10    NSVKLKYVKLGYQYLVNHILTLTLIPIMAGILLEVLRLGPDEL-LKLWDS-LHFNLVQIL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++F+AT+Y MSKPR IYLVDYAC+KPPVTCRVPFSTFMEHSRL L +NPKSVEFQ
Sbjct  68    CSSFLIIFIATVYFMSKPRPIYLVDYACFKPPVTCRVPFSTFMEHSRLILSNNPKSVEFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGE  C P AIHYIPP PTM+ ARGEAE VIFSA+D+L +KT LK KDIDIL
Sbjct  128   MRILERSGLGESPCPPPAIHYIPPNPTMEDARGEAELVIFSAMDSLFEKTGLKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARD+L VHPNSNA+
Sbjct  188   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAV  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+HVVRTHKG+D
Sbjct  248   VVSTEIITPNYYQGNERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAY+CV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFLFTLIGR
Sbjct  308   DKAYKCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI NPKWKPYIPDF+ AFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHRFGNTSS
Sbjct  368   KILNPKWKPYIPDFRLAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL YIE+KGRM+KGDR+WQIAFGSGFKCNSAVWK N  +K  +DGPW+DCIDRYP
Sbjct  428   SSLWYELGYIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKGNGAIKTASDGPWVDCIDRYP  487

Query  627   VHIPEIVKL  601
             VHIPE+VKL
Sbjct  488   VHIPEVVKL  496



>gb|AAM67234.1| fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
Length=492

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/489 (80%), Positives = 442/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYL+N+ LTLLL+PV+A V IE+LR GPEEI+  +    +  EL+H+L
Sbjct  6     SSVKLKYVKLGYQYLINNFLTLLLIPVIATVAIELLRMGPEEILSVLNS--LHFELLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++AR EA+ VIF+A++ L K T LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSA LIS+D+AR+LL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSASLISVDVARNLLQVHPNSNAI  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CV EQED  G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKSYNCVMEQEDKNGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKCNR +K P DG W DCI+RYP
Sbjct  424   SSLWYELSYIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_006415873.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
 gb|ESQ34226.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
Length=496

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/489 (80%), Positives = 443/489 (91%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVK KYVKL YQYLVNH LTLLL+P++A + +E+L+ GPEEI+  +    +  +L+H+L
Sbjct  10    SSVKHKYVKLAYQYLVNHFLTLLLIPIIAYIAVELLQMGPEEILNHLNS--LHFDLLHIL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPF+TFMEHSRLNLKDNPKSVEFQ
Sbjct  68    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRLNLKDNPKSVEFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++AR EAE VIF+A+D L KKT LK KDIDIL
Sbjct  128   MRILERSGLGEETCLPPAIHYIPPIPTMESARSEAEMVIFTAMDDLFKKTGLKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS NLSGMGCSAGLIS+D+ARDLL VHPNSNA+
Sbjct  188   IVNCSLFSPTPSLSAMVINKYKLRSNIKSLNLSGMGCSAGLISVDVARDLLQVHPNSNAV  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTHKG++
Sbjct  248   IVSTEIITPNYYQGKERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHKGAE  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK++ CVYEQ+D +G VGINLSKDLM IAG+ALKSNITTIGPLVLPASEQLLFL +LIGR
Sbjct  308   DKSFYCVYEQQDKEGHVGINLSKDLMAIAGDALKSNITTIGPLVLPASEQLLFLTSLIGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQK+LQLS EHVEASRMTLHRFGNTSS
Sbjct  368   KIFNPKWKPYIPDFKMAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRMK+GDR+WQIAFGSGFKCNSAVWKCNR +K P +GPW DCIDRYP
Sbjct  428   SSLWYELSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKSPTEGPWSDCIDRYP  487

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  488   VFIPEVVKL  496



>emb|CDY04232.1| BnaC06g25830D [Brassica napus]
Length=497

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/501 (79%), Positives = 449/501 (90%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M++   P F+  SSVKLKYVKLGYQYLVNH L+LLL+P+MA + +E+LR GPEEI + + 
Sbjct  1     MSQAPMPDFS--SSVKLKYVKLGYQYLVNHFLSLLLIPIMAIIAVELLRMGPEEI-LNVW  57

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
             +S +  +++ VL SS  ++F++T+Y MSKP ++YLVDY+CYKPPVTCRVPF+TFMEHSRL
Sbjct  58    NS-LHFDIVQVLCSSFLVIFISTVYFMSKPCTVYLVDYSCYKPPVTCRVPFATFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
              LKD+PKSVEFQMRILERSGLGEETCLP AIHYIPP PTMD AR EA+ VIF+A+D L K
Sbjct  117   ILKDSPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDEARSEAQMVIFTAMDDLFK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT L  KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLLPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNSNA++VSTEIITPNYYKG+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+
Sbjct  237   DLLQVHPNSNAVIVSTEIITPNYYKGNERAMLLPNCLFRMGSAAILMSNRRSDRWRAKYK  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L H+VRTH+G+DDK+Y CVYEQED +GK+GINLSKDLM IAGEALK+NITTIGPLVLPAS
Sbjct  297   LCHLVRTHRGADDKSYYCVYEQEDREGKIGINLSKDLMAIAGEALKANITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFL +LIGRKIFN KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEAS
Sbjct  357   EQLLFLLSLIGRKIFNLKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P 
Sbjct  417   RMTLHRFGNTSSSSLWYELCYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             DGPW DCIDRYPV IPE+VKL
Sbjct  477   DGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_002890689.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66948.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/489 (80%), Positives = 441/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYL+N+ LT+LL+PV+A + IE+LR GPEEI+  +    +  EL+H+L
Sbjct  6     SSVKLKYVKLGYQYLINNFLTVLLIPVIATIVIELLRMGPEEILSVLNS--LHFELLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++AR EA+ VIF+A++ L K T LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSA LIS+D+ RDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSASLISVDVVRDLLQVHPNSNAV  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SN++ D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRKSDRWRAKYKLCHLVRTHRGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CV EQED  G VGINLSKDLM IAGEALKSNITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKSYNCVMEQEDKNGNVGINLSKDLMTIAGEALKSNITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRMK+ DR+WQIAFGSGFKCNSAVWKCNR +K P DG W DCI+RYP
Sbjct  424   SSLWYELSYIEAKGRMKRSDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_010511851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Camelina sativa]
Length=497

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/489 (81%), Positives = 442/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH L+ LL+P+MA   +E+LR GPEEI + + +S +  +L+ VL
Sbjct  11    SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIGAVELLRMGPEEI-LNVWNS-LEFDLVQVL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              +S F++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL LKD PKSVEFQ
Sbjct  69    CTSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQ  128

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEET LP AIHYIPP PTMDAAR EA+ VIF+A+D L KKT LK KD+DIL
Sbjct  129   MRILERSGLGEETSLPPAIHYIPPTPTMDAARSEAQLVIFTAMDDLFKKTGLKPKDVDIL  188

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  189   IVNCSLFSPTPSLSAMVINKYKLRSNIKSVNLSGMGCSAGLISVDLARDLLQVHPNSNAI  248

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTH+GSD
Sbjct  249   IVSTEIITPNYYQGNERAMLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGSD  308

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  309   DKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGR  368

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPK KPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  369   KIFNPKLKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  428

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW DCIDRYP
Sbjct  429   SSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  489   VFIPEVVKL  497



>ref|XP_010499108.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Camelina sativa]
Length=492

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/489 (80%), Positives = 442/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH LTLLL+P +A V IE+LR G +EI   +    +  E++H+L
Sbjct  6     SSVKLKYVKLGYQYLVNHFLTLLLIPFIATVAIELLRMGSQEIFTVLYS--LHFEVLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHY+PP PTM+AAR EA+ VIF+A++ L KKT LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSAGLIS+D+ARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAV  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAA+L+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAY CV E+ED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKAYYCVMEEEDKEGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQK+LQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKC R +K P DGPW DCI+RYP
Sbjct  424   SSLWYELSYIEAQGRMKRSDRVWQIAFGSGFKCNSAVWKCIRTIKTPTDGPWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>gb|AIE57499.1| KCS6 [Camelina sativa]
Length=492

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/489 (80%), Positives = 442/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH LTLLL+P +A V IE+LR G +EI   +    +  E++H+L
Sbjct  6     SSVKLKYVKLGYQYLVNHFLTLLLIPFIATVAIELLRMGSQEIFTVLYS--LHFEVLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHY+PP PTM+AAR EA+ VIF+A++ L KKT LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSAGLIS+D+ARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAV  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAA+L+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAY CV E+ED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKAYYCVMEEEDKEGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQK+LQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKC R +K P DGPW DCI+RYP
Sbjct  424   SSLWYELSYIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCIRTIKTPTDGPWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_010477925.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Camelina sativa]
Length=492

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/489 (80%), Positives = 441/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH LTLLL+P +A V IE+LR G +EI   +       E++H+L
Sbjct  6     SSVKLKYVKLGYQYLVNHFLTLLLIPFIATVAIELLRMGSQEIFTVLYS--FHFEVLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHY+PP PTM+AAR EA+ VIF+A++ L KKT LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSAGLIS+D+ARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAV  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAA+L+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAY CV E+ED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  304   DKAYYCVMEEEDKEGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQK+LQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKC R +K P DGPW DCI+RYP
Sbjct  424   SSLWYELSYIEAQGRMKRSDRVWQIAFGSGFKCNSAVWKCIRTIKTPTDGPWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_010415473.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
 ref|XP_010470803.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
Length=497

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/489 (81%), Positives = 442/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH L+ LL+P+MA   +E+LR GPEEI + + +S +  +L+ VL
Sbjct  11    SSVKLKYVKLGYQYLVNHFLSFLLIPIMAIGAVELLRMGPEEI-LNVWNS-LEFDLVQVL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              +S F++F++T+Y MSKPR+IYLVDY+CYKPPVTCRVPF+TFMEHSRL LKD PKSVEFQ
Sbjct  69    CTSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQ  128

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEET LP AIHYIPP PTMDAAR EA+ VIF+A+D L KKT LK KD+DIL
Sbjct  129   MRILERSGLGEETSLPPAIHYIPPTPTMDAARSEAQLVIFTAMDDLFKKTGLKPKDVDIL  188

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  189   IVNCSLFSPTPSLSAMVINKYKLRSNIKSVNLSGMGCSAGLISVDLARDLLQVHPNSNAI  248

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  249   IVSTEIITPNYYQGNERAMLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGAD  308

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK++ CVYEQED +G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  309   DKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGR  368

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPK KPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  369   KIFNPKLKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  428

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIESKGRM++GDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW DCIDRYP
Sbjct  429   SSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  489   VFIPEVVKL  497



>ref|XP_010265151.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=496

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/492 (80%), Positives = 444/492 (90%), Gaps = 2/492 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N  SSVKLKYVKLGYQYLVNHILT LL+P+MAG+ +E+LR GP+EI +RI +S +  +L+
Sbjct  7     NFSSSVKLKYVKLGYQYLVNHILTFLLIPIMAGIVVELLRLGPDEI-LRIWNS-LEFDLV  64

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
              +L S   ++FVAT+Y MS+PR IYLVDY+C+KPPVTCR PFSTFMEHSRL    N K V
Sbjct  65    QILCSGFLIIFVATVYFMSRPRHIYLVDYSCFKPPVTCRAPFSTFMEHSRLINGANTKVV  124

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             +F+MRILERSGLGEETCLP AIHYIPPKPTM   R EAE VIFS+ID+L+KKT +K KD+
Sbjct  125   DFEMRILERSGLGEETCLPPAIHYIPPKPTMADCRAEAELVIFSSIDSLLKKTGIKPKDV  184

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
             DILI+NCS+FSPTPS++AM+VNKYK+R NIKS+NLSGMGCSAGLISIDLARDLL VHPNS
Sbjct  185   DILILNCSMFSPTPSMTAMIVNKYKMRGNIKSFNLSGMGCSAGLISIDLARDLLQVHPNS  244

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              ALVVSTEIITP++Y GS+R+MLLPNCLFRMG AAIL+SN+R+D  RAKYRL HVVRTHK
Sbjct  245   YALVVSTEIITPSFYGGSQRSMLLPNCLFRMGSAAILLSNRRKDGWRAKYRLAHVVRTHK  304

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+DDKAYRCVYE+EDPQG  G++LSK+LMVIAGEALKSNITTIGPLVLPASEQLLFLFTL
Sbjct  305   GADDKAYRCVYEEEDPQGIRGVSLSKELMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  364

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             IGRK+FNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGN
Sbjct  365   IGRKLFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGN  424

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSSLWYEL+YIESKGRMK+GDR+WQIAFGSGFKCNSAVWKCNR +K   + PW DCID
Sbjct  425   TSSSSLWYELSYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKADPESPWFDCID  484

Query  636   RYPVHIPEIVKL  601
             RYPVHIPEIVKL
Sbjct  485   RYPVHIPEIVKL  496



>ref|XP_002282526.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=496

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/498 (79%), Positives = 448/498 (90%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             ++SP  +  SSVKLKYVKLGYQYLVNHILTLLL+P+M GV IEVLR GP+EI + + +S 
Sbjct  3     QASPELS--SSVKLKYVKLGYQYLVNHILTLLLIPIMVGVLIEVLRLGPDEI-LNLWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F  T+Y MSKPRSIYLVDYACYKPPV  RVPF+TFMEH+RL L 
Sbjct  59    LHFDLVQILCSSFLIIFATTVYFMSKPRSIYLVDYACYKPPVMLRVPFATFMEHARLVLS  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
               PKSVEFQ RILERSGLGEETCLP  +HYIPP+PTM+AAR EA+ VIFSA+D+L+ KT 
Sbjct  119   SQPKSVEFQTRILERSGLGEETCLPLTVHYIPPRPTMEAARDEAQLVIFSAMDSLLNKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDILIVNCS+FSPTPSLSAMV+NKYK+RSNIKS+NLSGMGCSAGLISIDLARDLL
Sbjct  179   LKPKDIDILIVNCSIFSPTPSLSAMVINKYKMRSNIKSFNLSGMGCSAGLISIDLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNA+VVSTEIITPN Y+G++RAML+PNCLFRMGGAAIL++N+R +  RAKYRL+H
Sbjct  239   QVHPNSNAVVVSTEIITPNCYQGNQRAMLVPNCLFRMGGAAILLTNRRWEHRRAKYRLVH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DDKAYRCV E+EDP+GKVGI+LSKDLMVIAGEALK+NITT GPLVLPASEQL
Sbjct  299   VVRTHKGADDKAYRCVMEEEDPEGKVGISLSKDLMVIAGEALKTNITTTGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFL TLIGRKIF   WKPYIPDFK AFEHFCIHAGGRAVIDELQ+NLQLS+EHVEASRM 
Sbjct  359   LFLLTLIGRKIFKQNWKPYIPDFKLAFEHFCIHAGGRAVIDELQQNLQLSAEHVEASRMA  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYEL+YIE+KGRMKKGDRIWQIAFGSGFKCNSA+WKCNR+++ P DGP
Sbjct  419   LHRFGNTSSSSLWYELSYIEAKGRMKKGDRIWQIAFGSGFKCNSAIWKCNRSIEPPRDGP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             WLDCI RYPVHIPE+VKL
Sbjct  479   WLDCIHRYPVHIPEVVKL  496



>ref|XP_003614634.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES97592.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/492 (80%), Positives = 439/492 (89%), Gaps = 2/492 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N+ +S K KYVKL YQY VNH +TL L+ +M  + IE++R GP EI+   K   +  + I
Sbjct  7     NSSNSSKHKYVKLFYQYFVNHFITLTLLTIMICIFIELVRLGPFEILNLFKS--LQFDHI  64

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
              +L S   ++F++T+Y M KPR+IYLVDYAC+KPP+TCRVPF+TFMEHSRL LK+NPKSV
Sbjct  65    QILCSCFLIIFISTIYFMLKPRTIYLVDYACFKPPITCRVPFATFMEHSRLILKNNPKSV  124

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQMRILERSGLGEETCLP AIHYIPPKPTM+ AR EAE VIFS++D L  KT LK KDI
Sbjct  125   EFQMRILERSGLGEETCLPPAIHYIPPKPTMEEARREAELVIFSSMDTLFAKTGLKPKDI  184

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
             DILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL V+PNS
Sbjct  185   DILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVYPNS  244

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
             NA+VVSTEIITPNYY+G ERAMLLPNCLFRMGGAAIL+SNK+ +  RAKYRLM VVRTHK
Sbjct  245   NAVVVSTEIITPNYYQGKERAMLLPNCLFRMGGAAILLSNKKAEHKRAKYRLMQVVRTHK  304

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G DDKAYRCV+E+ED +GKVGI+L KDLM IAGEALKSNITTIGPLVLPASEQLLFLFTL
Sbjct  305   GGDDKAYRCVFEEEDREGKVGISLQKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTL  364

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             IG+KIFNPK KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGN
Sbjct  365   IGKKIFNPKMKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGN  424

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSSLWYELNYIESKGRMK+GDR+WQIAFGSGFKCNSAVWKCNR++K P +GPW DCID
Sbjct  425   TSSSSLWYELNYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVNGPWEDCID  484

Query  636   RYPVHIPEIVKL  601
             RYPVHIPEIVKL
Sbjct  485   RYPVHIPEIVKL  496



>ref|XP_010263663.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/501 (78%), Positives = 445/501 (89%), Gaps = 4/501 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M   + P F+N  SVKLKYVKLGYQYLVNHILTLLL+P+MA + +E+LR GP+EI+    
Sbjct  1     MPPTALPNFSN--SVKLKYVKLGYQYLVNHILTLLLIPIMAAIVLEILRLGPDEILGLWN  58

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
                + L+L+ +L S   ++FVAT++ +S+PR IYLVDY+C+KPPVTCR PFSTFMEHSRL
Sbjct  59    S--LELDLVQILCSGFLIIFVATVFFVSRPRHIYLVDYSCFKPPVTCRAPFSTFMEHSRL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
                 N K V+F+MRILERSGLGEETCLP AIHYIPP PTM   R EAE VIFSAID+L+K
Sbjct  117   INGSNTKVVDFEMRILERSGLGEETCLPPAIHYIPPTPTMADCRAEAELVIFSAIDSLLK  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT +K KDIDILI+NCS+FSPTPSL+AM+VNKYK+R NI+S+NLSGMGCSAGLISIDLAR
Sbjct  177   KTGIKPKDIDILILNCSMFSPTPSLTAMIVNKYKMRGNIRSFNLSGMGCSAGLISIDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VHPNS ALVVSTEIITP+YY GS+R+MLLPNCLFRMG AAIL+SN+R+DS RAKYR
Sbjct  237   DLLQVHPNSYALVVSTEIITPSYYSGSQRSMLLPNCLFRMGSAAILLSNRRKDSWRAKYR  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L HVVRTHKG+DD+AYRCVYE+EDPQG  G++LSK+LMVIAGEALKSNITTIGPLVLPAS
Sbjct  297   LAHVVRTHKGADDRAYRCVYEEEDPQGIRGVSLSKELMVIAGEALKSNITTIGPLVLPAS  356

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLFLFTL+GRK+FNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEAS
Sbjct  357   EQLLFLFTLVGRKLFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEAS  416

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSSLWYEL+YIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K   
Sbjct  417   RMTLHRFGNTSSSSLWYELSYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKPDP  476

Query  663   DGPWLDCIDRYPVHIPEIVKL  601
             + PW DCI+RYPVHIPEIVKL
Sbjct  477   ESPWFDCINRYPVHIPEIVKL  497



>gb|AAO42223.1| putative fatty acid condensing enzyme CUT1 [Arabidopsis thaliana]
Length=492

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/489 (80%), Positives = 441/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYL+N+ LTLLL+PV+A V IE+LR GPEEI+  +    +  EL+H+L
Sbjct  6     SSVKLKYVKLGYQYLINNFLTLLLIPVIATVAIELLRMGPEEILSVLNS--LHFELLHIL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+CYKPPVTCRVPFS+FMEHSRL LKDNPKSVEFQ
Sbjct  64    CSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++AR EA+ VIF+A++ L K T LK KDIDIL
Sbjct  124   MRILERSGLGEETCLPPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKSYNLSGMGCSA LIS+D+ARDLL VHPNSNA+
Sbjct  184   IVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNSNAI  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYYKG+ERAMLLPNCLFRMGGAAIL+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  244   IISTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CV EQED  G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLL L +LIGR
Sbjct  304   DKSYNCVMEQEDKNGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLSLSSLIGR  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  364   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE++GRMK+ DR+WQIAFGSGFKCNSAVWKCNR +K P DG W DCI+RYP
Sbjct  424   SSLWYELSYIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP  483

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  484   VFIPEVVKL  492



>ref|XP_010527537.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Tarenaya hassleriana]
Length=494

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/489 (80%), Positives = 442/489 (90%), Gaps = 4/489 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQ LVNH L+LLL+P+MA + +E+LR GPE+I + + +S +  +L+  L
Sbjct  10    SSVKLKYVKLGYQCLVNHFLSLLLIPIMAAIVVELLRMGPEQI-LSLWNS-LHFDLVQTL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S   ++F++T+Y MSKPR++YLVDY+CYKPP+TCRVPF+TFMEHSRL LKDNPKSVEFQ
Sbjct  68    CSVFLVIFISTVYFMSKPRTVYLVDYSCYKPPLTCRVPFATFMEHSRLILKDNPKSVEFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP  TM+AARGEA+ V+FSA+D L KKT L  +D+DIL
Sbjct  128   MRILERSGLGEETCLPPAIHYIPP--TMEAARGEAQMVVFSAMDDLFKKTGLNPRDVDIL  185

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  186   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAV  245

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEI+TPNYYKG++RAMLLPNCLFRMG AAIL+SN+R D  RAKYRL HVVRTH+G+D
Sbjct  246   IVSTEILTPNYYKGNDRAMLLPNCLFRMGAAAILLSNRRTDRWRAKYRLCHVVRTHRGAD  305

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CVYE+ED  GKVGINLSKDLM IAGEALKSNITT+GPLVLPASEQ+LFL +LIGR
Sbjct  306   DKSYCCVYEKEDKDGKVGINLSKDLMAIAGEALKSNITTLGPLVLPASEQILFLLSLIGR  365

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDF+ AFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS
Sbjct  366   KIFNPKWKPYIPDFRLAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  425

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRM+ GDR+WQIAFGSGFKCNS VWKCNR +K   DGPW DCIDRYP
Sbjct  426   SSLWYELSYIEAKGRMRHGDRVWQIAFGSGFKCNSVVWKCNRTIKGLTDGPWTDCIDRYP  485

Query  627   VHIPEIVKL  601
             V+IPEIVKL
Sbjct  486   VYIPEIVKL  494



>gb|KFK44525.1| hypothetical protein AALP_AA1G267900 [Arabis alpina]
Length=495

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/489 (80%), Positives = 440/489 (90%), Gaps = 3/489 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH LTLLLVP++A V +++LR GPEEI   +    +  EL+HVL
Sbjct  10    SSVKLKYVKLGYQYLVNHFLTLLLVPIIASVAVKLLRMGPEEIFNLMNS--LHFELLHVL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR++YLVDY+C+KPPVTCRVPF+TFMEHSRL LKDNPKSVEFQ
Sbjct  68    CSSFLIIFVSTVYFMSKPRTVYLVDYSCFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MR+LERSGLGEETCLP AIHYIPP PTM++AR EA+ VIFSA+D L KKT LK KDIDIL
Sbjct  128   MRMLERSGLGEETCLPPAIHYIPPTPTMESARSEAQMVIFSAMDDLFKKTGLKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKS NLSGMGCSA LIS+D+ARDLL VHPNSNA+
Sbjct  188   IVNCSLFSPTPSLSAMIINKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAV  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             ++STEIITPNYY+G+ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTH+G+D
Sbjct  248   IISTEIITPNYYQGNERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK++ CV+EQED  G VGINLSKDLM IAGEALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  308   DKSFYCVHEQEDKDGNVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLSSLIGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             +IFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  368   RIFNPKWKPYIPDFKMAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRMK+G+R+WQIAFGSGFKCNSAVWKCNR + KP+   W DCIDRYP
Sbjct  428   SSLWYELSYIEAKGRMKRGERVWQIAFGSGFKCNSAVWKCNRTI-KPSTNAWSDCIDRYP  486

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  487   VFIPEVVKL  495



>emb|CDP00616.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/488 (79%), Positives = 438/488 (90%), Gaps = 2/488 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLG QYLVNH LT LLVPV+AG+ IE++R GP+EI    K   +  + I +L 
Sbjct  11    SVKLKYVKLGCQYLVNHFLTFLLVPVIAGILIELIRLGPDEIATLWKS--LQFDFIQILC  68

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             SS  ++F +TLY +S+PR +YLVDYACYKPPVTCRVPFS FMEHSRL L   PKSVEFQM
Sbjct  69    SSFLIIFTSTLYFVSRPRPVYLVDYACYKPPVTCRVPFSCFMEHSRLILSTEPKSVEFQM  128

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGEETCLP AIHYIPP P+M+AAR EAE VIFSA+D L KKT L+AKD+DILI
Sbjct  129   RILERSGLGEETCLPPAIHYIPPAPSMEAARKEAEMVIFSAVDTLFKKTGLEAKDVDILI  188

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSL+AMV+NKYK+R +IKS+NLSGMGCSAG+ISI+LARDLL  +PNS A+V
Sbjct  189   VNCSLFSPTPSLTAMVINKYKMRGDIKSFNLSGMGCSAGMISINLARDLLQSYPNSIAVV  248

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPNYY+G ER+MLLPNCLFRMGGAAI +SN+R DS RAKYRL+HVVRTHKG+DD
Sbjct  249   VSTEIITPNYYQGKERSMLLPNCLFRMGGAAIFLSNRRSDSIRAKYRLLHVVRTHKGADD  308

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KAYRCV+E+EDP+GK GI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL +L+GRK
Sbjct  309   KAYRCVFEEEDPEGKSGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLISLMGRK  368

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
              FNPKWKPYIPDFKQAF+HFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSSS
Sbjct  369   FFNPKWKPYIPDFKQAFDHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSS  428

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL+YIE+KGRM+KG+R+WQIAFGSGFKCNSAVWKC ++++ P DGPW DCIDRYPV
Sbjct  429   SLWYELSYIEAKGRMRKGNRVWQIAFGSGFKCNSAVWKCIKSIEIPTDGPWSDCIDRYPV  488

Query  624   HIPEIVKL  601
             HIPE+VKL
Sbjct  489   HIPEVVKL  496



>ref|XP_010551269.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Tarenaya hassleriana]
Length=490

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/489 (80%), Positives = 438/489 (90%), Gaps = 8/489 (2%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH L  LL+P+MA + +E+LR GP+EI + + +S +  +L+  L
Sbjct  10    SSVKLKYVKLGYQYLVNHFLGFLLIPIMAAIAVELLRMGPQEI-LSVWNS-LHFDLVQTL  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S+  +VF++T+Y MSKPR++YLVDYACYKPPVTCRVPFS      RL LKDNPKSVEFQ
Sbjct  68    CSAFLIVFISTVYFMSKPRTVYLVDYACYKPPVTCRVPFS------RLILKDNPKSVEFQ  121

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTM++ARGEA+ VIF+A+D L KKT LK +DIDIL
Sbjct  122   MRILERSGLGEETCLPPAIHYIPPNPTMESARGEAQMVIFTAMDDLFKKTGLKPRDIDIL  181

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+
Sbjct  182   IVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAV  241

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYYKG++RAMLLPNCLFRMG AAIL+SN+R D  RAKYRL HVVRTH+G+D
Sbjct  242   IVSTEIITPNYYKGNDRAMLLPNCLFRMGAAAILLSNRRSDRWRAKYRLCHVVRTHRGAD  301

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CVYEQED  G VGINLSKDLM IAGEALKSNITT+GPLVLPASEQ+LFL +LIGR
Sbjct  302   DKSYYCVYEQEDKDGNVGINLSKDLMAIAGEALKSNITTLGPLVLPASEQILFLLSLIGR  361

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSS
Sbjct  362   KIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSS  421

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRM+ GDR+WQIAFGSGFKCNSAVWKCNR +K P DGPW D IDRYP
Sbjct  422   SSLWYELSYIEAKGRMRHGDRVWQIAFGSGFKCNSAVWKCNRTIKVPTDGPWSDSIDRYP  481

Query  627   VHIPEIVKL  601
             V+IPEIVKL
Sbjct  482   VYIPEIVKL  490



>ref|XP_009115318.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Brassica rapa]
Length=497

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/489 (79%), Positives = 437/489 (89%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +S K KYVKLGYQYLVN+ LTLLL+P++A   +E+ R GPEEI+  +    ++  L+H+L
Sbjct  11    TSTKHKYVKLGYQYLVNNFLTLLLIPILAYTALELFRMGPEEILNHLNS--LNFNLLHIL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR+IYLVDY+C+KPPVTCRVPF+TFMEHSRLNL D+PKSVEFQ
Sbjct  69    CSSFLIIFVSTVYFMSKPRTIYLVDYSCFKPPVTCRVPFATFMEHSRLNLIDSPKSVEFQ  128

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTMDAAR EAE VIF+A+D L KKT LK KDIDIL
Sbjct  129   MRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAELVIFTAMDDLFKKTGLKPKDIDIL  188

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKS NLSGMGCSA LIS+D+ARDLL VHPNSNA+
Sbjct  189   IVNCSLFSPTPSLSAMIINKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAV  248

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTH+G++
Sbjct  249   IVSTEIITPNYYQGKERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAE  308

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CVY+QED +  VGINL+KDLM IAGEALKSNITTIGPLVLPASEQLLFL +LIGR
Sbjct  309   DKSYYCVYQQEDDESHVGINLNKDLMAIAGEALKSNITTIGPLVLPASEQLLFLTSLIGR  368

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFN KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSS
Sbjct  369   KIFNAKWKPYIPDFKMAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSS  428

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KG+MK+GDR+WQIAFGSGFKCNSAVWK NR +K P +GPW DCIDRYP
Sbjct  429   SSLWYELSYIEAKGKMKRGDRVWQIAFGSGFKCNSAVWKSNRTIKTPTEGPWSDCIDRYP  488

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  489   VFIPEVVKL  497



>gb|KHN11421.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=460

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/462 (84%), Positives = 427/462 (92%), Gaps = 2/462 (0%)
 Frame = -3

Query  1986  MAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYA  1807
             M  + IEVLR GP+EI +++  S +  +L+ +L SS  ++F++T+Y MSKPR+IYLVDYA
Sbjct  1     MISIFIEVLRLGPDEI-LKLWHS-LHFDLVQILCSSFLIIFISTVYFMSKPRTIYLVDYA  58

Query  1806  CYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPT  1627
             C+KPPVTCRVPF+TFMEHSRL LKDNPKSVEFQMRILERSGLGEETCLP AIHYIPPKPT
Sbjct  59    CFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCLPPAIHYIPPKPT  118

Query  1626  MDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNI  1447
             M+AARGEAE VIFSA+D+L  KT LK KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNI
Sbjct  119   MEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNI  178

Query  1446  KSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFR  1267
             KS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+VVSTEIITPNYY+G ERAMLLPNCLFR
Sbjct  179   KSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAMLLPNCLFR  238

Query  1266  MGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMV  1087
             MGGAAIL+SN+  +  RAKYRL+HVVRTHKG+DDKAYRCV+E+ED +GKVGI+L KDLM 
Sbjct  239   MGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEGKVGISLQKDLMA  298

Query  1086  IAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGG  907
             IAGEALKSNITT+GPLVLPASEQLLFL TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGG
Sbjct  299   IAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGG  358

Query  906   RAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAF  727
             RAVIDELQKNLQLS+EHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDR+WQIAF
Sbjct  359   RAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRVWQIAF  418

Query  726   GSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             GSGFKCNSAVWKCNR++K P DGPW DCIDRYPVHIPEIVKL
Sbjct  419   GSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYPVHIPEIVKL  460



>emb|CDY42109.1| BnaA09g28510D [Brassica napus]
Length=497

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/489 (79%), Positives = 437/489 (89%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +S K KYVKLGYQYLVN+ LTLLL+P++A   +E+ R GPEEI+  +    ++  L+H+L
Sbjct  11    TSTKHKYVKLGYQYLVNNFLTLLLIPILAYTALELFRMGPEEILNHLNS--LNFNLLHIL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SS  ++FV+T+Y MSKPR+IYLVDY+C+KPPVTCRVPF+TFMEHSRLNL D+PKSVEFQ
Sbjct  69    CSSFLIIFVSTVYFMSKPRTIYLVDYSCFKPPVTCRVPFATFMEHSRLNLIDSPKSVEFQ  128

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHYIPP PTMDAAR EAE VIF+A+D L KKT LK KDIDIL
Sbjct  129   MRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAELVIFTAMDDLFKKTGLKPKDIDIL  188

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNIKS NLSGMGCSA LIS+D+ARDLL VHPNSNA+
Sbjct  189   IVNCSLFSPTPSLSAMIINKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAV  248

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             +VSTEIITPNYY+G ERAMLLPNCLFRMG AAIL+SN+R D  RAKY+L H+VRTH+G++
Sbjct  249   IVSTEIITPNYYQGKERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAE  308

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK+Y CVY+QED +  VGINL+KDLM IAGEALKSNITTIGPLVLPASEQLLFL +LIGR
Sbjct  309   DKSYYCVYQQEDDESHVGINLNKDLMAIAGEALKSNITTIGPLVLPASEQLLFLTSLIGR  368

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI+N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSS
Sbjct  369   KIYNAKWKPYIPDFKMAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSS  428

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KG+MK+GDR+WQIAFGSGFKCNSAVWK NR +K P +GPW DCIDRYP
Sbjct  429   SSLWYELSYIEAKGKMKRGDRVWQIAFGSGFKCNSAVWKSNRTIKTPTEGPWSDCIDRYP  488

Query  627   VHIPEIVKL  601
             V IPE+VKL
Sbjct  489   VFIPEVVKL  497



>ref|XP_007153392.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
 gb|ESW25386.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
Length=543

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/534 (77%), Positives = 471/534 (88%), Gaps = 12/534 (2%)
 Frame = -3

Query  2199  FLSSISDLLPLCMYFPSSQPHQ-YSERVKEE*LMAEESSPGFNNRSSVKLKYVKLGYQYL  2023
             F +S+S  LP      S+  HQ  S ++    +MA      F+N  SVKLKYVKLGYQYL
Sbjct  21    FKTSLSHPLPFSSQ--SATFHQPQSAKLNSHSIMAH-----FSN--SVKLKYVKLGYQYL  71

Query  2022  VNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLM  1843
             VNHI TL+L+P++ G+ IE+L  GP+E   ++ +S + L  + ++ SS  ++ + T+Y M
Sbjct  72    VNHITTLILIPLILGIFIELLHLGPDEF-HKLWNS-LHLHPVQIVCSSFLIIMIFTVYFM  129

Query  1842  SKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCL  1663
             SKPR+++LVDYAC++PPVTCRVPF+TFMEHSRL LK+NPKSVEFQMRILERSGLGEETCL
Sbjct  130   SKPRTVFLVDYACFEPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETCL  189

Query  1662  PAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSA  1483
             P AIHYIPPKPTM+AARGEA+ VIFSA+++L +KT LK KDIDILIVNCSLFSPTPSLSA
Sbjct  190   PPAIHYIPPKPTMEAARGEAQLVIFSAMESLFRKTGLKPKDIDILIVNCSLFSPTPSLSA  249

Query  1482  MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGS  1303
             MV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL +H NSNA+VVSTEIITPNYY+G+
Sbjct  250   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQIHLNSNAVVVSTEIITPNYYQGN  309

Query  1302  ERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQG  1123
             ERAMLLPNCLFRMGGAAIL+SN++ +S RAKYRL+HVVRTHKGSDDKA+RCV+E+ED +G
Sbjct  310   ERAMLLPNCLFRMGGAAILLSNRKSESSRAKYRLVHVVRTHKGSDDKAFRCVFEEEDKEG  369

Query  1122  KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFK  943
             KVGI+LSKDLM IAGEALKSNITT+GPLVLPASEQLLFLFTLIGRKIFNP+WKPYIPDFK
Sbjct  370   KVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLFTLIGRKIFNPRWKPYIPDFK  429

Query  942   QAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGR  763
             QAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSSSSLWYELNYIESKGR
Sbjct  430   QAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGR  489

Query  762   MKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             MK+GDR+WQIAFGSGFKCNSAVWKCNR+++ P DGPW DCI  YPVHIPEIVKL
Sbjct  490   MKRGDRVWQIAFGSGFKCNSAVWKCNRSIETPFDGPWSDCIHSYPVHIPEIVKL  543



>gb|KHN05569.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=461

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/463 (83%), Positives = 425/463 (92%), Gaps = 2/463 (0%)
 Frame = -3

Query  1989  VMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDY  1810
             +M  + +E+LR GPEEI+       + L+L+ +L S+  ++F+AT+Y MSKPR+IYLVDY
Sbjct  1     MMIAIFMEILRLGPEEILNLWHS--LHLDLVQILCSAFLIIFIATVYFMSKPRTIYLVDY  58

Query  1809  ACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKP  1630
             AC+KPPVTCRVPF+TFMEHSRL LKDNPKSVEFQMRILERSGLGEETCLP AIHYIPPKP
Sbjct  59    ACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCLPPAIHYIPPKP  118

Query  1629  TMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSN  1450
             TM+AARGEAE VIFSA+D+L  KT LK KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSN
Sbjct  119   TMEAARGEAELVIFSAMDSLFDKTGLKPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSN  178

Query  1449  IKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLF  1270
             IKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA+VVSTEIITPNYY+G ERAMLLPNCLF
Sbjct  179   IKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGKERAMLLPNCLF  238

Query  1269  RMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLM  1090
             RMGGAAIL+SN+  +  RAKYRL+HVVRTHKG+DDKAYRCV+E+ED +GKVGI+L KDLM
Sbjct  239   RMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDREGKVGISLQKDLM  298

Query  1089  VIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAG  910
              IAGEALKSNITT+GPLVLPASEQLLFL TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAG
Sbjct  299   AIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAG  358

Query  909   GRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIA  730
             GRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDR+WQIA
Sbjct  359   GRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRVWQIA  418

Query  729   FGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             FGSGFKCNSAVWKCNR++K P DGPW DCIDRYPV IPEIVKL
Sbjct  419   FGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYPVDIPEIVKL  461



>ref|XP_004135091.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159296.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
Length=450

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/451 (86%), Positives = 421/451 (93%), Gaps = 2/451 (0%)
 Frame = -3

Query  1953  GPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVP  1774
             GP+EI+   K   +  +LI +L SS F++FVAT+Y MSKPR+I+LVDYAC+KPPVTCRVP
Sbjct  2     GPDEILNLWKS--LHFDLIQILCSSFFIIFVATVYFMSKPRTIFLVDYACFKPPVTCRVP  59

Query  1773  FSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEV  1594
             FSTFMEHSRL LKDNPKSVEFQMRILERSGLGEETCLP AIHYIPPKPTM+AARGEAE V
Sbjct  60    FSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCLPPAIHYIPPKPTMEAARGEAELV  119

Query  1593  IFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCS  1414
             IFSA+DAL +KT LK KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCS
Sbjct  120   IFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCS  179

Query  1413  AGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNK  1234
             AGLISIDLARDLL VHPNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+
Sbjct  180   AGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAAILLSNR  239

Query  1233  RRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNIT  1054
             R +  RAKYRL+HVVRTHKG+DDKAYRCV+E++D +GKVGI+LSKDLM IAGEALKSNIT
Sbjct  240   RSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEGKVGISLSKDLMAIAGEALKSNIT  299

Query  1053  TIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNL  874
             TIGPLVLPASEQLLFL TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNL
Sbjct  300   TIGPLVLPASEQLLFLLTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNL  359

Query  873   QLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVW  694
             QLS+EHVEASRMTLHR+GNTSSSSLWYEL YIE+KGRMKKGDRIWQIAFGSGFKCNSAVW
Sbjct  360   QLSTEHVEASRMTLHRWGNTSSSSLWYELGYIEAKGRMKKGDRIWQIAFGSGFKCNSAVW  419

Query  693   KCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             KCN+ +K P DGPW DCIDRYPVHIPE+VKL
Sbjct  420   KCNKTIKTPIDGPWADCIDRYPVHIPEVVKL  450



>ref|XP_010692961.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/489 (78%), Positives = 439/489 (90%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +SV+LKYVKLGY YLVNH L+LLLVPVMAG+ +E+LR GPEEI+  I    + L++I VL
Sbjct  4     NSVRLKYVKLGYTYLVNHFLSLLLVPVMAGILVEILRVGPEEIISLINS--LKLDVIQVL  61

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S+  ++F+ T+Y MSKPR +YLVDYA +KPP   RVPF+TFMEH+RLNLK + K+VEFQ
Sbjct  62    CSTFLIIFILTVYYMSKPRPVYLVDYALFKPPYIFRVPFATFMEHNRLNLKGDQKAVEFQ  121

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP AIHY+ P PTM+AAR EAE VIFSA+D L+KKT +K KDIDIL
Sbjct  122   MRILERSGLGEETCLPPAIHYLNPNPTMEAARNEAEMVIFSAVDDLLKKTGVKTKDIDIL  181

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAMVVNKYKLRSNIKS+NLSGMGCS   IS+DLARDLL VHPNS AL
Sbjct  182   IVNCSLFSPTPSLSAMVVNKYKLRSNIKSFNLSGMGCSCSPISVDLARDLLQVHPNSYAL  241

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             V+STEIITPNYY+G ERAMLLPNCLFRMG AA+L+SNKR++  R+KY+L+HV+RTHKG+D
Sbjct  242   VISTEIITPNYYQGKERAMLLPNCLFRMGCAAMLLSNKRKEKKRSKYQLLHVIRTHKGAD  301

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++ VY++EDP+GKVGI+L KDLM IAG+ALKSNITT+GPLVLP SEQ+LFLF+LIGR
Sbjct  302   DKAFKVVYQEEDPEGKVGISLQKDLMAIAGDALKSNITTMGPLVLPTSEQVLFLFSLIGR  361

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSS
Sbjct  362   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSS  421

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIE+KGRMKKGDR+WQIAFGSGFKCNSA+WKCNR +K P +GPW DCI RYP
Sbjct  422   SSLWYELSYIEAKGRMKKGDRVWQIAFGSGFKCNSAIWKCNRTIKAPTEGPWDDCIHRYP  481

Query  627   VHIPEIVKL  601
             V+IP++VKL
Sbjct  482   VYIPDVVKL  490



>ref|XP_006841272.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
 gb|ERN02947.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
Length=498

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/497 (77%), Positives = 441/497 (89%), Gaps = 2/497 (0%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             S    N +SSV+LKYVKLGYQYLVNH+LT LLVP+MA   +E+LR GP EI +R+ DS +
Sbjct  4     SQTTLNFQSSVRLKYVKLGYQYLVNHLLTFLLVPIMAAAAVELLRMGPGEI-LRLWDS-L  61

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
              L+L+ +L SSLF+V +ATLY  SKPR IYLVDYACYKPPVTCRVPFSTF+EHSRL    
Sbjct  62    HLDLLQILCSSLFIVLMATLYFTSKPRPIYLVDYACYKPPVTCRVPFSTFLEHSRLLPVF  121

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
             + KS+EFQ+RILERSGLGE TCLP A+HYIPP PTM  AR EAE VIFSA+D L K+T +
Sbjct  122   DSKSIEFQIRILERSGLGETTCLPPALHYIPPDPTMADARAEAELVIFSAMDTLFKRTGI  181

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KD+DILIVNCSLFSPTPSLSAMVVNKYK+RSNIKS+NLSGMGCSAG+ISIDLARDLL 
Sbjct  182   KPKDVDILIVNCSLFSPTPSLSAMVVNKYKMRSNIKSFNLSGMGCSAGVISIDLARDLLQ  241

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VH N+ A+VVSTEII+PN+Y G++R+MLLPNCLFRMGGAA+L+SN+RR+S RAKY L HV
Sbjct  242   VHANAYAVVVSTEIISPNWYAGNQRSMLLPNCLFRMGGAALLLSNRRRESRRAKYLLAHV  301

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTH+G+DD+AYRCVYE+ED Q  VGI LSKDLM IAGEALKSNITT+GPLVLPASEQLL
Sbjct  302   VRTHRGADDRAYRCVYEEEDSQHNVGIALSKDLMTIAGEALKSNITTMGPLVLPASEQLL  361

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             FL +LIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAV+DEL+KNLQLS++HVEASRMTL
Sbjct  362   FLLSLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVVDELEKNLQLSAQHVEASRMTL  421

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYE++YIESKGRMKKG+R+WQIAFGSGFKCNSA+WKCNR++K   D PW
Sbjct  422   HRFGNTSSSSLWYEMSYIESKGRMKKGNRVWQIAFGSGFKCNSAIWKCNRSIKPETDSPW  481

Query  651   LDCIDRYPVHIPEIVKL  601
              DCID+YPV IPE+VKL
Sbjct  482   ADCIDQYPVLIPEVVKL  498



>ref|XP_008802438.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=497

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/489 (77%), Positives = 433/489 (89%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVN+ LT LLVPVMA V +E++R GP+EI+   +   + L+L+ +L
Sbjct  11    SSVKLKYVKLGYQYLVNNFLTFLLVPVMATVALELVRLGPDEILALWRS--LQLDLVAIL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S   +VF A +YLMS+PR ++LVDYAC+KPP +CRVPF+TFMEH+RL   D+PKSV+FQ
Sbjct  69    SSGFLIVFAAKVYLMSRPRPVFLVDYACFKPPSSCRVPFATFMEHTRLLNLDDPKSVQFQ  128

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             +RILERSGLGEETCLP A H+IPP PTM+A+R EA+ VIFSAID L+ KT LK KDIDIL
Sbjct  129   IRILERSGLGEETCLPPANHFIPPNPTMEASRAEAQLVIFSAIDDLITKTGLKPKDIDIL  188

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VHPNSNAL
Sbjct  189   IVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNAL  248

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             V+STEIITPN+Y G++R+MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKG+D
Sbjct  249   VISTEIITPNFYSGNQRSMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGAD  308

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+AY+CVYE+ED QG  GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLLF FTL+GR
Sbjct  309   DRAYQCVYEEEDAQGHSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGR  368

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+ NPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNL LS EHVEASRMTLHRFGNTSS
Sbjct  369   KLINPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLHLSPEHVEASRMTLHRFGNTSS  428

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYELNYIESKGRM++G+R+WQI FGSGFKCNSAVWKC R +K P DGPW DCI RYP
Sbjct  429   SSLWYELNYIESKGRMRRGNRVWQIGFGSGFKCNSAVWKCIRTIKTPVDGPWADCIHRYP  488

Query  627   VHIPEIVKL  601
             V IPE+VK 
Sbjct  489   VDIPEVVKF  497



>ref|XP_010926125.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=497

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/488 (77%), Positives = 432/488 (89%), Gaps = 2/488 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLGYQYLVN+ LT LLVP MA V +E++R GP+EI+ + +   ++L+L+ +L 
Sbjct  12    SVKLKYVKLGYQYLVNNFLTFLLVPAMATVALELVRLGPDEILAKWRS--LNLDLVEILA  69

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+L +VF AT+Y MS+PR ++LVDYAC+KPP  CRVP ++FMEH RL   D+PKSV+FQ 
Sbjct  70    SALLIVFAATVYFMSRPRPVFLVDYACFKPPCYCRVPSASFMEHIRLLNLDDPKSVQFQT  129

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGEET LP A H+IPP PTM+A+R EA+ VIFSAID L++KT LK KDIDIL+
Sbjct  130   RILERSGLGEETYLPPANHFIPPNPTMEASRAEAQLVIFSAIDDLIRKTGLKPKDIDILV  189

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM+VNKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VHPNSNALV
Sbjct  190   VNCSLFSPTPSLSAMIVNKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALV  249

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             +STEIITPN+Y G +R+MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKG+DD
Sbjct  250   ISTEIITPNFYPGKQRSMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADD  309

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AY CVYE+EDPQG  GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLLF FTL+GRK
Sbjct  310   RAYLCVYEEEDPQGHSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRK  369

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + NPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSSS
Sbjct  370   LINPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSS  429

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYELNYIESKGRM++GDR+WQI FGSGFKCNSAVWKCNR +K P DGPW DCI RYPV
Sbjct  430   SLWYELNYIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCNRTIKTPVDGPWADCIHRYPV  489

Query  624   HIPEIVKL  601
              IPE+VK 
Sbjct  490   DIPEVVKF  497



>ref|XP_009390849.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/489 (77%), Positives = 435/489 (89%), Gaps = 3/489 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVN+ +TLLL+PVMA V +E++R GPEEI+   +   + L+LI +L
Sbjct  11    SSVKLKYVKLGYQYLVNNFVTLLLIPVMAAVYLELVRMGPEEIMGLWRS--LRLDLIQIL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S   ++F AT+YL S+P+ +YLVDYAC+KPP TCRVPFSTFMEH+RL +  + KSV FQ
Sbjct  69    CSFFVIIFAATVYLTSRPQPVYLVDYACFKPPTTCRVPFSTFMEHTRL-ISSDEKSVRFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP A HYIPP+PTM+A+R E + VIFSAID L++KT L+ KDIDIL
Sbjct  128   MRILERSGLGEETCLPPANHYIPPRPTMEASRAETQLVIFSAIDDLVRKTGLRPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLFSPTPSLSAM++NKYKLRSN++S+NLSGMGCSAGLIS+DLARDLL VH +SNAL
Sbjct  188   VVNCSLFSPTPSLSAMIINKYKLRSNVRSFNLSGMGCSAGLISVDLARDLLQVHRSSNAL  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEIITPN+Y G++R+MLLPNCLFRMG AAIL+SN+RRD+ RAKYRL+HVVRTHKG+D
Sbjct  248   VVSTEIITPNFYAGNQRSMLLPNCLFRMGAAAILLSNRRRDARRAKYRLVHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+AYRCVY++ED +G  GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLLF  TL+GR
Sbjct  308   DRAYRCVYQEEDAEGHSGISLSKDLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+ NPKWKPYIPDFK AFEHFCIHAGGRAVIDELQKNL+LS+EHVEASRMTLHRFGNTSS
Sbjct  368   KLINPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSAEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYELNYIESKGRM++GDR+WQI FGSGFKCNSAVWKC R +K P DGPW DCIDRYP
Sbjct  428   SSLWYELNYIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPVDGPWSDCIDRYP  487

Query  627   VHIPEIVKL  601
             V IPEIV+L
Sbjct  488   VDIPEIVRL  496



>ref|XP_010916172.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=496

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/489 (77%), Positives = 432/489 (88%), Gaps = 3/489 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVN+ LT LLVP MA + +E++R GP+EI+   +   + L+L+ +L
Sbjct  11    SSVKLKYVKLGYQYLVNNFLTFLLVPFMAVLAVELVRLGPDEIITLWRS--LHLDLVEIL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               +  +VFV+T+Y MS+PR +YLVDYAC+KPP TCRVPF+TFMEH+RL   D PKSV+FQ
Sbjct  69    CMAFLIVFVSTVYFMSRPRPVYLVDYACFKPPNTCRVPFATFMEHTRLIYSD-PKSVQFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLGEETCLP A HYIPP PTM+A+R EA+ VIFSAID L+KKT +K KDIDIL
Sbjct  128   TRILERSGLGEETCLPPANHYIPPNPTMEASRAEAQFVIFSAIDDLIKKTGVKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLFSPTPSLSAM+VNKYKLRSNI+S+NLSGMGCSAGL+SIDLARDLL VH NSNAL
Sbjct  188   VVNCSLFSPTPSLSAMIVNKYKLRSNIRSFNLSGMGCSAGLLSIDLARDLLQVHSNSNAL  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             V+STEIITPN+Y G++RAMLLPNCLFRMG AAIL+SN+ R++ RAKYRL+HVVRTHKG+D
Sbjct  248   VISTEIITPNFYSGNQRAMLLPNCLFRMGAAAILLSNRPREARRAKYRLVHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+AYRC+YE+ED +G  GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLLF FTL+GR
Sbjct  308   DRAYRCIYEEEDAEGYSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+ N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS EHVEASRMTLHRFGNTSS
Sbjct  368   KLINMKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIESKGRM++GDR+WQI FGSGFKCNSAVWKC R +K P DGPW DCI RYP
Sbjct  428   SSLWYELSYIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCIRTIKTPVDGPWADCIHRYP  487

Query  627   VHIPEIVKL  601
             VHIPE+VKL
Sbjct  488   VHIPEVVKL  496



>ref|XP_010103772.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
 gb|EXB97050.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
Length=482

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/495 (77%), Positives = 431/495 (87%), Gaps = 18/495 (4%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+N  SVKLKYVKLGYQYLVNHILTL L+P+MAG+ +EVLR GP+E++   +   +  
Sbjct  6     PDFSN--SVKLKYVKLGYQYLVNHILTLTLIPIMAGILVEVLRLGPDELLTLWRS--LHF  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
             +L+ +L S+  ++FVAT+Y MSKPR+++LVDYACYKPPVTCRVPFSTFMEHSRL LK+NP
Sbjct  62    DLVQILCSAFLIIFVATVYFMSKPRTVFLVDYACYKPPVTCRVPFSTFMEHSRLILKNNP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSVE              T              M+AARGEAE VIFSA+D+L++KT LK 
Sbjct  122   KSVEPCPPPPIHYIPPTPT--------------MEAARGEAELVIFSAMDSLLQKTGLKP  167

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDIDILIVNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAG+ISIDLARDLL VH
Sbjct  168   KDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGVISIDLARDLLQVH  227

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+V+STEIITPNYY+G+ERAMLLPNCLFRMGGAAIL+SN+R +  RAKYRL+HVVR
Sbjct  228   PNSNAVVISTEIITPNYYQGNERAMLLPNCLFRMGGAAILISNRRSERRRAKYRLVHVVR  287

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL
Sbjct  288   THKGADDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFL  347

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHR
Sbjct  348   LTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHR  407

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYE++YIE+KGRMK+GDRIWQIAFGSG KCNSAVWKCNR +K P DGPW D
Sbjct  408   FGNTSSSSLWYEMSYIEAKGRMKRGDRIWQIAFGSGLKCNSAVWKCNRTIKTPTDGPWAD  467

Query  645   CIDRYPVHIPEIVKL  601
             CIDRYPVHIPEIVKL
Sbjct  468   CIDRYPVHIPEIVKL  482



>ref|XP_009390357.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/489 (76%), Positives = 433/489 (89%), Gaps = 3/489 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSV+LKYVKLGYQ+LV++ +T L +PVM  V +E++R GP+EIV   +   + L++IH+L
Sbjct  11    SSVRLKYVKLGYQHLVDNFVTFLSIPVMVAVGLELVRRGPQEIVGLWR--ALELDVIHIL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S   ++FVAT+Y MS+PR +YLV+YAC+KPP  CRVPFSTFMEH+RL +  + KSV+FQ
Sbjct  69    CSVFVIIFVATVYFMSRPRPVYLVEYACFKPPSNCRVPFSTFMEHTRL-INSDEKSVQFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             MRILERSGLGEETCLP A HYIPP PTM+A+R EA+ VIFSAID L++KT LK KDIDIL
Sbjct  128   MRILERSGLGEETCLPPANHYIPPHPTMEASRAEAQLVIFSAIDDLIRKTGLKPKDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL VHP SNAL
Sbjct  188   VVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPGSNAL  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             V+STEIITPN+Y G++RAMLLPNCLFRMG AAIL+SN+RRD+GRAKYRL+HVVRTHKG+D
Sbjct  248   VISTEIITPNFYAGNQRAMLLPNCLFRMGAAAILLSNRRRDAGRAKYRLVHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+AYRCVYE+ED +G  GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLLF  TL+ R
Sbjct  308   DRAYRCVYEEEDAEGHTGISLSKDLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVAR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+ NPK KPYIPDFK+AFEH CIHAGGRAVIDELQKNL+LS+EHVEASRMTLHRFGNTSS
Sbjct  368   KLINPKRKPYIPDFKKAFEHLCIHAGGRAVIDELQKNLELSAEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYELNYIESKGRM++GDR+WQI FGSGFKCNSAVWKC R +K P DGPW +CI RYP
Sbjct  428   SSLWYELNYIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCMRTVKTPIDGPWSECIHRYP  487

Query  627   VHIPEIVKL  601
             VHIPE+VKL
Sbjct  488   VHIPEVVKL  496



>ref|XP_004985167.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Setaria italica]
Length=494

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/488 (76%), Positives = 431/488 (88%), Gaps = 3/488 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   + L+L+H+L 
Sbjct  10    SVNLKYVKLGYQYLVNHFLTLLLVPVMAATALELARLGPGELLTLWRS--LELDLVHILC  67

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+  +VFV T+Y+MS+PR +YLVDY+CYKPP +CRVPF+TFMEH+RL + D+ KSV FQ 
Sbjct  68    SAFLVVFVGTVYVMSRPRPVYLVDYSCYKPPASCRVPFATFMEHTRL-ISDDEKSVRFQT  126

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+TCLP A HYIPP P+M+A+R EA+ VIFSAID L+++T LK KDIDIL+
Sbjct  127   RILERSGLGEDTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILV  186

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L VHPNSNALV
Sbjct  187   VNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALV  246

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN+Y+G+ R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKG+DD
Sbjct  247   VSTEIITPNFYQGTRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADD  306

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVY++ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF F L+GRK
Sbjct  307   RAYRCVYQEEDDQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRK  366

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS+ HVEASRMTLHRFGNTSSS
Sbjct  367   LINKKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSARHVEASRMTLHRFGNTSSS  426

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R++K P +GPW DCIDRYPV
Sbjct  427   SLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIDRYPV  486

Query  624   HIPEIVKL  601
              IPE+VKL
Sbjct  487   DIPEVVKL  494



>ref|NP_001049406.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|ABF94686.1| very-long-chain fatty acid condensing enzyme, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11320.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|EAY89070.1| hypothetical protein OsI_10556 [Oryza sativa Indica Group]
 gb|EAZ26093.1| hypothetical protein OsJ_09950 [Oryza sativa Japonica Group]
 dbj|BAG90041.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96897.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/496 (76%), Positives = 431/496 (87%), Gaps = 4/496 (1%)
 Frame = -3

Query  2085  PGFNNRS-SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMS  1909
             PG    S SVKLKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   + 
Sbjct  2     PGAAGYSGSVKLKYVKLGYQYLVNHFLTLLLVPVMAATALELARMGPGELLSLWRS--LQ  59

Query  1908  LELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDN  1729
             L+L+H+L S   +VFV T+Y MS+PR +YLVDY+CYKPP +CRVPF+TFMEH+RL + D+
Sbjct  60    LDLVHILCSVFLVVFVGTVYFMSRPRPVYLVDYSCYKPPPSCRVPFATFMEHTRL-ITDD  118

Query  1728  PKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELK  1549
              KSV FQ RILERSGLGEETCLP A HYIPP P+M+A+R EA+ VIFSAID L+++T LK
Sbjct  119   EKSVRFQTRILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLK  178

Query  1548  AKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHV  1369
              KDIDIL+VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLIS+DLARD+L V
Sbjct  179   PKDIDILVVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQV  238

Query  1368  HPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVV  1189
             HPNSNALVVSTEIITPN+Y G+ R M+LPNCLFRMG AAIL+SN+RR++ RAKYRLMHVV
Sbjct  239   HPNSNALVVSTEIITPNFYWGTRRDMMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVV  298

Query  1188  RTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLF  1009
             RTHKG+DD+AYRCVYE+ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF
Sbjct  299   RTHKGADDRAYRCVYEEEDEQGHSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLF  358

Query  1008  LFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLH  829
              F L+GRK+ N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNL LS++HVEASRMTLH
Sbjct  359   FFRLVGRKLINKKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLH  418

Query  828   RFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWL  649
             RFGNTSSSSLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R +K PADGPW 
Sbjct  419   RFGNTSSSSLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPADGPWD  478

Query  648   DCIDRYPVHIPEIVKL  601
             DCI RYPV IPE+VKL
Sbjct  479   DCIHRYPVDIPEVVKL  494



>ref|XP_009777704.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=496

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/488 (77%), Positives = 430/488 (88%), Gaps = 2/488 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             S+KLKYVKLGYQYLVN+ LT LLVP MA V ++ ++ GPEEI   + +S+   + I +L 
Sbjct  11    SLKLKYVKLGYQYLVNNFLTCLLVPTMALVLVQAIQLGPEEI-FNLWNSI-QFDFIKILC  68

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             SS  ++FV+ LY M +PR +YL+DY+C KPPV+CRVPFSTFMEHSRL L   PKSVEFQM
Sbjct  69    SSFLIIFVSILYFMLRPRGVYLIDYSCDKPPVSCRVPFSTFMEHSRLILSSEPKSVEFQM  128

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGEETCLP AIHYIPP P M++AR EAE VIFSA+D+L KKT +K KDIDILI
Sbjct  129   RILERSGLGEETCLPPAIHYIPPAPNMESARKEAEMVIFSAMDSLFKKTGVKPKDIDILI  188

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAMV+NKYK+R NIKS+NLSGMGCSAGLISIDLARDLL V+P S A+V
Sbjct  189   VNCSLFSPTPSLSAMVINKYKMRDNIKSFNLSGMGCSAGLISIDLARDLLQVYPKSKAVV  248

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             V+TEIITPNYY+G +R+MLLPNCLFRMGGAAIL+SNK  D  RAKY+L+HVVRTHKG+DD
Sbjct  249   VNTEIITPNYYRGKDRSMLLPNCLFRMGGAAILLSNKWADQWRAKYKLLHVVRTHKGADD  308

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K+YRCV+E ED +GK GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLLFLF+LIGRK
Sbjct  309   KSYRCVFEVEDSEGKAGISLSKDLMAIAGEALKSNITTIGPLVLPPSEQLLFLFSLIGRK  368

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNTSSS
Sbjct  369   VFNLKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSS  428

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWY L+YIE+KGRMK+GDRIWQIAFGSGFKCNSAVWKCN+ +K  +DGPW DCI +YPV
Sbjct  429   SLWYVLSYIEAKGRMKEGDRIWQIAFGSGFKCNSAVWKCNKTIKNLSDGPWSDCIHKYPV  488

Query  624   HIPEIVKL  601
             +IPE+VKL
Sbjct  489   YIPEVVKL  496



>ref|XP_002465630.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
 gb|EER92628.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
Length=494

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/488 (76%), Positives = 428/488 (88%), Gaps = 3/488 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   + L+L+H+L 
Sbjct  10    SVNLKYVKLGYQYLVNHFLTLLLVPVMAATALELARLGPGELLSLWRS--LELDLVHILC  67

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S   +VF+ T+Y+MS+PR +YLVDYACYKPP +CRVPF+TFMEH+RL + D+ KSV FQ 
Sbjct  68    SVFLVVFIGTVYVMSRPRPVYLVDYACYKPPASCRVPFATFMEHTRL-ISDDDKSVRFQT  126

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+TCLP A HYIPP P+M+A+R EA+ VIFSAID L+++T LK KDIDIL+
Sbjct  127   RILERSGLGEDTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILV  186

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L VHPNSNALV
Sbjct  187   VNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALV  246

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN+Y+GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKG+DD
Sbjct  247   VSTEIITPNFYQGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADD  306

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVY++ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF F L+GRK
Sbjct  307   RAYRCVYQEEDDQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRK  366

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN  WKPYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  367   LFNKAWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSS  426

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R++K P +GPW DCI RYPV
Sbjct  427   SLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYPV  486

Query  624   HIPEIVKL  601
              +PE+VKL
Sbjct  487   DVPEVVKL  494



>ref|XP_006651174.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=526

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/488 (76%), Positives = 427/488 (88%), Gaps = 3/488 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   + L+L+H+L 
Sbjct  42    SVKLKYVKLGYQYLVNHFLTLLLVPVMAATALELARMGPGELLSLWRS--LQLDLVHILC  99

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+  +VFV T+Y MS+PR +YLVDY+CYKPP +CRVPF+TFMEH+RL + D+ KSV FQ 
Sbjct  100   SAFLVVFVGTVYFMSRPRPVYLVDYSCYKPPPSCRVPFATFMEHTRL-ITDDEKSVRFQT  158

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGEETCLP A HYIPP P+M+A+R EA+ VIFSAID L+++T LK KDIDIL+
Sbjct  159   RILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILV  218

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLIS+DLARD+L VHPNSNALV
Sbjct  219   VNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALV  278

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN+Y G+ R M+LPNCLFRMG AAIL+SN+RR++ RAKYRLMHVVRTHKG+DD
Sbjct  279   VSTEIITPNFYWGTRRDMMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVVRTHKGADD  338

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVYE+ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF F L+GRK
Sbjct  339   RAYRCVYEEEDEQGHSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRK  398

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNL LS++HVEASRMTLHRFGNTSSS
Sbjct  399   LINKKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLHRFGNTSSS  458

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R +K P  GPW DCI RYPV
Sbjct  459   SLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKAPTGGPWDDCIHRYPV  518

Query  624   HIPEIVKL  601
              IPE+VKL
Sbjct  519   DIPEVVKL  526



>ref|NP_001130497.1| uncharacterized protein LOC100191595 [Zea mays]
 gb|ACF78737.1| unknown [Zea mays]
Length=494

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/488 (76%), Positives = 428/488 (88%), Gaps = 3/488 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LK+VKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   + L+L+H+L 
Sbjct  10    SVNLKHVKLGYQYLVNHFLTLLLVPVMAATALELARLGPGELLSLWRS--LELDLVHILC  67

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+  +VFV T+Y+MS+PR +YLVDYACYKPP +CRVPF+TFMEH+RL + D+ KSV FQ 
Sbjct  68    SAFLVVFVGTVYVMSRPRPVYLVDYACYKPPASCRVPFATFMEHTRL-ISDDDKSVRFQT  126

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+TCLP A HYIPP P+M+A+R EA+ VIFSAID L+++T LK KDIDIL+
Sbjct  127   RILERSGLGEDTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILV  186

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L VHPNSNALV
Sbjct  187   VNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALV  246

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN+Y+GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKGSDD
Sbjct  247   VSTEIITPNFYQGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGSDD  306

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVYE+ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF F L+GRK
Sbjct  307   RAYRCVYEEEDEQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRK  366

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + N  W+PYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  367   LVNKGWRPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSS  426

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R++K P +GPW DCI RYPV
Sbjct  427   SLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYPV  486

Query  624   HIPEIVKL  601
              +PE+VKL
Sbjct  487   DVPEVVKL  494



>ref|XP_008668455.1| PREDICTED: uncharacterized protein LOC100191595 isoform X1 [Zea 
mays]
 gb|ACF87925.1| unknown [Zea mays]
 gb|ACN34702.1| unknown [Zea mays]
 tpg|DAA44124.1| TPA: hypothetical protein ZEAMMB73_292233 [Zea mays]
Length=494

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/488 (75%), Positives = 428/488 (88%), Gaps = 3/488 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LK+VKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   + L+L+H+L 
Sbjct  10    SVNLKHVKLGYQYLVNHFLTLLLVPVMAATALELARLGPGELLSLWRS--LELDLVHILC  67

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+  +VFV T+Y+MS+PR +YLVDYACYKPP +CRVPF+TFMEH+RL + D+ KSV FQ 
Sbjct  68    SAFLVVFVGTVYVMSRPRPVYLVDYACYKPPASCRVPFATFMEHTRL-ISDDDKSVRFQT  126

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+TCLP A HYIPP P+M+A+R EA+ VIFSAID L+++T LK KDIDIL+
Sbjct  127   RILERSGLGEDTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILV  186

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L VHPNSNALV
Sbjct  187   VNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALV  246

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN+Y+GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKG+DD
Sbjct  247   VSTEIITPNFYQGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADD  306

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVYE+ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF F L+GRK
Sbjct  307   RAYRCVYEEEDEQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRK  366

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + N  W+PYIPDFK AFEHFCIHAGGRAVIDELQKNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  367   LVNKGWRPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSS  426

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R++K P +GPW DCI RYPV
Sbjct  427   SLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYPV  486

Query  624   HIPEIVKL  601
              +PE+VKL
Sbjct  487   DVPEVVKL  494



>ref|XP_008775195.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 6-like 
[Phoenix dactylifera]
Length=496

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/497 (75%), Positives = 430/497 (87%), Gaps = 3/497 (1%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             ++P  +  SSVKLKYVKLGYQYLVN+ LT LLVP MA + +E++R GP+E++   +   +
Sbjct  3     AAPMTDFSSSVKLKYVKLGYQYLVNNFLTFLLVPFMATMAVELVRRGPDEVIGLWRS--L  60

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
              L+L+ +L  +  +VF AT+Y MS+PR +YLVDYAC+KPP +CRVP +TFMEH+RL +  
Sbjct  61    HLDLVEILCLAFLIVFAATVYFMSRPRPVYLVDYACFKPPNSCRVPXATFMEHTRL-INS  119

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
             +PKSV FQ RILERSGLGEETCLP A HYIPP PTM+A+R EA  VIFSAID L+KKT L
Sbjct  120   DPKSVRFQTRILERSGLGEETCLPPANHYIPPNPTMEASRAEARLVIFSAIDDLIKKTGL  179

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KDIDIL+VNCSLFSPTPSLSAM+VNKYKLRSNI+S+NLSGMGCSAGLISIDLARDLL 
Sbjct  180   KPKDIDILVVNCSLFSPTPSLSAMIVNKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQ  239

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VHPNSNALVVSTEIITPN+Y G++ +MLLPNCLFRMG AAIL+SN+ R++ RAKYRL+HV
Sbjct  240   VHPNSNALVVSTEIITPNFYSGNQPSMLLPNCLFRMGAAAILLSNRPREARRAKYRLVHV  299

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTHKG+DD+AY CVYE+ED +G  GI+LSKDLM IAGEALKSNITTIGPLVLP SEQLL
Sbjct  300   VRTHKGADDRAYFCVYEEEDAEGHSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLL  359

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             F FTL+GRK+ N KWKPYIPDFK AFEHFCIHAGGRAVIDELQK+LQLS EHVEASRMTL
Sbjct  360   FFFTLVGRKLINSKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKSLQLSPEHVEASRMTL  419

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYELNYIESKGRM++GDR+WQI FGSGFKCNSAVWKC R +K P DGPW
Sbjct  420   HRFGNTSSSSLWYELNYIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCIRTIKTPVDGPW  479

Query  651   LDCIDRYPVHIPEIVKL  601
              DCI  YPV IPE+V+L
Sbjct  480   FDCIHHYPVPIPEVVQL  496



>ref|XP_009605061.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=530

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/520 (74%), Positives = 432/520 (83%), Gaps = 32/520 (6%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEI-----------VMRIKDS  1918
             S+KLKYVKLGYQYLVN+ LT LLVP M     +V++ GPEEI           +  +  S
Sbjct  11    SLKLKYVKLGYQYLVNNFLTCLLVPTMPFFLAQVIQLGPEEIFNHWNSLQHDFIKTLYSS  70

Query  1917  VMSLEL---------------------IHVLFSSLFLVFVATLYLMSKPRSIYLVDYACY  1801
              +SL                       I VL+SS  ++F + LY MS+PR +YL+DY+CY
Sbjct  71    FVSLSYGRDKVCAHSTLPIPHLWDYTGIVVLYSSFLIIFASILYFMSRPRGVYLIDYSCY  130

Query  1800  KPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMD  1621
             KPPV+CRVPFSTFMEHSRL L   PKSVEFQMRILERSGLGEETCLP AIHYIPP P M+
Sbjct  131   KPPVSCRVPFSTFMEHSRLILSSEPKSVEFQMRILERSGLGEETCLPPAIHYIPPAPNME  190

Query  1620  AARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKS  1441
             +AR EAE VIFSA+D+L KKT +K KDIDILIVNCSLFSPTPSLSAMV+NKYK+R NIKS
Sbjct  191   SARKEAEMVIFSAMDSLFKKTRVKPKDIDILIVNCSLFSPTPSLSAMVINKYKMRDNIKS  250

Query  1440  YNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMG  1261
             +NLSGMGCSAGLISIDLARDLL V+P SNA+VVSTEIITPNYY+G +R+MLLPNCLFRMG
Sbjct  251   FNLSGMGCSAGLISIDLARDLLQVYPKSNAVVVSTEIITPNYYRGKDRSMLLPNCLFRMG  310

Query  1260  GAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIA  1081
             GAAIL+SNK  D  RAKY+L+HVVRTHKGSDDK+Y CV+E ED +GK GI+LSKDLM IA
Sbjct  311   GAAILLSNKWADQWRAKYKLLHVVRTHKGSDDKSYSCVFEVEDSEGKAGISLSKDLMAIA  370

Query  1080  GEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRA  901
             GEALKSNITTIGPLVLP SEQLLFLF+LIGRK+FN K KPYIPDFKQAFEHFCIHAGGRA
Sbjct  371   GEALKSNITTIGPLVLPPSEQLLFLFSLIGRKVFNLKLKPYIPDFKQAFEHFCIHAGGRA  430

Query  900   VIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGS  721
             VIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYEL+YIE++GR+KKGDRIWQIAFGS
Sbjct  431   VIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELSYIEAEGRIKKGDRIWQIAFGS  490

Query  720   GFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             GFKCNSAVWKCN+ +K  +DGPW DCI +YPV+IPE+VKL
Sbjct  491   GFKCNSAVWKCNKTIKNLSDGPWSDCIHKYPVYIPEVVKL  530



>ref|XP_003558474.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
Length=497

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/498 (74%), Positives = 432/498 (87%), Gaps = 4/498 (1%)
 Frame = -3

Query  2091  SSPGFNNRS-SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             S+PG  + S SVKLKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP EI+   +   
Sbjct  3     SAPGSGSFSGSVKLKYVKLGYQYLVNHFLTLLLVPVMAATALELARLGPGEILTLWRS--  60

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             + L+L+H+L S+  +VFV T+Y+MS+PR +YLVDY CYKP  + RVPF+TFMEH +L + 
Sbjct  61    LDLDLVHILCSAFLVVFVGTVYVMSRPRPVYLVDYCCYKPSPSFRVPFTTFMEHIKL-IA  119

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             +N KS+ FQ RILERSGLGEETCLP A HYIPP P+M+A+R EA+ VIF+AID L+++T 
Sbjct  120   NNEKSLRFQTRILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTG  179

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK KDIDIL+VNCSLFSPTPSLSAM++N+YKLRSNI+S+NLSGMGCSAGLIS+DLARD+L
Sbjct  180   LKPKDIDILVVNCSLFSPTPSLSAMIINRYKLRSNIRSFNLSGMGCSAGLISLDLARDML  239

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNALV+STEIITPN+YKGS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+H
Sbjct  240   QVHPNSNALVISTEIITPNFYKGSRRDMLLPNCLFRMGAAAILLSNRRREAKRAKYRLLH  299

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTHKG+DD+AYRCVYE+ED +G  GI+LSK+LM IAGEALKSNITT+GPLVLP SEQL
Sbjct  300   VVRTHKGADDRAYRCVYEEEDDEGHSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQL  359

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LF F L+GRK+ N +WKPYIPDFK AFEHFCIHAGGRAVIDELQKNL+LSS HVEASRMT
Sbjct  360   LFFFRLVGRKVINKRWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSSRHVEASRMT  419

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R +K P DGP
Sbjct  420   LHRFGNTSSSSLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGP  479

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCI RYPV +PE+VKL
Sbjct  480   WDDCIHRYPVEVPEVVKL  497



>gb|EMT20723.1| 3-ketoacyl-CoA synthase 6 [Aegilops tauschii]
Length=496

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/497 (74%), Positives = 428/497 (86%), Gaps = 3/497 (1%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             S+ G     SV+LKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP E++   +   +
Sbjct  3     SALGSGFAGSVRLKYVKLGYQYLVNHFLTLLLVPVMAATALELARLGPGELLALWR--AL  60

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
              L+L+H+L S+  +VFVAT+Y MS+PR ++LVDY CYKP  + RVPF+TFMEH +L + +
Sbjct  61    DLDLVHILCSAFLVVFVATVYFMSRPRPVFLVDYCCYKPSPSFRVPFTTFMEHIKL-ISN  119

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
             N KS+ FQ RILERSGLGEETCLP A HYIPP P+M+A+R EA+ VIF+AID L+++T L
Sbjct  120   NDKSLRFQTRILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGL  179

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KDIDIL+VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L 
Sbjct  180   KPKDIDILVVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQ  239

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VHPNSNALV+STEIITPN+Y GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HV
Sbjct  240   VHPNSNALVISTEIITPNFYHGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHV  299

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTHKG+DD+AYRCVYE+ED +G  GI+LSK+LM IAGEALKSNITT+GPLVLP SEQLL
Sbjct  300   VRTHKGADDRAYRCVYEEEDDEGHSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLL  359

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             F F L+GRK+ N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNL+LS  HVEASRMTL
Sbjct  360   FFFRLVGRKVINSKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSPRHVEASRMTL  419

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYEL YIE+KGRM+KGDR+WQI FGSGFKCNSAVWKC R +K P DGPW
Sbjct  420   HRFGNTSSSSLWYELAYIEAKGRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGPW  479

Query  651   LDCIDRYPVHIPEIVKL  601
              DCI RYPVHIPE+VKL
Sbjct  480   DDCIQRYPVHIPEVVKL  496



>gb|ABG35744.1| putative very long chain fatty acid condensing enzyme CUT1;3 
[Hordeum vulgare]
Length=501

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/497 (74%), Positives = 428/497 (86%), Gaps = 3/497 (1%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             S+ G     SVKLKYVKLGYQYLVNH LTLLLVPVMA   +E+ R GP+E++   +   +
Sbjct  8     SALGSGLAGSVKLKYVKLGYQYLVNHFLTLLLVPVMAATALELARLGPDELLTLWRS--L  65

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
              L+L+H+L S+  +VFVAT+Y MS+PR ++LVDY CYKP  + RVPF+TFMEH +L + +
Sbjct  66    HLDLVHILCSAFLVVFVATVYFMSRPRPVFLVDYCCYKPSPSFRVPFTTFMEHIKL-ISN  124

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
             N KS+ FQ RILERSGLGEETCLP A HYIPP P+M+A+R EA+ VIF+AID L+++T +
Sbjct  125   NDKSLRFQTRILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGI  184

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KDIDIL+VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L 
Sbjct  185   KPKDIDILVVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQ  244

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VHPNSNALV+STEIITPN+Y GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HV
Sbjct  245   VHPNSNALVISTEIITPNFYHGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHV  304

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTHKG+DD+AYRCVYE+ED +G  GI+LSK+LM IAGEALKSNITT+GPLVLP SEQLL
Sbjct  305   VRTHKGADDRAYRCVYEEEDDEGHSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLL  364

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             F F L+GRK+ N KWKPYIPDFK AFEHFCIHAGGRAVIDELQKNL+LS  HVEASRMTL
Sbjct  365   FFFRLVGRKVINKKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSPRHVEASRMTL  424

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYEL YIE+KGRM+KGDR+WQI FGSGFKCNSAVWKC R +  P DGPW
Sbjct  425   HRFGNTSSSSLWYELAYIEAKGRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVNTPTDGPW  484

Query  651   LDCIDRYPVHIPEIVKL  601
              DCI RYPVHIPE+VKL
Sbjct  485   DDCIQRYPVHIPEVVKL  501



>ref|XP_006344141.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=493

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/491 (76%), Positives = 425/491 (87%), Gaps = 3/491 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SVKLK  KLGYQY+VNH LT LL+P+MA V ++ ++ GPEEI   + +S+   +    
Sbjct  5     QRSVKLKCAKLGYQYVVNHFLTCLLLPIMAMVFVQAIQLGPEEI-SNLWNSI-QFDYTKT  62

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             + SS  ++ V+ LY MS+PR +YLVDYACYKPP++ RVPFS FMEHSR+ L   PKSVEF
Sbjct  63    VCSSFVVILVSILYFMSRPRGVYLVDYACYKPPLSLRVPFSIFMEHSRIILSSEPKSVEF  122

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q++ILERSGLGE+TCLP AIHYIPP P+MD AR EAE VIFS +D+L KKT++K KDID 
Sbjct  123   QLKILERSGLGEDTCLPPAIHYIPPAPSMDTAREEAEMVIFSVMDSLFKKTQVKPKDIDF  182

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             LIVNCSLFSPTPSLSAMVVNKYK+R NIKSYNLSGMGCSAGLISIDLARDLL VHP S A
Sbjct  183   LIVNCSLFSPTPSLSAMVVNKYKMRDNIKSYNLSGMGCSAGLISIDLARDLLQVHPKSIA  242

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKR-RDSGRAKYRLMHVVRTHKG  1174
             +VVSTEIITPNYY+G +R+MLLPNCLFRMGGAAIL+SNK   D  RAKY+L+H VRTHKG
Sbjct  243   VVVSTEIITPNYYRGKDRSMLLPNCLFRMGGAAILLSNKWWADQRRAKYKLLHTVRTHKG  302

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             S+DK+Y CV+E ED +GK GI+LSKDLM IAGEALKSNIT++GPLVLP SEQLLFL +LI
Sbjct  303   SNDKSYNCVFETEDSEGKTGISLSKDLMAIAGEALKSNITSLGPLVLPPSEQLLFLLSLI  362

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
             GRK+FN K KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNT
Sbjct  363   GRKVFNTKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNT  422

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSSLWYEL+YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCN+ +K P+DGPW DCI +
Sbjct  423   SSSSLWYELSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPSDGPWSDCIHK  482

Query  633   YPVHIPEIVKL  601
             YPV+IPEIVKL
Sbjct  483   YPVYIPEIVKL  493



>gb|ABY82171.2| 3-ketoacyl-CoA synthase I [Triticum aestivum]
Length=496

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/497 (74%), Positives = 426/497 (86%), Gaps = 3/497 (1%)
 Frame = -3

Query  2091  SSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVM  1912
             S+ G     SVKLKYVKLGYQYLVNH LTLLLVPVMA   IE+ R GP E++   +   +
Sbjct  3     SALGSGFAGSVKLKYVKLGYQYLVNHFLTLLLVPVMAATAIELARLGPGELLTLWRS--L  60

Query  1911  SLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKD  1732
              L+L+H+L S+  +VFVAT+Y MS+PR ++LVDY CYKP  + RVPF+TFMEH +L + +
Sbjct  61    DLDLVHILCSAFLVVFVATVYFMSRPRPVFLVDYCCYKPSPSFRVPFTTFMEHIKL-ISN  119

Query  1731  NPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTEL  1552
             N KS+ FQ RILERSGLGEETCLP A HYIPP P+M+A+R EA+ VIF+AID L+++T L
Sbjct  120   NDKSLRFQTRILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGL  179

Query  1551  KAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLH  1372
             K KDIDIL+VNCSLFSPTPSLSAM++NKYKLRSNI+S+NLSGMGCSAGLISIDLARD+L 
Sbjct  180   KPKDIDILVVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQ  239

Query  1371  VHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHV  1192
             VHPNSNALV+STEIITPN+Y GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HV
Sbjct  240   VHPNSNALVISTEIITPNFYHGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHV  299

Query  1191  VRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLL  1012
             VRTHKG+DD+AYRCVYE+ED +G  GI+LSK+LM IAGEALKSNITT+GPLVLP SEQLL
Sbjct  300   VRTHKGADDRAYRCVYEEEDDEGHSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLL  359

Query  1011  FLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTL  832
             F F L+GRK+ N KWKPYIPDFK AFEHFCI AGGRAVIDEL KNL+LS  HVEASRMTL
Sbjct  360   FFFRLVGRKVINNKWKPYIPDFKLAFEHFCIRAGGRAVIDELHKNLELSPRHVEASRMTL  419

Query  831   HRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPW  652
             HRFGNTSSSSLWYEL YIE+KGRM+KGDR+WQI FGSGFKCNSAVWKC R +K P DGPW
Sbjct  420   HRFGNTSSSSLWYELAYIEAKGRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGPW  479

Query  651   LDCIDRYPVHIPEIVKL  601
              DCI RYPVHIPE+VKL
Sbjct  480   DDCIQRYPVHIPEVVKL  496



>gb|AHX25585.1| 3-ketoacyl-CoA synthase 6 [Nicotiana tabacum]
Length=497

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/502 (75%), Positives = 430/502 (86%), Gaps = 6/502 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M + SSP ++   S+K KY KLGYQY+VN+ILT LL+P M  + I +L+  P E++    
Sbjct  1     MPKISSPKYSQ--SMKQKYAKLGYQYIVNNILTFLLLPFMLTILILILQLSPNEVLSFYN  58

Query  1923  D-SVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSR  1747
               S  SL  I  LF    +++V+T Y MS+PR+IYLVDYAC++PP   R P ++F+EH++
Sbjct  59    SISFTSLPSICSLF---VIIYVSTYYFMSRPRTIYLVDYACFRPPNMFRAPSASFVEHAQ  115

Query  1746  LNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALM  1567
             L L   PKSV FQM++LERSGLGEET LP AIHYIPP PTM  AR EAE VIFS +D+L+
Sbjct  116   LILPTEPKSVRFQMKMLERSGLGEETALPPAIHYIPPTPTMVLAREEAELVIFSIMDSLL  175

Query  1566  KKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLA  1387
             +KT L  K IDILIVNCSLFSPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLISIDLA
Sbjct  176   EKTRLNPKFIDILIVNCSLFSPTPSLSAMLINKYKLRSNIKSFNLSGMGCSAGLISIDLA  235

Query  1386  RDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKY  1207
             RDLL  +PNSNA+V+STEIITPN Y G ER+MLLPNCLFRMGGAAIL+SNKR+DS RAKY
Sbjct  236   RDLLQHYPNSNAVVISTEIITPNSYLGKERSMLLPNCLFRMGGAAILLSNKRKDSSRAKY  295

Query  1206  RLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPA  1027
             RLMHVVRTHKG+DDKAYRCV+EQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPA
Sbjct  296   RLMHVVRTHKGADDKAYRCVFEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPA  355

Query  1026  SEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEA  847
             SEQLLFLFTLIGRKIFNPKWK YIPDFKQAFEHFCIHAGGRAVIDEL+KNLQLS EHVEA
Sbjct  356   SEQLLFLFTLIGRKIFNPKWKAYIPDFKQAFEHFCIHAGGRAVIDELRKNLQLSDEHVEA  415

Query  846   SRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKP  667
             SRMTLHRFGNTSSSSLWYE++ +E+KGRM+KGDR+WQIAFGSGFKCNSAVWKCNR +K  
Sbjct  416   SRMTLHRFGNTSSSSLWYEMSCMEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRTIKTG  475

Query  666   ADGPWLDCIDRYPVHIPEIVKL  601
              DGPW DCIDRYPV IP+IVKL
Sbjct  476   TDGPWEDCIDRYPVFIPKIVKL  497



>gb|AIV98044.1| 3-ketoacyl-CoA synthase, partial [Malus domestica]
Length=415

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/415 (87%), Positives = 391/415 (94%), Gaps = 0/415 (0%)
 Frame = -3

Query  1845  MSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETC  1666
             MSKPR IYLVDYAC+KPPV CRVPFSTFMEHSRL L +NPKSVEFQMRILERSGLGEETC
Sbjct  1     MSKPRPIYLVDYACFKPPVMCRVPFSTFMEHSRLILSNNPKSVEFQMRILERSGLGEETC  60

Query  1665  LPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLS  1486
             LP AIHYIPP PTM+AARGEAE VIFSA+D+L +KT LK KDIDILIVNCSLFSPTPSLS
Sbjct  61    LPPAIHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLS  120

Query  1485  AMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKG  1306
             AMV+NKYKLRSNIKS+NLSGMGCSAGLISIDLARDLL VHPNSNA+VVSTEIITPNYY+G
Sbjct  121   AMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQG  180

Query  1305  SERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQ  1126
             +ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+HVVRTHKG+DDKAY+CV+E+ED +
Sbjct  181   NERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKE  240

Query  1125  GKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDF  946
             GKVGI+LSKDLM IAGEALKSNITTIGPLVLPASEQLLFL TLIGRKI NPKWKPYIPDF
Sbjct  241   GKVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLITLIGRKILNPKWKPYIPDF  300

Query  945   KQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKG  766
             +QAFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMTLHRFGNTSSSSLWYEL YIE+KG
Sbjct  301   RQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELGYIEAKG  360

Query  765   RMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             RM+KGDR+WQIAFGSGFKCNSAVWKCNR +K  +DGPW DCIDRYPVHIPE+VKL
Sbjct  361   RMRKGDRVWQIAFGSGFKCNSAVWKCNRAIKTASDGPWADCIDRYPVHIPEVVKL  415



>ref|XP_004238923.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=494

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/491 (75%), Positives = 423/491 (86%), Gaps = 2/491 (0%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             ++SVKLK  KLGYQY+VNH LT LL+P+MA V ++ ++  PE+I     +S+   +    
Sbjct  5     QTSVKLKCAKLGYQYVVNHFLTCLLLPIMAMVFVQAIQLSPEKISNLWNNSI-QFDFTKT  63

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             + SS+ ++ V+ LY MS+PR +YLVDYACYKPP++ RV FS FMEHSR+ L   PKSVEF
Sbjct  64    VCSSVVVILVSILYFMSRPRGVYLVDYACYKPPLSLRVSFSIFMEHSRIILSSEPKSVEF  123

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q++ILERS LGE+TCLP AIHYIPP P++D AR EA+ VIFS +D+L KKTELK KDIDI
Sbjct  124   QLKILERSCLGEDTCLPPAIHYIPPAPSLDTAREEAQMVIFSVMDSLFKKTELKPKDIDI  183

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             LIVNCSLFSPTPSLSAMVVNKYK+R N+KSYNLSGMGCSAGLISIDLARDLL VHP S A
Sbjct  184   LIVNCSLFSPTPSLSAMVVNKYKMRDNVKSYNLSGMGCSAGLISIDLARDLLRVHPKSIA  243

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRR-DSGRAKYRLMHVVRTHKG  1174
             +VVSTEIITPNYY+G +R+MLLPNCLFRMGGAAIL+SNK   D  RAKY+L+H VRTHKG
Sbjct  244   VVVSTEIITPNYYRGKDRSMLLPNCLFRMGGAAILLSNKWWIDLRRAKYKLLHTVRTHKG  303

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             S+DK+Y CVYE ED +GK GI+LSKDLM IAGEALKSNIT++GPLVLP SEQLLFL +LI
Sbjct  304   SNDKSYNCVYETEDSEGKTGISLSKDLMAIAGEALKSNITSLGPLVLPPSEQLLFLLSLI  363

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
             GRK+FN K KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EHVEASRMTLHRFGNT
Sbjct  364   GRKVFNTKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNT  423

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSSLWYEL+YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCN+ ++ P DGPW DCI +
Sbjct  424   SSSSLWYELSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIETPTDGPWSDCIHK  483

Query  633   YPVHIPEIVKL  601
             YPV+IPEIVKL
Sbjct  484   YPVYIPEIVKL  494



>ref|XP_011076851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/495 (74%), Positives = 424/495 (86%), Gaps = 4/495 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F+   SVKLKYVKLGYQYLVNH L  LL+P+M  ++I+ L   PEEI +++ +S M L
Sbjct  6     PDFSQ--SVKLKYVKLGYQYLVNHFLIFLLIPIMLALSIQALNTSPEEI-LQLWNS-MHL  61

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+H++ S   +++  T + MS+PR++YLVDYA +KPP + RV F+ FMEH++L L   P
Sbjct  62    TLVHIICSLFLVIYSLTFFFMSRPRTVYLVDYALFKPPRSLRVSFAGFMEHAKLALFTEP  121

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
             KSV FQM+ILERSGLGEETCLP AIHYIPP P M  AR EAE VIFS +D+L +KT LK 
Sbjct  122   KSVHFQMKILERSGLGEETCLPPAIHYIPPSPNMAHAREEAEFVIFSCMDSLFQKTGLKP  181

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KD+DILI+NCSLFSPTPSL+AMV+NKYK+RSNIKS+NLSGMGCSAGLISIDLA+DLL  H
Sbjct  182   KDVDILILNCSLFSPTPSLTAMVINKYKMRSNIKSFNLSGMGCSAGLISIDLAKDLLQYH  241

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
             PNSNA+V+STEI+TPN Y G ERAMLLPNCLFRMGGAAIL+SN+R D  RAKYRL HVVR
Sbjct  242   PNSNAVVISTEILTPNIYLGKERAMLLPNCLFRMGGAAILLSNRRADRRRAKYRLAHVVR  301

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDK+YRC+ ++EDP+G VGI L+ DLM IAGEALKSNITTIGPLVLPASEQ+LF 
Sbjct  302   THKGADDKSYRCISQEEDPEGHVGIKLNIDLMAIAGEALKSNITTIGPLVLPASEQILFA  361

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              +LIGRKIFN K KPYIPDFKQAFEHFCIHAGGRAVIDELQK+LQL+ E VEASRMTLHR
Sbjct  362   LSLIGRKIFNSKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLTEEQVEASRMTLHR  421

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSSLWYEL+YIESKGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P +GPW D
Sbjct  422   FGNTSSSSLWYELSYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPVEGPWAD  481

Query  645   CIDRYPVHIPEIVKL  601
             CID+YPV+IPE+VKL
Sbjct  482   CIDKYPVYIPEVVKL  496



>ref|XP_009414779.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/483 (74%), Positives = 418/483 (87%), Gaps = 3/483 (1%)
 Frame = -3

Query  2049  YVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFL  1870
             + K GY+++VN+ +TL LV  M  V  E+L+ GP++I+   +   +  + I  L +   +
Sbjct  12    WAKFGYRFIVNNFVTLFLVGSMTAVGWELLQLGPDDIMALWRS--LQEKPIETLSAVFLV  69

Query  1869  VFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILER  1690
              FVA LY MS+PR +YLVDYAC+KPP TCRVPF+TFMEH+RL +  + KSV+FQ RILER
Sbjct  70    SFVAALYFMSRPRPVYLVDYACFKPPSTCRVPFATFMEHTRL-INSDKKSVQFQTRILER  128

Query  1689  SGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSL  1510
             SGLGEETCLP A HYIPP PTM+A+R EA+ VIFSAID LMKKT L+ KDID+L+VNCSL
Sbjct  129   SGLGEETCLPPANHYIPPNPTMEASRAEAQLVIFSAIDDLMKKTGLRPKDIDVLVVNCSL  188

Query  1509  FSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEI  1330
             FSPTPSLSAM++NKYKLRSN++S+NLSGMGCSAGLISIDLARDLL VHP +NALVVSTEI
Sbjct  189   FSPTPSLSAMIINKYKLRSNVRSFNLSGMGCSAGLISIDLARDLLLVHPRANALVVSTEI  248

Query  1329  ITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRC  1150
             ITPN+Y G++R+MLLPNCLFRMG AAIL+SN+RR++GRAKYRL HVVRTHKG+DD+AYRC
Sbjct  249   ITPNFYAGNQRSMLLPNCLFRMGAAAILLSNRRREAGRAKYRLAHVVRTHKGADDRAYRC  308

Query  1149  VYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPK  970
             VYE+ED +G  GI+LSKDLM IAGEALKSNITT+GPLVLP SEQLLF   L+GRK+ NP+
Sbjct  309   VYEEEDAEGHSGISLSKDLMAIAGEALKSNITTMGPLVLPMSEQLLFALNLVGRKLINPE  368

Query  969   WKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYE  790
             WKPYIPDFKQAF+HFCIHAGGRAVIDELQK+LQLS+EHVEASRMTLHRFGNTSSSSLWYE
Sbjct  369   WKPYIPDFKQAFDHFCIHAGGRAVIDELQKSLQLSAEHVEASRMTLHRFGNTSSSSLWYE  428

Query  789   LNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEI  610
             LNYIESKGRM++G+R+WQI FGSGFKCNSAVWKC R +K P DGPW DCIDRYPV IPEI
Sbjct  429   LNYIESKGRMRRGNRVWQIGFGSGFKCNSAVWKCLRTIKGPVDGPWTDCIDRYPVDIPEI  488

Query  609   VKL  601
             VKL
Sbjct  489   VKL  491



>ref|XP_002271250.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=492

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/489 (73%), Positives = 420/489 (86%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +SVKLKY+KLGYQYLVNHILT  L+P++ G  I++L  GP++I      S +  +L+  L
Sbjct  6     NSVKLKYIKLGYQYLVNHILTFFLIPILMGFLIKILSLGPDQIYE--IGSSLHFDLLQFL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SSL ++F+AT+Y MSKPRS+YLVDYAC+KPP + RVP +T ++H RL+ KDNP+ VEFQ
Sbjct  64    GSSLMIIFLATVYFMSKPRSVYLVDYACFKPPASYRVPHATLVKHLRLSNKDNPEIVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RIL+RSGLG+ETCL  A  YIPP P+++A+R EAE ++FS ID L+KKT  K KDIDIL
Sbjct  124   RRILQRSGLGDETCLAPANLYIPPTPSLEASRAEAELILFSVIDDLLKKTGTKTKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCS+ SPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSA LISIDLAR+LL VHPNS A+
Sbjct  184   IVNCSIVSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSASLISIDLARELLQVHPNSCAI  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEI TPNYY G+ER+M+L NCLFRMGGAAIL+SNK+ D  R+KY+L+H+VRTHKG+D
Sbjct  244   VVSTEITTPNYYSGNERSMVLINCLFRMGGAAILLSNKKADRSRSKYQLLHLVRTHKGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAYRC++EQED QG  G++LSKDLM+IAGEALKSNITTIGPLVLPASEQL FLFTLIG+
Sbjct  304   DKAYRCIHEQEDTQGIQGVSLSKDLMLIAGEALKSNITTIGPLVLPASEQLNFLFTLIGQ  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI   KWKPYIPDFKQAFEHFCIHAGGR VIDELQK LQLS++ VEASRMTLHRFGNTSS
Sbjct  364   KILKLKWKPYIPDFKQAFEHFCIHAGGRGVIDELQKKLQLSAKDVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYE+NYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +  P DGPWLDCI RYP
Sbjct  424   SSIWYEMNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTITTPTDGPWLDCIGRYP  483

Query  627   VHIPEIVKL  601
             V I +++ L
Sbjct  484   VSISQVLDL  492



>ref|XP_009380079.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/488 (74%), Positives = 422/488 (86%), Gaps = 3/488 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSV+LKYVKLGYQ LVN+ +  LL+PVM  V + ++R GP+EI M +  S + L+L  VL
Sbjct  11    SSVRLKYVKLGYQCLVNNFVAFLLIPVMIAVPLVLVRRGPDEI-MALWHS-LQLDLTQVL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
             FS   LVFVA +Y +S+PR +YLVDYAC+KPP TCRVP +TFMEH+ L +  + KSV+FQ
Sbjct  69    FSVFLLVFVAAVYFVSRPRPVYLVDYACFKPPTTCRVPSATFMEHAWL-INWDEKSVQFQ  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLGEETCLP A HYIPP PTM+AAR EA+ VIFSAID L KKT L+ K+IDIL
Sbjct  128   TRILERSGLGEETCLPPASHYIPPNPTMEAARAEAQLVIFSAIDDLFKKTGLRPKNIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLFSPTPSLS+M++NKY+LRSNI+S+NLSGMGCSAGLISIDLARDLL VHP SNAL
Sbjct  188   VVNCSLFSPTPSLSSMIINKYELRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPRSNAL  247

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             V+STEIITPN Y G++R+MLLPNCLFRMG AAIL+SN+RRD+ RAKYRL+HVVRTHKG+D
Sbjct  248   VISTEIITPNSYTGNQRSMLLPNCLFRMGAAAILLSNRRRDARRAKYRLLHVVRTHKGAD  307

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+AYRCVY++ED +G  GI+LSK+LM IAGEALKSNITTIGPLVLP SEQLLF  TL+GR
Sbjct  308   DRAYRCVYQEEDAEGHTGISLSKNLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVGR  367

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+ N KWKPY+PDFK AFEHFCIHAGGRAVIDELQ NLQL++EHVEASRMTLHRFGNTSS
Sbjct  368   KLINHKWKPYVPDFKLAFEHFCIHAGGRAVIDELQNNLQLTAEHVEASRMTLHRFGNTSS  427

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYEL+YIESKGRM++G R+WQI FGSGFKCNSAVWKC R ++   DGPW DCI+RYP
Sbjct  428   SSLWYELSYIESKGRMRRGHRVWQIGFGSGFKCNSAVWKCLRTVETLVDGPWADCINRYP  487

Query  627   VHIPEIVK  604
             V IP++VK
Sbjct  488   VDIPDVVK  495



>ref|XP_006344142.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=494

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/493 (73%), Positives = 422/493 (86%), Gaps = 4/493 (1%)
 Frame = -3

Query  2073  NRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIH  1894
             N  S+KL+YVKL YQYLVN+ILT LLVP+MA + I+ L+  P E+ +   +S +S   IH
Sbjct  4     NSHSIKLRYVKLCYQYLVNNILTFLLVPIMATILIQFLQSNPNEL-LNFYNS-LSFTSIH  61

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             ++ S   + +V T Y+MS+PR+IYLVDYAC+ PP+TCR+PF++FMEH+ L L   PKSV 
Sbjct  62    LVCSLFLISYVTTCYIMSRPRTIYLVDYACFLPPITCRIPFASFMEHAHLILSSEPKSVR  121

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQM+ILERSGL EET LP A+HYIPP PTMD AR EAE VIFSA+D+L+ KT LK KDID
Sbjct  122   FQMKILERSGLSEETALPPAMHYIPPTPTMDLAREEAELVIFSAMDSLLAKTGLKPKDID  181

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             +L+VNCSLFSPTPSLSAMV+NKY+LRSNIKS+NLSGMGCSAG+ISIDLARD+L  +PNSN
Sbjct  182   VLVVNCSLFSPTPSLSAMVINKYRLRSNIKSFNLSGMGCSAGVISIDLARDILQQYPNSN  241

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+V+STEI+TPN Y G ER+MLL NCLFRMGGAAIL+SN++ D  RAKYRL+H+VRTHKG
Sbjct  242   AVVISTEILTPNGYLGKERSMLLTNCLFRMGGAAILLSNRKSDRARAKYRLVHIVRTHKG  301

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDK++RCV +QEDP+GKVGINL  DLM +AGEALKSNITTIGPLVLPASEQLLFL TLI
Sbjct  302   ADDKSFRCVQQQEDPEGKVGINLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTLI  361

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              RK+F  K KPYIPDFK AFEHFCIHAGGRAVIDELQ NLQLS+EHVEASRM L+RFGNT
Sbjct  362   CRKLFKSKMKPYIPDFKLAFEHFCIHAGGRAVIDELQNNLQLSAEHVEASRMALYRFGNT  421

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD--GPWLDCI  640
             SSSSLWYE++YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +K P D   PW DCI
Sbjct  422   SSSSLWYEMSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKLPVDDHNPWADCI  481

Query  639   DRYPVHIPEIVKL  601
             DRYPV IPE+V+L
Sbjct  482   DRYPVDIPEVVRL  494



>ref|XP_010910111.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=498

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/489 (73%), Positives = 411/489 (84%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SSVKLKYVKLGYQYLVNH+LT LL+  M  + +E+ R GPE+I+   +   +    + +L
Sbjct  11    SSVKLKYVKLGYQYLVNHLLTFLLISTMVAILLELARLGPEQILSLWRS--LHFSQVQLL  68

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              S    V  AT + MS+PR IYLVDYAC++P  TCRVPFSTFMEH+R     + KSV FQ
Sbjct  69    CSIFLAVMAATFFFMSRPRPIYLVDYACFRPSRTCRVPFSTFMEHARQMPFFDEKSVRFQ  128

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
             +RILERSGLGEETCLP A HYIPP+ +M+A+R EA  VIFSAID L  KT LK KDIDIL
Sbjct  129   LRILERSGLGEETCLPPANHYIPPQSSMEASRAEASLVIFSAIDELFAKTGLKPKDIDIL  188

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLFSPTPSLSAMV+NKYKLRSNI S+NLSGMGCSAGLISIDLARDLL VH NS AL
Sbjct  189   VVNCSLFSPTPSLSAMVINKYKLRSNILSFNLSGMGCSAGLISIDLARDLLQVHRNSYAL  248

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEIITPNYY G++R+MLLPNCLFRMG AA+L+SN+RR+  RAKYRL+ +VRTHKG+D
Sbjct  249   VVSTEIITPNYYSGNQRSMLLPNCLFRMGAAAVLLSNRRRERARAKYRLVRIVRTHKGAD  308

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D++YRCVYE+ED +G  GINLSKDLM +AG+ALK+NITTIGPLVLPASEQLLFL +LIGR
Sbjct  309   DRSYRCVYEEEDDEGNAGINLSKDLMAVAGDALKANITTIGPLVLPASEQLLFLLSLIGR  368

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI  P WKPYIPDFK+AFEHFCIHAGGRAVIDELQK+L LS+EHVEASRM LHRFGNTSS
Sbjct  369   KIIYPAWKPYIPDFKRAFEHFCIHAGGRAVIDELQKSLDLSAEHVEASRMALHRFGNTSS  428

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SSLWYELNYIE+KGRM++GDR+W I FGSGFKCNSAVWKC R ++ P +GPW   I RYP
Sbjct  429   SSLWYELNYIEAKGRMRRGDRVWMIGFGSGFKCNSAVWKCLRTIRTPVEGPWSGSIHRYP  488

Query  627   VHIPEIVKL  601
             VHIPE+VKL
Sbjct  489   VHIPEVVKL  497



>emb|CDP00615.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/488 (73%), Positives = 419/488 (86%), Gaps = 2/488 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             S KLK  KLGYQYLVNHI T  L+P+M  V I++L+  PEE++     +V++  L+H + 
Sbjct  7     SFKLKLAKLGYQYLVNHITTFFLIPMMMFVFIQILQRSPEELLSLW--NVLNFTLVHAVC  64

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             SS  ++F+ + Y MSKPR++YLVD+AC+KPP   R P+++F+EH+RL L D+PKSV FQ 
Sbjct  65    SSFAIIFITSFYFMSKPRTVYLVDFACFKPPCHFRAPYASFVEHARLVLPDHPKSVSFQT  124

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             ++L RSGLGEETCLP AIHYIPP PT + A  EAE VIFSA+D ++ +T +K +DIDILI
Sbjct  125   KMLARSGLGEETCLPPAIHYIPPTPTRELAGEEAELVIFSAMDLILNQTGVKPRDIDILI  184

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCS++SPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLIS+DLARDLL VHPNSNA++
Sbjct  185   VNCSVYSPTPSLSAMIINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVI  244

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN Y G++R+MLLPNCLFRMGGAAIL+SN+  D  RAKYRL+HVVRTHKG+DD
Sbjct  245   VSTEIITPNCYVGNDRSMLLPNCLFRMGGAAILLSNRWTDRWRAKYRLVHVVRTHKGADD  304

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K+YRCV ++ D +G +GI+LS DLM IAGEALKSNITTIGPLVLPASEQLLFL TLIGRK
Sbjct  305   KSYRCVEQKVDSEGNLGISLSIDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRK  364

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             IF  K KPYIPDFKQAFEHFCIHAGGRAVIDELQK+LQLS+EHVEASRM LHRFGNTSSS
Sbjct  365   IFKLKLKPYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSAEHVEASRMALHRFGNTSSS  424

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYE++YIE+KGRMKKGDR+WQIAFGSGFKCNSAVWKCNR +K P  GPW DCIDRYP 
Sbjct  425   SLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKAPTKGPWEDCIDRYPF  484

Query  624   HIPEIVKL  601
             +IPE+VKL
Sbjct  485   YIPEVVKL  492



>emb|CAN63425.1| hypothetical protein VITISV_040442 [Vitis vinifera]
Length=492

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/489 (73%), Positives = 417/489 (85%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             +SVKLKY+K  YQYLVNHILT  L+P++ G  I++L  GP++I      S +  +L+  L
Sbjct  6     NSVKLKYIKHCYQYLVNHILTFFLIPILMGFLIKILSLGPDQIYE--IGSSLHFDLLQFL  63

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              SSL ++F AT+Y MSKPRS+YLVDYAC+KPP + RVP +T +EH RL+ KDNP+ VEFQ
Sbjct  64    GSSLMIIFFATVYFMSKPRSVYLVDYACFKPPASYRVPHATLVEHLRLSNKDNPEIVEFQ  123

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RIL+RSGLG+ETCL  A  YIPP P+++A+R EAE ++FS ID L+KKT +K KDIDIL
Sbjct  124   RRILQRSGLGDETCLAPANLYIPPTPSLEASRVEAELILFSVIDDLLKKTGIKTKDIDIL  183

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             IVNCS+ SPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSA LISIDLAR+LL VHPNS A+
Sbjct  184   IVNCSIVSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSASLISIDLARELLQVHPNSCAI  243

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTEI TPNYY G+ER+M+L NCLFRMGGAAIL+SNK+ D  R+K +L+H+VRTHKG+D
Sbjct  244   VVSTEITTPNYYSGNERSMVLINCLFRMGGAAILLSNKKADRSRSKXQLLHLVRTHKGAD  303

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKAYRC++EQED QG  G++LSKDLM+IAGEALKSNITTIGPLVLPASEQL FLFTLIG+
Sbjct  304   DKAYRCIHEQEDTQGIQGVSLSKDLMLIAGEALKSNITTIGPLVLPASEQLNFLFTLIGQ  363

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI   KWKPYIPDFKQAFEHFCIHAGGR VIDELQK LQLS++ VEASRMTLHRFGNTSS
Sbjct  364   KILKLKWKPYIPDFKQAFEHFCIHAGGRGVIDELQKKLQLSAKDVEASRMTLHRFGNTSS  423

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYE+NYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +  P DGPWLDCI RYP
Sbjct  424   SSIWYEMNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTITTPTDGPWLDCIGRYP  483

Query  627   VHIPEIVKL  601
             V I +++ L
Sbjct  484   VSISQVLDL  492



>ref|XP_004238922.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=494

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/493 (72%), Positives = 420/493 (85%), Gaps = 4/493 (1%)
 Frame = -3

Query  2073  NRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIH  1894
             N  S+KL+Y+KLGYQYLVN+ LT LLVP+MA + I+ L+  P E++ +  +S +S   IH
Sbjct  4     NSHSIKLRYIKLGYQYLVNNFLTFLLVPIMATILIQFLQSNPNELI-KFYNS-LSFTSIH  61

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             ++ S   + +V T Y+MS+PR+IYLVDYAC+ PP+T R+PF++FMEH+ L L   PKSV 
Sbjct  62    LVCSLFLVTYVTTCYIMSRPRTIYLVDYACFLPPITNRIPFASFMEHAHLILSTEPKSVR  121

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQM+ILERSGL EET LP  +HYIPP PTMD AR EAE VIFSA+D+L+ KT LK KDID
Sbjct  122   FQMKILERSGLSEETALPPPMHYIPPTPTMDLAREEAELVIFSAMDSLLAKTGLKPKDID  181

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             +L+VNCSLFSPTPSLSAMV+NKYKLRSNIKS+NLSGMGCSAG+ISIDLARD+L  +PNSN
Sbjct  182   VLVVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGVISIDLARDILQQYPNSN  241

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+V+STEI+TPN Y G ER+MLL NCLFRMGGAAIL+SNK+ D GR+KYRL+H+VRT KG
Sbjct  242   AVVISTEILTPNGYLGKERSMLLTNCLFRMGGAAILLSNKKSDRGRSKYRLLHIVRTLKG  301

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
              DDK++RCV +QEDP+GKVGINL  DLM +AGEALKSNITTIGPLVLPASEQLLFL TLI
Sbjct  302   GDDKSFRCVQQQEDPEGKVGINLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTLI  361

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              RK+F    KPYIPDFK AFEHFCIHAGGRAVIDELQ NLQLS+EHVEASRMTL+RFGNT
Sbjct  362   CRKLFKSNMKPYIPDFKLAFEHFCIHAGGRAVIDELQNNLQLSTEHVEASRMTLYRFGNT  421

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD--GPWLDCI  640
             SSSSLWYE++YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCN+ +K P D   PW DCI
Sbjct  422   SSSSLWYEMSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKLPVDDHNPWADCI  481

Query  639   DRYPVHIPEIVKL  601
             DRYPV IP++V+L
Sbjct  482   DRYPVDIPDVVRL  494



>ref|XP_008660394.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Zea mays]
 gb|AFW89171.1| hypothetical protein ZEAMMB73_058916 [Zea mays]
Length=494

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/488 (73%), Positives = 422/488 (86%), Gaps = 3/488 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LK+VKLGY+YL++H+LTLLLVPVMA   +E+ R GP E++   +   + L+L+H+L 
Sbjct  10    SVNLKHVKLGYRYLLDHLLTLLLVPVMAATALELARLGPGELLSLWRS--LELDLVHILC  67

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S+   VF  T+Y MS+PR +YLVDYACYKPP +CRVPF+TFMEH+RL + D+ +SV FQ 
Sbjct  68    SAFVAVFAGTVYAMSRPRPVYLVDYACYKPPGSCRVPFATFMEHTRL-ISDDDRSVRFQT  126

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+TCLP A H+IPP P+M+A+R EA+ V+FSAID L+++T  K KD+DIL+
Sbjct  127   RILERSGLGEDTCLPPANHFIPPNPSMEASRAEAQLVVFSAIDDLLRRTGTKPKDVDILV  186

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAMVVN+YKLRSN++S+NLSGMGCSAGLISIDLARD+L VHPNSNALV
Sbjct  187   VNCSLFSPTPSLSAMVVNRYKLRSNVRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALV  246

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPN+Y+GS R MLLPNCLFRMG AAIL+SN+RR++ RAKYRL+HVVRTHKG+DD
Sbjct  247   VSTEIITPNFYRGSRRDMLLPNCLFRMGAAAILLSNRRREAPRAKYRLVHVVRTHKGADD  306

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVY++ED QG  GI+LSK+LM IAG+ALKSNITTIGPLVLP SEQLLF F L+GRK
Sbjct  307   RAYRCVYQEEDQQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRK  366

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + N  WKPYIPDFK AF+HFCIHAGGRAVIDELQKNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  367   LLNGGWKPYIPDFKLAFDHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSS  426

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYEL YIE+KGRM++GDR+WQI FGSGFKCNSAVWKC R++  P  GPW DCI RYPV
Sbjct  427   SLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSVNTPTSGPWDDCIHRYPV  486

Query  624   HIPEIVKL  601
              +PE+V L
Sbjct  487   DVPEVVSL  494



>ref|XP_010681548.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/488 (72%), Positives = 407/488 (83%), Gaps = 5/488 (1%)
 Frame = -3

Query  2061  VKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFS  1882
             VKL Y+KL YQ +VNH  T++L+P++  V   + +    +I+  I  ++       +LF+
Sbjct  9     VKLTYIKLCYQCVVNHFFTIILIPIILSV---IFQQKSSKIITIIFTTLKQRNSYEILFT  65

Query  1881  SLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMR  1702
              + ++   T Y M +PRS+YLVDYACYKPP   RVPFS+FMEHS L +  N KSVEFQM+
Sbjct  66    FMVVILALTFYYMLRPRSVYLVDYACYKPPSLLRVPFSSFMEHSNL-IVHNQKSVEFQMK  124

Query  1701  ILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIV  1522
             ILERSGLGEETCLP AIHYIPP P+M AAR E+E +IFS +D L   T LKAKD+DILIV
Sbjct  125   ILERSGLGEETCLPPAIHYIPPDPSMAAARHESEVIIFSCLDKLFANTRLKAKDVDILIV  184

Query  1521  NCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVV  1342
             NCSLFSPTPSLSAMVVNKYKLRSNIKS+NLSGMGCSAGLIS+DLA+DLL  H NSNA+VV
Sbjct  185   NCSLFSPTPSLSAMVVNKYKLRSNIKSFNLSGMGCSAGLISVDLAKDLLQAHANSNAIVV  244

Query  1341  STEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDK  1162
             STEI+TPNYY+GSERAMLLPNCLFRMGGAA+L+SNK     R+KYRL+HVVRTHKGSDDK
Sbjct  245   STEILTPNYYRGSERAMLLPNCLFRMGGAAVLLSNKVAYRRRSKYRLLHVVRTHKGSDDK  304

Query  1161  AYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKI  982
             A++CV + ED +G VGI+LSKDLM IAGEALK+NITT+GPLVLPASEQLLFL +LIGRK+
Sbjct  305   AFKCVSQAEDKEGHVGISLSKDLMTIAGEALKTNITTMGPLVLPASEQLLFLLSLIGRKL  364

Query  981   FNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSS  802
              N K K YIPDFKQAFEHFCIHAGGRAVIDELQKNLQL +EHVEASRMTLHRFGNTSSSS
Sbjct  365   INAKRKAYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLCAEHVEASRMTLHRFGNTSSSS  424

Query  801   LWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKP-ADGPWLDCIDRYPV  625
             LWYEL YIE+KGRM KGDR+WQIAFGSGFKCNSAVWKC + +K P  D PWLDCI +YP+
Sbjct  425   LWYELAYIEAKGRMNKGDRVWQIAFGSGFKCNSAVWKCLKTVKTPIKDSPWLDCIHKYPI  484

Query  624   HIPEIVKL  601
             HIP++VKL
Sbjct  485   HIPDVVKL  492



>ref|XP_008801160.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Phoenix dactylifera]
Length=528

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/488 (72%), Positives = 401/488 (82%), Gaps = 2/488 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKL+YVKLGY YL NHILT LL+P++    +E  R  PE+I+     S +  + + +L 
Sbjct  42    SVKLRYVKLGYYYLANHILTFLLIPIIVAALLEFARLDPEQILSLW--SSLHFDHVQLLC  99

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
                  V VAT Y MS+PR IYLVDYAC++P  TCRVPFSTFMEH+R     + KSV FQ+
Sbjct  100   FGFLAVMVATFYFMSRPRPIYLVDYACFRPSQTCRVPFSTFMEHARQIPFFDEKSVRFQL  159

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGEETCLP A HYIPP+ +M+A+R EA  VIFSA+D L  KT L  KDIDIL+
Sbjct  160   RILERSGLGEETCLPPANHYIPPQGSMEASRAEASLVIFSAVDELFAKTGLNPKDIDILV  219

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLFSPTPSLSAMV+NKYKLRSNI S+NLSGMGCSAGLISIDLARDLL V  NS ALV
Sbjct  220   VNCSLFSPTPSLSAMVINKYKLRSNIVSFNLSGMGCSAGLISIDLARDLLQVRRNSYALV  279

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTEIITPNYY G+ R+MLLPNCLFRMG +A+L+SN+RR+  RAKYRL+ VVRTHKG+DD
Sbjct  280   VSTEIITPNYYMGNRRSMLLPNCLFRMGCSAVLLSNRRRERARAKYRLVRVVRTHKGADD  339

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             ++Y CVYE+ED +   GINLSKDLM +AG+ALK NITTIGPLVLPASEQL FL +LIGRK
Sbjct  340   RSYHCVYEEEDDECNSGINLSKDLMAVAGDALKDNITTIGPLVLPASEQLRFLLSLIGRK  399

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             I NP +KPYIPDFK+AFEHFCIHAGGRAVIDELQK+L LS+EHVEASRM LHRFGNTSSS
Sbjct  400   IINPAFKPYIPDFKRAFEHFCIHAGGRAVIDELQKSLDLSAEHVEASRMALHRFGNTSSS  459

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             SLWYELNYIE+KGRM++GDR+W I FGSGFKCNSAVWKC R +  P DGPW   I RYPV
Sbjct  460   SLWYELNYIEAKGRMRRGDRVWMIGFGSGFKCNSAVWKCLRTITTPVDGPWSSSIHRYPV  519

Query  624   HIPEIVKL  601
             HIPE+VKL
Sbjct  520   HIPEVVKL  527



>ref|XP_009391408.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Musa acuminata subsp. malaccensis]
Length=499

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/502 (71%), Positives = 411/502 (82%), Gaps = 5/502 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M  E  P F   SS+KLKYVKLGYQYL NH+LT LL+PVM G  +E  + GP+E+V   +
Sbjct  1     MPAEPLPQF--LSSIKLKYVKLGYQYLANHMLTFLLIPVMVGAFLEAAKIGPDELVSLWR  58

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
                + +  IH L + L +V VAT Y MS+PR +YLVDYAC++P   CRVPF+TF EH+RL
Sbjct  59    S--LGINAIHALCTVLLVVVVATAYFMSRPRPVYLVDYACFQPARNCRVPFATFFEHARL  116

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
                 + KSV FQ+RILERSGLGEETCLP A HYIPP P+M+A+R EA  VIFSAID L+ 
Sbjct  117   MPFFDEKSVRFQVRILERSGLGEETCLPPANHYIPPCPSMEASRAEAHLVIFSAIDDLIA  176

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT LK KDIDIL+VNCSLFSPTPSLSAM++NKYKLRSNI S+NLSGMGCSAGLIS+DLAR
Sbjct  177   KTGLKPKDIDILVVNCSLFSPTPSLSAMIINKYKLRSNIMSFNLSGMGCSAGLISVDLAR  236

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL  HPNS ALVVSTEIITPNYY G+ER+MLLPNCLFRMG AA+L+SN+RR+  RAKYR
Sbjct  237   DLLQAHPNSYALVVSTEIITPNYYAGNERSMLLPNCLFRMGAAAVLLSNRRRERARAKYR  296

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L+HVVRTHKG+DD+AYRCVYE+ED  G  GI LSKDLM IAGEAL+SNIT +GPLVLP +
Sbjct  297   LLHVVRTHKGADDRAYRCVYEEEDGDGNSGIKLSKDLMAIAGEALRSNITDVGPLVLPVT  356

Query  1023  EQLLFLFTLIGRKIFNPK-WKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEA  847
             EQL FL +L+ R++   + WKPYIPDFK+AFEHFCIHAGGRAVIDELQ NL+LS+ HVEA
Sbjct  357   EQLRFLASLVARRLLGSRGWKPYIPDFKRAFEHFCIHAGGRAVIDELQLNLRLSAAHVEA  416

Query  846   SRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKP  667
             SRM LHRFGNTSSSSLWYEL YIE+KGRM++GDR+W I FGSGFKCNSAVW+  R +  P
Sbjct  417   SRMALHRFGNTSSSSLWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAVWRSLRTVATP  476

Query  666   ADGPWLDCIDRYPVHIPEIVKL  601
              DGPW D I RYPVHIPE+VKL
Sbjct  477   VDGPWSDSIHRYPVHIPEVVKL  498



>ref|XP_009762000.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=498

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/503 (71%), Positives = 417/503 (83%), Gaps = 7/503 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             M + SSP ++   S+K KY KLGYQY+VN+ILT LL+P M  + I +L+  P E++    
Sbjct  1     MPKISSPKYSQ--SMKQKYAKLGYQYIVNNILTFLLLPFMLTILILILQLSPNEVLSFYN  58

Query  1923  D-SVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSR  1747
               S  SL  I  LF    +++V+T Y MS+PR+IYLVDYAC++PP   R P ++F+EH++
Sbjct  59    SISFTSLPSICSLF---VIIYVSTYYFMSRPRTIYLVDYACFRPPNMFRAPSASFVEHAQ  115

Query  1746  LNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALM  1567
             L L   PKSV FQM++LERSGLGEET LP AIHYIPP PTM  AR EAE VIFS +D+L+
Sbjct  116   LILPTEPKSVRFQMKMLERSGLGEETALPPAIHYIPPTPTMVLAREEAELVIFSIMDSLL  175

Query  1566  KKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLA  1387
             +KT L  K IDILIVNCSLFSPTPSLSAM++NKYKLRSNIKS+NLSGMGCSAGLISIDLA
Sbjct  176   EKTRLNPKFIDILIVNCSLFSPTPSLSAMLINKYKLRSNIKSFNLSGMGCSAGLISIDLA  235

Query  1386  RDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKY  1207
             RDLL  +PNSNA+V+STEIITPN Y G ER+MLLPNCLFRMGGAAI +SN++ D  RAKY
Sbjct  236   RDLLQHYPNSNAVVISTEIITPNSYLGKERSMLLPNCLFRMGGAAIFLSNRKSDQRRAKY  295

Query  1206  RLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPA  1027
             RL+HVVRTHKG+DDK++RCV +QEDP+GKVGINL  DLM +AGEALKSNITTIGPLVLPA
Sbjct  296   RLVHVVRTHKGADDKSFRCVQQQEDPEGKVGINLCIDLMQVAGEALKSNITTIGPLVLPA  355

Query  1026  SEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEA  847
             SEQLLFL T I RKIF    KPY+PDFK AFEHFCIHAGGRAVIDELQK+LQLS+EHVEA
Sbjct  356   SEQLLFLLTFIRRKIFKKNSKPYVPDFKLAFEHFCIHAGGRAVIDELQKSLQLSAEHVEA  415

Query  846   SRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKP  667
             SRMTL+RFGNTSSSSLWYE++YIE+KGRMKKGDRIWQIAFGSGFKCNSAVWKCNR +K P
Sbjct  416   SRMTLYRFGNTSSSSLWYEMSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTP  475

Query  666   -ADGPWLDCIDRYPVHIPEIVKL  601
                 PW DCIDRYPV IP++VKL
Sbjct  476   VTHSPWADCIDRYPVDIPDVVKL  498



>gb|EYU26766.1| hypothetical protein MIMGU_mgv1a005018mg [Erythranthe guttata]
Length=500

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/490 (70%), Positives = 413/490 (84%), Gaps = 4/490 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLGY YL+NH L  LL+P+   +TIE LR  P+E  ++   + + L LIHV+ 
Sbjct  13    SVKLKYVKLGYHYLINHFLLFLLLPITLSLTIEALRTTPQE--LQTLCNSIKLTLIHVIS  70

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             S   +++++T Y+MS+PR +YLVD+A +KPP + RV F+ FMEH+R+     P+SV FQM
Sbjct  71    SLFLVIYISTYYIMSRPRPVYLVDHALFKPPASFRVSFAGFMEHARMAPFSEPRSVHFQM  130

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGE+T LP AI YIPP P M+ AR EAE VIF+ +D+L++KT ++ KD+DIL+
Sbjct  131   KILERSGLGEQTSLPPAIRYIPPSPNMNLAREEAELVIFTCMDSLIRKTGVEPKDVDILV  190

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             +NCSLFSPTPSL+AMVVNKY +RSN+KS+NLSGMGCSAGLISIDLA+DLL  HPNSNA+V
Sbjct  191   LNCSLFSPTPSLTAMVVNKYGMRSNVKSFNLSGMGCSAGLISIDLAKDLLQHHPNSNAVV  250

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             +STEI+TPN Y G ERAMLLPNCLFRMGGAA+L+SN+R D  RAKYRL HVVRTHKG+DD
Sbjct  251   ISTEILTPNSYMGKERAMLLPNCLFRMGGAAVLLSNRRSDRRRAKYRLAHVVRTHKGADD  310

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K+YRCV ++ED +G VGI L+ DLM IAGEALKSNITT+GPLVLPASEQLLF  + IGRK
Sbjct  311   KSYRCVSQEEDSEGNVGIKLNIDLMAIAGEALKSNITTMGPLVLPASEQLLFALSFIGRK  370

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + N KWK YIPDFKQAF+HFCIHAGGRAVIDELQ++L+L++E VEASRM+LHRFGNTSSS
Sbjct  371   MINSKWKQYIPDFKQAFDHFCIHAGGRAVIDELQRSLRLTAEQVEASRMSLHRFGNTSSS  430

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD--GPWLDCIDRY  631
             SLWYEL+YIESKGRMK+GDR+WQIAFGSGFKCNSAVWKCNR +   A+  GPW DCID Y
Sbjct  431   SLWYELSYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTVDPTAEDGGPWADCIDNY  490

Query  630   PVHIPEIVKL  601
             PV+IPE+VKL
Sbjct  491   PVYIPEVVKL  500



>ref|XP_010265150.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/498 (67%), Positives = 420/498 (84%), Gaps = 4/498 (1%)
 Frame = -3

Query  2094  ESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV  1915
             ++ P F   SSV+LKYVKLGY+YLVN++LT+L +P+MAG+ +EVLR GP+EI  R+ +S 
Sbjct  3     QTIPSFT--SSVRLKYVKLGYRYLVNNLLTVLFIPIMAGLLLEVLRLGPDEI-FRLWNS-  58

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             + L+L+H+L S   ++ + T+YLMS+PR IYLVD++C+KP  T R P +TF+EH R+   
Sbjct  59    LELDLVHILCSGFLIIIIVTVYLMSRPRHIYLVDFSCFKPLGTLRAPLTTFVEHGRIIKG  118

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
              + K+V+F ++I ER GLG+ETC+P A+ YIPP  T+  +R EAE VIFSAID+L++KT 
Sbjct  119   PDSKAVQFSLKIFERCGLGDETCVPPALRYIPPALTIANSREEAELVIFSAIDSLLEKTG  178

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             +K K IDILI+NCS+FSPTPSL+AM+VNKYK+R +IKS+NLSGMGCSAG+ISI LARDLL
Sbjct  179   VKPKSIDILILNCSIFSPTPSLTAMIVNKYKMRGDIKSFNLSGMGCSAGMISIGLARDLL  238

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNS ALVVSTEIIT + Y G + +M+LPNC+FRMG AA+L+SN R++  RAKYRL H
Sbjct  239   QVHPNSYALVVSTEIITYSGYYGEQPSMMLPNCIFRMGSAALLLSNMRKERSRAKYRLFH  298

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             V+RTHKG+DD AYRCVY++EDP G  G++LSKD+ ++AG+ALKSNITTIGPLVLPASEQL
Sbjct  299   VIRTHKGADDTAYRCVYQEEDPDGFKGVSLSKDITMVAGQALKSNITTIGPLVLPASEQL  358

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LF+ TL+GRK+F  KWKPYIPDFKQAF+HFCIHAGGRAVIDEL+K L LS+E VEASRMT
Sbjct  359   LFVLTLVGRKLFERKWKPYIPDFKQAFDHFCIHAGGRAVIDELEKYLNLSAEDVEASRMT  418

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSS+WYEL+YIE+KGRMKKGDRIWQI FGSGFKCNS VWKCNRN++ P D P
Sbjct  419   LHRFGNTSSSSIWYELSYIETKGRMKKGDRIWQIGFGSGFKCNSVVWKCNRNIRPPVDSP  478

Query  654   WLDCIDRYPVHIPEIVKL  601
             W +CI RYPV IP++VK+
Sbjct  479   WSECIHRYPVKIPDVVKI  496



>ref|XP_006842379.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
 gb|ERN04054.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
Length=462

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/462 (73%), Positives = 395/462 (85%), Gaps = 2/462 (0%)
 Frame = -3

Query  1986  MAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYA  1807
             MA   +E+LR GP+EI +R+ DS   L L+H+L SSLF+VF+ATLY +SKP  IYLVDY 
Sbjct  1     MAASAVELLRMGPKEI-LRLCDSP-HLGLVHILCSSLFIVFMATLYFISKPYPIYLVDYT  58

Query  1806  CYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPT  1627
             CYKPP T RVP S F+EH +L+   +P+SV+FQ RILERSGLGE TC+P A+HYI P PT
Sbjct  59    CYKPPGTYRVPRSFFLEHLKLSPSFDPESVKFQFRILERSGLGERTCVPPALHYIAPDPT  118

Query  1626  MDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNI  1447
             M  AR EAE VIFSA+DAL ++T +K +D+D LIVNCS+FSPTPSLS MV+NKYK+RSNI
Sbjct  119   MADARAEAELVIFSAMDALFERTGIKPQDVDFLIVNCSMFSPTPSLSDMVINKYKMRSNI  178

Query  1446  KSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFR  1267
             KS+NLSGMGCS   IS+++ARDLL VH N+ A+VVSTEI+TPN+Y G++R+MLLPNCLFR
Sbjct  179   KSFNLSGMGCSPSPISVNIARDLLQVHANAYAVVVSTEIVTPNWYTGNQRSMLLPNCLFR  238

Query  1266  MGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMV  1087
             MG A +L+SN+RR+S RAKYRLMHVVRTH+G+DD+AY CV+++ED Q  VGI+LSKDLM 
Sbjct  239   MGAATLLLSNRRRESRRAKYRLMHVVRTHRGADDRAYHCVFQEEDVQRNVGISLSKDLMG  298

Query  1086  IAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGG  907
             IAGEALKSNITT+GPLVLPASEQLLFL +L  RKIFN K KPYIPDFKQAFEHFCIHAGG
Sbjct  299   IAGEALKSNITTMGPLVLPASEQLLFLLSLFARKIFNLKLKPYIPDFKQAFEHFCIHAGG  358

Query  906   RAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAF  727
             RAVIDEL+KNLQLS EHVEASRMTLHRFGNTSSSSLWYE+NYIE+KGRMKKGDR WQI F
Sbjct  359   RAVIDELEKNLQLSPEHVEASRMTLHRFGNTSSSSLWYEMNYIEAKGRMKKGDRSWQIGF  418

Query  726   GSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             GSGFKCNS VWKCNR++K  ADGPW DCID+YPVH  E VKL
Sbjct  419   GSGFKCNSLVWKCNRSIKAEADGPWADCIDQYPVHTVEAVKL  460



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/485 (67%), Positives = 400/485 (82%), Gaps = 2/485 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YLV H++TL LVP+M GV IEV R GPE+I        +   L+ V+ 
Sbjct  48    SVNLKYVKLGYHYLVTHLITLTLVPLMLGVAIEVGRLGPEDIHQLWIH--LKFNLVSVMT  105

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF AT+Y MS+PRS++LVDYAC+KP    RVPF++FMEHS+L+   + KS+EFQ 
Sbjct  106   CSALLVFAATVYFMSRPRSVFLVDYACHKPSPNIRVPFASFMEHSKLSGSFDDKSLEFQR  165

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+T LP A+HY+PP+P+MDAAR EAE V+FSA+D L  KT +K KD+ IL+
Sbjct  166   RILERSGLGEQTALPPAMHYLPPRPSMDAARQEAETVMFSALDELFHKTGVKPKDVGILV  225

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYK+R NI+SYNL GMGCSAG+I+IDLA+D+L VH N  A+V
Sbjct  226   VNCSLFNPTPSLSAMIVNKYKMRGNIRSYNLGGMGCSAGVIAIDLAKDMLQVHGNDYAIV  285

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ R+ML+PNCLFR+GGAA+L+SN+R D  RAKY L+H VRTHKG+DD
Sbjct  286   VSTENITQNWYFGNRRSMLIPNCLFRVGGAAMLLSNRRSDRRRAKYELLHTVRTHKGADD  345

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K++RCVY++ED   K+G++LSKDLM IAG+ALK+NITT+GPLVLP SEQ++F   L+ RK
Sbjct  346   KSFRCVYQEEDENSKMGVSLSKDLMAIAGQALKTNITTMGPLVLPLSEQIIFFSFLVARK  405

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F    KPYIPDF+ AF HFCIHAGGRAVIDEL+KNLQL++EHVEASRMTL+RFGNTSSS
Sbjct  406   VFKRAVKPYIPDFRLAFHHFCIHAGGRAVIDELEKNLQLTAEHVEASRMTLYRFGNTSSS  465

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+KG+R+WQIAFGSGFKCNSAVW+  R +K    GPW DCID++PV
Sbjct  466   SIWYELAYIEAKGRMRKGNRVWQIAFGSGFKCNSAVWRALRTIKASEKGPWADCIDQFPV  525

Query  624   HIPEI  610
              IPE+
Sbjct  526   AIPEV  530



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/485 (67%), Positives = 400/485 (82%), Gaps = 2/485 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YLV H++TL LVP+M GV IEV R GPE+I        +   L+ V+ 
Sbjct  48    SVNLKYVKLGYHYLVTHLITLTLVPLMLGVAIEVGRLGPEDIHQLWIH--LKFNLVSVMT  105

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF AT+Y MS+PRS++LVDYAC+KP    RVPF++FMEHS+L+   + KS+EFQ 
Sbjct  106   CSALLVFAATVYFMSRPRSVFLVDYACHKPSPNIRVPFASFMEHSKLSGSFDDKSLEFQR  165

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             RILERSGLGE+T LP A+HY+PP+P+MDAAR EAE V+FSA+D L  KT +K KD+ IL+
Sbjct  166   RILERSGLGEQTALPPAMHYLPPRPSMDAARQEAETVMFSALDELFHKTGVKPKDVGILV  225

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYK+R NI+SYNL GMGCSAG+I+IDLA+D+L VH N  A+V
Sbjct  226   VNCSLFNPTPSLSAMIVNKYKMRGNIRSYNLGGMGCSAGVIAIDLAKDMLQVHGNDYAIV  285

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ R+ML+PNCLFR+GGAA+L+SN+R D  RAKY L+H VRTHKG+DD
Sbjct  286   VSTENITQNWYFGNRRSMLIPNCLFRVGGAAMLLSNRRSDRRRAKYELLHTVRTHKGADD  345

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K++RCVY++ED   K+G++LSKDLM IAG+ALK+NITT+GPLVLP SEQ++F   L+ RK
Sbjct  346   KSFRCVYQEEDENAKMGVSLSKDLMAIAGQALKTNITTMGPLVLPLSEQIIFFSFLVARK  405

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F    KPYIPDF+ AF HFCIHAGGRAVIDEL+KNLQL++EHVEASRMTL+RFGNTSSS
Sbjct  406   VFKRAVKPYIPDFRLAFHHFCIHAGGRAVIDELEKNLQLTAEHVEASRMTLYRFGNTSSS  465

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+KG+R+WQIAFGSGFKCNSAVW+  R +K    GPW DCID++PV
Sbjct  466   SIWYELAYIEAKGRMRKGNRVWQIAFGSGFKCNSAVWRALRTIKASEKGPWADCIDQFPV  525

Query  624   HIPEI  610
              IPE+
Sbjct  526   AIPEV  530



>ref|XP_009399728.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=494

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/486 (66%), Positives = 391/486 (80%), Gaps = 3/486 (1%)
 Frame = -3

Query  2055  LKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSL  1876
             L  V+L Y  +VNH+L   ++PVM  V ++VL  GP+E++     S + ++ IH L +  
Sbjct  10    LSSVELAYLNVVNHLLAFPIIPVMVAVLLQVLELGPDELIAHW--SSLGIDTIHALCTIF  67

Query  1875  FLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRIL  1696
              +V VAT Y MS+PR +YLVD+AC++PP + RVPF+TF EH+ L    + KSV FQ+R L
Sbjct  68    TVVVVATAYFMSRPRPVYLVDHACFRPPRSFRVPFATFFEHASLVPFFDEKSVRFQVRFL  127

Query  1695  ERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNC  1516
             E SGLGEETCLP A  YIPP P+M+AA  EA  VIFSAID L+ KT+LK +D+DIL+VNC
Sbjct  128   ESSGLGEETCLPLANRYIPPCPSMEAACAEARLVIFSAIDELIAKTDLKPRDVDILVVNC  187

Query  1515  SLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVST  1336
             SLFSPTPSLSAM+VNKYK+RSNI S+NLSGMGCSAGLISIDLAR LL  HPNS ALVVST
Sbjct  188   SLFSPTPSLSAMIVNKYKMRSNIMSFNLSGMGCSAGLISIDLARSLLQAHPNSYALVVST  247

Query  1335  EIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAY  1156
             EIITPN+Y G+ER+MLLPNCLFRMG AA+L+SN RR+  RAKYRL+HVVRTH+G+DD+AY
Sbjct  248   EIITPNFYAGNERSMLLPNCLFRMGAAAVLLSNSRREEDRAKYRLLHVVRTHEGADDRAY  307

Query  1155  RCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFN  976
             RCVYE+ED +G  GINLSK+L  + GEAL++NIT +GPLVLP +EQL FL +L+ R++  
Sbjct  308   RCVYEEEDGEGNSGINLSKELTTVTGEALRANITAVGPLVLPVTEQLRFLASLVARRLLG  367

Query  975   PK-WKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSL  799
              +  KPYIPDFK+AF+H CIHAGGRAVIDELQ++L L +  VEASRMTLHRFGNTSSSSL
Sbjct  368   ARGGKPYIPDFKRAFDHLCIHAGGRAVIDELQRSLGLPAALVEASRMTLHRFGNTSSSSL  427

Query  798   WYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHI  619
             WYEL YIE+K RM++GDR+W I FGSGFKCNSAVW+C R  K P DGPW DCI RYPVH+
Sbjct  428   WYELAYIEAKSRMRRGDRVWMIGFGSGFKCNSAVWRCLRAPKAPVDGPWSDCIHRYPVHV  487

Query  618   PEIVKL  601
             PE+VKL
Sbjct  488   PEMVKL  493



>ref|XP_007222962.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
 gb|EMJ24161.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
Length=396

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/438 (73%), Positives = 359/438 (82%), Gaps = 53/438 (12%)
 Frame = -3

Query  1914  MSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLK  1735
             +  +L+ +L SS  ++F+AT+Y MSKPR+++LVDYAC+KPPVTCRVPFSTFMEHSRL L 
Sbjct  12    LHFDLVQILCSSFLIIFIATVYFMSKPRTVFLVDYACFKPPVTCRVPFSTFMEHSRLILS  71

Query  1734  DNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTE  1555
             +NP                                                     K T 
Sbjct  72    NNP-----------------------------------------------------KSTG  78

Query  1554  LKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLL  1375
             LK  DIDILIVNCSLFSPTPSLSAMV+NKYKLRSNI+S+NLSGMGCSAG+ISIDLARDLL
Sbjct  79    LKPTDIDILIVNCSLFSPTPSLSAMVINKYKLRSNIRSFNLSGMGCSAGVISIDLARDLL  138

Query  1374  HVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMH  1195
              VHPNSNA+VVSTEIITPNYY+G+ERAMLLPNCLFRMGGAA+L+SN+R +  RAKYRL+H
Sbjct  139   QVHPNSNAVVVSTEIITPNYYQGNERAMLLPNCLFRMGGAALLLSNRRSERRRAKYRLVH  198

Query  1194  VVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQL  1015
             VVRTH GSDDKAYRCV+E+ED +GKVGI+LSKDLM IAGEALKSNITT+GPLVLPASEQL
Sbjct  199   VVRTHMGSDDKAYRCVFEEEDKEGKVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQL  258

Query  1014  LFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMT  835
             LFL TLIGRKI NPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLS+EH EASRMT
Sbjct  259   LFLLTLIGRKIVNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMT  318

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSSLWYEL YIE+KGRM+KGDR+WQIAFGSGFKCNSAVWKCNRN++ P++GP
Sbjct  319   LHRFGNTSSSSLWYELGYIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRNIETPSEGP  378

Query  654   WLDCIDRYPVHIPEIVKL  601
             W DCIDRYPVHIPE+VKL
Sbjct  379   WADCIDRYPVHIPEVVKL  396



>ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=504

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/483 (65%), Positives = 396/483 (82%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTL L+P+MA + +E  +  P++I        +   L+ ++
Sbjct  22    QSVNLKYVKLGYHYLITHLLTLCLIPLMALIIVEASQKNPDDIHQLWLH--LQYNLVSII  79

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLVF +T+Y+M++PRSIYLVDYACY+PP   +V +  FMEHSRL    +  ++EFQ
Sbjct  80    ICSAFLVFGSTVYIMTRPRSIYLVDYACYRPPSHLQVRYHQFMEHSRLTGDFDESALEFQ  139

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V+F ++D L   T +K KDI IL
Sbjct  140   RKILERSGLGEETYVPEAMHYIPPQPSMAAAREEAEQVMFGSLDKLFANTNVKPKDIGIL  199

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+
Sbjct  200   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAV  259

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+H+VRTH+G+D
Sbjct  260   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSGDRRRAKYKLVHLVRTHRGAD  319

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  320   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAK  379

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  380   KLFNAKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPSHVEASRMTLHRFGNTSS  439

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL+YIE+KGRM+KG+R+WQIAFGSGFKCNSAVW+  RN+    +GPW DCI++YP
Sbjct  440   SSIWYELSYIEAKGRMRKGNRVWQIAFGSGFKCNSAVWQALRNVNPSPNGPWEDCINKYP  499

Query  627   VHI  619
             V +
Sbjct  500   VEV  502



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 391/489 (80%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H++ LL +P++  VT+EV R GPEE+     +  +   L+ VL
Sbjct  41    QSVNLKYVKLGYHYLITHLVILLFIPLLLAVTLEVGRMGPEEMWQLWVN--LQFNLVSVL  98

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y+MS+PR +YLVDYAC+ P    RV FS FM+HS  +   + +++EFQ
Sbjct  99    ICSALLVFGVTVYVMSRPRPVYLVDYACHLPAENTRVKFSLFMDHSEKSGFFDERALEFQ  158

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET LP ++H +P    M  AR EAEEV+F A+D L +KT++K KDI IL
Sbjct  159   RKILERSGLGEETHLPVSLHRLPANANMAEARNEAEEVMFGALDELFEKTKVKPKDIGIL  218

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKY +R NI++YNL GMGCSAG+ISIDLA+D+L VH  + A+
Sbjct  219   VVNCSLFNPTPSLSAMIVNKYHMRGNIRTYNLGGMGCSAGVISIDLAKDMLQVHGGTYAI  278

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ R+ML+PNCLFR+GGAAIL+SNKR +  RAKY+L+H VRTHKG+D
Sbjct  279   VVSTENITQNWYYGNRRSMLIPNCLFRVGGAAILLSNKRSEKRRAKYQLVHTVRTHKGAD  338

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK +RCVY++ED +  +G++LSKDLM IAG+ALK+NITT+GPLVLP SEQLLF   L+ R
Sbjct  339   DKCFRCVYQEEDEKNFMGVSLSKDLMAIAGDALKTNITTLGPLVLPLSEQLLFFGILVAR  398

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+ +HVE SRMTLHRFGNTSS
Sbjct  399   KVFNMKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTKDHVEPSRMTLHRFGNTSS  458

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYELNYIESKGRMKKGDR+WQIAFGSGFKCNSAVW+  R LK PA GPW  CID YP
Sbjct  459   SSIWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWQAVRTLKPPARGPWTHCIDSYP  518

Query  627   VHIPEIVKL  601
             V IPE+ K 
Sbjct  519   VKIPEVYKF  527



>ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
 gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
Length=510

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 392/482 (81%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LK+VKLGY YL+ H+LTL LVP+MA V  +  +  P +I        +   L+ V+ 
Sbjct  29    SVNLKHVKLGYHYLITHLLTLCLVPLMAFVIFQAFQLNPNDIHQLWLH--LQYNLVSVII  86

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF AT+Y+M++PRS++LVDYACYKPP   +V F  FMEHS L    +  S+EFQ 
Sbjct  87    CSAFLVFGATVYIMTRPRSLFLVDYACYKPPSNLQVKFEQFMEHSSLTGDFDDSSLEFQR  146

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HYIPP+P+M AAR EA++V+F A+D L   T +K KDI IL+
Sbjct  147   KILERSGLGEETYVPEAMHYIPPRPSMAAAREEAQQVMFGALDVLFANTNIKPKDIGILV  206

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  207   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVV  266

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTHKG+DD
Sbjct  267   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDKRRAKYKLVHVVRTHKGADD  326

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA++CVY+++D  GK G++LSK+LM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  327   KAFKCVYQEQDDAGKTGVSLSKELMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKK  386

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  387   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  446

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+K R+++GDRIWQIAFGSGFKCNSA+W+  R++K  ++ PW DCIDRYPV
Sbjct  447   SIWYELAYTEAKERVRRGDRIWQIAFGSGFKCNSAIWEALRHIKPSSNNPWQDCIDRYPV  506

Query  624   HI  619
              I
Sbjct  507   QI  508



>emb|CDP07508.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/483 (65%), Positives = 392/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++H+LTL LVPVM  + IE  +  P++I  R     +   L+ V+
Sbjct  36    QSVNLKYVKLGYHYLISHLLTLCLVPVMIIILIEASQMNPDDI--RQLWLHLQYNLVSVI  93

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PR +YLVDY CY+ P   + PF +FMEHSRL    +  S++FQ
Sbjct  94    TCSAILVFGSTVYIMTRPRPVYLVDYFCYRAPDELKAPFESFMEHSRLTGDFDESSLQFQ  153

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG+ET +P A+H++PP+P+M AAR EAE+V+F A+D L   T++KAKDI IL
Sbjct  154   RKILERSGLGDETYVPEAMHFVPPRPSMQAAREEAEQVMFGALDNLFANTKVKAKDIGIL  213

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+
Sbjct  214   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAV  273

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+++AML+PNCLFR+GGAA+L+SNK  D  RAKYRL+HVVRTH+GSD
Sbjct  274   VVSTENITQNWYFGNKKAMLIPNCLFRVGGAAVLLSNKSVDRRRAKYRLVHVVRTHRGSD  333

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G+ LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  334   DKAFRCVYQEQDDAGKTGVTLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVLK  393

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNTSS
Sbjct  394   KLFQKNIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSS  453

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGR+++G RIWQIAFGSGFKCNSAVW+  R++K   +GPW DCIDRYP
Sbjct  454   SSIWYELAYTEAKGRIRRGQRIWQIAFGSGFKCNSAVWQALRHVKPAPNGPWEDCIDRYP  513

Query  627   VHI  619
             V +
Sbjct  514   VKV  516



>ref|XP_010932594.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Elaeis guineensis]
Length=491

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/481 (64%), Positives = 386/481 (80%), Gaps = 1/481 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             S+  KY KL Y+YL N++L +LLVP +  + IEVL   P +   ++  S  + +  ++LF
Sbjct  2     SMATKYFKLCYRYLFNNLLAILLVPGLITILIEVLYLAPVDF-QKLSASFQAFDAFYLLF  60

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              SL L+ +AT+Y  S+PR+IYLVD+ACYKPP +CR P S FM HS+      P S+EFQ 
Sbjct  61    FSLALIVLATIYFTSRPRTIYLVDFACYKPPTSCRFPISKFMNHSKQIEDFEPSSIEFQR  120

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGE+T LP A H IP  PTM  +R E+E VIFS +D+L +KT++K +DIDIL+
Sbjct  121   KILERSGLGEDTSLPPAHHAIPFTPTMAKSREESELVIFSIVDSLFQKTKVKPRDIDILV  180

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYK+RSNI+SYNLSGMGCSAG+ISIDLARD L VH NS ALV
Sbjct  181   VNCSLFAPTPSLSAMIVNKYKMRSNIRSYNLSGMGCSAGIISIDLARDELLVHANSYALV  240

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             V+TEIIT ++Y G+ R+MLL NCLFRMGGAA+L+SNKRR++ RAKY L+HVVRTHKG+DD
Sbjct  241   VTTEIITEHWYTGNRRSMLLANCLFRMGGAAVLLSNKRREATRAKYELLHVVRTHKGADD  300

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             +AYRCVY++ED + K+G++LS+DL  IAG ALK+NITTIGPLVLP SEQ+LF    +GR+
Sbjct  301   RAYRCVYQEEDGEKKIGVSLSRDLTEIAGGALKANITTIGPLVLPLSEQVLFFVNKVGRR  360

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
               NPKW+PY+PDF +AFEHFCIHAGGRAVI+EL   L+LS E  EASRMTLHRFGNTSSS
Sbjct  361   FANPKWRPYVPDFTKAFEHFCIHAGGRAVIEELGTKLRLSEEQTEASRMTLHRFGNTSSS  420

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S WYEL Y+E+KGRM+KGDR+WQI  GSGFKCNSAVW+C R++ +  +G W DCID YPV
Sbjct  421   SPWYELGYVEAKGRMRKGDRVWQIGLGSGFKCNSAVWRCRRSVGREEEGVWADCIDEYPV  480

Query  624   H  622
             H
Sbjct  481   H  481



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/483 (65%), Positives = 394/483 (82%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTL L+P+M+ + I+V +  P++I        +   L+ V+
Sbjct  23    QSVNLKYVKLGYHYLITHLLTLCLIPLMSVIIIQVSQMNPQDIHQLWLH--LKYNLVSVI  80

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PRS+YLVD++CYKPP    V F+ F+EHSRL    +  S+EFQ
Sbjct  81    ACSTILVFGSTVYIMTRPRSVYLVDFSCYKPPSNLSVKFTKFVEHSRLKGDFDESSLEFQ  140

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET LP A+H IPP P+M +AR EAE+V++ A+D L   T++K KDI IL
Sbjct  141   RKILERSGLGEETYLPEAMHQIPPTPSMASAREEAEQVMYGALDNLFANTKIKPKDIGIL  200

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+
Sbjct  201   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAV  260

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTHKG+D
Sbjct  261   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGSDRRRAKYKLVHVVRTHKGAD  320

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  321   DKAFKCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFTTLVVK  380

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  381   KLFNAKAKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPMHVEASRMTLHRFGNTSS  440

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL YIE+KGRM+KG+RIWQIAFGSGFKCNSAVW+  ++++  +  PW DCIDRYP
Sbjct  441   SSIWYELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQAMKHVRASSKSPWEDCIDRYP  500

Query  627   VHI  619
             V I
Sbjct  501   VEI  503



>ref|XP_011037520.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 390/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTL  VP +A V  +  +  P +I        +   L+ V+
Sbjct  28    QSVNLKYVKLGYHYLITHLLTLCFVPSIAFVIFQASQLNPNDIHQLWLH--LQYNLVSVI  85

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S+FLVF AT+Y++++PRS+YLVDYACYKPP   +V +  FMEHS+L    +  S+EFQ
Sbjct  86    ICSVFLVFGATVYIVTRPRSVYLVDYACYKPPAKLQVKYEQFMEHSKLTGDFDDSSLEFQ  145

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLGEET +P A+HYIPP+P+M AAR EAE+V+F A+D L   T +K KDI +L
Sbjct  146   RRILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDILFANTNIKPKDIGVL  205

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+++NL GMGCSAG+I++DLA+D+L +H N+ A+
Sbjct  206   VVNCSLFNPTPSLSAMIVNKYKLRGNIRTFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAV  265

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTHKG+D
Sbjct  266   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGAD  325

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  326   DKAFKCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAK  385

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  386   KLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSS  445

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGR+++GDR+WQIAFGSGFKCNSAVW+  R +K     PW DCID+YP
Sbjct  446   SSIWYELAYTEAKGRVRRGDRVWQIAFGSGFKCNSAVWEALRYVKPSTSNPWEDCIDKYP  505

Query  627   VHI  619
             V I
Sbjct  506   VQI  508



>ref|XP_006341948.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Solanum tuberosum]
Length=519

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 393/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++H+LTL L+PVMA + +EV +  P++I  R     +   L+ V+
Sbjct  37    QSVNLKYVKLGYHYLISHLLTLCLIPVMAVILVEVSQMNPDDI--RQLWLHLQYNLVSVI  94

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PR +YLVDY+CYK P   + P+  FM+HSRL    +  S+EFQ
Sbjct  95    ICSAVLVFGSTVYIMTRPRPVYLVDYSCYKAPEHLKAPYERFMQHSRLTGDFDESSLEFQ  154

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG+ET +P A+H +PP+P+M AAR EAE+V+F A+D L   T +K K I +L
Sbjct  155   RKILERSGLGDETYVPEAMHQLPPQPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVL  214

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+
Sbjct  215   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAV  274

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+H VRTH+G+D
Sbjct  275   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDRRRAKYKLVHAVRTHRGAD  334

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  +LI +
Sbjct  335   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFGSLIIK  394

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+  HVEASRMTLHRFGNTSS
Sbjct  395   KIFNKHIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSS  454

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL YIE+KGRMKKG+++WQIAFGSGFKCNSAVW+  RN+K   DGPW DCIDRYP
Sbjct  455   SSIWYELAYIEAKGRMKKGNKVWQIAFGSGFKCNSAVWQALRNVKPSPDGPWEDCIDRYP  514

Query  627   VHI  619
             V +
Sbjct  515   VKV  517



>ref|XP_004238271.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Solanum lycopersicum]
Length=517

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 393/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++H+LTL L+PVMA + IE  +  P++I  R     +   L+ V+
Sbjct  35    QSVNLKYVKLGYHYLISHLLTLCLIPVMAVILIEASQMNPDDI--RQLWLHLQYNLVSVI  92

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PR +YL+DY+CYK P   + P+  FM+HSRL    +  S+EFQ
Sbjct  93    ICSAVLVFGSTVYIMTRPRPVYLIDYSCYKAPEHLKAPYERFMQHSRLTGDFDESSLEFQ  152

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG+ET +P A+H +PP+P+M AAR EAE+V+F A+D L   T +K K I +L
Sbjct  153   RKILERSGLGDETYVPEAMHQLPPQPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVL  212

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+
Sbjct  213   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAV  272

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH+G+D
Sbjct  273   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGAD  332

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  +LI +
Sbjct  333   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFGSLIIK  392

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KIFN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+  HVEASRMTLHRFGNTSS
Sbjct  393   KIFNKHIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSS  452

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL YIE+KGRMKKG+++WQIAFGSGFKCNSAVW+  RN+K   DGPW DCIDRYP
Sbjct  453   SSIWYELAYIEAKGRMKKGNKVWQIAFGSGFKCNSAVWQALRNVKPSPDGPWEDCIDRYP  512

Query  627   VHI  619
             V +
Sbjct  513   VKV  515



>ref|XP_007200967.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
 gb|EMJ02166.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
Length=506

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/480 (65%), Positives = 390/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H+LTL  VP+MA V I+  +  P++I        +   L+ V+ 
Sbjct  25    SVNLKYVKLGYHYLITHLLTLCSVPLMAVVVIQASQMNPDDIHHLWLQ--LQYNLVSVII  82

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+Y+M++PRS+YLVDY+CYKPP   +V F  FMEHS+L    +  S+EFQ 
Sbjct  83    FSAVIVFGSTVYIMTRPRSVYLVDYSCYKPPSHLQVRFQQFMEHSKLTGDFDESSLEFQR  142

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HY+PP+P+M AAR EAE+VIF A+D L   T +K KDI IL+
Sbjct  143   KILERSGLGEETYVPEAMHYLPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILV  202

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+++L VH N+ A+V
Sbjct  203   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNAYAVV  262

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTH+G+DD
Sbjct  263   VSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSLDRRRAKYKLVHVVRTHRGADD  322

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  323   KAFRCVYQEQDNTGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKK  382

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  383   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  +N+K     PW DCIDRYPV
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQNVKPSLHSPWEDCIDRYPV  502



>ref|XP_009627040.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana tomentosiformis]
Length=516

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 393/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL L+PVMA + IE  +  P++I  R     +   L+ V+
Sbjct  34    QSVNLKYVKLGYHYLISNLLTLCLIPVMAVILIEASQMNPDDI--RQLWLHLKYNLVFVI  91

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PR +YLVDY+CYK P   + P+  FM+HSRL    +  S+EFQ
Sbjct  92    ICSAVLVFGSTVYIMTRPRPVYLVDYSCYKAPDELKAPYERFMQHSRLTGDFDESSLEFQ  151

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG+ET +P A+HY+PP+P+M AARGEAE+V+F A+D L   T +K KDI +L
Sbjct  152   RKILERSGLGDETYVPEAMHYLPPQPSMQAARGEAEQVMFGALDNLFANTSVKPKDIGVL  211

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+
Sbjct  212   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAV  271

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTH+G+D
Sbjct  272   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSVDRRRAKYKLVHVVRTHRGAD  331

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TLI +
Sbjct  332   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLIIK  391

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI N   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+  HVEASRMTLHRFGNTSS
Sbjct  392   KICNKHVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSS  451

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG+++WQIAFGSGFKCNSAVW+  RN+K    GPW DCIDRYP
Sbjct  452   SSIWYELAYTEAKGRMRKGNKVWQIAFGSGFKCNSAVWQALRNVKPSQKGPWEDCIDRYP  511

Query  627   VHI  619
             V +
Sbjct  512   VKV  514



>ref|XP_011048431.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 391/482 (81%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LK+VKLGY YL+ H+LTL LVP+MA V  +  +  P +I        +   L+ V+ 
Sbjct  29    SVNLKHVKLGYHYLITHLLTLCLVPLMAFVIFQAFQLNPNDIHQLWLH--LQYNLVSVII  86

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF AT+Y+M++PRS++LVDYACYKPP   +V F  FMEHS L    +  S+EFQ 
Sbjct  87    CSAFLVFGATVYIMTRPRSLFLVDYACYKPPSNLQVKFEQFMEHSNLTGDFDDSSLEFQR  146

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HYIPP+P+M AAR EA++V+F A++ L   T +K KDI IL+
Sbjct  147   KILERSGLGEETYVPEAMHYIPPRPSMAAAREEAQQVMFGALNVLFANTNIKPKDIGILV  206

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  207   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVV  266

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTHKG+DD
Sbjct  267   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDKRRAKYKLVHVVRTHKGADD  326

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA++CVY+++D  GK G++LSK+LM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  327   KAFKCVYQEQDDAGKTGVSLSKELMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKK  386

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  387   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  446

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+K R+++GDR+WQIAFGSGFKCNSA+W+  R++K  +  PW DCIDRYPV
Sbjct  447   SIWYELAYTEAKERVRRGDRVWQIAFGSGFKCNSAIWEALRHVKPSSSNPWQDCIDRYPV  506

Query  624   HI  619
              I
Sbjct  507   QI  508



>ref|XP_010248169.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=518

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/481 (65%), Positives = 392/481 (81%), Gaps = 2/481 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++H+LTL L+P+MA + +EV +  PE++  R     +   L+ V+ 
Sbjct  37    SVNLKYVKLGYHYLMSHLLTLCLIPLMAVIMVEVGQMNPEDV--RQLWLHLQYNLVSVIV  94

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF +TLY+M++PR +YLVDY+CY+PP   +V    FMEHSRL    +  S+EFQ 
Sbjct  95    CSAFLVFGSTLYIMTRPRPVYLVDYSCYRPPSRLQVRSDQFMEHSRLTGDFDDASLEFQR  154

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +I+ERSGLG+ET +P A+HY+PP+P+M AAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  155   KIVERSGLGDETYVPEAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTSVKPKDIGILV  214

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  215   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVV  274

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ ++ML+PNCLFR+GGAA+L+SNK  D  R+KY+L+HVVRTHKG++D
Sbjct  275   VSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNKSADRRRSKYKLVHVVRTHKGAED  334

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
              A+RCVY+++D  GKVG++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  335   TAFRCVYQEQDDAGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFXTLVAKK  394

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRM+LHRFGNTSSS
Sbjct  395   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLMPVHVEASRMSLHRFGNTSSS  454

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+  R++K    GPW DCIDRYPV
Sbjct  455   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWEALRHVKPSPKGPWEDCIDRYPV  514

Query  624   H  622
              
Sbjct  515   Q  515



>ref|XP_010243778.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nelumbo nucifera]
Length=518

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/481 (65%), Positives = 392/481 (81%), Gaps = 2/481 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++H+LTL L+P+MA + +EV +  PE++  R     +   L+ V+ 
Sbjct  37    SVNLKYVKLGYHYLMSHLLTLCLIPLMAVIMVEVGQMNPEDV--RQLWLHLQYNLVSVIV  94

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF +TLY+M++PR +YLVDY+CY+PP   +V    FMEHSRL    +  S+EFQ 
Sbjct  95    CSAFLVFGSTLYIMTRPRPVYLVDYSCYRPPSRLQVRSDQFMEHSRLTGDFDDASLEFQR  154

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +I+ERSGLG+ET +P A+HY+PP+P+M AAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  155   KIVERSGLGDETYVPEAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTSVKPKDIGILV  214

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  215   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVV  274

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ ++ML+PNCLFR+GGAA+L+SNK  D  R+KY+L+HVVRTHKG++D
Sbjct  275   VSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNKSADRRRSKYKLVHVVRTHKGAED  334

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
              A+RCVY+++D  GKVG++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  335   TAFRCVYQEQDDAGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLVAKK  394

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRM+LHRFGNTSSS
Sbjct  395   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLMPVHVEASRMSLHRFGNTSSS  454

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+  R++K    GPW DCIDRYPV
Sbjct  455   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWEALRHVKPSPKGPWEDCIDRYPV  514

Query  624   H  622
              
Sbjct  515   Q  515



>ref|XP_002305431.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
 gb|EEE85942.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
Length=510

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/483 (64%), Positives = 390/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTL  VP++A V  +  +  P +I        +   L+ V+
Sbjct  28    QSVNLKYVKLGYHYLITHLLTLCFVPLIAFVIFQASQLNPNDIHQLWLH--LQYNLVSVI  85

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S+FLVF AT+Y++++PRS+YLVDYACYKPP   +V +  FMEHS+L    +  S+EFQ
Sbjct  86    ICSVFLVFGATVYIVTRPRSVYLVDYACYKPPAKLQVKYEQFMEHSKLTGDFDDSSLEFQ  145

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLGEET  P A+HYIPP+P+M AAR EAE+V+F A+D L   T +K KDI +L
Sbjct  146   RRILERSGLGEETYAPEAMHYIPPRPSMAAAREEAEQVMFGALDVLFANTNIKPKDIGVL  205

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+++NL GMGCSAG+I++DLA+D+L +H N+ A+
Sbjct  206   VVNCSLFNPTPSLSAMIVNKYKLRGNIRTFNLGGMGCSAGVIAVDLAKDMLQIHRNTCAV  265

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTHKG+D
Sbjct  266   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGAD  325

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  326   DKAFKCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAK  385

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  386   KLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSS  445

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGR+++G+R+WQIAFGSGFKCNSAVW+  R +K     PW DCID+YP
Sbjct  446   SSIWYELAYTEAKGRVRRGNRVWQIAFGSGFKCNSAVWEALRYVKPSTSNPWEDCIDKYP  505

Query  627   VHI  619
             V I
Sbjct  506   VQI  508



>ref|XP_010028602.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Eucalyptus grandis]
Length=513

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 387/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H LTLLLVP MA + ++  +  PEEI        +   L+ V+ 
Sbjct  32    SVNLKYVKLGYHYLMTHFLTLLLVPSMAVIIVQASQMNPEEINQLWLH--LKYNLVSVII  89

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF +T+Y+MS+PRS+YLVDY+CYKPP   +V F  FMEHS+L    +  S+EFQ 
Sbjct  90    CSAFLVFGSTVYIMSRPRSVYLVDYSCYKPPEHLQVKFHQFMEHSKLTGDFDESSLEFQR  149

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +IL RSGLGEET +P A+HY+PP+P+M AAR E+E+V++ A+D L   T +K KDI IL+
Sbjct  150   KILARSGLGEETYVPEAMHYLPPRPSMAAAREESEQVMYGALDNLFANTNVKPKDIGILV  209

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NIKS+NL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  210   VNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVV  269

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTH+G+DD
Sbjct  270   VSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSSDRRRAKYKLVHVVRTHRGADD  329

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  330   KAFRCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKK  389

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
              FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRM LHRFGNTSSS
Sbjct  390   FFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPSHVEASRMALHRFGNTSSS  449

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+      PW DCI +YPV
Sbjct  450   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVTPSPSSPWEDCIHKYPV  509

Query  624   HI  619
              +
Sbjct  510   QL  511



>ref|XP_009406296.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/483 (66%), Positives = 397/483 (82%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV +KYVKLGY YL+ H+L LLL+P+M  + +E  +  P++  +R     +   L+ VL
Sbjct  29    QSVNIKYVKLGYHYLITHLLALLLIPLMVVILLEAAQTEPDD--LRQLWLHLQYNLVSVL  86

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLVF AT+Y+M++PR +YLVDYACY+PP   +VPF  FM+HS+L+ + N  S+EFQ
Sbjct  87    VCSAFLVFGATVYIMTRPRPVYLVDYACYRPPPKLQVPFRRFMKHSQLSGEFNESSLEFQ  146

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLG+ETCLP+A+HYIPP+P+M  AR EAE+V+F A+D L + T +K KD+ IL
Sbjct  147   RRILERSGLGQETCLPSALHYIPPRPSMAYAREEAEDVMFGALDTLFRNTGVKPKDVGIL  206

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VN+YKLR NIKS+NL GMGCSAG+ISIDLARDLL VH ++ A+
Sbjct  207   VVNCSLFNPTPSLSAMIVNRYKLRGNIKSFNLGGMGCSAGVISIDLARDLLQVHRSTYAV  266

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ ++ML+PNCLFR+G AA+L+SN+  D  RA+Y+L+HVVRTH+G+D
Sbjct  267   VVSTENITQNWYFGNRKSMLIPNCLFRVGAAAVLLSNRTVDRRRARYKLVHVVRTHRGAD  326

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GKVG++LSK+LM IAGEALK NITT+GPLVLP SEQLLF  TL+ +
Sbjct  327   DKAFRCVYQEQDEAGKVGVSLSKELMAIAGEALKINITTLGPLVLPISEQLLFFATLVAK  386

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNTSS
Sbjct  387   KLFNGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRPEHVEASRMTLHRFGNTSS  446

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+  R++K   DGPW DCI RYP
Sbjct  447   SSIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWQALRSVKPSPDGPWEDCIHRYP  506

Query  627   VHI  619
             V I
Sbjct  507   VEI  509



>ref|XP_011083903.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Sesamum indicum]
Length=522

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 394/482 (82%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL LVP+M  + +EV +  P ++  R     +   L+ V+ 
Sbjct  41    SVNLKYVKLGYHYLISNLLTLCLVPLMVIIIVEVSQMNPNDV--RQLWLHLQYNLVSVII  98

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF +T+Y+M++PR +YLVDY+CY+PP +   PF  FMEHSRL    +  S+EFQ 
Sbjct  99    CSAFLVFGSTVYIMNRPRPVYLVDYSCYRPPDSLMAPFDRFMEHSRLQGDFDESSLEFQR  158

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLG+ET +P A+H+IPP+P+M AAR EAE+V+F A+D L   T +K K+I +L+
Sbjct  159   KILERSGLGDETYVPEAMHFIPPRPSMQAAREEAEQVMFGALDNLFANTNVKPKEIGVLV  218

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  219   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVV  278

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VS E IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTHKG+DD
Sbjct  279   VSMENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKAGDRRRAKYKLVHVVRTHKGADD  338

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  339   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVIKK  398

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  399   LFNKNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  458

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSAVW+  R++K   +GPW DCIDRYPV
Sbjct  459   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRSVKPSRNGPWHDCIDRYPV  518

Query  624   HI  619
              +
Sbjct  519   KV  520



>ref|XP_010690872.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Beta vulgaris subsp. vulgaris]
Length=508

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/485 (65%), Positives = 394/485 (81%), Gaps = 8/485 (2%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIV---MRIKDSVMSLELIH  1894
             SV LKYVKLGY YL+ H+LTL L+P+M+ + I+  +   +++    + +K ++ S     
Sbjct  27    SVNLKYVKLGYHYLMTHLLTLCLIPLMSVILIQASQMQYDDVYHLWVHLKYNIFS-----  81

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             V+     LVF  TLY+M++PRSIYLVD++ Y PP   +V FS F+EHSRL       S++
Sbjct  82    VIICCTILVFGFTLYIMTRPRSIYLVDFSLYYPPNKFKVKFSDFVEHSRLTGDFEESSLD  141

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGEET +P A+H IPP+P+M AAR E+E+V+FSA++ L+  T +K KDI 
Sbjct  142   FQRKILERSGLGEETVVPEAMHSIPPRPSMQAAREESEQVMFSALENLLSHTGIKTKDIG  201

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNK+KLR NIKS+NL GMGCSAG+I+IDLA+D+L VH N+ 
Sbjct  202   ILVVNCSLFNPTPSLSAMIVNKFKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTY  261

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+ +L+SNK  D  RAKYRL+HVVRTH+G
Sbjct  262   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSVVLLSNKSIDRARAKYRLVHVVRTHRG  321

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA++CVY+++D  GK G++LSKDLM IAG+ALK+NITT+GPLVLP SEQLLF FTL+
Sbjct  322   ADDKAFKCVYQEQDDVGKTGVSLSKDLMAIAGDALKTNITTLGPLVLPISEQLLFFFTLV  381

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              RK FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNL+LSS HVEASRMTLHRFGNT
Sbjct  382   VRKFFNVKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLELSSVHVEASRMTLHRFGNT  441

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL YIE+KGRMKKG R+WQIAFGSGFKCNSAVW+  RN+K     PWLDCIDR
Sbjct  442   SSSSIWYELGYIEAKGRMKKGHRVWQIAFGSGFKCNSAVWQALRNVKPSPKSPWLDCIDR  501

Query  633   YPVHI  619
             YPV I
Sbjct  502   YPVEI  506



>ref|XP_010530834.1| PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1 [Tarenaya hassleriana]
 ref|XP_010530836.1| PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X2 [Tarenaya hassleriana]
Length=515

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/492 (64%), Positives = 394/492 (80%), Gaps = 8/492 (2%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY Y++ H+  L LVP+MA V +E  R  P++  +R     +   L+
Sbjct  24    NFLQSVNMKYVKLGYHYIITHMWKLCLVPLMAIVALEASRLSPDD--LRHLWIHLQYNLV  81

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
              V+  S  LVF +T+Y+M++PRS++LVDY+CYKPP   +V F  FM+HSRL    +  S+
Sbjct  82    GVIVFSAVLVFGSTVYIMTRPRSVFLVDYSCYKPPSHMQVKFQKFMDHSRLIEDFDDSSL  141

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             +FQ +ILERSGLGEET LP A+H IPPKPTM AAR EAE+V+F A+D+L + T++K +DI
Sbjct  142   QFQRKILERSGLGEETYLPEALHCIPPKPTMAAAREEAEQVMFGALDSLFENTKIKPRDI  201

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              IL+VNCSLF+PTPSLSAM++NKYKLR NIKSYNL GMGCSAG+ISIDLA+DLL VH N+
Sbjct  202   GILVVNCSLFNPTPSLSAMIINKYKLRGNIKSYNLGGMGCSAGVISIDLAKDLLQVHRNT  261

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  R+KY+L+H +RTHK
Sbjct  262   YAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAMLLSNKSGDRRRSKYKLVHTIRTHK  321

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+DDKA++CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQLLF  TL
Sbjct  322   GADDKAFKCVYQEQDDNGKTGVSLSKDLMAIAGEALKTNITTLGPLVLPISEQLLFFMTL  381

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGG------RAVIDELQKNLQLSSEHVEASRMT  835
             + +++FN K KPYIPDFK AFEHFCIHAGG      RAVIDEL+KNLQLS  HVEASRMT
Sbjct  382   VAKRLFNAKIKPYIPDFKLAFEHFCIHAGGRAGIDERAVIDELEKNLQLSPTHVEASRMT  441

Query  834   LHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGP  655
             LHRFGNTSSSS+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW   RN+K   + P
Sbjct  442   LHRFGNTSSSSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVKPSVNSP  501

Query  654   WLDCIDRYPVHI  619
             W DCI RYPV I
Sbjct  502   WEDCIYRYPVKI  513



>ref|XP_004289669.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 393/489 (80%), Gaps = 4/489 (1%)
 Frame = -3

Query  2085  PGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSL  1906
             P F N  SV LKYVKLGY YL+ ++L L L+P+MA + IE  +  P++I        +  
Sbjct  23    PDFLN--SVNLKYVKLGYHYLITNLLKLCLIPLMALIVIEASQMNPDDIHQLWLQ--LQY  78

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+ V+  S  LVF +T+Y+M++PRS+YLVDY+CYK P   +V +  FM+HSRL    + 
Sbjct  79    NLVSVIVFSAVLVFGSTVYIMTRPRSVYLVDYSCYKAPDHLKVKYQKFMDHSRLTGDFDE  138

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
              S+EFQ +ILERSGLGEET LP A+H+IPP+PTM AAR EAE+VIF A+D L   T +K 
Sbjct  139   SSLEFQRKILERSGLGEETYLPEAMHFIPPRPTMAAAREEAEQVIFGALDNLFANTNVKP  198

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDI IL+VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH
Sbjct  199   KDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVH  258

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
              N+ A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVR
Sbjct  259   RNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSLDRRRAKYKLVHVVR  318

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+DDKA+RCVY+++D  GK G++LSK+LM IAG ALK+NITT+GPLVLP SEQLLF 
Sbjct  319   THKGADDKAFRCVYQEQDDIGKTGVSLSKELMAIAGGALKTNITTLGPLVLPLSEQLLFF  378

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TL+ +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVE+SRMTLHR
Sbjct  379   ATLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVESSRMTLHR  438

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSS+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  +N+K    GPW D
Sbjct  439   FGNTSSSSIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQNVKPSPSGPWED  498

Query  645   CIDRYPVHI  619
             CID YPV I
Sbjct  499   CIDSYPVQI  507



>ref|XP_009760261.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana sylvestris]
Length=516

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 393/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL L+PVMA + IE  +  P++I  R     +   L+ V+
Sbjct  34    QSVNLKYVKLGYHYLISNLLTLCLIPVMAVILIEASQMNPDDI--RHLWLHLKYNLVSVI  91

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PR +YLVDY+CYK P   + P+  FM+HSRL    +  S+EFQ
Sbjct  92    ICSAVLVFGSTVYIMTRPRPVYLVDYSCYKAPDELKAPYERFMQHSRLTGDFDESSLEFQ  151

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG+ET +P A+H++PP+P+M AAR EAE+V+F A+D L   T +K KDI IL
Sbjct  152   RKILERSGLGDETYVPEAMHHLPPQPSMQAAREEAEQVMFGALDNLFANTSVKPKDIGIL  211

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+
Sbjct  212   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAV  271

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTH+G+D
Sbjct  272   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSVDRRRAKYKLVHVVRTHRGAD  331

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TLI +
Sbjct  332   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLIIK  391

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             KI N   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+  HVEASRMTLHRFGNTSS
Sbjct  392   KICNKHVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSS  451

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG+++WQIAFGSGFKCNSAVW+  RN+K   +GPW DCIDRYP
Sbjct  452   SSIWYELAYTEAKGRMRKGNKVWQIAFGSGFKCNSAVWQALRNVKPSQNGPWEDCIDRYP  511

Query  627   VHI  619
             V +
Sbjct  512   VKV  514



>ref|XP_003606927.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES89124.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=504

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 391/482 (81%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H+LTL L+P+M+ + I+V +  P EI        +   L+ ++ 
Sbjct  23    SVNLKYVKLGYHYLITHLLTLCLIPLMSVIIIQVSQMNPNEIHQLWLH--LKYNLVSIIT  80

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF +T+Y+M++PRSIYL+D++CYKPP    V F+ F++HS+L    +  S+EFQ 
Sbjct  81    CSAILVFGSTVYIMTRPRSIYLIDFSCYKPPSNLAVKFTKFIQHSKLKGDFDESSLEFQR  140

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGE+T LP A+H IPP P M +AR EAE+V++ A+D L   T++K KDI IL+
Sbjct  141   KILERSGLGEDTYLPEAMHKIPPTPCMASAREEAEQVMYGALDNLFANTKIKPKDIGILV  200

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+V
Sbjct  201   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVV  260

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTHKG+DD
Sbjct  261   VSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGCDRSRAKYKLVHVVRTHKGADD  320

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  321   KAFKCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFTTLVIKK  380

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
              FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQL  +HVEASRMTLHRFGNTSSS
Sbjct  381   WFNAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLMPDHVEASRMTLHRFGNTSSS  440

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+KG+RIWQIAFGSGFKCNSAVW+  +++K     PW DCIDRYPV
Sbjct  441   SIWYELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQAMKHVKASPMSPWEDCIDRYPV  500

Query  624   HI  619
              I
Sbjct  501   EI  502



>ref|XP_008236905.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Prunus mume]
Length=506

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/480 (65%), Positives = 388/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H+LTL  VP+MA V I+  +   ++I        +   L+ V+ 
Sbjct  25    SVNLKYVKLGYHYLITHLLTLCSVPIMAVVVIQASQMNLDDIHHLWLQ--LQYNLVSVII  82

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+Y+M++PRS+YLVDY+CYKPP   +V F  FMEHS+L    +  S+EFQ 
Sbjct  83    FSAVIVFGSTVYIMTRPRSVYLVDYSCYKPPSHLQVRFQQFMEHSKLTGDFDESSLEFQR  142

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+VIF A+D L   T +K KDI IL+
Sbjct  143   KILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILV  202

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+++L VH N+ A+V
Sbjct  203   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNTYAVV  262

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SN+  D  RAKY+L+HVVRTH+G+DD
Sbjct  263   VSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSLDRRRAKYKLVHVVRTHRGADD  322

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  323   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKK  382

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  383   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  +N+K     PW DCID YPV
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQNVKPSLHSPWEDCIDWYPV  502



>gb|KDP46259.1| hypothetical protein JCGZ_10099 [Jatropha curcas]
Length=510

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 394/483 (82%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++H+LTL L+P+MA + +E  +  PE++        +   L+ V+
Sbjct  28    QSVNLKYVKLGYHYLMSHLLTLCLIPLMAVIIVEASQLNPEDVHQLWLQ--LQYNLVTVI  85

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S+F+V  +T+Y+M++PRS+YLVDYACYKPP   +V F  FMEHS+L    +  S+EFQ
Sbjct  86    VCSVFVVVGSTVYIMTRPRSVYLVDYACYKPPPKLQVKFHQFMEHSKLTGDFDESSLEFQ  145

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+H+IPP+P+M AAR EAE+V+F A+D L   T +K KDI IL
Sbjct  146   RKILERSGLGEETYVPEAMHHIPPRPSMAAAREEAEQVMFGALDILFANTNIKPKDIGIL  205

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM++NKYKLR NI S+NL GMGCSAG+I+IDL +DLL +H NS A+
Sbjct  206   VVNCSLFNPTPSLSAMIINKYKLRGNILSFNLGGMGCSAGVIAIDLTKDLLQIHRNSYAV  265

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+H+VRTH+G+D
Sbjct  266   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSTDRRRAKYKLVHLVRTHRGAD  325

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  326   DKAFRCVYQEQDDEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAK  385

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  386   KLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSS  445

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   + PW DCIDRYP
Sbjct  446   SSIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNIKPSTNNPWEDCIDRYP  505

Query  627   VHI  619
             V +
Sbjct  506   VQL  508



>ref|XP_010489197.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Camelina sativa]
Length=511

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/486 (64%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R   E++        +   L+
Sbjct  26    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLVTEISRLTTEDLYQIWLH--LQYNLV  83

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +F S   VF +T+Y+MS+PRS+YLVDY+CY PP T +V +  FM+HS+L    N  S+
Sbjct  84    AFIFLSALAVFGSTVYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHSKLIEDFNESSL  143

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM AAR EAE+V+F A+D L + TE+  +DI
Sbjct  144   EFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFVALDKLFENTEINPRDI  203

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH N+
Sbjct  204   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNT  263

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK +D  R+KY+L+H VRTHK
Sbjct  264   YAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHK  323

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  324   GAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTL  383

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  384   VTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGN  443

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  444   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEHCID  503

Query  636   RYPVHI  619
             RYPV +
Sbjct  504   RYPVKL  509



>ref|XP_008805392.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Phoenix dactylifera]
Length=525

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/483 (65%), Positives = 397/483 (82%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H++TLLL+P+MA + +E  R  P++I  R     +   L+ VL
Sbjct  34    QSVNLKYVKLGYHYLITHLVTLLLIPLMAMILVEAGRTDPDDI--RQLWVHLQYNLVSVL  91

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF +T+Y+M++PR +YLVDYACY+PP   +V F +FMEHSRL+ + N  ++EFQ
Sbjct  92    VCSAVLVFGSTVYIMTRPRPVYLVDYACYRPPERLQVRFRSFMEHSRLSGEFNEGALEFQ  151

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLGEET +P A+H++PP+P+M  AR EAE+V+F A+DAL + T +K KDI IL
Sbjct  152   RRILERSGLGEETYVPEAMHFLPPRPSMAYAREEAEQVMFGALDALFRNTGVKPKDISIL  211

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VN YKLRSNIKS+NL GMGCSAG+I++DLARDLL  H ++ A+
Sbjct  212   VVNCSLFNPTPSLSAMIVNHYKLRSNIKSFNLGGMGCSAGVIAVDLARDLLQAHRSTYAV  271

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ ++ML+PNCLFR+G AA+L+SN+  D  R+KYRL+HVVRTH+G+D
Sbjct  272   VVSTENITQNWYFGNRKSMLIPNCLFRVGAAAVLLSNRSSDRRRSKYRLVHVVRTHRGAD  331

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+A+RCVY+++D +GKVG++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  332   DRAFRCVYQEQDDRGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAK  391

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+  HVE SRMTLHRFGNTSS
Sbjct  392   KLFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTPVHVEPSRMTLHRFGNTSS  451

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL YIE+KGRM++G R+WQIAFGSGFKCNSAVW+  RN+K   + PW DC+DRYP
Sbjct  452   SSIWYELAYIEAKGRMRRGHRVWQIAFGSGFKCNSAVWQALRNVKPSPNSPWEDCMDRYP  511

Query  627   VHI  619
             V +
Sbjct  512   VQL  514



>ref|XP_008377297.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=506

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 388/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             +V LKYVKLGY YL+ H+LTL LVP+MA V IE  +  P++I        +   L+ V+ 
Sbjct  25    TVNLKYVKLGYHYLITHLLTLCLVPLMAVVVIEASQMNPDDIHQLWLQ--LQYNLVSVII  82

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+Y+M++PRS+YLVDY+CYKPP   +V +  FMEHS+L    +  S+EFQ 
Sbjct  83    FSAMVVFGSTVYIMTRPRSVYLVDYSCYKPPSHLQVRYQQFMEHSKLTGDFDESSLEFQR  142

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+VIF A+D L   T +K KDI IL+
Sbjct  143   KILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILV  202

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L +H N+ A+V
Sbjct  203   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVV  262

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH G+DD
Sbjct  263   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDWRRAKYKLVHVVRTHCGADD  322

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  323   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFVTLVAKK  382

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  383   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  +++K     PW DCI  YPV
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQSVKPSPHSPWEDCIRGYPV  502



>gb|AGH32920.1| ketoacyl-CoA synthase [Camellia chekiangoleosa]
Length=517

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY Y+++++LTL L+P+MA + +E  +  P+EI        +   L+ V+
Sbjct  35    QSVNLKYVKLGYHYVISNLLTLCLIPLMAMLVLESSQMNPDEIHQLWVH--LQYNLLSVV  92

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S+FLVF +T+Y+M++P+ +YLVDYACY+ P   +  +  FM HSRL    +  S+EFQ
Sbjct  93    ICSVFLVFGSTVYIMTRPKPVYLVDYACYRAPDHLKASYHKFMNHSRLTGDFDESSLEFQ  152

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET  P A+H IPP+P+M AAR EAE+V+F A+D L   T +K+KDI +L
Sbjct  153   RKILERSGLGEETYFPEAMHSIPPRPSMAAARDEAEQVMFGALDNLFANTNVKSKDIGVL  212

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR N++S+NL GMGCSAG+I++DLA+DLL +H N+ A+
Sbjct  213   VVNCSLFNPTPSLSAMIVNKYKLRGNVRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTCAV  272

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ ++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTHKG+D
Sbjct  273   VVSTENITQNWYFGNNKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHKGAD  332

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  TL+ +
Sbjct  333   DKAFRCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFATLVVK  392

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN   KPYIPDF  AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  393   KLFNKNIKPYIPDFTLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSS  452

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL YIE+KGRM+KG R+WQIAFGSGFKCNSAVWK  RN+K+P +GPW DCID+YP
Sbjct  453   SSIWYELAYIEAKGRMRKGHRVWQIAFGSGFKCNSAVWKALRNVKQPRNGPWEDCIDKYP  512

Query  627   VHI  619
             V +
Sbjct  513   VEL  515



>ref|XP_010467354.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Camelina sativa]
Length=511

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R   E++        +   L+
Sbjct  26    NFLQSVNIKYVKLGYHYLITHLFKLCLVPLMAVLVTEISRLTTEDLYQIWLH--LQYNLV  83

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +  S   VF +T+Y+MS+PRS+YLVDY+CY PP T +V +  FM+HS+L    N  S+
Sbjct  84    AFIVLSALAVFGSTVYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHSKLIEDFNESSL  143

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM AAR EAE+V+F A+D L + TE+  +DI
Sbjct  144   EFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTEINPRDI  203

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH N+
Sbjct  204   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNT  263

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK +D  R+KY+L+H VRTHK
Sbjct  264   YAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHK  323

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  324   GAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTL  383

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  384   VTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGN  443

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  444   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEHCID  503

Query  636   RYPVHI  619
             RYPV +
Sbjct  504   RYPVKL  509



>ref|XP_010255306.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=523

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/481 (65%), Positives = 389/481 (81%), Gaps = 2/481 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YLV+H+LTL L+P+MA + ++  +  PE+   R     +   L+ V+
Sbjct  41    QSVNLKYVKLGYHYLVSHLLTLCLIPLMAMIIVQAGQMNPED--ARQLWLHLQYNLVSVI  98

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLVF +TLY+M++PR +YLVDYACY+PP   +V    FMEHSRL    +  S+EFQ
Sbjct  99    VCSAFLVFGSTLYVMTRPRPVYLVDYACYRPPSHFQVRPQKFMEHSRLIGDFDEASLEFQ  158

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG+ET LP A+H +PP+P+M AAR EAE+V+F A+D L   T +K KDI IL
Sbjct  159   RKILERSGLGDETYLPEAMHCLPPRPSMAAAREEAEQVMFGALDTLFANTSVKPKDIGIL  218

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM++NKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+
Sbjct  219   VVNCSLFNPTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHGNTYAV  278

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTH+G+D
Sbjct  279   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRAKYKLVHVVRTHRGAD  338

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY++ED  GKVG++LSKDLM IAG ALK NITT+GPLVLP SEQLLF  TL+ +
Sbjct  339   DKAFRCVYQEEDDAGKVGVSLSKDLMAIAGGALKINITTLGPLVLPISEQLLFFATLVVK  398

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNL L   HVEASRM+LHRFGNTSS
Sbjct  399   KLFNSKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLHLMPVHVEASRMSLHRFGNTSS  458

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  R++K     PW DCIDRYP
Sbjct  459   SSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWESLRHVKPSPKNPWEDCIDRYP  518

Query  627   V  625
             V
Sbjct  519   V  519



>gb|KDP38510.1| hypothetical protein JCGZ_04435 [Jatropha curcas]
Length=502

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/481 (64%), Positives = 391/481 (81%), Gaps = 2/481 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL  +P++   +IE  +   ++  +R     +   L+ ++
Sbjct  20    QSVNLKYVKLGYHYLISNLLTLCFIPLIVVTSIEASQMNLDD--LRHLWLHLQYNLVSII  77

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLVF  T+Y+M++PR +YLVDYACY+ P   + PF  FMEHSRL    +  S+EFQ
Sbjct  78    ICSAFLVFGLTVYIMTRPRPVYLVDYACYRAPDHLKAPFDQFMEHSRLTGDFDESSLEFQ  137

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V+F A+D L   T +  K+I IL
Sbjct  138   RKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGIL  197

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+
Sbjct  198   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAV  257

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  R+KY+L+HVVRTH+G+D
Sbjct  258   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSGDKNRSKYKLVHVVRTHRGAD  317

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+A+RCVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  318   DRAFRCVYQEQDGAGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVK  377

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  378   KLFNKKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSS  437

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+K RM+KG+R+WQIAFGSGFKCNSAVW+  RN+K  A+GPW DCID+YP
Sbjct  438   SSIWYELAYVEAKRRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSANGPWEDCIDKYP  497

Query  627   V  625
             V
Sbjct  498   V  498



>ref|XP_009378513.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=506

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/480 (64%), Positives = 387/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             +V LKYVKLGY YL+ H+LTL LVP+MA V IE  +  P++I        +   L+ V+ 
Sbjct  25    TVNLKYVKLGYHYLITHLLTLCLVPLMAVVVIEASQMNPDDIHQLWLQ--LQYNLVSVII  82

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+Y+M++PRS+YLVDY+CYKPP   +V +  FMEHS+L    +  S+EFQ 
Sbjct  83    FSAMVVFGSTVYIMTRPRSVYLVDYSCYKPPSHLQVRYQQFMEHSKLTGDFDESSLEFQR  142

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+VIF A+D L   T +K KD  IL+
Sbjct  143   KILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDFGILV  202

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L +H N+ A+V
Sbjct  203   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVV  262

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH G+DD
Sbjct  263   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHCGADD  322

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  323   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFVTLVAKK  382

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  383   LFNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  +++K     PW DCI  YPV
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQSVKPSPHSPWEDCIHGYPV  502



>ref|XP_002884160.1| hypothetical protein ARALYDRAFT_900287 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60419.1| hypothetical protein ARALYDRAFT_900287 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R   +++        +   L+
Sbjct  26    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLVTEISRLTTDDLYQIWLH--LQYNLV  83

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +F S   +F +T+Y+MS+PRS+YLVDY+CY PP + +V +  FM+HS+L    N  S+
Sbjct  84    AFIFLSALAIFGSTVYIMSRPRSVYLVDYSCYLPPESLQVKYQKFMDHSKLIEDFNESSL  143

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM AAR EAE+V+F A+D L + TE+  +DI
Sbjct  144   EFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTEINPRDI  203

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+I+IDLA+D+L VH N+
Sbjct  204   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNT  263

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK +D  R+KY+L+H VRTHK
Sbjct  264   YAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHK  323

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  324   GAVEKAFNCVYQEQDDYGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTL  383

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  384   VTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGN  443

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  444   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEHCID  503

Query  636   RYPVHI  619
             RYPV +
Sbjct  504   RYPVKL  509



>ref|XP_010516877.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 9-like 
[Camelina sativa]
Length=511

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R   E++        +   L+
Sbjct  26    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLVTEISRLTTEDLYQIWLH--LQYNLV  83

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +F S   VF +T+Y+MS+PRS+YLVDY+CY PP T +V +  FM+HS+L    N  S+
Sbjct  84    AFIFLSALAVFGSTVYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHSKLIEDFNESSL  143

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM AAR EAE+V+F A+D L + TE+  +DI
Sbjct  144   EFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTEINPRDI  203

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH N+
Sbjct  204   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNT  263

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK +D  R+KY+L+H VRTHK
Sbjct  264   YAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHK  323

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  324   GAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTL  383

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  384   VTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGN  443

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+ YEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  444   TSSSSIXYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEHCID  503

Query  636   RYPVHI  619
             RYPV +
Sbjct  504   RYPVKL  509



>ref|XP_006409460.1| hypothetical protein EUTSA_v10022654mg [Eutrema salsugineum]
 gb|ESQ50913.1| hypothetical protein EUTSA_v10022654mg [Eutrema salsugineum]
Length=510

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 384/486 (79%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R  P+++        +   L+
Sbjct  25    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLFTEISRLTPDDLYQLWLH--LQYNLV  82

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +  S   VF +T+++M++PRS+YLVDY+CY PP + +V +  FM+HS+L    N  S+
Sbjct  83    AFILLSALAVFGSTVFIMTRPRSVYLVDYSCYLPPESLKVKYQKFMDHSKLIEDFNDSSL  142

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP PTM AAR EAE+V+F ++D L + T +  +DI
Sbjct  143   EFQRKILERSGLGEETYLPEALHCIPPTPTMVAARQEAEQVMFGSLDKLFENTRINPRDI  202

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR NIKS+NL GMGCSAG+I+IDLA+D+L VH N+
Sbjct  203   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNT  262

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+ +AML+PNCLFR+GG A+L+SNK RD  R+KY+L+H VRTHK
Sbjct  263   YAVVVSTENITQNWYFGNRKAMLIPNCLFRVGGTAVLLSNKSRDRRRSKYKLVHTVRTHK  322

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+D+KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  323   GADEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFATL  382

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  383   VAKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSERHVEASRMTLHRFGN  442

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  443   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALGNVKPSVSSPWEHCID  502

Query  636   RYPVHI  619
             RYPV +
Sbjct  503   RYPVKL  508



>ref|XP_006416504.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
 gb|ESQ34857.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
Length=520

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 390/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL L P+   +++E  +  P++  +R     +   L+ ++
Sbjct  38    QSVNLKYVKLGYHYLISNLLTLCLFPLAVAISVEASQMNPDD--LRQLWIHLQYNLVSII  95

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y+M++PR +YLVD++CY PP   + PF+ FM+HSRL    +  ++EFQ
Sbjct  96    ICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPFTRFMDHSRLTGDFDDSALEFQ  155

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGE+T +P A+HY+PP+ +M AAR EAE+V+F A+D L   T +  KDI IL
Sbjct  156   RKILERSGLGEDTYVPEAMHYVPPRISMAAAREEAEQVMFGALDNLFANTNVNPKDIGIL  215

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH  + A+
Sbjct  216   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRKTYAV  275

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  RAKYRL+HVVRTH+G+D
Sbjct  276   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRAKYRLVHVVRTHRGAD  335

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ +
Sbjct  336   DKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVAK  395

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSS
Sbjct  396   KLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSS  455

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  RN+K     PW DCID+YP
Sbjct  456   SSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRNVKPSKKSPWEDCIDKYP  515

Query  627   VHI  619
             V +
Sbjct  516   VKL  518



>ref|XP_011088406.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Sesamum indicum]
Length=498

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/484 (63%), Positives = 388/484 (80%), Gaps = 5/484 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SV+LKYVKLGY YL  H  TL L+  +A   I++ +   + + + +K ++++L    +
Sbjct  18    QQSVRLKYVKLGYHYLTTHFFTLCLLAFLAFTFIQLSQINFQGLYLHLKYNLVTL----M  73

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +FS   +VF  TLY M++PR++YLVDYACY+PP   RV F  FM HSRL    +  S+EF
Sbjct  74    VFSGA-VVFGLTLYFMTRPRAVYLVDYACYRPPDHLRVDFHKFMHHSRLTGDFDDSSLEF  132

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGEET LP  +H IPP+P+M  AR EAE+V+F A+D L K T +K KDI +
Sbjct  133   QRKILERSGLGEETYLPEPLHQIPPQPSMAKAREEAEQVMFGALDNLFKATGVKPKDIGV  192

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM++NKYKLR NIKS+NL GMGCSAG+I+IDLA+D+L +H N+ A
Sbjct  193   LVVNCSLFNPTPSLSAMIINKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQLHRNTYA  252

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE IT N+Y G++++ML+PNCLFRMGG+A+L+SN+  D  R+KY++MHVVRTH GS
Sbjct  253   VVVSTENITENWYFGNKKSMLIPNCLFRMGGSAVLLSNRASDKRRSKYKMMHVVRTHIGS  312

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
              D A+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ 
Sbjct  313   QDTAFRCVYQEQDERGKTGVSLSKDLMAIAGNALKTNITTLGPLVLPVSEQLLFFVTLVA  372

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+ NPK KPYIPDFK AF+HFCIHAGGRAVIDEL+KNL+L    VEASRMTLHRFGNTS
Sbjct  373   RKLINPKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLRLEPIQVEASRMTLHRFGNTS  432

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL YIE+KGR++KG R+WQIAFGSGFKCNSAVW+  RN+K  A+ PWLDCIDRY
Sbjct  433   SSSIWYELAYIEAKGRIRKGQRVWQIAFGSGFKCNSAVWQALRNVKPSANSPWLDCIDRY  492

Query  630   PVHI  619
             PV I
Sbjct  493   PVKI  496



>ref|XP_006299088.1| hypothetical protein CARUB_v10015226mg [Capsella rubella]
 gb|EOA31986.1| hypothetical protein CARUB_v10015226mg [Capsella rubella]
Length=511

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R   +++        +   L+
Sbjct  26    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLVTEISRLTTDDLYQIWLH--LQYNLV  83

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +F S   VF +T+Y+MS+PRS+YLVDY+CY PP + +V +  FM+HS+L    N  S+
Sbjct  84    AFIFLSALAVFGSTVYIMSRPRSVYLVDYSCYLPPESLQVNYQKFMDHSKLIEDFNESSL  143

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM AAR EAE+V+F A+D L + T++  +DI
Sbjct  144   EFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTKINPRDI  203

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+I+IDLA+D+L VH N+
Sbjct  204   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNT  263

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+V+STE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK +D  R+KY+L+H VRTHK
Sbjct  264   YAVVISTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHK  323

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  324   GAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTL  383

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  384   VTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGN  443

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  444   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEHCID  503

Query  636   RYPVHI  619
             RYPV +
Sbjct  504   RYPVKL  509



>ref|NP_179223.1| 3-ketoacyl-CoA synthase 9 [Arabidopsis thaliana]
 sp|Q9SIX1.1|KCS9_ARATH RecName: Full=3-ketoacyl-CoA synthase 9; Short=KCS-9; AltName: 
Full=Very long-chain fatty acid condensing enzyme 9; Short=VLCFA 
condensing enzyme 9 [Arabidopsis thaliana]
 gb|AAD22309.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEC06480.1| 3-ketoacyl-CoA synthase 9 [Arabidopsis thaliana]
Length=512

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R   +++        +   L+
Sbjct  27    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLVTEISRLTTDDLYQIWLH--LQYNLV  84

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +F S   +F +T+Y+MS+PRS+YLVDY+CY PP + +V +  FM+HS+L    N  S+
Sbjct  85    AFIFLSALAIFGSTVYIMSRPRSVYLVDYSCYLPPESLQVKYQKFMDHSKLIEDFNESSL  144

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM AAR E+E+V+F A+D L + T++  +DI
Sbjct  145   EFQRKILERSGLGEETYLPEALHCIPPRPTMMAAREESEQVMFGALDKLFENTKINPRDI  204

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH N+
Sbjct  205   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNT  264

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK +D  R+KY+L+H VRTHK
Sbjct  265   YAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHK  324

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  325   GAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTL  384

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  385   VTKKLFNSKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGN  444

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  445   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALNNVKPSVSSPWEHCID  504

Query  636   RYPVHI  619
             RYPV +
Sbjct  505   RYPVKL  510



>ref|XP_009782317.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana sylvestris]
Length=518

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/485 (64%), Positives = 389/485 (80%), Gaps = 8/485 (2%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEI---VMRIKDSVMSLELIH  1894
             S+ LKYVKLGY YLV H L+L LVP+++   ++  +   +++    + +K ++ S+    
Sbjct  37    SINLKYVKLGYHYLVTHFLSLCLVPLISVTFVQASQMNYQDLQNLYLHLKLNLASI----  92

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             ++FS+LF VF  T+Y+M++PRSIYLVDY+CY PP   +V FS FM HSRL+   N  S+E
Sbjct  93    IIFSALF-VFGTTVYIMTRPRSIYLVDYSCYHPPEHLKVKFSKFMGHSRLSGDFNESSLE  151

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGEET LP A+H +PP+P+M  AR EAE+V+F A+D L   T +K KDI 
Sbjct  152   FQRKILERSGLGEETYLPEALHDVPPRPSMATAREEAEQVMFGALDNLFNNTNVKPKDIG  211

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYK+R NIKS+NL GMGCSAG+I+IDLA+D+L VH N+ 
Sbjct  212   ILVVNCSLFNPTPSLSAMIVNKYKMRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTY  271

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVS E IT N Y G+ +AML+PNCLFR+GGAAIL+SNK  D  RAKY+++HVVRTHKG
Sbjct  272   AVVVSMENITQNRYFGNNKAMLIPNCLFRVGGAAILLSNKSGDKRRAKYKVVHVVRTHKG  331

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DD A++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  +L+
Sbjct  332   ADDTAFKCVYQEQDDNGKTGVSLSKDLMSIAGNALKTNITTLGPLVLPISEQLLFFMSLV  391

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              RK+F+ K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNT
Sbjct  392   ARKLFHAKIKPYIPDFKMAFEHFCIHAGGRAVIDELEKNLQLSPLHVEASRMTLHRFGNT  451

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL YIE+KGR++KG RIWQIAFGSGFKCNSAVW+   N+K   + PW DCI R
Sbjct  452   SSSSIWYELAYIEAKGRIRKGHRIWQIAFGSGFKCNSAVWQALTNVKPSPNSPWEDCIHR  511

Query  633   YPVHI  619
             YPV +
Sbjct  512   YPVQL  516



>ref|NP_173376.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
 sp|Q9LN49.1|KCS4_ARATH RecName: Full=3-ketoacyl-CoA synthase 4; Short=KCS-4; AltName: 
Full=Very long-chain fatty acid condensing enzyme 4; Short=VLCFA 
condensing enzyme 4 [Arabidopsis thaliana]
 gb|AAF79428.1|AC025808_10 F18O14.21 [Arabidopsis thaliana]
 gb|ACE79746.1| At1g19440 [Arabidopsis thaliana]
 gb|AEE29852.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
Length=516

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 394/483 (82%), Gaps = 6/483 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL++++LTL L P+   +++E  +  P+++    K   + L+  L+ 
Sbjct  34    QSVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQMNPDDL----KQLWIHLQYNLVS  89

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             ++  S  LVF  T+Y+M++PR +YLVD++CY PP   + P++ FMEHSRL    +  ++E
Sbjct  90    IIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDSALE  149

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGE+T +P A+HY+PP+ +M AAR EAE+V+F A+D L   T +K KDI 
Sbjct  150   FQRKILERSGLGEDTYVPEAMHYVPPRISMAAAREEAEQVMFGALDNLFANTNVKPKDIG  209

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ 
Sbjct  210   ILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTY  269

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  R+KYRL+HVVRTH+G
Sbjct  270   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRG  329

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+
Sbjct  330   ADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLV  389

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNT
Sbjct  390   VKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNT  449

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  R++K   + PW DCID+
Sbjct  450   SSSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEDCIDK  509

Query  633   YPV  625
             YPV
Sbjct  510   YPV  512



>ref|XP_002282403.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=509

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 387/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YLV+++LTL LVP+M G+ I+  +  P++  +R     +   L+ V+ 
Sbjct  28    SVNLKYVKLGYHYLVSNLLTLCLVPLMIGILIQASQTNPDD--LRHLWLHLQYNLVSVII  85

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LV   T+Y+  +PR ++LVDYACY+PP   +V F  FM+HS+L       ++EFQ 
Sbjct  86    CSAILVSATTVYITRRPRPVFLVDYACYRPPDHLQVRFHQFMDHSKLTGDFTESTLEFQR  145

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HY+PP+P+M AAR EAE+V+F A+DAL   T +K KDI IL+
Sbjct  146   KILERSGLGEETYVPQAMHYLPPRPSMSAAREEAEQVMFGALDALFSDTCIKPKDIGILV  205

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA DLL VH N+ A+V
Sbjct  206   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLASDLLQVHRNTYAVV  265

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++R+ML+PNCLFR+GGAAIL+SN+ RD  RAKYRL+HVVRTH+G+DD
Sbjct  266   VSTENITQNWYFGNDRSMLIPNCLFRVGGAAILLSNRSRDRRRAKYRLVHVVRTHRGADD  325

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+ CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  326   KAFSCVYQKQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKK  385

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +     KPYIPDFK AF HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNTSSS
Sbjct  386   LLKSNAKPYIPDFKLAFNHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  445

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  R+++   +GPW DCID+YPV
Sbjct  446   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRHVQPSRNGPWEDCIDKYPV  505

Query  624   HI  619
              +
Sbjct  506   KV  507



>gb|AGK29994.1| 3-ketoacyl-CoA synthase 4 [Gossypium raimondii]
Length=504

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/483 (62%), Positives = 388/483 (80%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++H+LTL L+P+M+ + +E  R   +++        +   L+  +
Sbjct  22    QSVNLKYVKLGYHYLISHLLTLCLIPLMSVIVVEASRLSLDDVHQLWLQ--LQYNLVSFI  79

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S+ LVF +T+Y+M++PRS+YL+DY+CY PP   +V +  FMEHS+L    +  S+EFQ
Sbjct  80    VFSVVLVFGSTVYIMTRPRSVYLLDYSCYLPPSHLKVKYQQFMEHSKLTGDFDESSLEFQ  139

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEETC+P A+HY+PP+P+M AAR EAE+V+F A+D L   T +K +DI IL
Sbjct  140   RKILERSGLGEETCVPEAMHYLPPRPSMAAAREEAEQVMFGALDKLFANTNVKPRDIGIL  199

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM++NKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH NS A+
Sbjct  200   VVNCSLFNPTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNSYAV  259

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SN+  D  R+KY+L+HVVRTH G++
Sbjct  260   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRRRSKYKLVHVVRTHCGAN  319

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQ+LF  TL+ +
Sbjct  320   DKAFKCVYQEQDDNGKTGVSLSKDLMAIAGGALKTNITTMGPLVLPISEQILFFVTLVAK  379

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   H EASRMTLHRFGNTSS
Sbjct  380   KLFNAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHAEASRMTLHRFGNTSS  439

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNS VW   RN+K   + PW DCI RYP
Sbjct  440   SSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSTVWVALRNVKPSPNNPWEDCIHRYP  499

Query  627   VHI  619
             V +
Sbjct  500   VQL  502



>ref|XP_006304681.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
 gb|EOA37579.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
Length=512

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/482 (63%), Positives = 394/482 (82%), Gaps = 6/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIHV  1891
             SV LKYVKLGY YL++++LTL L P+   +++E  +  P+++    K   + L+  L+ +
Sbjct  31    SVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQTNPDDL----KQLWIHLQYNLVSI  86

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S FLVF  T+Y+M++PR +YLVD++CY PP   + P+S FMEHS+L    +  S+EF
Sbjct  87    IICSAFLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFMEHSKLTGDFDDSSLEF  146

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE+T +P A+HY+PP+ +M AAR EAE+V+F A+D L   T +  KDI I
Sbjct  147   QRKILERSGLGEDTYVPEAMHYVPPRISMAAARKEAEQVMFGALDNLFADTNVNPKDIGI  206

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A
Sbjct  207   LVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYA  266

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  R+KYRL+HVVRTH+G+
Sbjct  267   VVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSKDKRRSKYRLVHVVRTHRGA  326

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ 
Sbjct  327   DDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFVTLVV  386

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTS
Sbjct  387   KKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTS  446

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  R++K   + PW DCID+Y
Sbjct  447   SSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEDCIDKY  506

Query  630   PV  625
             PV
Sbjct  507   PV  508



>ref|XP_010104374.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB99937.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=513

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 384/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL  VP++    IE  +    +  +R     +   L+ V+
Sbjct  31    QSVNLKYVKLGYHYLISNLLTLCFVPLIIVTLIEASQMDLGD--LRQLWLHLQYNLVSVI  88

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLV   T+Y+M++PR +YLVDY+CY+ P   + PF  FM HS L    +  S+EFQ
Sbjct  89    ICSSFLVVGLTVYIMTRPRPVYLVDYSCYRAPDNLKAPFDRFMTHSELTGDFDDSSLEFQ  148

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+H+IPP+P+M AAR EAE+V+F A+D L   T +K KDI IL
Sbjct  149   RKILERSGLGEETYVPEAMHFIPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGIL  208

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+
Sbjct  209   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAV  268

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKYRL+HVVRTHKG+D
Sbjct  269   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSMDRRRAKYRLVHVVRTHKGAD  328

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  329   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVVK  388

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSS
Sbjct  389   KFFNADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQVHVEASRMTLHRFGNTSS  448

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E++GRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   +GPW DCID+YP
Sbjct  449   SSIWYELAYTEAQGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVKPSRNGPWEDCIDKYP  508

Query  627   VH  622
             V 
Sbjct  509   VE  510



>ref|XP_002509491.1| acyltransferase, putative [Ricinus communis]
 gb|EEF50878.1| acyltransferase, putative [Ricinus communis]
Length=508

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 389/482 (81%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++H+LTL L P++A + ++  +F P++I  R     +   L+ VL 
Sbjct  27    SVNLKYVKLGYHYLMSHLLTLCLAPLIAVIIVQASQFNPDDI--RQLWLQLQYNLVSVLV  84

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
               +F+VF  T+Y+M++PRS++LVDYACYKPP   +V F  FMEHS+L    +  S+EFQ 
Sbjct  85    CCVFVVFGGTVYIMTRPRSVFLVDYACYKPPANLQVKFHQFMEHSKLTGDFDDSSLEFQR  144

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HYIPP+P+  AAR EAE+V+F A+D L     +K K I +L+
Sbjct  145   KILERSGLGEETYVPEAMHYIPPRPSTAAAREEAEQVMFGALDILFANANIKPKAIGVLV  204

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI S+NL GMGCSAG+I+IDLA+DLL +H N+ A+V
Sbjct  205   VNCSLFNPTPSLSAMIVNKYKLRGNIMSFNLGGMGCSAGVIAIDLAKDLLQIHRNTYAVV  264

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  RAKY+L+HVVRTH+G+DD
Sbjct  265   VSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRAKYKLVHVVRTHRGADD  324

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  325   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVSKK  384

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AFEH+CIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  385   LFNAKVKPYIPDFKLAFEHYCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  444

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+   N+K     PW DCIDRYPV
Sbjct  445   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALSNVKPSTSNPWEDCIDRYPV  504

Query  624   HI  619
              +
Sbjct  505   QL  506



>ref|XP_007042184.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
 gb|EOX98015.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
Length=507

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 387/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++H+LTL LVP+MA + +E  R   ++I        +   L+ V+ 
Sbjct  26    SVNLKYVKLGYHYLISHLLTLCLVPLMAVIIVEASRLNLDDIHQLWLQ--LQYNLVSVVV  83

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF +T+Y+M++PRS+++VDY+CY PP   +V +  F+EHS L    +  S+EFQ 
Sbjct  84    FSAILVFGSTVYIMTRPRSVFMVDYSCYLPPPHLKVKYQQFIEHSALTGDFDESSLEFQR  143

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEETC+P A+HY+PP+P+M AAR EAE+V+F A+D L   T +K +DI IL+
Sbjct  144   KILERSGLGEETCVPEAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPRDIGILV  203

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM++NKYK R NI+S+NL GMGCSAG+I++DLA+D+L VH NS A+V
Sbjct  204   VNCSLFNPTPSLSAMIINKYKFRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNSYAIV  263

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  R+KY+L+HVVRTH G++D
Sbjct  264   VSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRSKYKLVHVVRTHCGAND  323

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQ+LF  TL+ +K
Sbjct  324   KAFKCVYQEQDNAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQILFFVTLVAKK  383

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   H EASRMTLHRFGNTSSS
Sbjct  384   LFNAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHAEASRMTLHRFGNTSSS  443

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW   RN+K   + PW +CI RYPV
Sbjct  444   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVAIRNVKPSPNNPWEECIHRYPV  503

Query  624   HI  619
              +
Sbjct  504   QL  505



>gb|KFK41268.1| hypothetical protein AALP_AA2G107900 [Arabis alpina]
Length=514

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 383/486 (79%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY YL+ H+  L L+P+MA    E+ R  PE++        +   LI
Sbjct  29    NFLQSVNMKYVKLGYHYLITHLFKLCLIPLMAVFITEISRLTPEDLYQIWLH--LQYNLI  86

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
               +  S   VF +T+++M++PRS+YLVDY+CY PP   +V +  FM+HSRL    N  S+
Sbjct  87    AFIILSALAVFGSTVFIMTRPRSVYLVDYSCYLPPTNLQVSYQKFMDHSRLIDDFNDSSL  146

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +ILERSGLGEET LP A+H IPP+PTM  AR EAE+V+F A+D L + T++  +DI
Sbjct  147   EFQRKILERSGLGEETYLPEALHCIPPRPTMVEARQEAEQVMFGALDKLFENTKINPRDI  206

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+I+IDLA+D+L VH N+
Sbjct  207   GVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNT  266

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G+++AML+PNCLFR+GG+AIL+SNK  D  R+KY+L+H VRTHK
Sbjct  267   YAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAILLSNKSGDRRRSKYKLVHTVRTHK  326

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+ +KA+ CVY++ED  GK G++LSK+LM IAGEALK+NITT+GPLVLP SEQ+LF  TL
Sbjct  327   GAIEKAFNCVYQEEDDNGKTGVSLSKELMAIAGEALKANITTLGPLVLPISEQILFFATL  386

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGN
Sbjct  387   VTKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSETHVEASRMTLHRFGN  446

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
             TSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  CID
Sbjct  447   TSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEHCID  506

Query  636   RYPVHI  619
             RYPV +
Sbjct  507   RYPVKL  512



>ref|XP_007136167.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
 gb|ESW08161.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
Length=512

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 384/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLGY YL++H++TL L+P+M+ + I+  +   ++I        +   L+ V+ 
Sbjct  32    SVKLKYVKLGYHYLMSHLVTLCLLPLMSVILIQASQMKTQDIQELWAH--LQYNLLSVIA  89

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  L   +TLY+M++P SIYL+DY+CY+PP   RV F  F+ HS L     P S++FQ 
Sbjct  90    ISAILALGSTLYIMTRPTSIYLIDYSCYRPPHHLRVHFQKFLHHSTLTGDFLPSSLDFQR  149

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +IL+RSGLGEET LP A+H IPP+P+MDAAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  150   KILQRSGLGEETYLPEAMHSIPPRPSMDAAREEAEQVMFGALDNLFANTRVKPKDIGILV  209

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+I+IDLA+D+L VH N+  +V
Sbjct  210   VNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYVVV  269

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ +AML+PNCLFR+GGAAIL+SNK  D  RAKY+L+HVVRTHKG+DD
Sbjct  270   VSTENITQNWYFGNNKAMLIPNCLFRVGGAAILLSNKSSDKRRAKYKLLHVVRTHKGADD  329

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  330   KAFRCVYQEQDDIGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFLTLVLKK  389

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  390   LFNAKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSS  449

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  R++      PW DCI +YPV
Sbjct  450   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRHVNPSPKSPWEDCIHKYPV  509

Query  624   HI  619
              I
Sbjct  510   QI  511



>ref|XP_002510394.1| acyltransferase, putative [Ricinus communis]
 gb|EEF52581.1| acyltransferase, putative [Ricinus communis]
Length=502

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/483 (63%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL  +P++   +IE  +   ++  +R     +   L+ ++
Sbjct  20    QSVNLKYVKLGYHYLISNLLTLCFIPLIIITSIEASQMNLDD--LRHLWLHLQYNLVGII  77

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLVF  T+Y+M++PR +YLVDY+CY+ P   + PF  FMEHS+L    +  S+EFQ
Sbjct  78    ICSAFLVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPFGRFMEHSKLTGDFDESSLEFQ  137

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGE+T +P A+HYIPP+P+M AAR EAE+V+F A+D L   T +  K+I IL
Sbjct  138   RKILERSGLGEDTYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGIL  197

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSA++VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+
Sbjct  198   VVNCSLFNPTPSLSAIIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAV  257

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SN+  D  RAKY+L+HVVRTH+G+D
Sbjct  258   VVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRRRAKYKLVHVVRTHRGAD  317

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  318   DKAFRCVYQEQDDAGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVK  377

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  378   KLFNKKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSS  437

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+K RM+KG+R+WQIAFGSGFKCNSAVW+  RN+K   +GPW DCID+YP
Sbjct  438   SSIWYELAYVEAKRRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSPNGPWEDCIDKYP  497

Query  627   VHI  619
             V +
Sbjct  498   VKL  500



>gb|KFK44079.1| hypothetical protein AALP_AA1G213300 [Arabis alpina]
Length=515

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 391/483 (81%), Gaps = 6/483 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL++++LTL L P+   ++++  +  PE++    K   + L+  L+ 
Sbjct  33    QSVNLKYVKLGYHYLISNLLTLCLFPLAVVISVQASQTNPEDL----KQLWIHLQYNLVS  88

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             ++  S  LVF  T+Y+M++PR +YLVD++CY P    + PF+ FMEHSRL    +  ++E
Sbjct  89    IIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPQDHLKAPFTRFMEHSRLTGDFDDSALE  148

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGE T LP A+H++PPK +M AAR EAE+V+F A+D L   T +  KDI 
Sbjct  149   FQRKILERSGLGEHTYLPEAMHHVPPKISMAAAREEAEQVMFGALDNLFANTNVNPKDIG  208

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ 
Sbjct  209   ILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLLVHRNTY  268

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  RAKYRL+HVVRTH+G
Sbjct  269   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRAKYRLVHVVRTHRG  328

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+
Sbjct  329   ADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLV  388

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNT
Sbjct  389   VKKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNT  448

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  RN+K   + PW DCI++
Sbjct  449   SSSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRNVKPSKNSPWEDCIEK  508

Query  633   YPV  625
             YPV
Sbjct  509   YPV  511



>ref|XP_008357196.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/485 (62%), Positives = 391/485 (81%), Gaps = 6/485 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL++++LTL  +P++    IE  +      +  I+   + L+  L+ 
Sbjct  34    QSVNLKYVKLGYHYLISNLLTLCFIPLIIVTLIEASQMD----IYDIQQLWLHLQYNLVS  89

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             V+  S  LVF  T+Y+M++PR +YLVDYACY+PP   + P+  FMEHSRL    +  S+E
Sbjct  90    VIICSAVLVFGLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLE  149

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V++ A+D L   T +K KDI 
Sbjct  150   FQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIG  209

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL +H N+ 
Sbjct  210   ILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTY  269

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH+G
Sbjct  270   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRG  329

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  +L+
Sbjct  330   ADDKAFRCVYQEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLV  389

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              +K+F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNT
Sbjct  390   VKKLFKSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPXHVEASRMTLHRFGNT  449

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL Y+E+KGR+++G+RIWQIAFGSGFKCNSAVW+  RN+K   +GPW DCID+
Sbjct  450   SSSSIWYELAYMEAKGRIRRGNRIWQIAFGSGFKCNSAVWEALRNVKPSCNGPWEDCIDK  509

Query  633   YPVHI  619
             YPV +
Sbjct  510   YPVKV  514



>ref|XP_009365554.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/485 (63%), Positives = 391/485 (81%), Gaps = 6/485 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL+++ILTL  +P++    IE  +      +  I+   + L+  L+ 
Sbjct  34    QSVNLKYVKLGYHYLISNILTLCFIPLIIVTLIEASQMD----IYDIQQLWLHLQYNLVS  89

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             V+  S  LVF  T+Y++++PR +YLVDYACY+PP   + P+  FMEHSRL    +  S+E
Sbjct  90    VIICSAVLVFGLTVYIVTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLE  149

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V++ A+D L   T +K KDI 
Sbjct  150   FQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIG  209

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL +H N+ 
Sbjct  210   ILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTY  269

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH+G
Sbjct  270   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRG  329

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  +L+
Sbjct  330   ADDKAFRCVYQEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLV  389

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              +K+FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNT
Sbjct  390   VKKLFNSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNT  449

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL Y+E+KGR+++G+RIWQIAFGSGFKCNSAVW+  RN+K   +GPW DCID 
Sbjct  450   SSSSIWYELAYMEAKGRIRRGNRIWQIAFGSGFKCNSAVWEALRNVKASRNGPWEDCIDT  509

Query  633   YPVHI  619
             YPV +
Sbjct  510   YPVKV  514



>ref|XP_008388058.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 387/483 (80%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL  +P++    IE  +    +I        +   L+ V+
Sbjct  34    QSVNLKYVKLGYHYLISNLLTLCFIPLIIVTLIEASQMDIHDIQQLWLH--LQYNLVSVI  91

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y+M++PR +YLVDYACY+PP   + P+  FMEHSRL    +  S+EFQ
Sbjct  92    ICSAVLVFGLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQ  151

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V++ A+D L   T +K KDI IL
Sbjct  152   RKILERSGLGEETYVPEAMHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGIL  211

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL +H N+ A+
Sbjct  212   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAV  271

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH+G+D
Sbjct  272   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGAD  331

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  +++  
Sbjct  332   DKAFRCVYQEQDEKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVN  391

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  392   KLFKSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSS  451

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  RN+K   +GPW DCID+YP
Sbjct  452   SSIWYELAYMEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSRNGPWEDCIDKYP  511

Query  627   VHI  619
             V +
Sbjct  512   VKV  514



>ref|XP_002890341.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66600.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/483 (62%), Positives = 393/483 (81%), Gaps = 6/483 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL++++LTL L P+   +++E  +  P+++    K   + L+  L+ 
Sbjct  33    QSVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQMNPDDL----KQLWIHLQYNLVS  88

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             ++  S  LVF  T+Y+M++PR +YLVD++CY PP   + P++ F+EHSRL    +  ++E
Sbjct  89    IIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFIEHSRLTGDFDDSALE  148

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGE+T +P A+H++PP+ +M AAR EAE+V+F A+D L   T +  KDI 
Sbjct  149   FQRKILERSGLGEDTYVPEAMHFVPPRISMAAAREEAEQVMFGALDNLFANTSVNPKDIG  208

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ 
Sbjct  209   ILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTY  268

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  R+KYRL+HVVRTH+G
Sbjct  269   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRG  328

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+
Sbjct  329   ADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLV  388

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
              +K+FN K KPYIPDFK AFEHFC+HAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNT
Sbjct  389   VKKLFNGKVKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNT  448

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  R++K   + PW DCID+
Sbjct  449   SSSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEDCIDK  508

Query  633   YPV  625
             YPV
Sbjct  509   YPV  511



>ref|XP_009341963.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=503

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 386/480 (80%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             +V LKYVKLGY YL+ H+LTL LVP++A + IE     P++I        +   L+ V+ 
Sbjct  22    TVNLKYVKLGYHYLITHLLTLCLVPLVAVIVIEASLLNPDDIHQLWLQ--LQCNLVAVII  79

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+ +M++PRS+YLVDY+CYK P   +V +  FMEHS+L    N  S+EFQ 
Sbjct  80    FSAMVVFGSTVNVMTRPRSVYLVDYSCYKAPSHLKVRYHQFMEHSKLIGDFNESSLEFQG  139

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A++YIPP+ +M AAR EAE+VIF A+D L     +K KDI IL+
Sbjct  140   KILERSGLGEETYVPEAMNYIPPRISMAAAREEAEQVIFGALDDLFANANVKPKDIGILV  199

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAMVVNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L +H N+ A+V
Sbjct  200   VNCSLFNPTPSLSAMVVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVV  259

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH G+DD
Sbjct  260   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDRRRAKYKLVHVVRTHCGADD  319

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  320   KAFRCVYQEQDDDGKTGVSLSKDLMAIAGGALKANITTLGPLVLPLSEQLLFFATLVAKK  379

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K +PYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  380   LFNAKVEPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  439

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+KG+R+WQIAFGSGFKCNSAVW+  +++K     PW DCIDRYPV
Sbjct  440   SIWYELAYIEAKGRMQKGNRVWQIAFGSGFKCNSAVWEVLQSVKASPHSPWEDCIDRYPV  499



>ref|XP_010263648.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=515

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 379/482 (79%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV +KYVKLGY YL+ +++T  L+PVMA   +   +   E+I+       +   L+ V  
Sbjct  34    SVNVKYVKLGYHYLLKYLITFSLIPVMAVTLVRASQLSSEDILELSHQ--LEKNLVSVAI  91

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LV  AT Y M++PR +YLVD++CY P    RV +  FMEHSRL    +  S+EFQ 
Sbjct  92    CSALLVLSATAYFMTRPRPVYLVDFSCYLPHSHQRVNYKNFMEHSRLTGDFDESSLEFQH  151

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HY PP+PTM  AR EAE+V+F A++ L   T +KAKDI IL+
Sbjct  152   KILERSGLGEETHVPDAMHYTPPRPTMANAREEAEQVMFGALENLFSNTSVKAKDIGILV  211

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM++NKYKLR NI+S+NL GMGCSAG+++IDLA+D+L VH N+ A+V
Sbjct  212   VNCSLFNPTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVVAIDLAKDMLQVHRNTYAVV  271

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH G+DD
Sbjct  272   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSSDRRRAKYKLLHVVRTHCGADD  331

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D QGK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF F L+ +K
Sbjct  332   KAFRCVYQEQDDQGKTGVSLSKDLMSIAGMALKTNITTLGPLVLPISEQLLFFFNLLAKK  391

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             + +PK K YIPDFK AF+HFCIHAGGRAVIDEL++NLQL   HVEASRMTLHRFGNTSSS
Sbjct  392   LIDPKRKSYIPDFKLAFDHFCIHAGGRAVIDELERNLQLEPTHVEASRMTLHRFGNTSSS  451

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+  RN K   + PWL CIDRYPV
Sbjct  452   SIWYELAYTEAKGRMRKGHRLWQIAFGSGFKCNSAVWEAVRNAKPSPNSPWLHCIDRYPV  511

Query  624   HI  619
              I
Sbjct  512   EI  513



>ref|XP_010254814.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=506

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/484 (62%), Positives = 384/484 (79%), Gaps = 2/484 (0%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             R +V+ KYVKLGY YL+ H++TL LVP++A    +  +   ++++       +   L+ V
Sbjct  23    RQNVRRKYVKLGYHYLMKHLMTLCLVPIVAMTVDKAGQMSSDDVLHLWLH--LQHNLVTV  80

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
                S  LVF AT+Y+M++PRS+YLVD++CY PP   RV +  FMEHS+     +  S+EF
Sbjct  81    AVCSALLVFGATVYVMTRPRSVYLVDFSCYLPPSDLRVNYKDFMEHSKATGDFDDSSLEF  140

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q RILERSGLGEET +P A+ YIPP+PTM  AR EAE+V+F A+D L   T L  KDI I
Sbjct  141   QRRILERSGLGEETYVPDAMRYIPPRPTMAKAREEAEQVMFGALDNLFTNTSLNPKDIGI  200

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM++N+YKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A
Sbjct  201   LVVNCSLFNPTPSLSAMIINRYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYA  260

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE IT N+Y G++++ML+PNCLFR+GGAAIL+SNK  D  RAKY+L+HVVRTH G+
Sbjct  261   VVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAILLSNKSSDRRRAKYKLVHVVRTHCGA  320

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DD+A+ CVY+++D +GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQ+LF+ TL  
Sbjct  321   DDRAFHCVYQEQDDRGKTGVSLSKDLMAIAGMALKTNITTLGPLVLPISEQVLFVLTLAA  380

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN   +PYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  +HVEASRMTLHRFGNTS
Sbjct  381   KKLFNANIRPYIPDFKMAFDHFCIHAGGRAVIDELEKNLQLQPKHVEASRMTLHRFGNTS  440

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+  RN+K   + PW+ CIDRY
Sbjct  441   SSSIWYELAYTEAKGRMRKGHRLWQIAFGSGFKCNSAVWEALRNVKASPNSPWMQCIDRY  500

Query  630   PVHI  619
             PV I
Sbjct  501   PVEI  504



>ref|XP_009364915.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/485 (62%), Positives = 390/485 (80%), Gaps = 6/485 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL++++LTL  +P++    IE  +      +  I+   + L+  L+ 
Sbjct  34    QSVNLKYVKLGYHYLISNLLTLCFIPLIIVTLIEASQMD----IYDIQQLWLHLQYNLVS  89

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             V+  S  LVF  T+Y+M++PR +YLVDYACY+PP   + P+  FMEHSRL    +  S+E
Sbjct  90    VIICSAVLVFGLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLE  149

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V++ A+D L   T +K KDI 
Sbjct  150   FQRKILERSGLGEETYVPEAMHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIG  209

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             IL+VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL +H N+ 
Sbjct  210   ILVVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTY  269

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH+G
Sbjct  270   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRG  329

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  +++
Sbjct  330   ADDKAFRCVYQEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIV  389

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
               K+F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNT
Sbjct  390   VNKLFKSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNT  449

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL Y+E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  RN+K   +GPW DCID+
Sbjct  450   SSSSIWYELAYMEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSRNGPWEDCIDK  509

Query  633   YPVHI  619
             YPV +
Sbjct  510   YPVKL  514



>ref|XP_007160751.1| hypothetical protein PHAVU_001G014100g [Phaseolus vulgaris]
 gb|ESW32745.1| hypothetical protein PHAVU_001G014100g [Phaseolus vulgaris]
Length=511

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 385/482 (80%), Gaps = 4/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL LVP++    I+V     +   +      +   L+ +L 
Sbjct  32    SVNLKYVKLGYHYLISNLLTLFLVPLILVTLIQV----SQTTDLHHLWLHLQYNLLTILT  87

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  TLY +++PR++YL+D AC++P    + PF +FM+HSRL       S++FQ 
Sbjct  88    CSAVLVFGLTLYAVTRPRAVYLLDSACFRPAEHLKAPFRSFMDHSRLTGDFEESSLDFQR  147

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP+P+M AAR EAE+V+F A+D L   T LK KDI ILI
Sbjct  148   KILERSGLGEETYVPEAMHSIPPQPSMAAARAEAEQVMFGALDNLFHNTSLKPKDIGILI  207

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  208   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVV  267

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+G +A+L+SNK  D  RAKYRL+HVVRTH+G+DD
Sbjct  268   VSTENITQNWYFGNKKSMLIPNCLFRVGCSALLLSNKPADRRRAKYRLVHVVRTHRGADD  327

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  328   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLLMKK  387

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL SEHVEASRMTLHRFGNTSSS
Sbjct  388   LFKADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRSEHVEASRMTLHRFGNTSSS  447

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW+   N+K   +GPW DCID+YPV
Sbjct  448   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWQALGNIKPSPNGPWEDCIDKYPV  507

Query  624   HI  619
              I
Sbjct  508   EI  509



>gb|ACQ41892.1| 3-ketoacyl-CoA synthase [Camellia oleifera]
Length=525

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 388/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++H+LTL L+PV+A + ++  +  P ++  R     +   L+ V+ 
Sbjct  44    SVNLKYVKLGYHYLISHLLTLCLIPVIAVILVQASQMNPNDV--RQLWLHLQYNLVSVIV  101

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF +T Y++++PR +YLVDYACY+ P   +   S F+EHSRL    +  S+EFQ 
Sbjct  102   CSAFLVFGSTAYIVTRPRPVYLVDYACYRAPDHLKASSSRFLEHSRLTGDFDESSLEFQR  161

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET  P ++H IPP+P+M AAR EAE V++ A+D L   T +K KDI +L+
Sbjct  162   KILERSGLGEETYAPESMHCIPPRPSMAAAREEAEMVMYGALDNLFANTSIKPKDIGVLV  221

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM++NKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+V
Sbjct  222   VNCSLFNPTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLLVHRNTLAVV  281

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE +T N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTHKG+DD
Sbjct  282   VSTENMTQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKYADRRRAKYKLVHVVRTHKGADD  341

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  TL+ +K
Sbjct  342   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFATLVVKK  401

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDF  AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  402   LFNKNIKPYIPDFTLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  461

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGR++KG ++WQIAFGSGFKCNSAVWK  RN+K P +GPW DCID+YPV
Sbjct  462   SIWYELAYIEAKGRIRKGHQVWQIAFGSGFKCNSAVWKALRNVKHPRNGPWEDCIDKYPV  521

Query  624   HI  619
              +
Sbjct  522   EL  523



>ref|XP_009416553.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTLLL+P+M  + +E  +  P +  +R     +   L+ VL
Sbjct  34    QSVNLKYVKLGYHYLITHLLTLLLIPLMVVILLEAAQTDPND--LRQLWLHLQYNLVSVL  91

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S FLVF  T+Y+M+ PR +YLVDYACY+PP   R PF  FM+HS+L  + N  ++EFQ
Sbjct  92    VCSAFLVFGTTVYIMTGPRPVYLVDYACYRPPPNLRAPFPRFMKHSQLCGEFNESALEFQ  151

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              RILERSGLG+ET LP+A+HY+PP+P+M +AR EAEEV+F A+DAL + T +K KDI IL
Sbjct  152   RRILERSGLGQETYLPSALHYLPPRPSMASAREEAEEVMFGALDALFRNTGVKPKDIGIL  211

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VN+YK R NIKS+NL GMGCSAG+ISIDLARDLL +H ++ A+
Sbjct  212   VVNCSLFNPTPSLSAMIVNRYKFRGNIKSFNLGGMGCSAGVISIDLARDLLQIHRSTYAV  271

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ ++ML+PNCLFR+G AA+L+SN+  D  R+KY+L+HVVRTH G+D
Sbjct  272   VVSTENITQNWYFGNRKSMLIPNCLFRVGAAAMLLSNRSADRWRSKYKLVHVVRTHSGAD  331

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             D+A+RCVY+++D  GKVG++LSKDLM IAGEALK NITT+GPLVLP SEQLLF  TL+ +
Sbjct  332   DRAFRCVYQEQDDAGKVGVSLSKDLMAIAGEALKINITTLGPLVLPISEQLLFFATLVAK  391

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQL  +HVEASRMTLHRFGNTSS
Sbjct  392   KLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLRPDHVEASRMTLHRFGNTSS  451

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+   N+K   DGPW DCI RYP
Sbjct  452   SSIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWQALCNVKPSPDGPWEDCIHRYP  511

Query  627   VHI  619
             V I
Sbjct  512   VEI  514



>emb|CDX71278.1| BnaC07g05570D [Brassica napus]
Length=507

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/489 (62%), Positives = 386/489 (79%), Gaps = 8/489 (2%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPE---EIVMRIKDSVMSL  1906
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R  P+   +I + ++ ++++ 
Sbjct  22    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLITEISRLTPDDYHQIWLHLQYNLVAF  81

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+  L      VF  T+++M++PRS+YLVDY+CY P  + +VP+  FM+HS L    N 
Sbjct  82    ILLSAL-----AVFGTTVFIMTRPRSVYLVDYSCYLPQASLQVPYKKFMDHSALIDDFNE  136

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
              S+EFQ +ILERSGLGEET LP  +H +PP+ TM AAR EAE+V+F  +D L + T++  
Sbjct  137   SSLEFQRKILERSGLGEETYLPDGLHCVPPRTTMAAAREEAEQVMFGCLDKLFENTKINP  196

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             KDI +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH
Sbjct  197   KDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVH  256

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
              N+ A+VVSTE IT N+Y G+++AML+PNCLFR+GG A+L+SNK  D  R+KY+++H VR
Sbjct  257   RNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYKMVHTVR  316

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+D+KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF 
Sbjct  317   THKGADEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFF  376

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TL+ +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHR
Sbjct  377   VTLVWKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSLTHVEASRMTLHR  436

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  
Sbjct  437   FGNTSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEH  496

Query  645   CIDRYPVHI  619
             CIDRYPV +
Sbjct  497   CIDRYPVKL  505



>ref|XP_001757568.1| predicted protein [Physcomitrella patens]
 gb|EDQ77625.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 389/489 (80%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTLL +P++  + +E  R GPE++    ++  +   L+ V+
Sbjct  32    QSVNLKYVKLGYHYLITHLLTLLFIPLLLAILLEAGRMGPEDLWQLWEN--LQFNLVSVI  89

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVFV T+Y MS+PR I+LVD+ACY P    +V    FME +RL    + KS+EFQ
Sbjct  90    ACSALLVFVGTVYFMSRPRPIFLVDFACYLPDEKLQVSVPLFMERTRLAGFFDEKSMEFQ  149

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG +T LPAA+H +PP P+M AAR EAE+V+F  +D L +KT++K KD+ +L
Sbjct  150   EKILERSGLGAKTYLPAAMHSLPPCPSMKAAREEAEQVMFGCLDELFEKTKIKPKDVGVL  209

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKY +R NI++YNL GMGCSAG+I+IDLARD+L VH N+ A+
Sbjct  210   VVNCSLFNPTPSLSAMIVNKYHMRGNIRTYNLGGMGCSAGVIAIDLARDMLQVHGNTYAI  269

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ R+ML+PNCLFR+GGAAIL+SNKRRD  R+KY+L HVVRTHKG+D
Sbjct  270   VVSTENITQNWYFGNRRSMLIPNCLFRVGGAAILLSNKRRDGSRSKYQLNHVVRTHKGAD  329

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK Y CVY+++D QG +G++LSKDLM IAGE LK+NITT+GPLVLP SEQLLF  TL+ R
Sbjct  330   DKCYNCVYQEQDEQGNMGVSLSKDLMAIAGETLKANITTLGPLVLPLSEQLLFFSTLVAR  389

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+  H E SRMTLHRFGNTSS
Sbjct  390   KVFNMKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTPGHCEPSRMTLHRFGNTSS  449

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K     PW  CID YP
Sbjct  450   SSIWYELAYMEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNIKPSEKSPWAHCIDEYP  509

Query  627   VHIPEIVKL  601
              H+ +I K+
Sbjct  510   QHVDDIQKV  518



>ref|XP_009389417.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/495 (64%), Positives = 394/495 (80%), Gaps = 7/495 (1%)
 Frame = -3

Query  2088  SPGFNNR-----SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             SPG + R      SV LKYVKLGY YL+ H+LTLLL+P+MA + +E  +  P+E  +R  
Sbjct  16    SPGRSRRLPDFLQSVNLKYVKLGYHYLITHLLTLLLIPLMAVILLEAAQTDPDE--LRQV  73

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
                +   L+ VL  S   VF  T+Y+M++PR +YLVDYACY+PP   + PF  FMEHS+L
Sbjct  74    WLHLQYNLVSVLVCSAVFVFGTTVYIMTRPRPVYLVDYACYRPPPELKAPFHRFMEHSQL  133

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
                 N  ++EFQ RILERSGLG++TCLP A+HY+PP+P+M AAR EAE+V+F A+D L  
Sbjct  134   CGGFNESALEFQRRILERSGLGQDTCLPVALHYLPPRPSMAAAREEAEQVMFGALDTLFN  193

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
              T +K KD+ +L+VNCSLF+PTPSLSAM+VN+YKLR NIKS+NL GMGCSAG++++DLAR
Sbjct  194   NTGVKPKDVGVLVVNCSLFNPTPSLSAMIVNRYKLRGNIKSFNLGGMGCSAGVLAVDLAR  253

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL VH  + A+VVSTE IT N+Y G+ +AML+PNCLFR+G AA+L+SN+  D  RAKY+
Sbjct  254   DLLQVHRATYAVVVSTENITQNWYFGNRKAMLIPNCLFRVGAAALLLSNRAADRRRAKYK  313

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L+H+VRTH+G+DD+A+RCVY+++D  GKVG++LSKDLM IAGEALK NITT+GPLVLP S
Sbjct  314   LVHIVRTHRGADDRAFRCVYQEQDEVGKVGVSLSKDLMAIAGEALKINITTLGPLVLPIS  373

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLF  TL+ +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEAS
Sbjct  374   EQLLFFATLVAKKLFNGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRPIHVEAS  433

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTLHRFGNTSSSS+WYEL Y E+KGRM+KG R+WQIAFGSGFKCNSAVW+  RN+K   
Sbjct  434   RMTLHRFGNTSSSSIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWQALRNVKPSH  493

Query  663   DGPWLDCIDRYPVHI  619
             DGPW DCI  YPV I
Sbjct  494   DGPWEDCIHGYPVEI  508



>ref|XP_007222865.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
 ref|XP_008220808.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Prunus mume]
 gb|EMJ24064.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
Length=518

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 387/483 (80%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++LTL  +P++    IE  +    +I        +   L+ V+
Sbjct  36    QSVNLKYVKLGYHYLISNLLTLCFIPLIIVTLIEASQMDLYDIQQLWLH--LQYNLVSVI  93

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y+M++PR +YLVDYACY+PP   + P+  FMEHSRL    +  S+EFQ
Sbjct  94    ICSAVLVFGLTVYIMTRPRPVYLVDYACYRPPDHLKAPYHRFMEHSRLTQDFDDSSLEFQ  153

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V++ A+D L   T +K KDI IL
Sbjct  154   RKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGIL  213

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+ DLA+DLL +H N+ A+
Sbjct  214   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAADLAKDLLQIHRNTYAI  273

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+G +A+L+SNK  D  RAKY+L+HVVRTH+G+D
Sbjct  274   VVSTENITQNWYFGNKKSMLIPNCLFRVGCSAVLLSNKSADWRRAKYKLVHVVRTHRGAD  333

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D +GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQLLF  +L+ +
Sbjct  334   DKAFRCVYQEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVK  393

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  394   KLFNANVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSS  453

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+KGR++KG+R+WQIAFGSGFKCNSAVW+  RN+K   +GPW DCID+YP
Sbjct  454   SSIWYELAYMEAKGRIRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSRNGPWEDCIDKYP  513

Query  627   VHI  619
             V +
Sbjct  514   VKL  516



>ref|XP_006423278.1| hypothetical protein CICLE_v10028243mg [Citrus clementina]
 ref|XP_006469151.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Citrus sinensis]
 gb|ESR36518.1| hypothetical protein CICLE_v10028243mg [Citrus clementina]
Length=504

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/481 (65%), Positives = 392/481 (81%), Gaps = 2/481 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H+LTLLLVP+MA + IE  +  P++I        +   L+ V+ 
Sbjct  23    SVNLKYVKLGYHYLMTHLLTLLLVPLMAVIIIEASQMNPDDIHQLWLH--LKYNLVSVII  80

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF +T+Y+MS+PRSIYLVD++CY+PP   +V F  FMEHSRL    +  S+EFQ 
Sbjct  81    CSAVLVFGSTVYIMSRPRSIYLVDFSCYRPPCHLQVKFHQFMEHSRLTGDFDESSLEFQR  140

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HY+PP+P+M AAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  141   KILERSGLGEETYVPDAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILV  200

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+V
Sbjct  201   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVV  260

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTHKG+DD
Sbjct  261   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADD  320

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
              A++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  321   NAFKCVYQEQDNAGKTGVSLSKDLMAIAGMALKANITTLGPLVLPISEQLLFFATLVAKK  380

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
               N K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNTSSS
Sbjct  381   FSNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  440

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   + PW DCID+YPV
Sbjct  441   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVKPSPNSPWEDCIDKYPV  500

Query  624   H  622
              
Sbjct  501   Q  501



>ref|XP_008800772.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=488

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/480 (62%), Positives = 375/480 (78%), Gaps = 1/480 (0%)
 Frame = -3

Query  2052  KYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLF  1873
             +Y KL    L N+ L + LV  +    IEVL  GP+E V ++  S  + +  ++LF  L 
Sbjct  5     EYFKLCCHCLFNNFLAISLVSSLMAALIEVLGLGPDE-VQKLWTSFQAFDAFYLLFFWLA  63

Query  1872  LVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILE  1693
              + +AT+Y MS+PR IYLVD+ACYKPP +CR PFS FM HS  N    P S+EFQ +ILE
Sbjct  64    FIVLATVYFMSRPRPIYLVDFACYKPPASCRFPFSKFMNHSTKNEVFEPSSIEFQRKILE  123

Query  1692  RSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCS  1513
             RSGLGE+T LP A H IP  PTM  +R E+E V+FS +D+L +KT++K +DIDIL+VNCS
Sbjct  124   RSGLGEDTSLPPAHHVIPFTPTMAKSREESELVLFSVVDSLFRKTKVKPRDIDILVVNCS  183

Query  1512  LFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTE  1333
             LFSPTPSLSAM+VNKYK+R NI+S+NLSGMGCSAG+ISIDLARD L VH NSNALVV+TE
Sbjct  184   LFSPTPSLSAMIVNKYKMRGNIRSFNLSGMGCSAGIISIDLARDELLVHANSNALVVTTE  243

Query  1332  IITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYR  1153
             IIT  +Y G+ R+MLL NCLFRMGGAA+L+SNKR++  +AKY L+HVVRTH G+DD+AYR
Sbjct  244   IITEQWYTGNRRSMLLANCLFRMGGAAVLLSNKRQEKRKAKYELLHVVRTHHGADDRAYR  303

Query  1152  CVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNP  973
             CVY++ED + K+G++LS+DL  IAG ALK+NI  +GPLVLP SEQ+LF    +GR+  NP
Sbjct  304   CVYQEEDDEKKIGVSLSRDLTAIAGAALKANIAALGPLVLPLSEQVLFFLNTLGRRFANP  363

Query  972   KWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWY  793
             KW+PY+PDF++AF+HFCIHAGG+AVI ++   L+LS E  EASRMTLHRFGNTSSSS WY
Sbjct  364   KWRPYVPDFRKAFDHFCIHAGGKAVILDMGTKLRLSEEQTEASRMTLHRFGNTSSSSPWY  423

Query  792   ELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPE  613
             EL Y+E+KGRM+KGDR+WQI  GSGFKCNSAVW+C R++ +  +  W DCID+YPV + E
Sbjct  424   ELGYVEAKGRMRKGDRVWQIGLGSGFKCNSAVWRCRRSVGREEEEAWADCIDQYPVQVAE  483



>ref|XP_010539905.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Tarenaya hassleriana]
Length=514

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/481 (63%), Positives = 384/481 (80%), Gaps = 2/481 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL++++L L L P++  +++E  +  P++  +R     +   L+ ++
Sbjct  32    QSVNLKYVKLGYHYLISNLLALCLFPLIVVISVEASQMNPDD--LRQLWVHLQYNLVSII  89

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y+M++PR +YLVDY+CY+PP   + PF+ FMEHSRL       ++EFQ
Sbjct  90    ICSAILVFGLTVYVMTRPRPVYLVDYSCYRPPDHLKAPFNRFMEHSRLTGDFEESALEFQ  149

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+H IPP+P+M AAR EAE+V+F A+D L   T +  KDI IL
Sbjct  150   RKILERSGLGEETYVPEAMHCIPPRPSMAAAREEAEQVMFGALDNLFSNTNVNPKDIGIL  209

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+
Sbjct  210   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGIIAVDLAKDLLQVHRNTYAV  269

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+++AML+PNCLFR+GG+A+L+SNK RD  RAKY+L+HVVRTH+G+D
Sbjct  270   VVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDRRRAKYQLVHVVRTHRGAD  329

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQLLF  TLI +
Sbjct  330   DKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQLLFFVTLIMK  389

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+   K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  390   KLSKGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSS  449

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   +  W DCI  YP
Sbjct  450   SSIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSKNSAWEDCIHNYP  509

Query  627   V  625
             V
Sbjct  510   V  510



>ref|XP_008444712.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis melo]
Length=514

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 383/482 (79%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL +VP++A   IEV +   +++  R     +   L+ V+ 
Sbjct  33    SVNLKYVKLGYHYLISNLLTLCIVPLIAVTLIEVSQMNLDDV--RHLWFHLQYNLVSVII  90

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF  T+Y M++PR +YLVDY+CY+P    + PF  FMEHSRL    +  S+EFQ 
Sbjct  91    CSTVMVFGLTVYTMTRPRPVYLVDYSCYRPADDLKAPFHRFMEHSRLTGDFDDSSLEFQR  150

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP P+M AAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  151   KILERSGLGEETYVPEAMHCIPPTPSMAAAREEAEQVMFGALDKLFANTNVKPKDIGILV  210

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  211   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTLAVV  270

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKYRL+H+VRTH+G+DD
Sbjct  271   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADD  330

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  331   KAFRCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKK  390

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
              FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  391   FFNGNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  450

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM KG+R+WQIAFGSGFKCNSAVW+  RN++     PW DCID YPV
Sbjct  451   SIWYELAYTEAKGRMHKGNRVWQIAFGSGFKCNSAVWEALRNVRPSQSSPWEDCIDNYPV  510

Query  624   HI  619
              +
Sbjct  511   KL  512



>gb|EPS60765.1| hypothetical protein M569_14036, partial [Genlisea aurea]
Length=503

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 387/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++L L LVP++  + I      P++++       +   L+ V+ 
Sbjct  23    SVNLKYVKLGYHYLISNLLALCLVPLIGAIFIHASEMNPDDVLQLWLH--LKYNLVSVVI  80

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF +T+Y+M+ PR++YLVDY+CY+ P + +  +  FMEHSRL    +  S+EFQ 
Sbjct  81    CSAFLVFGSTVYIMTLPRAVYLVDYSCYRAPESLKASYRQFMEHSRLTGDFDDSSLEFQR  140

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLG+ET +P A+H++PP+P+M AAR EAE+V+F A+D L   T L+ K+I ILI
Sbjct  141   KILERSGLGDETYVPEAMHFVPPRPSMQAAREEAEQVMFGALDNLFANTNLRPKEIGILI  200

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NIKS+NL GMGCSAG+I++DLA+DLL +H N+ A+V
Sbjct  201   VNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVV  260

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GGAA+L+SNK  D  R+KY+L+HVVRTHKG+DD
Sbjct  261   VSTENITQNWYFGNKKSMLIPNCLFRVGGAALLLSNKAADRRRSKYKLVHVVRTHKGADD  320

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+ CVY+++D  GK G++LSKDLM IAG ALK+NITT+GP+VLP SEQL+F  TL+ +K
Sbjct  321   KAFHCVYQEQDENGKTGVSLSKDLMAIAGGALKTNITTLGPVVLPISEQLIFFMTLVIKK  380

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F    +PYIPDFK AF+HFCIHAGGRAVIDE++KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  381   VFKYNLRPYIPDFKLAFDHFCIHAGGRAVIDEVEKNLQLLPVHVEASRMTLHRFGNTSSS  440

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM++G+++WQIAFGSGFKCNSAVW   R++    +GPW DCIDRYPV
Sbjct  441   SIWYELAYIEAKGRMRRGNKVWQIAFGSGFKCNSAVWVALRSVAPSKNGPWDDCIDRYPV  500

Query  624   HI  619
              +
Sbjct  501   KV  502



>ref|XP_010924276.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Elaeis guineensis]
Length=517

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/482 (65%), Positives = 392/482 (81%), Gaps = 5/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H+LTLLL+P+MA + +E  R    ++ + ++       L+ V+ 
Sbjct  30    SVNLKYVKLGYHYLITHLLTLLLIPLMAMILVEAGRSDIRQLWLHLQ-----YNLVSVVV  84

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S FLVF  T+Y+M++PR +YLVDYACY+PP + +VP+  FM HSRL  + N  S+EFQ 
Sbjct  85    CSTFLVFGTTVYIMTRPRPVYLVDYACYRPPESLQVPYEKFMGHSRLCGEFNDASLEFQR  144

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             ++LERSGLG+ET LP A+H +PP+PTM  AR EA++V+F A+DAL + T +K +DI IL+
Sbjct  145   KVLERSGLGQETYLPEALHALPPRPTMAHAREEAQQVMFGALDALFRNTGIKPRDISILV  204

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAMVVN YKLRSNIKS+NL GMGCSAG+ISIDLARDLL  H NS A+V
Sbjct  205   VNCSLFNPTPSLSAMVVNHYKLRSNIKSFNLGGMGCSAGVISIDLARDLLQAHRNSYAVV  264

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VS E IT N+Y G+ ++ML+PNCLFR+GGAA+L+SN+  D  R+KYRL+HVVRTH+G+DD
Sbjct  265   VSAENITQNWYLGNRKSMLIPNCLFRVGGAAVLLSNRSADRRRSKYRLVHVVRTHRGADD  324

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA++CVY+++D  GKVG++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  325   KAFQCVYQEQDDDGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKK  384

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVE SRMTLHRFGNTSSS
Sbjct  385   LFNAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEPSRMTLHRFGNTSSS  444

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGR+++G ++WQIAFGSGFKCNSAVW+  RN+K   + PW DCIDRYPV
Sbjct  445   SIWYELAYIEAKGRIRRGHKVWQIAFGSGFKCNSAVWQSLRNVKPSPNSPWEDCIDRYPV  504

Query  624   HI  619
              +
Sbjct  505   QL  506



>gb|KDO49072.1| hypothetical protein CISIN_1g010687mg [Citrus sinensis]
Length=504

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/481 (65%), Positives = 392/481 (81%), Gaps = 2/481 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+ H+LTLLLVP+MA + IE  +  P++  M      +   L+ V+ 
Sbjct  23    SVNLKYVKLGYHYLMTHLLTLLLVPLMAVIIIEASQMNPDD--MHQLWLHLKYNLVSVII  80

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF +T+Y+M++PRSIYLVD++CY+PP   +V F  FMEHSRL    +  S+EFQ 
Sbjct  81    CSAVLVFGSTVYIMTRPRSIYLVDFSCYRPPSHLQVKFHQFMEHSRLTGDFDESSLEFQR  140

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+HY+PP+P+M AAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  141   KILERSGLGEETYVPDAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILV  200

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+V
Sbjct  201   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVV  260

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTHKG+DD
Sbjct  261   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADD  320

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
              A++CVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  321   NAFKCVYQEQDNAGKTGVSLSKDLMAIAGMALKANITTLGPLVLPISEQLLFFATLVAKK  380

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
               N K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNTSSS
Sbjct  381   FSNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  440

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   + PW DCID+YPV
Sbjct  441   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVKPSPNSPWEDCIDKYPV  500

Query  624   H  622
              
Sbjct  501   Q  501



>ref|XP_008378462.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=503

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/480 (63%), Positives = 385/480 (80%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             +V  KYVKLGY YL+ H+LTL LVP+MA + IE  +  P++I        +   L+ V+ 
Sbjct  22    TVNSKYVKLGYHYLIAHLLTLCLVPLMAIIVIEASQVDPDDIHQLWLQ--LQSNLVAVII  79

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+Y+M++PRS+YLVDY+CYK P   +V +  FMEHS+L    +  S+EFQ 
Sbjct  80    FSAMVVFGSTVYVMTRPRSVYLVDYSCYKAPSHLKVRYHQFMEHSKLIGDFDKSSLEFQR  139

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLG ET +P A++Y+PP+ +M AAR EAE+V+F A+D L     +K KDI IL+
Sbjct  140   KILERSGLGVETYVPEAMNYVPPRISMAAARQEAEQVVFGALDDLFANANVKPKDIGILV  199

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAMVVNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L +H N+ A+V
Sbjct  200   VNCSLFNPTPSLSAMVVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVV  259

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH G+DD
Sbjct  260   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKPMDRRRAKYKLVHVVRTHCGADD  319

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  320   KAFRCVYQEQDDDGKTGVSLSKDLMAIAGGALKANITTLGPLVLPLSEQLLFFATLVAKK  379

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K +PYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  380   LFNAKVEPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  439

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+KG+R+WQIAFGSGFKCNSAVW+   ++K     PW DCIDRYPV
Sbjct  440   SIWYELAYIEAKGRMQKGNRVWQIAFGSGFKCNSAVWEVVESVKASPHSPWEDCIDRYPV  499



>ref|XP_010459615.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=518

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 390/482 (81%), Gaps = 6/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIHV  1891
             SV LKYVKLGY YL++++LTL L P+   +++E  +  PE++    K   + L+  L+ +
Sbjct  37    SVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQMNPEDL----KQLWIHLQYNLVSI  92

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF  T+Y+M++PR +YLVD++CY PP   + P+S FMEHSRL    +  ++EF
Sbjct  93    IICSAVLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFMEHSRLTGDFDDSALEF  152

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE+T +P A+H++P + +M AAR EAE+V+F A+D L     +  KDI I
Sbjct  153   QRKILERSGLGEDTYVPEAMHHVPARISMAAAREEAEQVMFGALDNLFANANVNPKDIGI  212

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A
Sbjct  213   LVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYA  272

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE +T N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  R+KYRL+HVVRTH+G+
Sbjct  273   VVVSTENMTQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGA  332

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ 
Sbjct  333   DDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVV  392

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTS
Sbjct  393   KKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTS  452

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  R++K   + PW  CID+Y
Sbjct  453   SSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEHCIDKY  512

Query  630   PV  625
             PV
Sbjct  513   PV  514



>ref|XP_004152699.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis sativus]
 gb|KGN62598.1| hypothetical protein Csa_2G361630 [Cucumis sativus]
Length=514

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 383/482 (79%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL +VP++A   IEV +   +++  R     +   L+ V+ 
Sbjct  33    SVNLKYVKLGYHYLISNLLTLCIVPLIAVTLIEVSQMNLDDV--RHLWFHLQYNLVSVII  90

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF  T+Y M++PR +YLVDY+CY+P    + PF  FMEHSRL    +  S+EFQ 
Sbjct  91    CSTVMVFGLTVYTMTRPRPVYLVDYSCYRPADDLKAPFHRFMEHSRLTGDFDDSSLEFQR  150

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP P+M AAR EAE+V+F A+D L   T +K KDI IL+
Sbjct  151   KILERSGLGEETYVPEAMHCIPPTPSMAAAREEAEQVMFGALDKLFASTNVKPKDIGILV  210

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  211   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTLAVV  270

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  D  RAKYRL+H+VRTH+G+DD
Sbjct  271   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADD  330

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  331   KAFRCVYQEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKK  390

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
              FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  391   FFNGNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  450

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL Y E+KGRM KG+R+WQIAFGSGFKCNSAVW+  RN++     PW DCID YPV
Sbjct  451   SIWYELAYTEAKGRMHKGNRVWQIAFGSGFKCNSAVWEALRNVRPSQSSPWEDCIDNYPV  510

Query  624   HI  619
              +
Sbjct  511   KL  512



>emb|CDY46211.1| BnaA07g03590D [Brassica napus]
Length=507

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 385/489 (79%), Gaps = 8/489 (2%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPE---EIVMRIKDSVMSL  1906
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R  P+   +I + ++ ++++ 
Sbjct  22    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLITEISRLTPDDFHQIWLHLQYNLVAF  81

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+  L      VF  T+++M++PRS+YLVDY+CY P  + +VP+  FM+HS L    N 
Sbjct  82    ILLSAL-----AVFGTTVFIMTRPRSVYLVDYSCYLPQASLQVPYKKFMDHSALIDDFNA  136

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
              S+EFQ +ILERSGLGEET LP  +H +PP+ TM AAR EAE+V+F  +D L + T++  
Sbjct  137   SSLEFQRKILERSGLGEETYLPEGLHCVPPRTTMAAAREEAEQVMFGCLDKLFENTKINP  196

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             +D+ +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH
Sbjct  197   RDVGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVH  256

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
              N+ A+VVSTE IT N+Y G+++AML+PNCLFR+GG A+L+SNK  D  R+KY+++H VR
Sbjct  257   RNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYKMVHTVR  316

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+D+KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF 
Sbjct  317   THKGADEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFF  376

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TL+ +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHR
Sbjct  377   VTLVWKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHR  436

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSS+WYEL YIE+KGRMKKG+R+WQIAFGSGFKCNSAVW    N+K     PW  
Sbjct  437   FGNTSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSVSSPWEH  496

Query  645   CIDRYPVHI  619
              IDRYPV +
Sbjct  497   SIDRYPVKL  505



>emb|CDY21665.1| BnaA09g44160D [Brassica napus]
Length=510

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 390/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY Y+++++L L L+P+   +++EV +  PE+  +R     +   L+ ++ 
Sbjct  29    SVNLKYVKLGYHYVISNLLALCLLPLAVVISVEVSQTDPED--LRQLWIHLQYNLVSIIA  86

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR IYLVD++CY PP   +VP S FM HS L    +  S+EFQ 
Sbjct  87    CSAVLVFGLTVYVMTRPRPIYLVDFSCYLPPDHLKVPVSRFMNHSTLTGDFDESSLEFQR  146

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGE+T LP A+H++PP  +M AAR EAE+V+F A+D L   T +KAKDI +L+
Sbjct  147   KILERSGLGEDTYLPEAMHHVPPTISMAAAREEAEQVMFGALDKLFANTNVKAKDIGVLV  206

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  207   VNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVV  266

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+++AML+PNCLFR+GG+A+L+SNK RD  R+KYRL HVVRTH+G+DD
Sbjct  267   VSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADD  326

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  G+ G++LSK+LM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ +K
Sbjct  327   KAFRCVYQEQDDTGRTGVSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKK  386

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  387   LFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  446

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   D PW DCID+YPV
Sbjct  447   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSKDSPWEDCIDKYPV  506



>ref|XP_009117539.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=511

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 390/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY Y+++++L L L+P+   +++EV +  PE+  +R     +   L+ ++ 
Sbjct  30    SVNLKYVKLGYHYVISNLLALCLLPLAVVISVEVSQTDPED--LRQLWIHLQYNLVSIIA  87

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR IYLVD++CY PP   +VP S FM HS L    +  S+EFQ 
Sbjct  88    CSAVLVFGLTVYVMTRPRPIYLVDFSCYLPPDHLKVPVSRFMNHSTLTGDFDESSLEFQR  147

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGE+T LP A+H++PP  +M AAR EAE+V+F A+D L   T +KAKDI +L+
Sbjct  148   KILERSGLGEDTYLPEAMHHVPPTISMAAAREEAEQVMFGALDKLFANTNVKAKDIGVLV  207

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  208   VNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVV  267

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+++AML+PNCLFR+GG+A+L+SNK RD  R+KYRL HVVRTH+G+DD
Sbjct  268   VSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADD  327

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  G+ G++LSK+LM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ +K
Sbjct  328   KAFRCVYQEQDDTGRTGVSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKK  387

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  388   LFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  447

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   D PW DCID+YPV
Sbjct  448   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSKDSPWEDCIDKYPV  507



>ref|XP_001758798.1| predicted protein [Physcomitrella patens]
 gb|EDQ76304.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 389/489 (80%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTLL +P++  + +E  R GP+++  ++ D+ +   L+ V+
Sbjct  32    QSVNLKYVKLGYHYLITHLLTLLFIPLVLTILLEAGRMGPDDL-RQLWDN-LRFNLVSVI  89

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y MS+PRSI+LVD+ACY P    +VP   FME +R+    + KS++FQ
Sbjct  90    TCSALLVFGGTVYFMSRPRSIFLVDFACYLPDERLQVPIPLFMERTRMAGFFDEKSLDFQ  149

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLG +T LPAA+H +PP P+M AAR EAE+V+F  +D L +KT +K KD+ IL
Sbjct  150   QKILERSGLGPKTYLPAAMHELPPCPSMKAAREEAEQVMFGCLDELFEKTSIKPKDVGIL  209

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKY +R NI++YN+ GMGCSAG+I+IDLA+D+L ++ ++ A+
Sbjct  210   VVNCSLFNPTPSLSAMIVNKYHMRGNIRTYNMGGMGCSAGVIAIDLAKDMLQINGSTYAI  269

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ R+ML+PNCLFR+GGAAIL+SNKR+D+ R+KY+L HVVRTHKG+D
Sbjct  270   VVSTENITQNWYFGNRRSMLIPNCLFRVGGAAILLSNKRKDARRSKYKLNHVVRTHKGAD  329

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK Y CVY+++D QG +G++LSKDLM IAGE LK+NITT+GPLVLP SEQLLF  +L+ R
Sbjct  330   DKCYNCVYQEQDQQGNMGVSLSKDLMAIAGETLKANITTLGPLVLPLSEQLLFFTSLVTR  389

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL+ EH E SRMTLHRFGNTSS
Sbjct  390   KVFNMKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTPEHCEPSRMTLHRFGNTSS  449

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+K  +++G R+WQIAFGSGFKCNSAVW+  RN+K     PW  CI+ YP
Sbjct  450   SSIWYELAYMEAKEHVRRGHRVWQIAFGSGFKCNSAVWQALRNIKPSQRSPWAHCINEYP  509

Query  627   VHIPEIVKL  601
              H+ EI K 
Sbjct  510   QHVDEIQKF  518



>ref|XP_010477163.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=517

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 390/482 (81%), Gaps = 6/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIHV  1891
             SV LKYVKLGY YL++++LTL L P+   +++E  +  P ++    K   + L+  L+ +
Sbjct  36    SVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQTNPNDL----KQLWIHLQYNLVSI  91

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF  T+Y+M++PR +YLVD++CY PP   + P+S FMEHS+L    +  ++EF
Sbjct  92    IICSAVLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFMEHSKLTGDFDDSALEF  151

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE+T +P A+H++PP+ +M AAR EAE+V+F A+D L     +  KDI I
Sbjct  152   QRKILERSGLGEDTYVPEAMHHVPPRISMAAAREEAEQVMFGALDNLFANANVNPKDIGI  211

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A
Sbjct  212   LVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYA  271

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  R+KY+L+HVVRTH+G+
Sbjct  272   VVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYKLVHVVRTHRGA  331

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ 
Sbjct  332   DDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVV  391

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTS
Sbjct  392   KKLFNSKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTS  451

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  R++K   + PW  CID+Y
Sbjct  452   SSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEHCIDKY  511

Query  630   PV  625
             PV
Sbjct  512   PV  513



>ref|XP_010088926.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB37130.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=503

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/482 (63%), Positives = 382/482 (79%), Gaps = 5/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV +KYVKLGY Y + H+LTL LVP MA   +E  +   +E+ + ++       L  V+ 
Sbjct  26    SVNVKYVKLGYHYFITHLLTLCLVPFMAVSVVEASKMNLDELWLHLQ-----YNLASVVV  80

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF +T+Y+M++PRS+YL+DY+CY PP   +V +  FM+HSRL       S+EFQ 
Sbjct  81    VSTVVVFASTVYIMTRPRSVYLIDYSCYHPPAHLKVTYEKFMKHSRLTGDFEDSSLEFQR  140

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +I+ERSGLGEET  P A+H IPP+PTM  AR EAE+V+F A+D L  KT +K KD+ IL+
Sbjct  141   KIMERSGLGEETYCPEAMHMIPPRPTMAKAREEAEQVMFGALDNLFAKTNVKPKDVGILV  200

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLS+M+VNKYKLR NI+S+NL GMGCSAG+I+IDL +D+L VH N+ A+V
Sbjct  201   VNCSLFNPTPSLSSMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLVKDMLQVHRNTYAVV  260

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VS E IT N+Y G++++ML+PNCLFR+GGAAIL+SNK  D  RAKY+L+HVVRTHKG+DD
Sbjct  261   VSFENITQNWYFGNKKSMLIPNCLFRVGGAAILLSNKSSDRRRAKYKLVHVVRTHKGADD  320

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KAY CV++++D  GK G++LSKDLM IAG ALKSNITT+GPLVLP SEQLLF  TL+ +K
Sbjct  321   KAYNCVFQEQDDAGKTGVSLSKDLMAIAGGALKSNITTLGPLVLPISEQLLFFLTLVLKK  380

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +   K KP+IPDFK AF+HFCIHAGGR VIDEL+KNLQL  EHVEASRMTLHRFGNTSSS
Sbjct  381   LSAAKLKPHIPDFKLAFDHFCIHAGGRGVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  440

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+KG+RIWQIAFGSGFKCNSAVW+  RN+K  ++ PW DCID YPV
Sbjct  441   SIWYELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQALRNVKPSSNSPWADCIDMYPV  500

Query  624   HI  619
              +
Sbjct  501   KL  502



>ref|XP_006847589.1| hypothetical protein AMTR_s00014p00234760 [Amborella trichopoda]
 gb|ERN09170.1| hypothetical protein AMTR_s00014p00234760 [Amborella trichopoda]
Length=512

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/517 (62%), Positives = 403/517 (78%), Gaps = 19/517 (4%)
 Frame = -3

Query  2157  FPSSQPH----QYSERVKEE*LMAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVP  1990
             F SSQP+    Q S R+           P F    SV LKYVKLGY YL+ H+LTLLL+P
Sbjct  4     FQSSQPYPPRCQPSRRL-----------PDF--LQSVNLKYVKLGYHYLITHLLTLLLIP  50

Query  1989  VMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDY  1810
             +MA + ++  +  P++ +       +   L+ VL  S FLVF +T+Y+M++PR IYLVDY
Sbjct  51    LMAVILVQASQMNPDDALELWVH--LQYNLVSVLVCSAFLVFGSTVYIMTRPRPIYLVDY  108

Query  1809  ACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKP  1630
             ACYKPP   +V F+ FMEHS+L+ K +  ++EFQ +ILERSGLGEET  P A+H +PP+ 
Sbjct  109   ACYKPPSHLKVAFAQFMEHSKLSGKFDEPALEFQRKILERSGLGEETYFPDAMHQLPPRL  168

Query  1629  TMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSN  1450
             +M AAR EAE+V+F A+D L   T ++ KD+ ILIVNCSLF+PTPSLSAM+VNKYKLR N
Sbjct  169   SMAAAREEAEQVMFGALDKLFSNTRIRPKDVGILIVNCSLFNPTPSLSAMIVNKYKLRGN  228

Query  1449  IKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLF  1270
             I+S+NL GMGCSAG+I+IDLA+DLL VH ++ A+VVSTE IT N+Y G++R+ML+PNCLF
Sbjct  229   IRSFNLGGMGCSAGVIAIDLAKDLLQVHGSTYAVVVSTENITQNWYFGNKRSMLIPNCLF  288

Query  1269  RMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLM  1090
             R+GG+A+L+SNK  D  R+KY L+HVVRTHKG+DDKA+RCVY+++D  GK G++LSKDLM
Sbjct  289   RVGGSAVLLSNKSSDKRRSKYELVHVVRTHKGADDKAFRCVYQEQDETGKPGVSLSKDLM  348

Query  1089  VIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAG  910
              IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K+ N K KPYIPDFK AFEHFCIHAG
Sbjct  349   AIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLLNAKIKPYIPDFKLAFEHFCIHAG  408

Query  909   GRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIA  730
             GRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSSS+WYEL+Y E+KGRM+KG R+WQIA
Sbjct  409   GRAVIDELEKNLQLLPGHVEASRMTLHRFGNTSSSSIWYELSYTEAKGRMRKGHRVWQIA  468

Query  729   FGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHI  619
             FGSGFKCNSAVWK  + +K   DGPW DCI+ YPV I
Sbjct  469   FGSGFKCNSAVWKALKTVKPSPDGPWEDCINEYPVQI  505



>gb|ABS18382.1| 3-ketoacyl-CoA synthase [Eranthis hyemalis]
Length=514

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/483 (65%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTLLL+P+M  + +E  +  PE+  +R     +   L+ V+
Sbjct  32    QSVNLKYVKLGYHYLITHLLTLLLIPLMVVIVVEGAQTNPED--LRQLWIHLQYNLVSVI  89

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S+FLVF +T+Y+M++PR +YLVDYACY+PP   RV +  FMEHSRL    +  S+EFQ
Sbjct  90    VCSVFLVFGSTVYIMTRPRPVYLVDYACYRPPSHLRVKYDQFMEHSRLTGDFDESSLEFQ  149

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGEET +P A+H IPPKP+M  AR EAE+V++ A+D L   T +K KDI IL
Sbjct  150   RKILERSGLGEETYVPEAMHCIPPKPSMATAREEAEQVMYGALDNLFANTSVKPKDIGIL  209

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I+IDLA+DLL +H N+ A+
Sbjct  210   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAIDLAKDLLQIHRNTYAV  269

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK  +  RAKYRL+HVVRTH+GSD
Sbjct  270   VVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVERRRAKYRLVHVVRTHRGSD  329

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             +KA+RCVY+++D  GKVG+ LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +
Sbjct  330   EKAFRCVYQEQDDAGKVGVTLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVIK  389

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSS
Sbjct  390   KLFNTKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSS  449

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW+  R +K  +  PW DCI +YP
Sbjct  450   SSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRYVKPSSKSPWEDCISKYP  509

Query  627   VHI  619
             V +
Sbjct  510   VQV  512



>ref|XP_003549437.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max]
Length=513

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/485 (63%), Positives = 388/485 (80%), Gaps = 5/485 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIH  1894
              SV LKYVKLGY YL+++++TL LVP++    I+V +      +  ++   + L+  L+ 
Sbjct  30    QSVNLKYVKLGYHYLISNLVTLFLVPLILVTLIQVFQ---TTDIDHLRHLWLHLQYNLLT  86

Query  1893  VLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVE  1714
             +L  S  LVF  TLY +++PR++YL+D AC++P    + PF +FM+HSRL       S+E
Sbjct  87    ILTCSAVLVFGLTLYAVTRPRAVYLLDSACFRPADHLKAPFRSFMDHSRLTGDFEDSSLE  146

Query  1713  FQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDID  1534
             FQ +ILERSGLGEET +P A+H IPP+P+M AAR EAE+V+F A+D L + T +K KDI 
Sbjct  147   FQRKILERSGLGEETYVPEAMHSIPPQPSMAAARAEAEQVMFGALDKLFQGTNIKPKDIG  206

Query  1533  ILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSN  1354
             ILIVNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ 
Sbjct  207   ILIVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTY  266

Query  1353  ALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKG  1174
             A+VVSTE IT N+Y G++++ML+PNCLFR+G +A+L+SNK  D  RAKYRL+HVVRTH+G
Sbjct  267   AVVVSTENITQNWYFGNKKSMLIPNCLFRVGCSALLLSNKPADRRRAKYRLVHVVRTHRG  326

Query  1173  SDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLI  994
             +DDKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+
Sbjct  327   ADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLL  386

Query  993   GRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNT  814
               K+F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNT
Sbjct  387   MNKLFKAGVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNT  446

Query  813   SSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDR  634
             SSSS+WYEL YIE+KGR+KKG+RIWQIAFGSGFKCNSAVW+  RN++   +GPW DCI +
Sbjct  447   SSSSIWYELAYIEAKGRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSPNGPWEDCIHK  506

Query  633   YPVHI  619
             YPV I
Sbjct  507   YPVEI  511



>ref|XP_001753137.1| predicted protein [Physcomitrella patens]
 gb|EDQ82178.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/489 (63%), Positives = 392/489 (80%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTLL VP++  + +EV R GPE++  ++ D+ +   L+ V+
Sbjct  32    QSVNLKYVKLGYHYLITHLLTLLFVPLLLTILLEVGRMGPEDL-RQLWDN-LRFNLVSVI  89

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF+ T++ MS PR+I+LVD+ACY P    +VP   FME +RL    + +S+EFQ
Sbjct  90    TCSALLVFIGTIFFMSLPRAIFLVDFACYLPEEKLQVPIPLFMERTRLAGFFDERSMEFQ  149

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILER+GLG +T LPAA+H  PP P+M AAR EAE+V+F  +D L +KT++K KD+ IL
Sbjct  150   EKILERAGLGPKTYLPAAMHAQPPCPSMKAAREEAEQVMFGCLDELFEKTKIKPKDVGIL  209

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKY++R NI++YNL GMGCSAG+ISIDLA+DLL VH NS A+
Sbjct  210   VVNCSLFNPTPSLSAMIVNKYRMRGNIRTYNLGGMGCSAGVISIDLAKDLLQVHGNSYAI  269

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G+ R+ML+PNCLFR+GG+A+L+SNK +D  R+KY+L HVVRTHKG+D
Sbjct  270   VVSTENITQNWYFGNRRSMLIPNCLFRVGGSAVLLSNKLKDGSRSKYKLNHVVRTHKGAD  329

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK Y CVY+++D QG +G++LSKDLM IAGE LK NITT+GPLVLP SEQLLF  TL+ R
Sbjct  330   DKCYNCVYQEQDEQGILGVSLSKDLMAIAGETLKVNITTLGPLVLPISEQLLFFSTLVAR  389

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL++EH E SRMTLHRFGN+SS
Sbjct  390   KVFNLKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTAEHCEPSRMTLHRFGNSSS  449

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+KGR+++G+R+WQIAFGSGFKCNSAVW+  RN+K P   PW  CI  YP
Sbjct  450   SSIWYELAYMEAKGRIRRGNRVWQIAFGSGFKCNSAVWQALRNIKPPEKSPWAHCIHEYP  509

Query  627   VHIPEIVKL  601
              H+ EI K 
Sbjct  510   QHLDEIQKF  518



>ref|XP_010498362.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Camelina sativa]
Length=516

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 389/482 (81%), Gaps = 6/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLE--LIHV  1891
             SV LKYVKLGY YL++++LTL L P    +++E  +  P+++    K   + L+  L+ +
Sbjct  35    SVNLKYVKLGYHYLISNLLTLCLFPFAVVISVEASQMNPDDL----KQLWIHLQYNLVSI  90

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF  T+Y+M++PR +YLVD++CY PP   + P++ FMEHSRL    +  ++EF
Sbjct  91    IICSAVLVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDSALEF  150

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE+T +P A+H++P + +M AAR EAE+V+F A+D L     +  KDI I
Sbjct  151   QRKILERSGLGEDTYVPEAMHHVPARISMAAAREEAEQVMFGALDNLFANANVNPKDIGI  210

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A
Sbjct  211   LVVNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYA  270

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE +T N+Y G++++ML+PNCLFR+GG+A+L+SNK RD  R+KYRL+HVVRTH+G+
Sbjct  271   VVVSTENMTQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGA  330

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDKA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ 
Sbjct  331   DDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVV  390

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTS
Sbjct  391   KKLFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTS  450

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSA+W+  R++K   + PW  CID+Y
Sbjct  451   SSSIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEHCIDKY  510

Query  630   PV  625
             PV
Sbjct  511   PV  512



>emb|CDO97044.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/483 (63%), Positives = 383/483 (79%), Gaps = 3/483 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY +L++H LTL L+P++A   ++  +   ++         + L LI VL 
Sbjct  36    SVNLKYVKLGYHHLMSHFLTLCLLPLIAITLLQASQMNYQDFQTLYLQ--LQLNLITVLL  93

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
             ++  +VF +T+Y+M++PRS+YLVDYACY+PP   +V F+ FM+HSRL    +  S+EFQ 
Sbjct  94    ATAIMVFGSTVYIMTRPRSVYLVDYACYRPPHHLQVKFNKFMDHSRLTGDFDESSLEFQR  153

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLG ET LP A+H +PP+P+M  AR EAE+V+F A+D L K T +K KDI IL+
Sbjct  154   KILERSGLGVETYLPEAMHCVPPRPSMSTAREEAEQVMFGALDNLFKSTNVKPKDIGILV  213

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VN+Y LR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+V
Sbjct  214   VNCSLFNPTPSLSAMIVNRYGLRGNIQSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVV  273

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+G AA L+SNK  +  RAKY+L+HVVRTHKG+ D
Sbjct  274   VSTENITQNWYFGNKKSMLIPNCLFRVGCAATLLSNKASEKRRAKYKLVHVVRTHKGAQD  333

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
              A+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL  RK
Sbjct  334   TAFRCVYQEQDDHGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLAARK  393

Query  984   IFN-PKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             + N  K KPYIPDFK AF+HFCIHAGGR VIDEL+KNLQLS  HVEASRMTLHRFGNTSS
Sbjct  394   LCNDAKIKPYIPDFKLAFDHFCIHAGGRGVIDELEKNLQLSPIHVEASRMTLHRFGNTSS  453

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRMKKG R+WQIAFGSGFKCNSAVW+  RN+K   + PW DC+DRYP
Sbjct  454   SSIWYELAYTEAKGRMKKGHRVWQIAFGSGFKCNSAVWQALRNVKPSPNSPWQDCVDRYP  513

Query  627   VHI  619
             V +
Sbjct  514   VEM  516



>emb|CDX81929.1| BnaC08g36720D [Brassica napus]
Length=510

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 388/480 (81%), Gaps = 2/480 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++L L L+P+   +++E  +  PE+  +R     +   L+ ++ 
Sbjct  29    SVNLKYVKLGYHYLISNLLALCLLPLAVVISVEASQTDPED--LRQLWIHLQYNLVSIIA  86

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR IYLVD++CY PP   +VP S FM HS L    +  S+EFQ 
Sbjct  87    CSAVLVFGLTVYVMTRPRPIYLVDFSCYLPPDRLKVPVSRFMNHSTLTGDFDESSLEFQR  146

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGE+T LP A+H++PP  +M AAR EAE+V+F A+D L   T +KAKDI +L+
Sbjct  147   KILERSGLGEDTYLPEAMHHVPPTISMAAAREEAEQVMFGALDKLFTNTNVKAKDIGVLV  206

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  207   VNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVV  266

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+++AML+PNCLFR+GG+A+L+SNK RD  R+KYRL HVVRTH+G+DD
Sbjct  267   VSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADD  326

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D   + G++LSK+LM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ +K
Sbjct  327   KAFRCVYQEQDDTRRTGVSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFLTLVVKK  386

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  387   LFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  446

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   D PW DCID+YPV
Sbjct  447   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSKDSPWEDCIDKYPV  506



>ref|NP_001267518.1| uncharacterized protein LOC100797855 [Glycine max]
 gb|AFY23861.1| 3-ketoacyl-CoA synthase [Glycine max]
Length=510

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 384/482 (80%), Gaps = 4/482 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL+++++TL LVP++    I+V     +   +R     +   L+ +L 
Sbjct  31    SVNLKYVKLGYHYLISNLVTLFLVPLILVTLIQV----SQTTDLRHLWLHLQYNLLTILT  86

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  TLY ++ PR +YL+D AC++P    + PF +FM+HSRL       S+EFQ 
Sbjct  87    CSAVLVFGLTLYAVTCPRPVYLLDSACFRPADHLKAPFRSFMDHSRLTGDFEESSLEFQR  146

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP+P+M AAR EAE+V+F A+D L + T +K KDI ILI
Sbjct  147   KILERSGLGEETYVPDAMHSIPPQPSMAAARAEAEQVMFGALDNLFQSTNIKPKDIGILI  206

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLS+M+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  207   VNCSLFNPTPSLSSMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVV  266

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+G + +L+SNK  D  RAKYRL+HVVRTH+G+DD
Sbjct  267   VSTENITQNWYFGNKKSMLIPNCLFRVGCSVLLLSNKPADRRRAKYRLVHVVRTHRGADD  326

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  327   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLLMKK  386

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F    KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL  EHVEASRMTLHRFGNTSSS
Sbjct  387   LFKADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  446

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGR+KKG+RIWQIAFGSGFKCNSAVW+  RN++   +GPW DCID+YPV
Sbjct  447   SIWYELAYIEAKGRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSPNGPWEDCIDKYPV  506

Query  624   HI  619
              I
Sbjct  507   EI  508



>ref|XP_009121221.1| PREDICTED: 3-ketoacyl-CoA synthase 9 [Brassica rapa]
Length=507

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 384/489 (79%), Gaps = 8/489 (2%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPE---EIVMRIKDSVMSL  1906
             N   SV +KYVKLGY YL+ H+  L LVP+MA +  E+ R  P+   +I + ++ ++++ 
Sbjct  22    NFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVLITEISRLTPDDFHQIWLHLQYNLVAF  81

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
              L+  L      VF  T+++M++PRS+YLVDY+CY P  + +VP+  FM+HS L    N 
Sbjct  82    ILLSAL-----AVFGTTVFIMTRPRSVYLVDYSCYLPQASLQVPYKKFMDHSALIDDFNA  136

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
              S+EFQ +ILERSGLGEET LP  +H +PP+ TM AAR EAE+V+F  +D L + T++  
Sbjct  137   SSLEFQRKILERSGLGEETYLPEGLHCVPPRTTMAAAREEAEQVMFGCLDKLFENTKINP  196

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             +D+ +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH
Sbjct  197   RDVGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVH  256

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
              N+ A+VVSTE IT N+Y G+++AML+PNCLFR+GG A+L+SNK  D  R+KY+++H VR
Sbjct  257   RNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYKMVHTVR  316

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+D+KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF 
Sbjct  317   THKGADEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFF  376

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TL+ +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHR
Sbjct  377   VTLVWKKLFNAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHR  436

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSS+WYEL YIE+KGRMKKG+R+WQIA GSGFKCNSAVW    N+K     PW  
Sbjct  437   FGNTSSSSIWYELAYIEAKGRMKKGNRVWQIACGSGFKCNSAVWVALHNVKPSVSSPWEH  496

Query  645   CIDRYPVHI  619
              IDRYPV +
Sbjct  497   SIDRYPVKL  505



>gb|AGK29996.1| 3-ketoacyl-CoA synthase 18 [Gossypium raimondii]
Length=515

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 390/482 (81%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL  +P++A ++IE  +   ++  +R     +   L  ++ 
Sbjct  34    SVNLKYVKLGYHYLISNLLTLCFIPLIAVISIEASQMNLDD--LRQLWVHLQYNLASIII  91

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR +YLVDY+CY+ P   + P+  FMEHS+L    +  S+EFQ 
Sbjct  92    CSAILVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPYGRFMEHSKLTGDFDESSLEFQR  151

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP P+M AAR EAEEV+F A+D L   T +K KDI IL+
Sbjct  152   KILERSGLGEETYVPKAMHNIPPTPSMAAAREEAEEVMFGALDILFHNTNVKPKDIGILV  211

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+D+L VH N+ A+V
Sbjct  212   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVV  271

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTH+G+DD
Sbjct  272   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSKDRRRAKYKLIHVVRTHRGADD  331

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  332   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFTTLVVKK  391

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  392   LFNAGIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  451

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+K +R+WQIAFGSGFKCNSAVW+  RN+K  ++GPW DCIDRYPV
Sbjct  452   SIWYELAYIEAKGRMRKRNRVWQIAFGSGFKCNSAVWEALRNVKSSSNGPWEDCIDRYPV  511

Query  624   HI  619
              I
Sbjct  512   KI  513



>ref|XP_009112385.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 9-like 
[Brassica rapa]
Length=510

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 387/489 (79%), Gaps = 8/489 (2%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPE---EIVMRIKDSVMSL  1906
             N   SV +KYVKLGY +L+ H+  L LVP+MA V  E+ R  P+   ++ + ++ +++S 
Sbjct  25    NFLQSVNIKYVKLGYHHLIKHLFKLCLVPLMAVVISEISRLTPDDFHQLWLHLQYNLVSF  84

Query  1905  ELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNP  1726
                 +L S+L +V   T+++M++ RS+YLVDY+CY PP + +VP+  FM+HS+L    N 
Sbjct  85    ----ILLSALAVVG-CTVFVMTRSRSVYLVDYSCYLPPESLQVPYKKFMDHSKLIEDFND  139

Query  1725  KSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKA  1546
              S+EFQ +ILERSGLGEET LP  +H +PP+ TM AAR EAE+V+F  +D L + T++  
Sbjct  140   SSLEFQRKILERSGLGEETYLPEGLHCVPPRTTMVAAREEAEQVMFGCLDKLFENTKVNP  199

Query  1545  KDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVH  1366
             +DI +L+VNCSLF+PTPSLSAM+VNKYKLR N+KS+NL GMGCSAG+ISIDLA+D+L VH
Sbjct  200   RDISVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVH  259

Query  1365  PNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVR  1186
               + A+VVSTE IT N+Y G+++AML+PNCLFR+GG A+L+SNK  D  R+KY ++H VR
Sbjct  260   RKTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYMMVHTVR  319

Query  1185  THKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFL  1006
             THKG+++KA+ CVY+++D  GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ+LF 
Sbjct  320   THKGANEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFF  379

Query  1005  FTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHR  826
              TL+ +K+FN K KPYIPDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHR
Sbjct  380   ATLVAKKLFNAKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLELSVTHVEASRMTLHR  439

Query  825   FGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLD  646
             FGNTSSSS+WYEL YIE+KGRMKKGDR+WQIAFGSGFKCNSAVW    N+K     PW  
Sbjct  440   FGNTSSSSIWYELAYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWVALNNVKPSVSSPWEH  499

Query  645   CIDRYPVHI  619
             CIDRYPV +
Sbjct  500   CIDRYPVKL  508



>gb|AGK30005.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=515

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 388/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL  +P +A ++I+V +   ++  +R     +   L+ ++ 
Sbjct  34    SVNLKYVKLGYHYLISNLLTLCFIPAIAALSIQVSQMNLDD--LRQLWLHLQYNLVSIII  91

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR +YLVDY+CY+PP   + P+  F+EHSRL    +  S+EFQ 
Sbjct  92    CSAILVFGLTVYIMTRPRPVYLVDYSCYRPPDHLKAPYGRFLEHSRLTGDFDESSLEFQR  151

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP P+M AAR EAEEV+F A+D L + T +  KDI IL+
Sbjct  152   KILERSGLGEETYVPKAMHSIPPTPSMAAAREEAEEVMFGALDTLFRNTNVSPKDIGILV  211

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  212   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVV  271

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ ++ML+PNCLFR+GG+A+L+SNK  D  RAKY+L+HVVRTH+G+DD
Sbjct  272   VSTENITQNWYFGNNKSMLIPNCLFRVGGSAVLLSNKSNDRRRAKYKLIHVVRTHRGADD  331

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL  +K
Sbjct  332   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFTTLAVKK  391

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  392   LFNASVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  451

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGR++  +RIWQIAFGSGFKCNSAVW+  RN+K  ++GPW DCID+YPV
Sbjct  452   SIWYELAYIEAKGRIRNRNRIWQIAFGSGFKCNSAVWQALRNVKPSSNGPWEDCIDKYPV  511

Query  624   HI  619
              I
Sbjct  512   KI  513



>ref|XP_010925903.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Elaeis guineensis]
Length=465

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/456 (65%), Positives = 374/456 (82%), Gaps = 2/456 (0%)
 Frame = -3

Query  1986  MAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYA  1807
             MA + +E  R  P+ I  R     +   L+ VL  S FLVF +T+Y+M++PR +YLVDYA
Sbjct  1     MAMILVEAGRSDPDGI--RQLWVHLQYNLVSVLVCSAFLVFGSTVYIMTRPRPVYLVDYA  58

Query  1806  CYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPT  1627
             CY+PP   +V + +FMEHSRL  + N  ++EFQ +ILERSGLGEET +P A+H++PP+P+
Sbjct  59    CYRPPDRLQVRYRSFMEHSRLCGEFNEDALEFQRKILERSGLGEETYVPEAMHFLPPRPS  118

Query  1626  MDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNI  1447
             M  AR EA++V+F A+DAL + T +K KDI IL+VNCSLF+PTPSLSAM+VN YKLRSNI
Sbjct  119   MANAREEAQQVMFGALDALFRNTGVKPKDISILVVNCSLFNPTPSLSAMIVNHYKLRSNI  178

Query  1446  KSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFR  1267
             KS+NL GMGCSAG+I++DLARDLL  H ++ A+VVSTE IT N+Y G+ ++ML+PNCLFR
Sbjct  179   KSFNLGGMGCSAGVIAVDLARDLLQAHRSTYAVVVSTENITQNWYFGNRKSMLIPNCLFR  238

Query  1266  MGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMV  1087
             +GGAA+L+SN+  D  R+KYRL+HVVRTH+G+DD+A+RCVY+++D QGKVG++LSKDLM 
Sbjct  239   VGGAAVLLSNRSADRRRSKYRLVHVVRTHRGADDRAFRCVYQEQDDQGKVGVSLSKDLMA  298

Query  1086  IAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGG  907
             IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K+FN K KPYIPDFK AF+HFCIHAGG
Sbjct  299   IAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLFNAKVKPYIPDFKLAFDHFCIHAGG  358

Query  906   RAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAF  727
             RAVIDEL+KNLQL+  HVE SRMTLHRFGNTSSSS+WYEL YIE+KGRM++G R+WQIAF
Sbjct  359   RAVIDELEKNLQLTPVHVEPSRMTLHRFGNTSSSSIWYELAYIEAKGRMRRGHRVWQIAF  418

Query  726   GSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHI  619
             GSGFKCNSAVW+  RN+K   + PW DCIDRYPV +
Sbjct  419   GSGFKCNSAVWQALRNVKPSPNSPWEDCIDRYPVQL  454



>ref|XP_010548057.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Tarenaya hassleriana]
Length=479

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/479 (62%), Positives = 379/479 (79%), Gaps = 2/479 (0%)
 Frame = -3

Query  2055  LKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSL  1876
             +KYVKLGY  L+ H+  L LVP+MA V  +  R  P++  +R     +   L+ V+  S 
Sbjct  1     MKYVKLGYHCLITHMWKLCLVPLMAVVAKDATRLSPDD--LRHLWLHLQYNLVGVVVFSA  58

Query  1875  FLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRIL  1696
              L++ +T+++M++PRS+YL+DY+CYKPP T    F  FM+  RL    +  S+EFQ +I+
Sbjct  59    ALIYGSTVFIMTRPRSVYLIDYSCYKPPSTLEANFQKFMDQLRLVEDFDDSSLEFQRKII  118

Query  1695  ERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNC  1516
             ERSGLGEET LP A H IPP+ TM A+R E E+VIF A+D L++ T++  ++I IL+VNC
Sbjct  119   ERSGLGEETHLPEAFHCIPPRQTMVASREETEQVIFGALDNLLENTKINPREIGILVVNC  178

Query  1515  SLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVST  1336
             SLF+PTPSLSAM+VNKYKLR NIK+YNL GMGCSAG+I+IDL +DLL VH N+ A+VVST
Sbjct  179   SLFNPTPSLSAMIVNKYKLRGNIKTYNLGGMGCSAGVIAIDLVKDLLQVHRNTYAVVVST  238

Query  1335  EIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAY  1156
             E IT N+Y G++++ML+PNCLFR+GG+AIL+SNK  D   +KY+L+H VRTHKG+DDKA+
Sbjct  239   ENITQNWYLGNKKSMLIPNCLFRVGGSAILLSNKPSDRRHSKYKLVHTVRTHKGADDKAF  298

Query  1155  RCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFN  976
             +CVY+++D  GK G++LSKDL+ IAGEALK NITT+GPLVLP SEQLLF  TL+ +K+FN
Sbjct  299   KCVYQEQDGNGKSGVSLSKDLVAIAGEALKMNITTLGPLVLPISEQLLFFMTLVAKKLFN  358

Query  975   PKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLW  796
              K KPYIPDFK AFEHFC+HAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSSSS+W
Sbjct  359   AKIKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSDTHVEASRMTLHRFGNTSSSSIW  418

Query  795   YELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHI  619
             YEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW   RN++   + PW DCI RYPV I
Sbjct  419   YELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVRPSVNSPWDDCIGRYPVKI  477



>gb|KDO84579.1| hypothetical protein CISIN_1g010193mg [Citrus sinensis]
Length=515

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/482 (62%), Positives = 384/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL  +P++   +I+V     ++  +R     +   L+ V+ 
Sbjct  34    SVNLKYVKLGYHYLISNLLTLCFIPLIIITSIQVSEMNIDD--LRQLWIHLQFNLVSVVI  91

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+++M++PR +YLVDY+CYKPP   +  +  FMEHS+L    +  S+EFQ 
Sbjct  92    CSAILVFGLTVFIMTRPRPVYLVDYSCYKPPHNLKASYDKFMEHSKLTGDFDESSLEFQR  151

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET  P A+H IPPKP+M AAR EAE+V++ A+D L   T +  KDI IL+
Sbjct  152   KILERSGLGEETYFPEAMHAIPPKPSMAAAREEAEQVMYGALDNLFSNTNVNPKDIGILV  211

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKY+LR NI+SYNL GMGCSAG+I++DLA+DLL V+ N+ A+V
Sbjct  212   VNCSLFNPTPSLSAMIVNKYRLRGNIRSYNLGGMGCSAGVIAVDLAKDLLQVNWNTYAVV  271

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+G +A+L+SNKR+D  +AKYRL+H+VRTHKG+DD
Sbjct  272   VSTENITQNWYFGNKKSMLIPNCLFRVGCSAVLLSNKRKDRRQAKYRLVHIVRTHKGADD  331

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D QGK G++LSK+LM IAG ALK+NITT+GP+VLP SEQLLF  TL+ +K
Sbjct  332   KAFRCVYQEQDDQGKTGVSLSKELMAIAGGALKTNITTLGPVVLPVSEQLLFFATLVIKK  391

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  392   LFNRNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  451

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM +G R+WQIAFGSGFKCNSAVW+  +N+K     PW DCID YPV
Sbjct  452   SIWYELAYIEAKGRMCRGHRVWQIAFGSGFKCNSAVWQALQNVKPSHHSPWEDCIDNYPV  511

Query  624   HI  619
              +
Sbjct  512   KL  513



>ref|XP_010688098.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688099.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688100.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Beta vulgaris subsp. vulgaris]
Length=518

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 380/486 (78%), Gaps = 3/486 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SV+LKYVKLGY YL+ H + L L P +  +  ++  F  E+I +  K   +   LI V
Sbjct  30    KQSVRLKYVKLGYHYLITHAMYLFLTPFVVILAAQLSTFSIEDINLLWKH--LQYNLISV  87

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  +VF++TLY M++PR +YLV+++CYK   + + P   FME S      +   + F
Sbjct  88    IICSTLIVFLSTLYFMTRPRPVYLVNFSCYKGNESQKCPRPYFMEQSATAKVFSDGILAF  147

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGEET LP A+H  PP P+M  AR EAE+V++ AID L+ KT +K KDI I
Sbjct  148   QRKILERSGLGEETYLPVALHNTPPNPSMAYARSEAEDVMYGAIDELLAKTNVKPKDIGI  207

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VN YKLR NI SYNL GMGCSAG+ISI+LA+ LL VHPNS A
Sbjct  208   LVVNCSLFNPTPSLSAMIVNHYKLRGNIVSYNLGGMGCSAGVISIELAKQLLQVHPNSYA  267

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LVVSTE IT N+Y G+ER+MLLPNCLFRMG AAIL+SNKR D  R+KY+L+H VRTHKGS
Sbjct  268   LVVSTENITLNWYLGNERSMLLPNCLFRMGAAAILLSNKRSDRRRSKYQLVHCVRTHKGS  327

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDK + CVY+QEDP GKVG++LSK+LM +AG+ALK+NITT+GPLVLP SEQLLFL TL+G
Sbjct  328   DDKCFSCVYQQEDPSGKVGVSLSKELMAVAGDALKTNITTLGPLVLPMSEQLLFLATLVG  387

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNLQLS  H+E SRMTL+RFGNTS
Sbjct  388   KKLFNMKVKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNTS  447

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD-GPWLDCIDR  634
             SSSLWYEL Y E+KGR++KGDR+WQIAFGSGFKCNSAVWK  R +    +  PW+D I +
Sbjct  448   SSSLWYELAYSEAKGRVRKGDRVWQIAFGSGFKCNSAVWKALRTINPAKEKNPWMDEIHK  507

Query  633   YPVHIP  616
             +PV++P
Sbjct  508   FPVNVP  513



>ref|XP_006435002.1| hypothetical protein CICLE_v10000889mg [Citrus clementina]
 gb|ESR48242.1| hypothetical protein CICLE_v10000889mg [Citrus clementina]
Length=515

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/482 (62%), Positives = 382/482 (79%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL  +P++   +I+V     ++  +R     +   L+ V+ 
Sbjct  34    SVNLKYVKLGYHYLISNLLTLCFIPLIIITSIQVSEMNIDD--LRQLWIHLQFNLVSVVI  91

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+++M++PR +YLVDY+CYKPP   +  +  FMEHS+L    +  S+EFQ 
Sbjct  92    CSAILVFGLTVFIMTRPRPVYLVDYSCYKPPHNLKASYDKFMEHSKLTGDFDESSLEFQR  151

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
              ILERSGLGEET  P A+H IPPKP+M AAR EAE+V++ A+D L   T +  KDI IL+
Sbjct  152   NILERSGLGEETYFPEAMHAIPPKPSMAAAREEAEQVMYGALDNLFSNTNVNPKDIGILV  211

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKY+LR NI+SYNL GMGCSAG+I++DLA+DLL V+ N+ A+V
Sbjct  212   VNCSLFNPTPSLSAMIVNKYRLRGNIRSYNLGGMGCSAGVIAVDLAKDLLQVNWNTYAVV  271

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+G +A+L+SNK +D  RAKYRL+H+VRTHKG+DD
Sbjct  272   VSTENITQNWYFGNKKSMLIPNCLFRVGCSAVLLSNKGKDRRRAKYRLVHIVRTHKGADD  331

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D QGK G++LSK+LM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  332   KAFRCVYQEQDDQGKTGVSLSKELMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVIKK  391

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  392   LFNRNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  451

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM +G R+WQIAFGSGFKCNSAVW+  +N+K     PW DCID YPV
Sbjct  452   SIWYELAYIEAKGRMCRGHRVWQIAFGSGFKCNSAVWQALQNVKPSHHSPWEDCIDNYPV  511

Query  624   HI  619
              +
Sbjct  512   KL  513



>ref|XP_001753229.1| predicted protein [Physcomitrella patens]
 gb|EDQ81858.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/489 (61%), Positives = 377/489 (77%), Gaps = 2/489 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY +L+ H+ TLL +P++ G+ +EV R  P ++     +  +   L+ V+
Sbjct  42    QSVNLKYVKLGYHHLITHLFTLLFIPMLLGIFLEVWRMSPNDLHSLWMN--LQFNLVSVI  99

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S  LVF  T+Y+MS+PR+IYLVD++CY P     VP   FME +R     +   + FQ
Sbjct  100   ICSALLVFGGTVYVMSRPRTIYLVDFSCYLPGSQFEVPKGLFMERTRQTGCFDEGCIGFQ  159

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +ILERSGLGE+T  P A+  +PPKP+M AAR E+  V+F  +D L +KT++K KD+ +L
Sbjct  160   EKILERSGLGEQTYFPPAMFEVPPKPSMKAAREESSAVMFGCLDELFEKTKIKPKDVGVL  219

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VN SLF+PTPSLS+M+VNKY +R NI++YNL GMGCSAG+I+IDLA+D+L VH N+ A+
Sbjct  220   VVNSSLFNPTPSLSSMIVNKYNMRGNIRTYNLGGMGCSAGVIAIDLAKDMLQVHGNTYAI  279

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G  ++ML+PNCLFR+GGAAIL+SNKR+D GR+KY+L HVVRTHKG+D
Sbjct  280   VVSTENITQNWYIGKRKSMLIPNCLFRVGGAAILLSNKRKDKGRSKYKLNHVVRTHKGAD  339

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DK YRCVY+++D + ++G+ LSKDLM IAG+ALK+NITT+GPLVLP SEQLLF   L+ R
Sbjct  340   DKCYRCVYQEQDEEARMGVTLSKDLMAIAGDALKTNITTLGPLVLPLSEQLLFFGFLVAR  399

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+ N K  PYIPDFK AF HFCIHAGGRAVIDELQKNL L+ E  E SRMTLHRFGNTSS
Sbjct  400   KVLNLKVTPYIPDFKLAFNHFCIHAGGRAVIDELQKNLNLTEELCEPSRMTLHRFGNTSS  459

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGRMKKG R+WQIAFGSGFKCNSAVW+  R++K P   PW  CID+YP
Sbjct  460   SSIWYELAYTEAKGRMKKGHRVWQIAFGSGFKCNSAVWQALRSIKPPKQSPWAHCIDQYP  519

Query  627   VHIPEIVKL  601
             VHI E+ K+
Sbjct  520   VHIDEVEKI  528



>ref|XP_010548056.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Tarenaya hassleriana]
Length=509

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/486 (62%), Positives = 381/486 (78%), Gaps = 2/486 (0%)
 Frame = -3

Query  2076  NNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELI  1897
             N   SV +KYVKLGY  L+ H+  L LVP++A V  E  R   ++  +R     +   L 
Sbjct  24    NFLQSVNMKYVKLGYHCLITHMWKLCLVPLIAVVATEASRLSLDD--LRHLWLHLQYNLF  81

Query  1896  HVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSV  1717
              ++  S  L F +T+++M++PR +YLVDY+CYKPP    V F  FM HSRL    +  S+
Sbjct  82    GIVVFSAALAFGSTVFIMTRPRPVYLVDYSCYKPPSNLVVNFQKFMNHSRLIEDFDDSSL  141

Query  1716  EFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDI  1537
             EFQ +I++RSGLGEET LP A+  IPP  TM AAR EAE+V+F A+D L++ T++  +DI
Sbjct  142   EFQRKIIQRSGLGEETHLPEALQCIPPNSTMAAAREEAEQVMFGALDNLLENTKISPRDI  201

Query  1536  DILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNS  1357
              IL+VNCSLF+PTPSLSAM+VNKYKLR NIKSYNL GMGCSAG+I+IDLA+DLL VH N+
Sbjct  202   GILVVNCSLFNPTPSLSAMIVNKYKLRGNIKSYNLGGMGCSAGVIAIDLAKDLLQVHRNT  261

Query  1356  NALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHK  1177
              A+VVSTE IT N+Y G++++ML+PNCLFR+GG+AIL+SNK  D   +KY+L+H VRTHK
Sbjct  262   YAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAILLSNKPSDRRHSKYKLIHTVRTHK  321

Query  1176  GSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTL  997
             G+DDKA++CV++++D +GK G++LSKDLM IAGEALK+NITT+GPLVLP SEQ++F  TL
Sbjct  322   GADDKAFKCVHQEQDGKGKTGVSLSKDLMAIAGEALKTNITTLGPLVLPISEQIIFFMTL  381

Query  996   IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGN  817
             + +K+FN K KPYIPDFK AFEHFC+HAGGRAVIDEL+KNLQLS  HVEAS+MTLHRFGN
Sbjct  382   VAKKLFNAKIKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSDTHVEASKMTLHRFGN  441

Query  816   TSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCID  637
              SSSS+WYEL Y E+KGRM+KG+R+WQIAFGSGFKCNSAVW   RN++   + PW DCI 
Sbjct  442   ISSSSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWMALRNVRPSVNSPWDDCIG  501

Query  636   RYPVHI  619
             RYPV I
Sbjct  502   RYPVKI  507



>ref|XP_009594431.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 4-like 
[Nicotiana tomentosiformis]
Length=513

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/484 (63%), Positives = 385/484 (80%), Gaps = 6/484 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLEL-IHVL  1888
             S+ LKYVKLGY YL++H L+L LVP+++   ++  +   +++    ++  + L+L +  +
Sbjct  32    SINLKYVKLGYHYLMSHFLSLCLVPLISVTFVQASQMNYQDL----QNLYLHLKLNLACI  87

Query  1887  FSSLFL-VFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
              SSL L VF A +Y+M++PR I LVDY+CY PP   +V FS FM HSRL    +  S+EF
Sbjct  88    SSSLXLFVFGAIVYIMTRPRPICLVDYSCYHPPEHLKVKFSKFMGHSRLTGDFDESSLEF  147

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGEET LP A+H +PP+P+M  AR EAE+V+F A+D L   T +K KDI+I
Sbjct  148   QRKILERSGLGEETYLPEALHDVPPRPSMATAREEAEQVMFGALDNLFNNTNVKPKDIEI  207

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VNKYKLR NIKS+NL GMGCSAG+I+IDLA+D+L  H N+ A
Sbjct  208   LVVNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQFHRNTYA  267

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVS E IT N+Y G+++AML+PNCLFR+GGAAIL+SNK  D  RAKY+++HVVRTHKG+
Sbjct  268   VVVSMENITQNWYFGNKKAMLIPNCLFRVGGAAILLSNKAGDKRRAKYKVVHVVRTHKGA  327

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DD A++CVY+++D  GK G++LSKDLM I G ALK+NITT+GPL LP S+QLLF  +L+ 
Sbjct  328   DDTAFKCVYQEQDDNGKTGVSLSKDLMAITGNALKTNITTLGPLXLPISKQLLFFMSLVA  387

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+F+ K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTS
Sbjct  388   RKLFHAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTS  447

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL YIE+KGR+++G RIWQIAFGSGFKCNSAVW+   N+K   + PW DCI RY
Sbjct  448   SSSIWYELAYIEAKGRIRRGHRIWQIAFGSGFKCNSAVWQALTNVKPSPNSPWEDCIHRY  507

Query  630   PVHI  619
             PV +
Sbjct  508   PVEL  511



>gb|EMS60006.1| 3-ketoacyl-CoA synthase 6 [Triticum urartu]
Length=445

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/462 (67%), Positives = 364/462 (79%), Gaps = 17/462 (4%)
 Frame = -3

Query  1986  MAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYA  1807
             MA   IE+ R GP E++   +   + L+L+H+L S+  +VFVAT+Y MS+PR ++LVDY 
Sbjct  1     MAATAIELARLGPGELLALWR--ALHLDLVHILCSAFLVVFVATVYFMSRPRPVFLVDYC  58

Query  1806  CYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPT  1627
             CYKP  + RVPF+TFMEH +L + +N +S+ FQ RILERSGLGEETCLP A HYIPP P+
Sbjct  59    CYKPSPSFRVPFTTFMEHIKL-ISNNDRSLRFQTRILERSGLGEETCLPPANHYIPPNPS  117

Query  1626  MDAARGEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNI  1447
             M+A+R EA+ VIF+AID L+++T LK KDIDIL+VNCSLFSPTPSL AM++NKYKLRSNI
Sbjct  118   MEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLPAMIINKYKLRSNI  177

Query  1446  KSYNLSGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFR  1267
             +S+NLSGMGCSAGLISIDLARD+L VHPNSNALV+STEII            +LP     
Sbjct  178   RSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEII------------ILPREPAG  225

Query  1266  MGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMV  1087
                A + V + R   G             +G+DD+AYRCVYE+ED +G  GI+LSK+LM 
Sbjct  226   HAAAQLPVPDGR--GGDPAVEPAAGGAARQGADDRAYRCVYEEEDDEGHSGISLSKELMA  283

Query  1086  IAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGG  907
             IAGEALKSNITT+GPLVLP SEQLLF F L+GRK+ N KWKPYIPDFK AFEHFCIHAGG
Sbjct  284   IAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVVNSKWKPYIPDFKLAFEHFCIHAGG  343

Query  906   RAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAF  727
             RAVIDELQKNL+LS  HVEASRMTLHRFGNTSSSSLWYEL YIE+KGRM+KGDR+WQI F
Sbjct  344   RAVIDELQKNLELSPRHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMRKGDRVWQIGF  403

Query  726   GSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPVHIPEIVKL  601
             GSGFKCNSAVWKC R +K P DGPW DCI RYPVHIP++VKL
Sbjct  404   GSGFKCNSAVWKCLRTVKTPTDGPWEDCIQRYPVHIPDVVKL  445



>ref|XP_007017550.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
 gb|EOY14775.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
Length=515

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 388/482 (80%), Gaps = 2/482 (0%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY YL++++LTL  +P++A ++IE  +   ++  +R     +   L+ ++ 
Sbjct  34    SVNLKYVKLGYHYLISNLLTLCFIPLIAVISIEGSQMNLDD--LRQLWLHLKYNLVSIII  91

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR +YLVDY+CY+ P   + P   FMEHSRL    +  S++FQ 
Sbjct  92    CSAILVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPCGRFMEHSRLTGDFDESSLKFQR  151

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLGEET +P A+H IPP P+M AAR EAEEV+F A+D L + T +  KDI IL+
Sbjct  152   KILERSGLGEETYVPKAMHNIPPTPSMAAAREEAEEVMFGALDILFRNTNVNPKDIGILV  211

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I++DLA+DLL VH N+ A+V
Sbjct  212   VNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVV  271

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SNK +D  RAKY+L+HVVRTH+G+DD
Sbjct  272   VSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSKDRRRAKYKLIHVVRTHRGADD  331

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ +K
Sbjct  332   KAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFTTLLVKK  391

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN   KPYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTSSS
Sbjct  392   LFNASVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  451

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM+K +R+WQIAFGSGFKCNSAVW+  RN+K   +GPW DCID YPV
Sbjct  452   SIWYELAYIEAKGRMRKRNRVWQIAFGSGFKCNSAVWEALRNVKPSGNGPWEDCIDNYPV  511

Query  624   HI  619
              I
Sbjct  512   KI  513



>ref|XP_002321310.2| very-long-chain fatty acid condensing enzyme family protein [Populus 
trichocarpa]
 gb|EEE99625.2| very-long-chain fatty acid condensing enzyme family protein [Populus 
trichocarpa]
Length=539

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 387/488 (79%), Gaps = 12/488 (2%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSV-----MSLE  1903
              SV LKYVKLGY YL++++LTL  +P++  ++IE  +       M IKD       +   
Sbjct  57    QSVNLKYVKLGYHYLISNLLTLCFIPLIIIISIESSQ-------MNIKDLRQLWIHLQYN  109

Query  1902  LIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPK  1723
             L+ V+  S FLVF  T+++M++PR +YL+DY+CY+ P   + PF+ FMEHSRL    +  
Sbjct  110   LVTVITCSAFLVFGFTVFIMTRPRPVYLIDYSCYRAPDHLKAPFNQFMEHSRLTGDFDDT  169

Query  1722  SVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAK  1543
             S+EFQ +ILERSGLGEET +P A+HYIPP+P+M AAR EAE+V+F A+D L   T++  K
Sbjct  170   SLEFQRKILERSGLGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFTNTQVNPK  229

Query  1542  DIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHP  1363
              I IL+VNCSLF+PTPSLSAM+VNKY+LR NI+S+NL GMGCSAG+I+IDLA+D+L VH 
Sbjct  230   SIGILVVNCSLFNPTPSLSAMIVNKYRLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHR  289

Query  1362  NSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRT  1183
             N+ A+VVSTE IT N+Y G++++ML+PNCLFR+GG+A+L+SN+  D  + KY+L+HVVRT
Sbjct  290   NTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNESADKRKGKYKLVHVVRT  349

Query  1182  HKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLF  1003
             H+G+DDKA+RCVY+++D  GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  
Sbjct  350   HRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFA  409

Query  1002  TLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRF  823
             TL+ +K+ N K  PYIPDFK AF+HFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRF
Sbjct  410   TLVVKKLLNKKMMPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRF  469

Query  822   GNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDC  643
             GNTSSSS+WYEL YIE+K RM+KG+R+WQIAFGSGFKCNSAVW+  R++K   + PW DC
Sbjct  470   GNTSSSSIWYELAYIEAKQRMQKGNRVWQIAFGSGFKCNSAVWEALRDVKPSCNSPWEDC  529

Query  642   IDRYPVHI  619
             ID YPV +
Sbjct  530   IDMYPVKL  537



>ref|NP_001130638.1| g14A [Zea mays]
 gb|ACF78938.1| unknown [Zea mays]
 gb|ACF84285.1| unknown [Zea mays]
 gb|AFW63814.1| g14A [Zea mays]
Length=485

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/489 (62%), Positives = 376/489 (77%), Gaps = 8/489 (2%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SS +L+ +K  YQ +VN+ILT++ VP+ A V ++    GPEEI+ R +    +L   H+L
Sbjct  3     SSAQLRRLKPLYQLVVNNILTIVAVPLAAAVLLKAAELGPEEILARAR----ALRPAHML  58

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              +         LYL  +PR++YLVDYAC++    CRVPF+TF+EHSR+    + +SV F 
Sbjct  59    LAGFLPAVATVLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFM  118

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              R+LERSGLGEETCLP A HYIPP   ++++R EAE VIFSAID L+ KT +  +DIDIL
Sbjct  119   TRLLERSGLGEETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDIL  178

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHP-NSNA  1351
             +VNCSLF+PTPS + MV+ +Y LR +++S +L+GMGCSAGLIS++LAR+LL V P  + A
Sbjct  179   VVNCSLFAPTPSFADMVMRRYGLRGDVRSVHLAGMGCSAGLISVELARNLLQVAPRGARA  238

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LVVSTE ITPNYY G ERAMLLPNCLFRMGGAA L+S    D   A++RL  VVRT +G+
Sbjct  239   LVVSTETITPNYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGA  295

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
              D AYRCVY++ED +G VGINLSKDLM IAG+ALK+NIT +GPLVLPASEQLLF  + I 
Sbjct  296   SDAAYRCVYQEEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIA  355

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+ N + KPYIPDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTS
Sbjct  356   RKVLNDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTS  415

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSSLWYEL YIE+KGRM++GDR+W I FGSGFKCNSA W+C R      DGPW +CI RY
Sbjct  416   SSSLWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPAANADDGPWANCIHRY  475

Query  630   PVHIPEIVK  604
             PVHIP+++K
Sbjct  476   PVHIPDVLK  484



>gb|ACO72624.1| g14a [Zea mays]
Length=485

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 375/489 (77%), Gaps = 8/489 (2%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SS +L+ +K  YQ +VN+ILT++ VP+ A V ++    GPEEI+ R +    +L   H+L
Sbjct  3     SSAQLRRLKPLYQLVVNNILTIVAVPLAAAVLLKAAELGPEEILARAR----ALRPAHML  58

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              +         LYL  +PR++YLVDYAC++    CRVPF+TF+EHSR+    + +SV F 
Sbjct  59    LAGFLPAVATVLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFM  118

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              R+LERSGLGEETCLP A HYIPP   ++++R EAE VIFSAID L+ KT +  +DIDIL
Sbjct  119   TRLLERSGLGEETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDIL  178

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHP-NSNA  1351
             +VNCSLF+PTPS + MV+ +Y LR +++S +L+GMGCSAGLIS++LAR+LL V P  + A
Sbjct  179   VVNCSLFAPTPSFADMVMRRYGLRGDVRSVHLAGMGCSAGLISVELARNLLQVAPRGARA  238

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LVVSTE ITPNYY G ERAMLLPNCLFRMGGAA L+S    D   A++RL  VVRT +G+
Sbjct  239   LVVSTETITPNYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGA  295

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
              D AYRCVY++ED +G VGINLSKDLM IAG+ALK+NIT +GPLVLPASEQLLF  + I 
Sbjct  296   SDAAYRCVYQEEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIA  355

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+ N + KPYIPDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRF NTS
Sbjct  356   RKVLNDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFSNTS  415

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSSLWYEL YIE+KGRM++GDR+W I FGSGFKCNSA W+C R      DGPW +CI RY
Sbjct  416   SSSLWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPAANADDGPWANCIHRY  475

Query  630   PVHIPEIVK  604
             PVHIP+++K
Sbjct  476   PVHIPDVLK  484



>ref|XP_003637542.1| Beta-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH41035.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=521

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/518 (60%), Positives = 395/518 (76%), Gaps = 8/518 (2%)
 Frame = -3

Query  2151  SSQPHQYSERVKEE*LMAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVT  1972
             ++Q + YS R      ++ E S   N   SVKLKYVKLGY YL+++ + L+L+P++   +
Sbjct  8     NNQQNHYSRRS-----ISFERSKLPNFLISVKLKYVKLGYHYLISNAMYLVLIPLLGVAS  62

Query  1971  IEVLRFGPEEIVMRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPP  1792
             + +  F  ++++   ++  +    + +L  +  +VF+ATLY MS+PR IYLVD+ACYKP 
Sbjct  63    VHLSTFSIKDLIQIYEN--LKFNFVSMLICTSLVVFLATLYFMSRPRGIYLVDFACYKPQ  120

Query  1791  VTCRVPFSTFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAAR  1612
                +V    F+E S L      +++ FQ +ILERSGLG++T LP AI  +PP P M  AR
Sbjct  121   KDLQVTREIFVERSILTKAFTEETLSFQKKILERSGLGQKTYLPPAIMRVPPNPCMAEAR  180

Query  1611  GEAEEVIFSAIDALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNL  1432
              EAEEV+F AID +++KT +KAKDI IL+VNCSLF+PTPSLSAM+VN YKLR NI SYNL
Sbjct  181   KEAEEVMFGAIDEVLQKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNILSYNL  240

Query  1431  SGMGCSAGLISIDLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAA  1252
              GMGCSAGLISIDLA+ LL VHPNS ALVVS E IT N+Y G++R+ML+PNCLFRMGGAA
Sbjct  241   GGMGCSAGLISIDLAKQLLQVHPNSYALVVSMENITLNWYFGNDRSMLVPNCLFRMGGAA  300

Query  1251  ILVSNKRRDSGRAKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEA  1072
             +L+SNK RD  R+KY+L+H VRTHKG+D+K+Y CV+++ED   +VG++LSKDLM +AGEA
Sbjct  301   VLLSNKPRDRLRSKYQLVHTVRTHKGADNKSYGCVFQEEDDTKQVGVSLSKDLMAVAGEA  360

Query  1071  LKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVID  892
             LK+NITT+GPLVLP SEQLLF  TL+ RKIF  K KPYIPDFK AFEHFCIHAGGRAV+D
Sbjct  361   LKTNITTLGPLVLPMSEQLLFFGTLVARKIFKMKIKPYIPDFKLAFEHFCIHAGGRAVLD  420

Query  891   ELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFK  712
             EL+KNL LS  H+E SRMTL+RFGNTSSSSLWYEL Y E+KGR+KKGDR WQIAFGSGFK
Sbjct  421   ELEKNLDLSDWHMEPSRMTLNRFGNTSSSSLWYELAYTEAKGRIKKGDRTWQIAFGSGFK  480

Query  711   CNSAVWKCNRNLKKPAD-GPWLDCIDRYPVHIPEIVKL  601
             CNSAVWK  + +    +  PW+D I  +PVH+P++ K+
Sbjct  481   CNSAVWKALKTINPAKEKNPWIDEIHEFPVHVPKVSKV  518



>gb|ACO72625.1| g14a [Zea mays]
Length=485

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 375/489 (77%), Gaps = 8/489 (2%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SS +L+ +K  YQ +VN+ILT++ VP+ A V ++    GPEEI+ R +    +L   H+L
Sbjct  3     SSAQLRRLKPLYQLVVNNILTIVAVPLAAAVLLKAAELGPEEILARAR----ALRPAHML  58

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              +         LYL  +PR++YLVDYAC++    CRVPF+TF+EHSR+    + +SV F 
Sbjct  59    LAGFLPAVATVLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFM  118

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              R+LERSGLGEETCLP A HYIPP   ++++R EAE VIFSAID L+ KT +  +DIDIL
Sbjct  119   TRLLERSGLGEETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDIL  178

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHP-NSNA  1351
             +VNCSLF+PTPS + MV+ +Y LR +++S +L+GM CSAGLIS++LAR+LL V P  + A
Sbjct  179   VVNCSLFAPTPSFADMVMRRYGLRGDVRSVHLAGMDCSAGLISVELARNLLQVAPRGARA  238

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LVVSTE ITPNYY G ERAMLLPNCLFRMGGAA L+S    D   A++RL  VVRT +G+
Sbjct  239   LVVSTETITPNYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGA  295

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
              D AYRCVY++ED +G VGINLSKDLM IAG+ALK+NIT +GPLVLPASEQLLF  + I 
Sbjct  296   SDAAYRCVYQEEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIA  355

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+ N + KPYIPDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTS
Sbjct  356   RKVLNDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTS  415

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSSLWYEL YIE+KGRM++GDR+W I FGSGFKCNSA W+C R      DGPW +CI RY
Sbjct  416   SSSLWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPAANADDGPWANCIHRY  475

Query  630   PVHIPEIVK  604
             PVHIP+++K
Sbjct  476   PVHIPDVLK  484



>gb|ACO72623.1| g14a [Zea mays]
Length=485

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 375/489 (77%), Gaps = 8/489 (2%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             SS +L+ +K  YQ +VN+ILT++ VP+ A V ++    GPEEI+ R +    +L   H+L
Sbjct  3     SSAQLRRLKPLYQLVVNNILTIVAVPLAAAVLLKAAELGPEEILARAR----ALRPAHML  58

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              +         LYL  +PR++YLVDYAC++    CRVPF+TF+EHSR+    + +SV F 
Sbjct  59    LAGFLPAVATVLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFM  118

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              R+LERSGLGEETCLP A HYIPP   ++++R EAE VIFSAID L+ KT +  +DIDIL
Sbjct  119   TRLLERSGLGEETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDIL  178

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHP-NSNA  1351
             +VNCSLF+PTPS + MV+ +Y LR +++S +L+GMGCSAGLIS++LAR+LL V P  + A
Sbjct  179   VVNCSLFAPTPSFADMVMRRYGLRGDVRSVHLAGMGCSAGLISVELARNLLQVAPRGARA  238

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LVVSTE ITPNYY G ERAMLLPNCLFRMGGAA L+S    D   A++RL  VVRT +G+
Sbjct  239   LVVSTETITPNYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGA  295

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
              D AYRCVY++ED +G V INLSKDLM IAG+ALK+NIT +GPLVLPASEQLLF  + I 
Sbjct  296   SDAAYRCVYQEEDERGNVDINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIA  355

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+ N + KPYIPDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTS
Sbjct  356   RKVLNDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTS  415

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSSLWYEL YIE+KGRM++GDR+W I FGSGFKCNSA W+C R      DGPW +CI RY
Sbjct  416   SSSLWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPAANADDGPWANCIHRY  475

Query  630   PVHIPEIVK  604
             PVHIP+++K
Sbjct  476   PVHIPDVLK  484



>ref|XP_009601634.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana tomentosiformis]
Length=517

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 374/489 (76%), Gaps = 3/489 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SVKLKYVKLGY YL++H++ L LVP++  V++ +     EE+V       +   L+ V+ 
Sbjct  28    SVKLKYVKLGYHYLISHVMYLCLVPILGAVSVHLSTLTVEEVVQLWNQ--LKFNLVTVIL  85

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF+ATLY M++PR +YLVD++CYKP      P   FME S+       +++ FQ 
Sbjct  86    CSALMVFLATLYFMTRPRKVYLVDFSCYKPKPDVMCPKELFMERSKQAGIFTDENLAFQK  145

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLG++T  P A+  +PP P M  AR EAE V+F AID L++KT +KAKDI IL+
Sbjct  146   KILERSGLGQKTYFPEALLKVPPNPCMAEARKEAEMVMFGAIDELLEKTGVKAKDIGILV  205

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VN YKLR NI SYNL GMGCSAGLISIDLA+ +L VHPNS ALV
Sbjct  206   VNCSLFNPTPSLSAMIVNHYKLRGNIMSYNLGGMGCSAGLISIDLAKQMLQVHPNSYALV  265

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VS E IT N+Y G+ R+ML+ NC+FRMGGAAIL+SNK  D  R+KY+L+H VRTHKG+DD
Sbjct  266   VSMENITLNWYFGNNRSMLVSNCIFRMGGAAILLSNKSSDRRRSKYQLIHTVRTHKGADD  325

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K+Y CV+++ED   K+G+ LSKDLM +AGEALK+NITT+GP+VLP SEQLLF  TL+ RK
Sbjct  326   KSYSCVFQEEDDNKKIGVALSKDLMAVAGEALKTNITTLGPIVLPMSEQLLFFITLVARK  385

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F  K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNL+LS  H+E SRMTL+RFGNTSSS
Sbjct  386   VFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSQWHMEPSRMTLYRFGNTSSS  445

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD-GPWLDCIDRYP  628
             SLWYEL Y E+KGR+KKGDR WQIAFGSGFKCNSAVW   R +    +  PW+D ID +P
Sbjct  446   SLWYELAYTEAKGRIKKGDRTWQIAFGSGFKCNSAVWCALRTINPAKEKNPWMDEIDEFP  505

Query  627   VHIPEIVKL  601
             V +P +V +
Sbjct  506   VQVPRVVTI  514



>ref|XP_009779614.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Nicotiana sylvestris]
Length=518

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/507 (61%), Positives = 382/507 (75%), Gaps = 11/507 (2%)
 Frame = -3

Query  2100  AEESSPGFNNRS-----SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIV  1936
             A+E S  +NN+      SVKLKYVKLGY YL++H++ L LVP++  V++ +     EE+V
Sbjct  13    AQERS-SYNNKLPNFLLSVKLKYVKLGYHYLISHVMYLCLVPILGAVSVHLSTLTVEEVV  71

Query  1935  MRIKDSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFME  1756
                    +   L+ VL  S  +VF+ATLY M++PR +YLVD++CYKP      P   FME
Sbjct  72    QLWYQ--LKFNLVTVLLCSALMVFLATLYFMTRPRKVYLVDFSCYKPKPDFMCPKELFME  129

Query  1755  HSRLNLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAID  1576
              S+       +++ FQ +ILERSGLG++T  P A+  +PP P M  AR EAE V+F AID
Sbjct  130   RSKEAGIFIDENLAFQKKILERSGLGQKTYFPEALLKVPPNPCMAEARKEAEMVMFGAID  189

Query  1575  ALMKKTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISI  1396
              L++KT +KAKDI IL+VNCSLF+PTPSLSAM+VN YKLR NI SYNL GMGCSAGLISI
Sbjct  190   ELLEKTGVKAKDIGILVVNCSLFNPTPSLSAMIVNHYKLRGNIMSYNLGGMGCSAGLISI  249

Query  1395  DLARDLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGR  1216
             DLA+ +L VHPNS ALVVS E IT N+Y G+ R+ML+ NC+FRMGGAAIL+SNK  D  R
Sbjct  250   DLAKQMLQVHPNSYALVVSMENITLNWYFGNNRSMLVSNCIFRMGGAAILLSNKSSDRRR  309

Query  1215  AKYRLMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLV  1036
             +KY+L+H VRTHKG+DDK+Y CV+++ED   K+G+ LSKDLM +AGEALK+NITT+GP+V
Sbjct  310   SKYQLIHTVRTHKGADDKSYSCVFQEEDDNKKIGVALSKDLMAVAGEALKTNITTLGPIV  369

Query  1035  LPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEH  856
             LP SEQLLF  TL+ RK+F  K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNL+LS  H
Sbjct  370   LPMSEQLLFFITLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSQWH  429

Query  855   VEASRMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNL  676
             +E SRMTL+RFGNTSSSSLWYEL Y E+KGR+KKGDR WQIAFGSGFKCNSAVW C    
Sbjct  430   MEPSRMTLYRFGNTSSSSLWYELAYTEAKGRIKKGDRTWQIAFGSGFKCNSAVW-CALRT  488

Query  675   KKPA--DGPWLDCIDRYPVHIPEIVKL  601
               PA    PW+D ID +PV +P +V +
Sbjct  489   INPAKEKNPWMDEIDEFPVQVPRVVTI  515



>ref|XP_002284986.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Vitis vinifera]
 emb|CAN67313.1| hypothetical protein VITISV_014119 [Vitis vinifera]
Length=511

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/491 (62%), Positives = 377/491 (77%), Gaps = 3/491 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SVKLKYVKLGY YL+ H + L L P++  +  ++  F  +++   + D  +   LI V
Sbjct  23    KKSVKLKYVKLGYHYLITHGMYLFLSPLVVVIAAQLSTFSLQDL-HDLWDH-LRFNLISV  80

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF++TLY +++PR +YLVD+ACYKP  + +     FM+ S++       S+EF
Sbjct  81    ILCSTLLVFLSTLYFLTRPRPVYLVDFACYKPEESRKCTRKIFMDQSQMTGSFTESSLEF  140

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILE+SGLGE T LP A+  IPP P+M  AR EA  V+F A+D L  KT LK KDI I
Sbjct  141   QRKILEKSGLGESTYLPEAVLNIPPNPSMQEARKEAATVMFGALDQLFAKTSLKPKDIGI  200

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAMV+N YKLR NI SYNL GMGCSAGLISIDLA+DLL VHPNS A
Sbjct  201   LVVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAKDLLQVHPNSYA  260

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LV+S E IT N+Y G++R+ML+ NCLFRMGGAA+L+SNK  D  R+KYRL+H VRTHKG+
Sbjct  261   LVISMENITLNWYFGNQRSMLVSNCLFRMGGAAVLLSNKSSDRRRSKYRLVHTVRTHKGA  320

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDK + CV ++ED +GKVG++LSKDLM +AG+ALK+NITT+GPLVLP SEQLLF  TLIG
Sbjct  321   DDKCFACVTQEEDAEGKVGVSLSKDLMGVAGDALKTNITTLGPLVLPMSEQLLFFATLIG  380

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+F  K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNL LS  H+E SRMTL+RFGNTS
Sbjct  381   RKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLHLSDWHMEPSRMTLYRFGNTS  440

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD-GPWLDCIDR  634
             SSSLWYEL Y E+KGR+KKGDR WQIAFGSGFKCNSAVWK  R +    +  PW+D ID 
Sbjct  441   SSSLWYELAYTEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALRTINPAQEKNPWMDEIDM  500

Query  633   YPVHIPEIVKL  601
             +PV++P++  L
Sbjct  501   FPVNVPKVSAL  511



>ref|XP_011081914.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Sesamum indicum]
Length=511

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/488 (62%), Positives = 375/488 (77%), Gaps = 3/488 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SVKLKYVKLGY YL+ H + L L P++  +  +V  F  +++ +      +   LI V
Sbjct  23    KQSVKLKYVKLGYHYLITHGMYLFLSPLVVVIAAQVSTFSLQDLYVLWDH--LRFNLISV  80

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF++T+Y +++PR +YLV+++CYKP    +     FME SRL      +++EF
Sbjct  81    IVCSALLVFLSTVYFLTRPRPVYLVNFSCYKPNDDRKCTRQIFMERSRLTGTFTEENLEF  140

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE T LP A+  +PP P M  AR EAE V+F AID L+ KT LK KDI I
Sbjct  141   QRKILERSGLGESTYLPEAVLRVPPNPCMAEARKEAETVMFGAIDELLAKTSLKPKDIGI  200

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             LIVNCSLF+PTPSLSAMV+N YKLR NI SYNL GMGCSAGLISIDLA+DLL VHPN+ A
Sbjct  201   LIVNCSLFNPTPSLSAMVINHYKLRGNIISYNLGGMGCSAGLISIDLAKDLLQVHPNTYA  260

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LV+S E IT N+Y G+ER+ML+ NCLFRMGGAAIL+SNKR D  R+KYRL+H VRTHKGS
Sbjct  261   LVISMENITLNWYFGNERSMLVSNCLFRMGGAAILLSNKRSDYWRSKYRLVHTVRTHKGS  320

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDK + CV + ED +GK+G+ LSKDLM +AG+ALK+NITT+GPLVLP SEQLLF  TL+G
Sbjct  321   DDKCFSCVTQMEDSKGKIGVALSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVG  380

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+F  K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNLQLS  H+E SRMTL+RFGNTS
Sbjct  381   KKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNTS  440

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD-GPWLDCIDR  634
             SSSLWYEL Y E+KGR+K+GDR WQIAFGSGFKCNSAVWK  R +    +  PW+D I +
Sbjct  441   SSSLWYELAYSEAKGRIKRGDRTWQIAFGSGFKCNSAVWKALRTINPAKEKNPWMDEIHQ  500

Query  633   YPVHIPEI  610
             +PV +P++
Sbjct  501   FPVEVPKV  508



>ref|XP_003536489.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/487 (62%), Positives = 380/487 (78%), Gaps = 5/487 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV+LKYVKLGY Y++++ + L+L+P++   +  +     +E+V   ++  +  +L+ V  
Sbjct  29    SVRLKYVKLGYHYVISNAMYLMLIPLIGTASAHLSTISMKELVRLWEN--LKFDLVSVTL  86

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  +VF+ TLY MS+PR +YLVD+ACYKP V C+     F+E S L      +++ FQ 
Sbjct  87    CSSLMVFLGTLYFMSRPRGVYLVDFACYKPDVDCKCTREIFVERSGLTGSFTEENLSFQK  146

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +ILERSGLG++T LP AI  +PPKP M AAR EAE+V+F AID L+ KT +KAKDI IL+
Sbjct  147   KILERSGLGQKTYLPPAILSLPPKPCMAAAREEAEQVMFGAIDQLLAKTGVKAKDIGILV  206

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VN YKLR N+ SYNL+GMGCSA LISIDLA+ LL VHPNS ALV
Sbjct  207   VNCSLFNPTPSLSAMIVNHYKLRGNVFSYNLAGMGCSASLISIDLAKHLLQVHPNSYALV  266

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VS E IT N+Y G+ R+ML+ NCLFRMGGAAIL+SN+  D  RAKY+L+H VRTHKG+DD
Sbjct  267   VSMENITLNWYFGNNRSMLVSNCLFRMGGAAILLSNRSGDRRRAKYQLVHTVRTHKGADD  326

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             K+Y CV+++ED   ++G+ LSKDLM +AGEALK+NITT+GPLVLP SEQLLF  TL+ RK
Sbjct  327   KSYSCVFQEEDETKRIGVALSKDLMAVAGEALKTNITTLGPLVLPMSEQLLFFATLVARK  386

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +F  K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNL+LS  H+E SRMTL+RFGNTSSS
Sbjct  387   VFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSDWHMEPSRMTLYRFGNTSSS  446

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA--DGPWLDCIDRY  631
             SLWYEL Y E+KGR+KKGDR WQIAFGSGFKCNSAVW+  R +  PA  + PW+D I  +
Sbjct  447   SLWYELAYTEAKGRIKKGDRTWQIAFGSGFKCNSAVWRALRTI-NPAKENNPWMDEIHDF  505

Query  630   PVHIPEI  610
             PVH+P++
Sbjct  506   PVHVPKV  512



>ref|XP_009607438.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana tomentosiformis]
Length=512

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/491 (61%), Positives = 381/491 (78%), Gaps = 3/491 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SVKLKYVKLGY YL+ H + L L P++  +  ++  F   ++ +  +   +   LI V
Sbjct  24    KQSVKLKYVKLGYHYLITHGMYLFLSPLVVVLAAQLSTFSLSDLYILWEQ--LRFNLISV  81

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF++TLY +++PR +YLVD++CYKP  + +     FME S+L      +++EF
Sbjct  82    VICSTLLVFLSTLYFLTRPRPVYLVDFSCYKPEDSRKCTRQIFMERSKLTGSFPDETLEF  141

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE T LP A+  +PP P M  AR EAE V+F AID L+ KT +K+KDI I
Sbjct  142   QRKILERSGLGESTYLPEAVLRVPPNPCMAEARKEAEIVMFGAIDELLAKTGIKSKDIGI  201

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VN YKLR NI SYNL GMGCSAGLISIDLA+DLL VHPN+ A
Sbjct  202   LVVNCSLFNPTPSLSAMIVNHYKLRGNIVSYNLGGMGCSAGLISIDLAKDLLQVHPNTYA  261

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LV+S E IT N+Y G+E++MLLPNCLFRMGGAA+L+SNK  +  R+KY+L+H VRTHKGS
Sbjct  262   LVLSMENITLNWYFGTEKSMLLPNCLFRMGGAAVLLSNKGSERRRSKYQLVHTVRTHKGS  321

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDK + CVY+ EDP GKVG++LSKDLM +AG+ALK+NITT+GPLVLP SEQLLF  TL+G
Sbjct  322   DDKCFSCVYQMEDPNGKVGVSLSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVG  381

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+   K KPYIPDF+ AFEHFCIHAGGRAV+DE++KNLQL+  H+E SRMTL+RFGNTS
Sbjct  382   RKLLKMKIKPYIPDFRLAFEHFCIHAGGRAVLDEIEKNLQLTDWHMEPSRMTLYRFGNTS  441

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD-GPWLDCIDR  634
             SSSLWYEL Y E+KGR+K+GDR WQIAFGSGFKCNSAVWK  R++    +  PW+D I++
Sbjct  442   SSSLWYELAYSEAKGRIKRGDRTWQIAFGSGFKCNSAVWKALRSINPAKEKNPWMDEINQ  501

Query  633   YPVHIPEIVKL  601
             +PV +P + K+
Sbjct  502   FPVDVPRVAKI  512



>gb|AGK29998.1| 3-ketoacyl-CoA synthase 9 [Gossypium raimondii]
Length=504

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/483 (61%), Positives = 380/483 (79%), Gaps = 4/483 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEI-VMRIKDSVMSLELIHVL  1888
             SVKLKYVKLGY YL +H+L L LVPVMA V I+  R   ++I  M ++   +   L+ V+
Sbjct  23    SVKLKYVKLGYHYLASHLLKLCLVPVMAAVIIKASRLSLDDIHQMWLQ---LEYNLVRVV  79

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
               S   VF +T+Y+M++ R IYLVDYACY PP   +     FME+++     +  ++EF 
Sbjct  80    VFSAIFVFGSTVYVMTRKRFIYLVDYACYLPPQHLKADHRYFMEYAKEAADFDEPTMEFL  139

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              +I+ERSGLG+ET  P ++H  PP+P+M AAR EAE V+F A+D L   T +K +DI IL
Sbjct  140   RKIMERSGLGDETGAPPSMHCFPPRPSMAAARQEAELVMFGALDTLFASTNVKPRDIGIL  199

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSL+AM++NKYK+R NIKS+NLSGMGCSAG+I+IDLA+D+L VH N+ A+
Sbjct  200   VVNCSLFNPTPSLTAMIINKYKMRGNIKSFNLSGMGCSAGVIAIDLAKDMLQVHRNNYAV  259

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             V STE +T N+Y G E++ML+ NCLFR+GG+A+L+SNK  D GR+KY+L+HVVRTH G++
Sbjct  260   VFSTENMTQNWYSGIEKSMLISNCLFRLGGSAVLLSNKSIDRGRSKYKLVHVVRTHCGAN  319

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++CVY++ED  GK+G++LSKDLM IAG ALK+NITT+GPLVLP SEQ+LF  TL+ +
Sbjct  320   DKAFKCVYQEEDNVGKIGVSLSKDLMAIAGNALKTNITTLGPLVLPISEQILFFVTLVAK  379

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPY+PDFK AFEHFCIHAGGR VIDEL+KN+QLS  HVEASRMTLHRFGNTSS
Sbjct  380   KLFNAKIKPYVPDFKLAFEHFCIHAGGRGVIDELEKNMQLSPLHVEASRMTLHRFGNTSS  439

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y+E+KGRM+KGDRIWQ+AFGSGFKCNSAVW   +N+K     PW DCI +YP
Sbjct  440   SSIWYELAYMEAKGRMRKGDRIWQVAFGSGFKCNSAVWLALKNVKPSCGNPWEDCIHKYP  499

Query  627   VHI  619
             V +
Sbjct  500   VKL  502



>ref|NP_001146356.1| uncharacterized protein LOC100279934 [Zea mays]
 ref|XP_008643503.1| PREDICTED: uncharacterized protein LOC100279934 isoform X1 [Zea 
mays]
 gb|ACL53765.1| unknown [Zea mays]
 gb|ACN28136.1| unknown [Zea mays]
Length=493

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/489 (61%), Positives = 376/489 (77%), Gaps = 13/489 (3%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
             S V+L+ +K  YQ +VN+IL ++ VP+ A V ++    GPEEI        ++L   H+ 
Sbjct  16    SPVQLRRLKPLYQLVVNNILAIVAVPLAAAVLLKASSLGPEEI--------LALRPAHMF  67

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
              ++        LYLM +PR++YLVDYAC++    CRVPF+TF+EHSR+    + +SV F 
Sbjct  68    LAAFLPAAATVLYLMLRPRAVYLVDYACFRTSPNCRVPFATFLEHSRVWPGFDERSVRFM  127

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              R+LERSGLGEETCLP A HYIPP   ++++R EAE VIFSAID L+ KT +  +DIDIL
Sbjct  128   TRLLERSGLGEETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPRDIDIL  187

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHP-NSNA  1351
             +VNCSLF+PTPS + MV ++Y+LR ++++ +L+GMGCSAGL+S++LAR+LL V P  + A
Sbjct  188   VVNCSLFAPTPSFADMVAHRYRLRGDVRNVHLAGMGCSAGLVSVELARNLLQVAPRGARA  247

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LVVSTE ITPNYY G ERAMLLPNCLFRMGGAA L+S    D   A++RL  VVRT +G+
Sbjct  248   LVVSTETITPNYYMGEERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGA  304

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
              D AYRCVY++ED +G VGINLSKDLM IAG+ALK+NIT +GPLVLPASEQLLF  + I 
Sbjct  305   SDGAYRCVYQEEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIA  364

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+ N + +PYIPDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTS
Sbjct  365   RKVLNNRIRPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTS  424

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSSLWYEL Y+E+KGRM++GDR+W I FGSGFKCNSA W+C R     ADGPW +CI RY
Sbjct  425   SSSLWYELAYVEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPAAN-ADGPWANCIHRY  483

Query  630   PVHIPEIVK  604
             PVHIP+++K
Sbjct  484   PVHIPDVLK  492



>ref|XP_009149432.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=506

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/480 (61%), Positives = 385/480 (80%), Gaps = 5/480 (1%)
 Frame = -3

Query  2064  SVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVLF  1885
             SV LKYVKLGY Y+++++LTL L+P+   ++++        + + ++       L+ ++ 
Sbjct  28    SVNLKYVKLGYHYVISNLLTLCLLPLAVVISVQASHDDLRHLWLHLQ-----YNLVSIIT  82

Query  1884  SSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQM  1705
              S  LVF  T+Y+M++PR +YLVD++CY PP   + PFS FM HSRL    +  ++EFQ 
Sbjct  83    CSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPFSRFMAHSRLTGDFDDSALEFQR  142

Query  1704  RILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDILI  1525
             +IL+RSGLGE+T +P  +H++PP+ +M AAR EAE+V+F A+D+L + T +  KDI IL+
Sbjct  143   KILQRSGLGEDTYVPEGMHHVPPRISMAAAREEAEQVMFGALDSLFENTNINPKDIGILV  202

Query  1524  VNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNALV  1345
             VNCSLF+PTPSLSAM+VNKYKLR NI+SYNL GMGCSAG+I++DLA+D+L VH  + A+V
Sbjct  203   VNCSLFNPTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRKTYAVV  262

Query  1344  VSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSDD  1165
             VSTE IT N+Y G+ +AML+PNCLFR+GG+A+L+SNK  D  R+KYRL HVVRTH+G+DD
Sbjct  263   VSTENITQNWYFGNNKAMLIPNCLFRVGGSAVLLSNKSSDKRRSKYRLSHVVRTHRGADD  322

Query  1164  KAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRK  985
             KA+RCVY+++D  G+ G++LSKDLM IAGE LK+NITT+GPLVLP SEQ+LF  TL+ +K
Sbjct  323   KAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFTTLVVKK  382

Query  984   IFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSS  805
             +FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSSS
Sbjct  383   LFNGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  442

Query  804   SLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYPV  625
             S+WYEL YIE+KGRM++G+R+WQIAFGSGFKCNSAVW+  RN+K   + PW DCID+YPV
Sbjct  443   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSKNSPWEDCIDKYPV  502



>ref|XP_007154946.1| hypothetical protein PHAVU_003G160400g [Phaseolus vulgaris]
 gb|ESW26940.1| hypothetical protein PHAVU_003G160400g [Phaseolus vulgaris]
Length=510

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/499 (61%), Positives = 380/499 (76%), Gaps = 3/499 (1%)
 Frame = -3

Query  2103  MAEESSPGFNNRSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIK  1924
             MA  S    + + S+KLKYVKLGY YL+ H + L L P++  +  ++  F  ++     +
Sbjct  11    MASSSRSLPDFKKSIKLKYVKLGYHYLITHGMYLCLTPLVVLIAAQLSTFSFQDFYDIWE  70

Query  1923  DSVMSLELIHVLFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL  1744
                +   LI V+  S  LVF++TLY +++PR +YLVD++CYKP  + +    TF++HSRL
Sbjct  71    H--LQYNLISVILCSTLLVFLSTLYFLTRPRPVYLVDFSCYKPEESRQCTKRTFIDHSRL  128

Query  1743  NLKDNPKSVEFQMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMK  1564
                   +++EFQ +ILERSGLGE T LP A+  IPP P+M  AR EAE V+F AID L+ 
Sbjct  129   TGSFTEENLEFQRKILERSGLGETTYLPEAVLNIPPNPSMKEARKEAEAVMFGAIDELLA  188

Query  1563  KTELKAKDIDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLAR  1384
             KT +K KDI ILIVNCSLF+PTPSLSAM+VN YKLR NI+SYNL GMGCSAGLISIDLA+
Sbjct  189   KTSVKPKDIGILIVNCSLFNPTPSLSAMIVNHYKLRGNIRSYNLGGMGCSAGLISIDLAK  248

Query  1383  DLLHVHPNSNALVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYR  1204
             DLL  +PNS ALV+S E IT N+Y G++R+ L+ NCLFRMGGAA+L+SNK  D  R+KYR
Sbjct  249   DLLQANPNSYALVISMENITLNWYFGNDRSKLVSNCLFRMGGAAVLLSNKSSDRRRSKYR  308

Query  1203  LMHVVRTHKGSDDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPAS  1024
             L+  VRTHKG+DDK + CV ++ED  GK+G+ LSKDLM +AG+ALK+NITT+GPLVLP S
Sbjct  309   LVTTVRTHKGADDKCFSCVTQEEDANGKIGVTLSKDLMAVAGDALKTNITTLGPLVLPTS  368

Query  1023  EQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEAS  844
             EQLLF  TL+G+KIF  K KPYIPDFK AFEHFCIHAGGRAV+DEL+KNLQLS+ H+E S
Sbjct  369   EQLLFFATLVGKKIFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSTWHMEPS  428

Query  843   RMTLHRFGNTSSSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPA  664
             RMTL+RFGNTSSSSLWYEL Y E+KGR++KGDR WQIAFGSGFKCNSAVWK  R +    
Sbjct  429   RMTLYRFGNTSSSSLWYELAYTEAKGRIRKGDRTWQIAFGSGFKCNSAVWKALRTIDSAK  488

Query  663   D-GPWLDCIDRYPVHIPEI  610
             +  PW+D ID++PV +P +
Sbjct  489   EKSPWIDEIDQFPVDVPRV  507



>gb|AFW81175.1| acyltransferase [Zea mays]
Length=505

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/484 (63%), Positives = 385/484 (80%), Gaps = 5/484 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTL L+P++A + +E  R  P++  +R     +   L+ VL
Sbjct  18    QSVNLKYVKLGYHYLITHLLTLTLLPLIAVILLEAGRTDPDD--LRQLWLHLQYNLVSVL  75

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL-NLKDNPKSVEF  1711
               S  LVF AT+Y +++PR +YLVD+ACY+PP   RV F  FM HSRL    D+  ++EF
Sbjct  76    VLSAVLVFGATVYALTRPRPVYLVDFACYRPPAHLRVRFDQFMRHSRLCGFSDD--ALEF  133

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGL EET +P A+H +PP+PTM  AR EAE V+F A+DAL + T +K KD+ +
Sbjct  134   QRKILERSGLSEETYVPEAMHALPPQPTMANARAEAEAVMFGALDALFRSTGVKPKDVGV  193

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAMVVN+Y+LR N++S+NL GMGCSAG+I++DLARD+L VH  + A
Sbjct  194   LVVNCSLFNPTPSLSAMVVNRYRLRGNVRSFNLGGMGCSAGVIAVDLARDMLQVHRATYA  253

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE IT N+Y G+ ++ML+PNCLFR+GGAA+L+SN+  D  RAKY L HVVRTHKG+
Sbjct  254   VVVSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGADRRRAKYVLRHVVRTHKGA  313

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DD+A+ CVY+++D +GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ 
Sbjct  314   DDRAFGCVYQEQDGEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVA  373

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+ + K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTS
Sbjct  374   KKLLSAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPAHVEASRMTLHRFGNTS  433

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL Y+E+KGR+++G R+WQIAFGSGFKCNSAVW   RN+K   D PW DCIDRY
Sbjct  434   SSSIWYELAYMEAKGRVRRGHRVWQIAFGSGFKCNSAVWHALRNVKPSPDSPWEDCIDRY  493

Query  630   PVHI  619
             PV +
Sbjct  494   PVEL  497



>ref|XP_009801870.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=512

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/491 (61%), Positives = 380/491 (77%), Gaps = 3/491 (1%)
 Frame = -3

Query  2070  RSSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHV  1891
             + SVKLKYVKLGY YL+ H + + L P++  +  ++  F   ++ +  +   +   LI V
Sbjct  24    KQSVKLKYVKLGYHYLITHGMYVFLSPLVVVLAAQLSTFSLSDLYILWEQ--LRFNLISV  81

Query  1890  LFSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEF  1711
             +  S  LVF++TLY +++PR +YLVD++CYKP  + +     FME S+L      +++EF
Sbjct  82    VICSTLLVFLSTLYFLTRPRPVYLVDFSCYKPEDSRKCTRQIFMERSKLTGSFPDETLEF  141

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGLGE T LP A+  +PP P M  AR EAE V+F AID L+ KT +K KDI I
Sbjct  142   QRKILERSGLGESTYLPEAVLRVPPNPCMAEARKEAEIVMFGAIDELLAKTGIKPKDIGI  201

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VN YKLR NI SYNL GMGCSAGLISIDLA+DLL VHPN+ A
Sbjct  202   LVVNCSLFNPTPSLSAMIVNHYKLRGNIVSYNLGGMGCSAGLISIDLAKDLLQVHPNTYA  261

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             LV+S E IT N+Y G+E++MLLPNCLFRMGGAA+L+SNK  +  R+KY+L+H VRTHKGS
Sbjct  262   LVLSMENITLNWYFGTEKSMLLPNCLFRMGGAAVLLSNKGSERRRSKYQLVHTVRTHKGS  321

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             DDK + CVY+ EDP GKVG++LSKDLM +AG+ALK+NITT+GPLVLP SEQLLF  TL+G
Sbjct  322   DDKCFSCVYQMEDPNGKVGVSLSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVG  381

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             RK+   K KPYIPDF+ AFEHFCIHAGGRAV+DE++KNLQL+  H+E SRMTL+RFGNTS
Sbjct  382   RKLLKMKIKPYIPDFRLAFEHFCIHAGGRAVLDEIEKNLQLTDWHMEPSRMTLYRFGNTS  441

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPAD-GPWLDCIDR  634
             SSSLWYEL Y E+KGR+K+GDR WQIAFGSGFKCNSAVWK  R++    +  PW+D I++
Sbjct  442   SSSLWYELAYSEAKGRIKRGDRTWQIAFGSGFKCNSAVWKALRSINPAKEKNPWMDEINQ  501

Query  633   YPVHIPEIVKL  601
             +PV +P + K+
Sbjct  502   FPVDVPRVAKI  512



>ref|NP_001056354.1| Os05g0568000 [Oryza sativa Japonica Group]
 gb|AAU10670.1| putative beta-ketoacyl-CoA synthase [Oryza sativa Japonica Group]
 dbj|BAF18268.1| Os05g0568000 [Oryza sativa Japonica Group]
 dbj|BAG94915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99710.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64728.1| hypothetical protein OsJ_19584 [Oryza sativa Japonica Group]
Length=514

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 385/484 (80%), Gaps = 5/484 (1%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              SV LKYVKLGY YL+ H+LTLLL+P+MA + +E  R  P++  +R     +   L+ VL
Sbjct  23    QSVNLKYVKLGYHYLITHLLTLLLLPLMAVIVLEAGRTDPDD--LRQLWLHLQYNLVSVL  80

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRL-NLKDNPKSVEF  1711
               S  LVF AT+Y++++PR +YLVD+ACYKPP   +V F  F+ HS+L    D+   +EF
Sbjct  81    VLSAVLVFGATVYVLTRPRPVYLVDFACYKPPDKLKVRFDEFLHHSKLCGFSDD--CLEF  138

Query  1710  QMRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDI  1531
             Q +ILERSGL EET +P A+H IPP+PTM  AR EAE V+F A+D L K T +K KD+ +
Sbjct  139   QRKILERSGLSEETYVPEAMHLIPPEPTMANARAEAESVMFGALDKLFKFTGVKPKDVGV  198

Query  1530  LIVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNA  1351
             L+VNCSLF+PTPSLSAM+VNKYKLR NIKS+NL GMGCSAG+I++DLARD+L VH N+ A
Sbjct  199   LVVNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLARDMLQVHRNTYA  258

Query  1350  LVVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGS  1171
             +VVSTE IT N+Y G+ ++ML+PNCLFR+GGAA+L+SN+  D  RAKY L HVVRTHKG+
Sbjct  259   VVVSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGADRRRAKYALKHVVRTHKGA  318

Query  1170  DDKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIG  991
             D+KA+ CVY+++D +GK G++LSKDLM IAG ALK+NITT+GPLVLP SEQLLF  TL+ 
Sbjct  319   DNKAFNCVYQEQDDEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPFSEQLLFFATLVA  378

Query  990   RKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTS  811
             +K+FN K KPYIPDFK AFEHFCIHAGGRAVIDEL+KNLQL   HVEASRMTLHRFGNTS
Sbjct  379   KKLFNAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLQPVHVEASRMTLHRFGNTS  438

Query  810   SSSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRY  631
             SSS+WYEL Y+E+KGR+++G RIWQIAFGSGFKCNSAVW   RN+    + PW DCIDRY
Sbjct  439   SSSIWYELAYMEAKGRVRRGHRIWQIAFGSGFKCNSAVWHALRNVNPSPESPWEDCIDRY  498

Query  630   PVHI  619
             PV +
Sbjct  499   PVEL  502



>ref|XP_009630522.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/483 (61%), Positives = 383/483 (79%), Gaps = 2/483 (0%)
 Frame = -3

Query  2067  SSVKLKYVKLGYQYLVNHILTLLLVPVMAGVTIEVLRFGPEEIVMRIKDSVMSLELIHVL  1888
              ++KLKYVKLG  YLV+H+L+L  +P++A + ++  +   +++     +   +L  I +L
Sbjct  30    QNIKLKYVKLGCHYLVSHLLSLFSLPLIAIIFVQGSQMNYQDLHYLYFNLQHNLASIIIL  89

Query  1887  FSSLFLVFVATLYLMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLNLKDNPKSVEFQ  1708
             F  L LVF +T Y+M++P S+YLVDY+CY+ P   +  +  FMEHSRL    +  S+EFQ
Sbjct  90    F--LVLVFASTFYIMTRPGSVYLVDYSCYRGPDHLKATYYKFMEHSRLTDDFDETSLEFQ  147

Query  1707  MRILERSGLGEETCLPAAIHYIPPKPTMDAARGEAEEVIFSAIDALMKKTELKAKDIDIL  1528
              ++L RSGLGEET +P  ++ IPP+P+M AAR EAE V+F A+D L K T  K KDI IL
Sbjct  148   RKMLGRSGLGEETYVPETMNCIPPRPSMAAAREEAETVMFGALDNLFKNTNFKPKDIGIL  207

Query  1527  IVNCSLFSPTPSLSAMVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLHVHPNSNAL  1348
             +VNCSLF+PTPSLSAM+VNKYKLR NI+S+NL GMGCSAG+I+IDLA+D+L VH N+ A+
Sbjct  208   VVNCSLFNPTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDILQVHRNTYAI  267

Query  1347  VVSTEIITPNYYKGSERAMLLPNCLFRMGGAAILVSNKRRDSGRAKYRLMHVVRTHKGSD  1168
             VVSTE IT N+Y G++++ML+PNCLFR+GG AIL+SNK  D  RAKY+L+HV+RTHKG+D
Sbjct  268   VVSTENITQNWYFGTKKSMLIPNCLFRVGGVAILLSNKMADKRRAKYKLVHVMRTHKGAD  327

Query  1167  DKAYRCVYEQEDPQGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGR  988
             DKA++ +Y+++D +GK G++LSKDL+ IAG A+K+NITT+GPLVLP SEQ LF  TL+GR
Sbjct  328   DKAFKYIYQEQDDKGKTGVSLSKDLIEIAGNAVKTNITTLGPLVLPISEQFLFFMTLVGR  387

Query  987   KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSS  808
             K+FN K KPYIP+FK AFEHFCIHAGGRAVIDEL+KNLQLS  HVEASRMTLHRFGNTSS
Sbjct  388   KMFNAKMKPYIPNFKLAFEHFCIHAGGRAVIDELEKNLQLSPIHVEASRMTLHRFGNTSS  447

Query  807   SSLWYELNYIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRNLKKPADGPWLDCIDRYP  628
             SS+WYEL Y E+KGR+++G RIWQIAFGSGFKCNSAVW   RN++   + PW DCI RYP
Sbjct  448   SSIWYELAYTEAKGRIQRGHRIWQIAFGSGFKCNSAVWLALRNVRPSPNSPWEDCIHRYP  507

Query  627   VHI  619
             V +
Sbjct  508   VKL  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6955300918665