BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25038_g4_i2 len=742 path=[1340:0-132 13164:133-156 13188:157-166
12561:167-252 11158:253-741]

Length=742
                                                                      Score     E

gb|KHG23818.1|  BTB/POZ and MATH domain-containing 2 -like protein      101   1e-21   
ref|XP_009799864.1|  PREDICTED: BTB/POZ and MATH domain-containin...    100   6e-21   
ref|XP_009599207.1|  PREDICTED: BTB/POZ and MATH domain-containin...  99.8    6e-21   
emb|CDP03595.1|  unnamed protein product                              97.8    3e-20   
gb|KHG07672.1|  BTB/POZ and MATH domain-containing 2 -like protein    97.8    3e-20   
ref|XP_011082543.1|  PREDICTED: BTB/POZ and MATH domain-containin...  97.4    4e-20   
ref|XP_010652109.1|  PREDICTED: BTB/POZ and MATH domain-containin...  97.4    5e-20   
gb|AFK45358.1|  unknown                                               94.4    6e-20   
ref|XP_010278817.1|  PREDICTED: BTB/POZ and MATH domain-containin...  96.7    9e-20   
ref|XP_010255859.1|  PREDICTED: BTB/POZ and MATH domain-containin...  95.9    1e-19   
ref|XP_011079801.1|  PREDICTED: BTB/POZ and MATH domain-containin...  95.9    2e-19   
gb|EYU46623.1|  hypothetical protein MIMGU_mgv1a007354mg              95.5    2e-19   
gb|KDP21503.1|  hypothetical protein JCGZ_21974                       95.5    2e-19   
ref|XP_006604419.1|  PREDICTED: BTB/POZ and MATH domain-containin...  95.1    3e-19   
ref|XP_006358428.1|  PREDICTED: BTB/POZ and MATH domain-containin...  95.1    3e-19   
ref|XP_010326625.1|  PREDICTED: BTB/POZ and MATH domain-containin...  95.1    3e-19   
gb|KEH23724.1|  BTB/POZ/MATH-domain protein                           94.7    5e-19   
ref|XP_006444138.1|  hypothetical protein CICLE_v10020406mg           94.4    5e-19   
ref|XP_003590693.1|  Speckle-type POZ protein                         94.4    7e-19   
ref|XP_007162393.1|  hypothetical protein PHAVU_001G148400g           93.6    1e-18   
ref|XP_007144604.1|  hypothetical protein PHAVU_007G169300g           93.2    2e-18   
gb|KHN18899.1|  BTB/POZ and MATH domain-containing protein 2          92.4    2e-18   
gb|AFK40364.1|  unknown                                               92.8    2e-18   
emb|CDY47190.1|  BnaAnng08600D                                        89.4    3e-18   
ref|XP_004495233.1|  PREDICTED: BTB/POZ and MATH domain-containin...  92.0    4e-18   
emb|CDY02591.1|  BnaC02g08440D                                        92.0    4e-18   
ref|XP_006588617.1|  PREDICTED: BTB/POZ and MATH domain-containin...  92.0    4e-18   
ref|XP_004495232.1|  PREDICTED: BTB/POZ and MATH domain-containin...  92.0    5e-18   
ref|XP_006419782.1|  hypothetical protein CICLE_v10005094mg           91.3    7e-18   
ref|XP_006489244.1|  PREDICTED: BTB/POZ and MATH domain-containin...  91.3    7e-18   
ref|XP_010038130.1|  PREDICTED: BTB/POZ and MATH domain-containin...  91.3    7e-18   
gb|KFK26137.1|  hypothetical protein AALP_AA8G208400                  90.9    8e-18   
ref|XP_006400454.1|  hypothetical protein EUTSA_v10013699mg           90.9    9e-18   
ref|XP_007034571.1|  BTB-POZ and MATH domain 2                        89.4    3e-17   
ref|XP_007050686.1|  BTB-POZ and MATH domain 2                        90.1    4e-17   
ref|XP_006287870.1|  hypothetical protein CARUB_v10001097mg           89.0    4e-17   
ref|XP_008235067.1|  PREDICTED: BTB/POZ and MATH domain-containin...  88.2    5e-17   
ref|XP_010545078.1|  PREDICTED: BTB/POZ and MATH domain-containin...  89.4    7e-17   
gb|KHG05413.1|  BTB/POZ and MATH domain-containing 2 -like protein    88.2    8e-17   
ref|XP_007201051.1|  hypothetical protein PRUPE_ppa006488mg           88.2    8e-17   
ref|XP_002524811.1|  Speckle-type POZ protein, putative               88.6    1e-16   Ricinus communis
emb|CDY13941.1|  BnaC09g38850D                                        87.8    1e-16   
ref|XP_004134158.1|  PREDICTED: BTB/POZ and MATH domain-containin...  87.4    2e-16   
ref|XP_008438731.1|  PREDICTED: BTB/POZ and MATH domain-containin...  87.4    2e-16   
emb|CDX92567.1|  BnaA10g16060D                                        87.4    2e-16   
gb|KHG23129.1|  BTB/POZ and MATH domain-containing protein 1          84.3    2e-16   
ref|XP_010496737.1|  PREDICTED: BTB/POZ and MATH domain-containin...  87.0    2e-16   
ref|XP_008368872.1|  PREDICTED: BTB/POZ and MATH domain-containin...  87.0    2e-16   
ref|XP_002871853.1|  BTB-POZ and math domain 1                        87.0    2e-16   
ref|XP_010420683.1|  PREDICTED: BTB/POZ and MATH domain-containin...  86.7    3e-16   
ref|XP_010496738.1|  PREDICTED: BTB/POZ and MATH domain-containin...  87.0    3e-16   
ref|XP_009347696.1|  PREDICTED: BTB/POZ and MATH domain-containin...  86.7    3e-16   
ref|XP_004168572.1|  PREDICTED: BTB/POZ and MATH domain-containin...  83.2    3e-16   
ref|XP_010420684.1|  PREDICTED: BTB/POZ and MATH domain-containin...  86.7    4e-16   
ref|XP_004290680.1|  PREDICTED: BTB/POZ and MATH domain-containin...  86.3    4e-16   
ref|XP_010454160.1|  PREDICTED: BTB/POZ and MATH domain-containin...  86.3    4e-16   
ref|XP_006297810.1|  hypothetical protein CARUB_v10013845mg           86.3    4e-16   
ref|NP_566275.1|  BTB/POZ and M2 domain-containing protein            86.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884563.1|  ATBPM2                                           86.3    5e-16   
ref|XP_006850808.1|  hypothetical protein AMTR_s00025p00114450        85.9    5e-16   
ref|XP_010436693.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...  86.3    5e-16   
gb|KFK38092.1|  hypothetical protein AALP_AA3G068300                  85.9    6e-16   
ref|XP_002279548.1|  PREDICTED: BTB/POZ and MATH domain-containin...  85.9    6e-16   Vitis vinifera
ref|NP_197401.2|  BTB-POZ and math domain-containing protein          85.5    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355456.1|  PREDICTED: BTB/POZ and MATH domain-containin...  85.5    9e-16   
ref|NP_001190334.1|  BTB-POZ and math domain-containing protein       85.5    9e-16   
ref|XP_004493645.1|  PREDICTED: BTB/POZ and MATH domain-containin...  85.9    1e-15   
ref|XP_009129652.1|  PREDICTED: BTB/POZ and MATH domain-containin...  85.1    1e-15   
ref|XP_009120926.1|  PREDICTED: BTB/POZ and MATH domain-containin...  84.7    1e-15   
ref|XP_010905244.1|  PREDICTED: BTB/POZ and MATH domain-containin...  84.7    1e-15   
ref|XP_006407971.1|  hypothetical protein EUTSA_v10020850mg           84.7    1e-15   
emb|CDY24708.1|  BnaA05g31070D                                        84.3    2e-15   
ref|XP_009120927.1|  PREDICTED: BTB/POZ and MATH domain-containin...  84.7    2e-15   
ref|XP_008808250.1|  PREDICTED: BTB/POZ and MATH domain-containin...  84.3    2e-15   
gb|KHG23128.1|  BTB/POZ and MATH domain-containing protein 2          84.3    2e-15   
ref|XP_009134877.1|  PREDICTED: BTB/POZ and MATH domain-containin...  84.3    2e-15   
ref|XP_010096368.1|  BTB/POZ and MATH domain-containing protein 2     81.6    2e-15   
ref|XP_010524787.1|  PREDICTED: BTB/POZ and MATH domain-containin...  84.3    2e-15   
emb|CDY08064.1|  BnaC03g34590D                                        84.0    2e-15   
emb|CDY05245.1|  BnaC05g45580D                                        83.6    4e-15   
ref|XP_010551778.1|  PREDICTED: BTB/POZ and MATH domain-containin...  83.2    5e-15   
emb|CDY66705.1|  BnaAnng22770D                                        83.2    5e-15   
ref|XP_009131717.1|  PREDICTED: BTB/POZ and MATH domain-containin...  82.8    6e-15   
ref|XP_010551779.1|  PREDICTED: BTB/POZ and MATH domain-containin...  83.2    6e-15   
ref|XP_008458543.1|  PREDICTED: BTB/POZ and MATH domain-containin...  82.8    7e-15   
ref|XP_004153182.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...  82.8    7e-15   
ref|XP_009131718.1|  PREDICTED: BTB/POZ and MATH domain-containin...  82.8    8e-15   
emb|CDX70860.1|  BnaC03g09440D                                        82.8    8e-15   
ref|XP_010524788.1|  PREDICTED: BTB/POZ and MATH domain-containin...  82.4    9e-15   
ref|XP_010103451.1|  BTB/POZ and MATH domain-containing protein 2     82.4    1e-14   
ref|XP_009124937.1|  PREDICTED: BTB/POZ and MATH domain-containin...  82.0    1e-14   
ref|XP_004296996.1|  PREDICTED: BTB/POZ and MATH domain-containin...  81.6    1e-14   
emb|CDY18844.1|  BnaAnng03090D                                        82.0    2e-14   
ref|XP_002516797.1|  Speckle-type POZ protein, putative               81.3    2e-14   Ricinus communis
ref|XP_006658050.1|  PREDICTED: BTB/POZ and MATH domain-containin...  79.0    4e-14   
ref|XP_009356739.1|  PREDICTED: BTB/POZ and MATH domain-containin...  80.5    4e-14   
ref|XP_009356740.1|  PREDICTED: BTB/POZ and MATH domain-containin...  80.5    4e-14   
gb|ACF80834.1|  unknown                                               74.7    5e-14   Zea mays [maize]
gb|ABK94822.1|  unknown                                               74.3    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004958540.1|  PREDICTED: BTB/POZ and MATH domain-containin...  79.7    8e-14   
ref|XP_008353276.1|  PREDICTED: BTB/POZ and MATH domain-containin...  78.2    8e-14   
ref|XP_010695312.1|  PREDICTED: BTB/POZ and MATH domain-containin...  79.7    9e-14   
ref|XP_009339952.1|  PREDICTED: BTB/POZ and MATH domain-containin...  78.2    1e-13   
gb|EEC82594.1|  hypothetical protein OsI_27153                        79.3    1e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001060495.1|  Os07g0655300                                     79.0    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009787612.1|  PREDICTED: BTB/POZ and MATH domain-containin...  78.6    2e-13   
ref|XP_009621647.1|  PREDICTED: BTB/POZ and MATH domain-containin...  78.6    2e-13   
ref|XP_004229460.1|  PREDICTED: BTB/POZ and MATH domain-containin...  78.6    2e-13   
ref|XP_008340895.1|  PREDICTED: BTB/POZ and MATH domain-containin...  78.6    2e-13   
ref|NP_001140355.1|  hypothetical protein                             78.6    2e-13   Zea mays [maize]
gb|KDP40087.1|  hypothetical protein JCGZ_02085                       78.6    2e-13   
gb|EPS58860.1|  hypothetical protein M569_15950                       78.2    3e-13   
ref|XP_010090357.1|  BTB/POZ and MATH domain-containing protein 2     78.2    3e-13   
ref|XP_002463303.1|  hypothetical protein SORBIDRAFT_02g041470        77.8    4e-13   Sorghum bicolor [broomcorn]
ref|XP_011009015.1|  PREDICTED: BTB/POZ and MATH domain-containin...  77.8    4e-13   
ref|XP_006339418.1|  PREDICTED: BTB/POZ and MATH domain-containin...  77.4    5e-13   
gb|ACG38997.1|  speckle-type POZ protein                              77.4    5e-13   Zea mays [maize]
ref|NP_001130519.1|  speckle-type POZ protein                         77.4    6e-13   Zea mays [maize]
dbj|BAJ97789.1|  predicted protein                                    77.4    6e-13   
ref|XP_006380054.1|  hypothetical protein POPTR_0008s20510g           77.0    6e-13   
ref|XP_008223027.1|  PREDICTED: BTB/POZ and MATH domain-containin...  77.0    6e-13   
gb|EMT06101.1|  Speckle-type POZ protein-like protein                 77.0    7e-13   
ref|XP_007222747.1|  hypothetical protein PRUPE_ppa006500mg           76.6    8e-13   
ref|XP_003562549.1|  PREDICTED: BTB/POZ and MATH domain-containin...  76.6    1e-12   
ref|XP_002315535.1|  speckle-type POZ family protein                  75.1    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009405866.1|  PREDICTED: BTB/POZ and MATH domain-containin...  74.7    4e-12   
ref|XP_009404705.1|  PREDICTED: BTB/POZ and MATH domain-containin...  72.8    2e-11   
ref|XP_009352133.1|  PREDICTED: BTB/POZ and MATH domain-containin...  72.4    2e-11   
ref|XP_011006874.1|  PREDICTED: BTB/POZ and MATH domain-containin...  72.4    2e-11   
ref|XP_008390810.1|  PREDICTED: BTB/POZ and MATH domain-containin...  71.2    7e-11   
ref|XP_010695310.1|  PREDICTED: BTB/POZ and MATH domain-containin...  69.7    2e-10   
ref|XP_009394086.1|  PREDICTED: BTB/POZ and MATH domain-containin...  65.5    5e-10   
ref|NP_974236.1|  BTB/POZ and M2 domain-containing protein            65.1    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009762142.1|  PREDICTED: BTB/POZ and MATH domain-containin...  65.1    6e-09   
ref|XP_009606600.1|  PREDICTED: BTB/POZ and MATH domain-containin...  65.1    7e-09   
emb|CDY15754.1|  BnaC04g15700D                                        61.2    2e-08   
gb|KDO47647.1|  hypothetical protein CISIN_1g015782mg                 63.9    2e-08   
ref|XP_006470186.1|  PREDICTED: BTB/POZ and MATH domain-containin...  63.9    2e-08   
ref|XP_011080496.1|  PREDICTED: BTB/POZ and MATH domain-containin...  63.5    3e-08   
emb|CDP09732.1|  unnamed protein product                              62.4    5e-08   
ref|XP_004491160.1|  PREDICTED: BTB/POZ and MATH domain-containin...  62.4    5e-08   
ref|XP_006362728.1|  PREDICTED: BTB/POZ and MATH domain-containin...  62.4    6e-08   
ref|XP_004228476.1|  PREDICTED: BTB/POZ and MATH domain-containin...  62.4    6e-08   
gb|KHG12366.1|  BTB/POZ and MATH domain-containing 4 -like protein    61.6    9e-08   
gb|ACM67640.1|  BTB-POZ and MATH domain protein                       61.2    1e-07   Capsicum annuum
gb|EYU46143.1|  hypothetical protein MIMGU_mgv1a007584mg              60.8    2e-07   
ref|XP_004491159.1|  PREDICTED: BTB/POZ and MATH domain-containin...  60.8    2e-07   
ref|XP_009628011.1|  PREDICTED: BTB/POZ and MATH domain-containin...  60.5    2e-07   
ref|XP_009771203.1|  PREDICTED: BTB/POZ and MATH domain-containin...  60.5    2e-07   
ref|XP_006340346.1|  PREDICTED: BTB/POZ and MATH domain-containin...  60.5    2e-07   
ref|XP_002961582.1|  hypothetical protein SELMODRAFT_270271           60.5    3e-07   
ref|XP_002313624.2|  hypothetical protein POPTR_0009s15830g           60.5    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007015536.1|  BTB/POZ and MATH domain-containing protein 4...  59.3    6e-07   
ref|XP_010266708.1|  PREDICTED: BTB/POZ and MATH domain-containin...  59.3    6e-07   
ref|XP_004251235.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.5    1e-06   
ref|XP_011016310.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.2    2e-06   
ref|XP_011043816.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.2    2e-06   
ref|XP_011043823.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.2    2e-06   
ref|XP_011016311.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.2    2e-06   
ref|XP_011043808.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.2    2e-06   
ref|XP_011016309.1|  PREDICTED: BTB/POZ and MATH domain-containin...  58.2    2e-06   
ref|XP_002970063.1|  hypothetical protein SELMODRAFT_267336           57.8    2e-06   
ref|XP_006826332.1|  hypothetical protein AMTR_s00004p00105320        57.8    2e-06   
gb|EPS71913.1|  hypothetical protein M569_02844                       57.8    2e-06   
gb|KDP42915.1|  hypothetical protein JCGZ_23857                       57.4    3e-06   
ref|XP_010685504.1|  PREDICTED: BTB/POZ and MATH domain-containin...  57.4    3e-06   
ref|XP_009366506.1|  PREDICTED: BTB/POZ and MATH domain-containin...  57.4    3e-06   
ref|XP_008386876.1|  PREDICTED: BTB/POZ and MATH domain-containin...  57.0    4e-06   
ref|XP_002533853.1|  Speckle-type POZ protein, putative               56.6    6e-06   Ricinus communis
ref|XP_001772248.1|  predicted protein                                56.6    6e-06   
gb|ACN26698.1|  unknown                                               53.9    7e-06   Zea mays [maize]
ref|XP_009353080.1|  PREDICTED: BTB/POZ and MATH domain-containin...  56.2    7e-06   
ref|XP_006384724.1|  hypothetical protein POPTR_0004s20530g           56.2    8e-06   
ref|XP_011006172.1|  PREDICTED: BTB/POZ and MATH domain-containin...  56.2    8e-06   
ref|XP_008391713.1|  PREDICTED: BTB/POZ and MATH domain-containin...  56.2    8e-06   
ref|XP_011090255.1|  PREDICTED: BTB/POZ and MATH domain-containin...  55.8    8e-06   
gb|AAO72687.1|  zinc finger POZ domain protein                        53.5    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009343027.1|  PREDICTED: BTB/POZ and MATH domain-containin...  55.1    2e-05   
ref|XP_003554047.1|  PREDICTED: BTB/POZ and MATH domain-containin...  55.1    2e-05   
gb|KHN34655.1|  BTB/POZ and MATH domain-containing protein 4          55.1    2e-05   
ref|XP_010921383.1|  PREDICTED: BTB/POZ and MATH domain-containin...  54.7    2e-05   
ref|XP_007161865.1|  hypothetical protein PHAVU_001G104500g           54.7    2e-05   
gb|KDP39652.1|  hypothetical protein JCGZ_02672                       54.7    2e-05   
ref|XP_003548681.2|  PREDICTED: BTB/POZ and MATH domain-containin...  54.7    2e-05   
gb|AGV54250.1|  BTB/POZ and MATH domain-containing protein 4-like...  54.7    2e-05   
dbj|BAJ93826.1|  predicted protein                                    54.7    2e-05   
tpg|DAA51835.1|  TPA: hypothetical protein ZEAMMB73_694112            53.9    3e-05   
ref|XP_004149104.1|  PREDICTED: BTB/POZ and MATH domain-containin...  54.3    3e-05   
ref|XP_008667501.1|  PREDICTED: uncharacterized protein LOC100273...  54.3    3e-05   
ref|XP_008442027.1|  PREDICTED: BTB/POZ and MATH domain-containin...  54.3    4e-05   
gb|ABK24368.1|  unknown                                               53.9    4e-05   Picea sitchensis
dbj|BAJ90220.1|  predicted protein                                    53.9    4e-05   
ref|XP_002976951.1|  hypothetical protein SELMODRAFT_443336           53.9    4e-05   
ref|XP_006651896.1|  PREDICTED: BTB/POZ and MATH domain-containin...  53.9    4e-05   
gb|EAZ28871.1|  hypothetical protein OsJ_12909                        53.5    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AFD04128.1|  speckle-type POZ                                      53.5    5e-05   
gb|EMT28882.1|  Speckle-type POZ protein                              53.9    5e-05   
gb|EAY92144.1|  hypothetical protein OsI_13855                        53.5    5e-05   Oryza sativa Indica Group [Indian rice]
gb|AAO37987.1|  expressed protein                                     53.5    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411294.1|  PREDICTED: BTB/POZ and MATH domain-containin...  53.5    6e-05   
ref|NP_001051524.1|  Os03g0792500                                     53.5    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525692.1|  BTB and MATH domain-containing protein, puta...  53.1    7e-05   Ricinus communis
ref|XP_003557540.2|  PREDICTED: BTB/POZ and MATH domain-containin...  53.5    7e-05   
ref|NP_001140637.1|  speckle-type POZ protein                         53.1    7e-05   Zea mays [maize]
ref|XP_002325436.2|  speckle-type POZ family protein                  53.1    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006371199.1|  hypothetical protein POPTR_0019s05580g           53.1    8e-05   
ref|XP_007015538.1|  BTB/POZ and MATH domain-containing protein 4...  52.8    9e-05   
ref|XP_003545187.1|  PREDICTED: BTB/POZ and MATH domain-containin...  52.8    9e-05   
gb|KHM99118.1|  BTB/POZ and MATH domain-containing protein 4          52.8    1e-04   
ref|XP_010106318.1|  hypothetical protein L484_004717                 49.3    1e-04   
ref|XP_002277148.1|  PREDICTED: BTB/POZ and MATH domain-containin...  52.8    1e-04   Vitis vinifera
ref|XP_006443499.1|  hypothetical protein CICLE_v10020215mg           52.8    1e-04   
ref|XP_006479173.1|  PREDICTED: BTB/POZ and MATH domain-containin...  52.8    1e-04   
gb|KDO66064.1|  hypothetical protein CISIN_1g013880mg                 52.8    1e-04   
ref|XP_001776409.1|  predicted protein                                52.4    1e-04   
ref|XP_003624698.1|  Speckle-type POZ protein                         52.4    2e-04   
gb|EYU19944.1|  hypothetical protein MIMGU_mgv1a007421mg              52.0    2e-04   
gb|ACG37150.1|  speckle-type POZ protein                              52.0    2e-04   Zea mays [maize]
ref|XP_003617061.1|  Speckle-type POZ protein                         52.0    2e-04   
ref|XP_001783005.1|  predicted protein                                52.0    2e-04   
ref|XP_011001713.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ...  51.6    2e-04   
ref|XP_010520490.1|  PREDICTED: BTB/POZ and MATH domain-containin...  51.6    2e-04   
ref|XP_010918008.1|  PREDICTED: BTB/POZ and MATH domain-containin...  51.6    2e-04   
ref|XP_003632235.1|  PREDICTED: BTB/POZ and MATH domain-containin...  51.2    3e-04   
emb|CBI24397.3|  unnamed protein product                              51.2    3e-04   
ref|XP_010036255.1|  PREDICTED: BTB/POZ and MATH domain-containin...  51.2    3e-04   
gb|KHG25171.1|  BTB/POZ and MATH domain-containing 4 -like protein    51.2    3e-04   
ref|XP_006657481.1|  PREDICTED: BTB/POZ and MATH domain-containin...  51.2    3e-04   
ref|XP_009411295.1|  PREDICTED: BTB/POZ and MATH domain-containin...  50.8    4e-04   
ref|XP_010923233.1|  PREDICTED: BTB/POZ and MATH domain-containin...  50.8    4e-04   
gb|KHN38451.1|  BTB/POZ and MATH domain-containing protein 4          50.4    4e-04   
ref|XP_008789435.1|  PREDICTED: BTB/POZ and MATH domain-containin...  50.8    5e-04   
ref|XP_007163464.1|  hypothetical protein PHAVU_001G236400g           50.8    5e-04   
ref|XP_009400061.1|  PREDICTED: BTB/POZ and MATH domain-containin...  50.4    5e-04   
gb|EMT17722.1|  Speckle-type POZ protein                              50.8    6e-04   
ref|XP_007029995.1|  BTB-POZ and MATH domain 4 isoform 1              50.4    6e-04   
gb|EMS49890.1|  BTB/POZ and MATH domain-containing protein 4          50.1    8e-04   
ref|NP_001058976.1|  Os07g0167200                                     50.1    8e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004239913.1|  PREDICTED: BTB/POZ and MATH domain-containin...  50.1    0.001   
ref|XP_004493213.1|  PREDICTED: BTB/POZ and MATH domain-containin...  50.1    0.001   
ref|NP_001141107.1|  uncharacterized protein LOC100273191             49.7    0.001   Zea mays [maize]
ref|XP_006355691.1|  PREDICTED: BTB/POZ and MATH domain-containin...  49.7    0.001   



>gb|KHG23818.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=402

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLK+SCP VLTELLEYVARVNEHP I  +   EAI DGSD NGRRVKQRL
Sbjct  344  AVMQTDGFEYLKQSCPSVLTELLEYVARVNEHPVIVCRHGNEAILDGSDANGRRVKQRL  402



>ref|XP_009799864.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana sylvestris]
Length=411

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL+ESCP VLTELLEYVARV+EH  IASKL  E I DG D NGRRVKQRL
Sbjct  353  AVMQTDGFDYLRESCPHVLTELLEYVARVSEHSGIASKLGNEVILDGGDVNGRRVKQRL  411



>ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana tomentosiformis]
Length=411

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL+ESCP VLTELLEYVARV+EH  IASKL  E I DG D NGRRVKQRL
Sbjct  353  AVMQTDGFDYLRESCPHVLTELLEYVARVSEHSGIASKLGNEVILDGGDVNGRRVKQRL  411



>emb|CDP03595.1| unnamed protein product [Coffea canephora]
Length=409

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR+NEH    +K L + I DGSD NGRRVKQRL
Sbjct  351  AVMQTDGFEYLKESCPSVLTELLEYVARINEHSVSVNKQLTDGILDGSDVNGRRVKQRL  409



>gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=405

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLE+VARVNEH  I  +   EAI DGSD NGRRVKQRL
Sbjct  347  AVMQTDGFEYLKESCPSVLTELLEHVARVNEHSVIVCRHGNEAILDGSDANGRRVKQRL  405



>ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Sesamum indicum]
Length=410

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR+NEH     K   EAI DGSD NGRRVKQRL
Sbjct  352  AVMQTDGFEYLKESCPHVLTELLEYVARINEHSVAVGKQGLEAILDGSDINGRRVKQRL  410



>ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Vitis vinifera]
 emb|CBI32329.3| unnamed protein product [Vitis vinifera]
Length=402

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVARV+EH  I  +   EAI DGSD NGRRVKQRL
Sbjct  344  AVMQTDGFEYLKESCPSVLTELLEYVARVSEHSVIVCRHGNEAILDGSDINGRRVKQRL  402



>gb|AFK45358.1| unknown [Medicago truncatula]
Length=175

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL*  434
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EAI DGSD NGRRVKQRL 
Sbjct  113  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEAILDGSDVNGRRVKQRL-  171

Query  435  SMLPCCKH  458
                CC++
Sbjct  172  ----CCEN  175



>ref|XP_010278817.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Nelumbo nucifera]
Length=407

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQR  428
            AVMQTDGFEYLKESCP VLTELLEYVARV EH  I  +   EAI DGSD NGRRVKQR
Sbjct  349  AVMQTDGFEYLKESCPSVLTELLEYVARVGEHSVIVCRYGNEAILDGSDVNGRRVKQR  406



>ref|XP_010255859.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVARV EH  I  +   EA+ DGSD NGRRVKQR+
Sbjct  347  AVMQTDGFEYLKESCPSVLTELLEYVARVGEHSVIVCRHGNEAVLDGSDVNGRRVKQRI  405



>ref|XP_011079801.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Sesamum indicum]
Length=410

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR+NEH     K   E I DGSD NGRRVKQRL
Sbjct  352  AVMQTDGFEYLKESCPHVLTELLEYVARINEHSIAVGKQGIEGILDGSDVNGRRVKQRL  410



>gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata]
Length=410

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR NEH     K   EAI DGSD NGRRVKQRL
Sbjct  352  AVMQTDGFEYLKESCPHVLTELLEYVARTNEHSIAMGKQGIEAILDGSDVNGRRVKQRL  410



>gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas]
Length=407

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYL+ESCP VLTELLEYVARV+EH  I  +   EAI DGSD NGRRVKQRL
Sbjct  349  AVMQTDGFEYLRESCPSVLTELLEYVARVSEHSVIICRHGNEAILDGSDLNGRRVKQRL  407



>ref|XP_006604419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Glycine max]
Length=410

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSD  401
            +  I T     AVMQTDGFEYLKESCP VLTELLEYVAR  EH  I  K   EA+ DGSD
Sbjct  341  LKFIATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDIMCKHRNEALLDGSD  400

Query  402  TNGRRVKQRL  431
             NGRRVKQRL
Sbjct  401  INGRRVKQRL  410



>ref|XP_006358428.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum tuberosum]
Length=411

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL+ESCP VLTELLEYVARVNEH +I +KL    + DG D NGRRVKQRL
Sbjct  353  AVMQTDGFDYLRESCPHVLTELLEYVARVNEHSSITNKLGNGLVLDGGDFNGRRVKQRL  411



>ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum lycopersicum]
Length=412

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL+ESCP VLTELLEYVARVNEH +I +KL    + DG D NGRRVKQRL
Sbjct  354  AVMQTDGFDYLRESCPHVLTELLEYVARVNEHSSITNKLGNGLVLDGGDFNGRRVKQRL  412



>gb|KEH23724.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=410

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSD  401
            +  I T     AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EAI DGSD
Sbjct  341  LKFIATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEAILDGSD  400

Query  402  TNGRRVKQRL  431
             NGRRVKQRL
Sbjct  401  INGRRVKQRL  410



>ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina]
 ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Citrus sinensis]
 gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina]
 gb|KDO68822.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis]
Length=407

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP +LTELLEYVA+V+EH  +  +   EAI DGSD NGRRVKQRL
Sbjct  349  AVMQTDGFEYLKESCPSLLTELLEYVAKVSEHSVVVCRHGNEAILDGSDVNGRRVKQRL  407



>ref|XP_003590693.1| Speckle-type POZ protein [Medicago truncatula]
 gb|AES60944.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=418

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EAI DGSD NGRRVKQRL
Sbjct  356  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEAILDGSDVNGRRVKQRL  414



>ref|XP_007162393.1| hypothetical protein PHAVU_001G148400g [Phaseolus vulgaris]
 gb|ESW34387.1| hypothetical protein PHAVU_001G148400g [Phaseolus vulgaris]
Length=411

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSD  401
            +  I T     AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EA+ DGSD
Sbjct  342  LKFIATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFMCKHRNEALLDGSD  401

Query  402  TNGRRVKQRL  431
             NGRRVKQRL
Sbjct  402  INGRRVKQRL  411



>ref|XP_007144604.1| hypothetical protein PHAVU_007G169300g [Phaseolus vulgaris]
 gb|ESW16598.1| hypothetical protein PHAVU_007G169300g [Phaseolus vulgaris]
Length=411

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EAI DGSD NGRRVKQRL
Sbjct  353  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDYLCKHRNEAILDGSDINGRRVKQRL  411



>gb|KHN18899.1| BTB/POZ and MATH domain-containing protein 2 [Glycine soja]
Length=381

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   E I DGSD NGRRVKQRL
Sbjct  323  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEVILDGSDVNGRRVKQRL  381



>gb|AFK40364.1| unknown [Medicago truncatula]
Length=418

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EAI DGSD NG+RVKQRL
Sbjct  356  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEAILDGSDVNGKRVKQRL  414



>emb|CDY47190.1| BnaAnng08600D [Brassica napus]
Length=170

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  246  CFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQ  425
            C  AVMQTDGF+YLK+SCP +LTELLEYVAR +EH  IA    KE   DG D NGRRVKQ
Sbjct  108  CCVAVMQTDGFDYLKKSCPSLLTELLEYVARRSEHSVIALGHRKEVFADGCDANGRRVKQ  167

Query  426  RL  431
            RL
Sbjct  168  RL  169



>ref|XP_004495233.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Cicer arietinum]
Length=410

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   E I DGSD NGRRVKQRL
Sbjct  352  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEQILDGSDINGRRVKQRL  410



>emb|CDY02591.1| BnaC02g08440D [Brassica napus]
Length=400

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK SCP +LTELLEYVAR++EH  IAS   KE + DG D NGRRVKQRL
Sbjct  341  AVMQTDGFDYLKRSCPSLLTELLEYVARLSEHSVIASGHRKEVVADGCDVNGRRVKQRL  399



>ref|XP_006588617.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Glycine max]
 gb|KHN03775.1| BTB/POZ and MATH domain-containing protein 2 [Glycine soja]
Length=413

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   E I DGSD NGRRVKQRL
Sbjct  355  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNELILDGSDVNGRRVKQRL  413



>ref|XP_004495232.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Cicer arietinum]
Length=455

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   E I DGSD NGRRVKQRL
Sbjct  397  AVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFLCKHRNEQILDGSDINGRRVKQRL  455



>ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina]
 gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina]
Length=403

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELL+YVA++ EH  IAS    E + DG D NGRRVKQR+
Sbjct  344  AVMQTDGFEYLKESCPSVLTELLQYVAKIGEHSVIASGHGNETLPDGCDVNGRRVKQRV  402



>ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Citrus sinensis]
 gb|KDO74864.1| hypothetical protein CISIN_1g015649mg [Citrus sinensis]
Length=403

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELL+YVA++ EH  IAS    E + DG D NGRRVKQR+
Sbjct  344  AVMQTDGFEYLKESCPSVLTELLQYVAKIGEHSVIASGHGNETLPDGCDVNGRRVKQRV  402



>ref|XP_010038130.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Eucalyptus grandis]
 gb|KCW49942.1| hypothetical protein EUGRSUZ_K03404 [Eucalyptus grandis]
Length=407

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELLEYVAR +E   I S    E I DGSD NGRRVKQR+
Sbjct  349  AVMQTDGFEYLKESCPSVLTELLEYVARASEQSMIVSSHGNEGILDGSDANGRRVKQRI  407



>gb|KFK26137.1| hypothetical protein AALP_AA8G208400 [Arabis alpina]
Length=399

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK+SCP +LTELLEYVAR++EH  +AS   KE   DG D NGRRVKQRL
Sbjct  340  AVMQTDGFDYLKKSCPTLLTELLEYVARLSEHSVVASGQQKEIFADGCDVNGRRVKQRL  398



>ref|XP_006400454.1| hypothetical protein EUTSA_v10013699mg [Eutrema salsugineum]
 gb|ESQ41907.1| hypothetical protein EUTSA_v10013699mg [Eutrema salsugineum]
Length=407

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK+SCP +LTELLEYVAR+ EH  +AS   KE   DG D NGRRVKQRL
Sbjct  348  AVMQTDGFDYLKKSCPSLLTELLEYVARLGEHSVVASGHRKEMFADGCDANGRRVKQRL  406



>ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
 gb|EOY05497.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
Length=410

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VLTELL YVAR+ EH  IA    KE   DG D NGRRVK RL
Sbjct  351  AVMQTDGFEYLKESCPTVLTELLHYVARIGEHSVIACGYRKETSFDGCDVNGRRVKPRL  409



>ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
 gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao]
Length=493

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRV  419
            AVMQTDGFEYLKESCP VLTELLEYVARVNEH  I  +   EAI DGSD NGRR+
Sbjct  348  AVMQTDGFEYLKESCPSVLTELLEYVARVNEHSVIVCRHGNEAILDGSDANGRRL  402



>ref|XP_006287870.1| hypothetical protein CARUB_v10001097mg [Capsella rubella]
 gb|EOA20768.1| hypothetical protein CARUB_v10001097mg [Capsella rubella]
Length=407

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK+SCP +LTELLEYVAR++EH  IAS   KE   DG D NGRRVK RL
Sbjct  348  AVMQTDGFDYLKKSCPSLLTELLEYVARLSEHSVIASGHRKEIFADGCDANGRRVKPRL  406



>ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Prunus mume]
Length=357

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQR  428
             + VMQTDG+++LKESCP VLTELLEYVARV+EH     +   EAI DGSD NGRRVKQR
Sbjct  297  LSGVMQTDGYKHLKESCPSVLTELLEYVARVSEHSVSLCRHGNEAILDGSDINGRRVKQR  356

Query  429  L  431
            L
Sbjct  357  L  357



>ref|XP_010545078.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Tarenaya hassleriana]
Length=534

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLKESCP VLTELLE VARV+EH  I      EA+ DGSD NGRRVKQRL
Sbjct  476  AVMQTEGFEYLKESCPSVLTELLEQVARVSEHCTIVKGTGSEAVLDGSDVNGRRVKQRL  534



>gb|KHG05413.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium 
arboreum]
Length=404

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF YLKESCP V+TELLEYVARV EH     K   E I DGSD NGRRVKQRL
Sbjct  346  AVMQTDGFVYLKESCPSVMTELLEYVARVIEHSMYVCKHGIEPIFDGSDANGRRVKQRL  404



>ref|XP_007201051.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica]
 gb|EMJ02250.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica]
Length=409

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            + VMQTDG+++LKESCP VLTELLEYVARV+EH     +   EAI DGSD NGRRVKQRL
Sbjct  350  SGVMQTDGYKHLKESCPSVLTELLEYVARVSEHSVSLCRHGNEAILDGSDINGRRVKQRL  409



>ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=500

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRV  419
            AVMQTDGFEYLKESCP VLTELLEYVA+V+EH  I SK   EAI DGSD NGRR+
Sbjct  355  AVMQTDGFEYLKESCPCVLTELLEYVAKVSEHSVIVSKHGNEAILDGSDFNGRRL  409



>emb|CDY13941.1| BnaC09g38850D [Brassica napus]
Length=439

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK+SCP +LTELL+YVAR+ EH   AS   KE   DG D NGRRVKQRL
Sbjct  380  AVMQTDGFDYLKKSCPSLLTELLKYVARLGEHSVSASGYRKEMFADGCDANGRRVKQRL  438



>ref|XP_004134158.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis sativus]
 ref|XP_004165840.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis sativus]
 gb|KGN57032.1| hypothetical protein Csa_3G150120 [Cucumis sativus]
Length=408

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ+DGF+YLKESCP VLTELL+YVARV EH  + S        DGSD NGRRVKQRL
Sbjct  349  AVMQSDGFDYLKESCPAVLTELLQYVARVTEHNVLTSGFGNLTFLDGSDLNGRRVKQRL  407



>ref|XP_008438731.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Cucumis 
melo]
Length=408

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ+DGF+YLKESCP VLTELL+YVARV EH  + S        DGSD NGRRVKQRL
Sbjct  349  AVMQSDGFDYLKESCPAVLTELLQYVARVTEHNVLTSGFGNLTFLDGSDLNGRRVKQRL  407



>emb|CDX92567.1| BnaA10g16060D [Brassica napus]
Length=439

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK+SCP +LTELL+YVAR+ EH   AS   KE   DG D NGRRVKQRL
Sbjct  380  AVMQTDGFDYLKKSCPSLLTELLKYVARLGEHSISASGYRKEIFADGCDANGRRVKQRL  438



>gb|KHG23129.1| BTB/POZ and MATH domain-containing protein 1 [Gossypium arboreum]
Length=181

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VL ELL+YVA++ EH   +    KE   DGSD NGRRVK RL
Sbjct  122  AVMQTDGFEYLKESCPGVLAELLQYVAKIGEHSVNSCGYRKEGSLDGSDVNGRRVKPRL  180



>ref|XP_010496737.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Camelina sativa]
Length=407

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM TDGF+YLK+SCP +LTELLEYVAR++EH  IAS   KE   DG D NGRRVK RL
Sbjct  348  AVMHTDGFDYLKKSCPSLLTELLEYVARLSEHSVIASGHRKEIFADGCDANGRRVKPRL  406



>ref|XP_008368872.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=410

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  213  PL*MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQD  392
            P+ +  I T      VMQTDG+++LKESCP +LT+LLEYVA VNEH A   +   EAI D
Sbjct  338  PVCLRFIATPGNLLGVMQTDGYKHLKESCPSILTDLLEYVASVNEHSASLFRQGNEAIPD  397

Query  393  GSDTNGRRVKQRL  431
            GSD +GRRVKQRL
Sbjct  398  GSDIHGRRVKQRL  410



>ref|XP_002871853.1| BTB-POZ and math domain 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48112.1| BTB-POZ and math domain 1 [Arabidopsis lyrata subsp. lyrata]
Length=407

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  258  VMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            VMQTDGF+YLKESCP +LTELLEYVAR++EH  IAS   KE   DG D +GRRVK RL
Sbjct  349  VMQTDGFDYLKESCPSLLTELLEYVARLSEHSVIASGHRKEIFADGCDASGRRVKPRL  406



>ref|XP_010420683.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Camelina sativa]
Length=407

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM TDGF+YLK+SCP +LTELLEYVAR++EH  IAS   KE   DG D NGRRVK RL
Sbjct  348  AVMHTDGFDYLKKSCPSLLTELLEYVARLSEHSVIASGHRKEIFADGCDGNGRRVKPRL  406



>ref|XP_010496738.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Camelina sativa]
Length=447

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM TDGF+YLK+SCP +LTELLEYVAR++EH  IAS   KE   DG D NGRRVK RL
Sbjct  388  AVMHTDGFDYLKKSCPSLLTELLEYVARLSEHSVIASGHRKEIFADGCDANGRRVKPRL  446



>ref|XP_009347696.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Pyrus x bretschneideri]
Length=410

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +3

Query  213  PL*MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQD  392
            P+ +  I T      VMQTDG+++LKESCP VLT+LLEYVA VNEH A   +   E I D
Sbjct  338  PVCLRFIATPGNLLGVMQTDGYKHLKESCPSVLTDLLEYVASVNEHSATLCRQGNETIPD  397

Query  393  GSDTNGRRVKQRL  431
            GSD +GRRVKQRL
Sbjct  398  GSDIHGRRVKQRL  410



>ref|XP_004168572.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like, 
partial [Cucumis sativus]
Length=153

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI-ASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLKESCP VLTELLEYVARV EH  I  S      + DGS  NGRRV+QRL
Sbjct  93   AVMQTEGFEYLKESCPSVLTELLEYVARVTEHAVITCSGYGNGTVLDGSYVNGRRVRQRL  152



>ref|XP_010420684.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X2 [Camelina sativa]
Length=447

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM TDGF+YLK+SCP +LTELLEYVAR++EH  IAS   KE   DG D NGRRVK RL
Sbjct  388  AVMHTDGFDYLKKSCPSLLTELLEYVARLSEHSVIASGHRKEIFADGCDGNGRRVKPRL  446



>ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Fragaria vesca subsp. vesca]
Length=411

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
             VM+TDG+++L+ESCP VLTELLEYVARV EH     ++  EAI DGSD NGRRVKQRL
Sbjct  353  GVMKTDGYKHLRESCPSVLTELLEYVARVGEHSVSQCRIGNEAILDGSDINGRRVKQRL  411



>ref|XP_010454160.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Camelina sativa]
 ref|XP_010454161.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Camelina sativa]
Length=407

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM TDGF+YLK+SCP +LTE+LEYVAR++EH  IAS   KE   DG D NGRRVK RL
Sbjct  348  AVMHTDGFDYLKKSCPSLLTEILEYVARLSEHSVIASGHRKEIFADGCDANGRRVKPRL  406



>ref|XP_006297810.1| hypothetical protein CARUB_v10013845mg [Capsella rubella]
 gb|EOA30708.1| hypothetical protein CARUB_v10013845mg [Capsella rubella]
Length=407

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  348  AVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGNRKELFADGCDVNGRRVKQRL  406



>ref|NP_566275.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana]
 sp|Q9M8J9.1|BPM2_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 2; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 2; Short=AtBPM2 
[Arabidopsis thaliana]
 gb|AAF30312.1|AC018907_12 unknown protein [Arabidopsis thaliana]
 gb|AAK76565.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14388.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74358.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana]
Length=406

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  347  AVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGHRKELFADGCDLNGRRVKQRL  405



>ref|XP_002884563.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60822.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  347  AVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGHRKELFADGCDLNGRRVKQRL  405



>ref|XP_006850808.1| hypothetical protein AMTR_s00025p00114450 [Amborella trichopoda]
 gb|ERN12389.1| hypothetical protein AMTR_s00025p00114450 [Amborella trichopoda]
Length=408

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQR  428
            AVMQT+GFEYLK+SCP VLTELLEYVARV EH  I  +   EA  DG+D+NGRRVKQR
Sbjct  351  AVMQTEGFEYLKQSCPPVLTELLEYVARVGEHSIITCRHQNEAF-DGTDSNGRRVKQR  407



>ref|XP_010436693.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 2-like [Camelina sativa]
Length=429

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  370  AVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGNRKELFADGCDVNGRRVKQRL  428



>gb|KFK38092.1| hypothetical protein AALP_AA3G068300 [Arabis alpina]
Length=406

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  347  AVMETDGFDYLKESCPSLLSELLEYVARLSEHSITSSGNRKELYADGCDVNGRRVKQRL  405



>ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 [Vitis 
vinifera]
 emb|CBI26169.3| unnamed protein product [Vitis vinifera]
Length=408

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAI-QDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK+SCP VLTELLEYVAR+ EH  I      E I  DGSD NGRRVKQR+
Sbjct  348  AVMQTDGFDYLKQSCPSVLTELLEYVARIGEHSVIVCGHGNENILLDGSDVNGRRVKQRI  407



>ref|NP_197401.2| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
 sp|Q8L765.1|BPM1_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 1; AltName: 
Full=Protein BTB-POZ AND MATH DOMAIN 1; Short=AtBPM1 
[Arabidopsis thaliana]
 gb|AAM97116.1| putative protein [Arabidopsis thaliana]
 gb|AAO00953.1| putative protein [Arabidopsis thaliana]
 gb|AED92637.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
Length=407

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLKESCP +LTELL+YVAR++EH  I S   KE   DG D +GRRVK RL
Sbjct  348  AVMQTDGFDYLKESCPSLLTELLQYVARLSEHSVIVSGHRKEIFADGCDASGRRVKPRL  406



>ref|XP_008355456.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=410

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  258  VMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            VMQTDG+++LKESCP +LT+LLEYVA VNEH A   +   EAI DGSD +GRRVKQRL
Sbjct  353  VMQTDGYKHLKESCPSILTDLLEYVASVNEHSASLXRQGNEAIPDGSDIHGRRVKQRL  410



>ref|NP_001190334.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
 gb|AED92638.1| BTB-POZ and math domain-containing protein [Arabidopsis thaliana]
Length=442

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLKESCP +LTELL+YVAR++EH  I S   KE   DG D +GRRVK RL
Sbjct  383  AVMQTDGFDYLKESCPSLLTELLQYVARLSEHSVIVSGHRKEIFADGCDASGRRVKPRL  441



>ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cicer arietinum]
Length=497

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSD  401
            +  I T     AVMQTDGFEYLKESCP VLTELLEYVAR  EH     K   EAI DGSD
Sbjct  341  LKFIATSENLRAVMQTDGFEYLKESCPSVLTELLEYVARFTEHSDFMCKHRNEAILDGSD  400

Query  402  TNGRRV  419
             NGRR+
Sbjct  401  VNGRRL  406



>ref|XP_009129652.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Brassica 
rapa]
Length=404

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  345  AVMETDGFDYLKESCPGLLSELLEYVARLSEHSLASSWNRKEFFPDGCDVNGRRVKQRL  403



>ref|XP_009120926.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X1 [Brassica rapa]
Length=400

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDG +YLK+SCP +LTELL+YVAR+ EH   AS   KE   DG D NGRRVKQRL
Sbjct  341  AVMQTDGVDYLKKSCPSLLTELLKYVARLGEHSVSASGYRKEMFADGCDANGRRVKQRL  399



>ref|XP_010905244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Elaeis guineensis]
Length=414

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLK SCP +LTELL+YVARV EH  I      EA+ DGSD NGRRVK R+
Sbjct  357  AVMQTDGFEYLKVSCPSILTELLDYVARVGEHSVIPCTYANEAL-DGSDANGRRVKPRI  414



>ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum]
 gb|ESQ49424.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum]
Length=406

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  347  AVMETDGFDYLKESCPCLLSELLEYVARLSEHSLTSSGNRKEFYADGCDVNGRRVKQRL  405



>emb|CDY24708.1| BnaA05g31070D [Brassica napus]
Length=403

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  344  AVMETDGFDYLKESCPGLLSELLEYVARLSEHSLASSWNRKEFYPDGCDVNGRRVKQRL  402



>ref|XP_009120927.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 isoform 
X2 [Brassica rapa]
Length=439

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDG +YLK+SCP +LTELL+YVAR+ EH   AS   KE   DG D NGRRVKQRL
Sbjct  380  AVMQTDGVDYLKKSCPSLLTELLKYVARLGEHSVSASGYRKEMFADGCDANGRRVKQRL  438



>ref|XP_008808250.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Phoenix dactylifera]
Length=414

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYL+ SCP +LTELLEYVARV EH  I      +A+ DGSD NGRRVK R+
Sbjct  357  AVMQTDGFEYLRVSCPSILTELLEYVARVGEHSVIPCTFANDAL-DGSDANGRRVKPRI  414



>gb|KHG23128.1| BTB/POZ and MATH domain-containing protein 2 [Gossypium arboreum]
Length=408

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP VL ELL+YVA++ EH   +    KE   DGSD NGRRVK RL
Sbjct  349  AVMQTDGFEYLKESCPGVLAELLQYVAKIGEHSVNSCGYRKEGSLDGSDVNGRRVKPRL  407



>ref|XP_009134877.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Brassica 
rapa]
 emb|CDY58342.1| BnaA03g57430D [Brassica napus]
Length=403

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   ++   KE   DG D NGRRVKQRL
Sbjct  344  AVMETDGFDYLKESCPCLLSELLEYVARLSEHSLTSTGQRKELYADGGDVNGRRVKQRL  402



>ref|XP_010096368.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
 gb|EXB63843.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
Length=188

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQR  428
              AVM+TDGFEYLK+SCP V+T+LL+Y+A  +EH    S+   EA+ DGSD NGRRVKQR
Sbjct  130  LGAVMETDGFEYLKQSCPSVMTDLLQYIA--SEHHVTVSRHGNEAVLDGSDINGRRVKQR  187

Query  429  L  431
            L
Sbjct  188  L  188



>ref|XP_010524787.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLK-EAIQDGSDTNGRRVKQR  428
            AAVMQT+GFEYLKESCP +LTELLE+VAR+ EH   AS   K E + DG D NGRRVKQR
Sbjct  347  AAVMQTEGFEYLKESCPTLLTELLEHVARLGEHRMAASVYPKEEVLVDGCDANGRRVKQR  406

Query  429  L  431
            L
Sbjct  407  L  407



>emb|CDY08064.1| BnaC03g34590D [Brassica napus]
Length=407

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   ++   KE   DG D NGRRVKQRL
Sbjct  348  AVMETDGFDYLKESCPCLLSELLEYVARLSEHSLTSTGQRKELYADGGDVNGRRVKQRL  406



>emb|CDY05245.1| BnaC05g45580D [Brassica napus]
Length=396

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   ++   KE   DG D NGRRVKQRL
Sbjct  337  AVMETDGFDYLKESCPGLLSELLEYVARLSEHSLASAWNRKEFYPDGCDVNGRRVKQRL  395



>ref|XP_010551778.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Tarenaya hassleriana]
Length=410

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 4/63 (6%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHP--AIASKLLKE--AIQDGSDTNGRRVK  422
            AVMQT+GFEYL ESCP VLTELLEYVAR+ EH   A +S   KE  A+ DG D+NGRRVK
Sbjct  347  AVMQTEGFEYLNESCPSVLTELLEYVARLGEHSITAASSGHRKEVVALADGCDSNGRRVK  406

Query  423  QRL  431
            QRL
Sbjct  407  QRL  409



>emb|CDY66705.1| BnaAnng22770D [Brassica napus]
Length=403

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK SCP +LTELL+Y+AR+ EH   A    K+ + DG D NGRRVKQRL
Sbjct  344  AVMQTDGFDYLKRSCPSLLTELLKYLARLREHSVTAPGHPKDIVADGCDANGRRVKQRL  402



>ref|XP_009131717.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Brassica rapa]
Length=403

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK SCP +LTELL+Y+AR+ EH   A    K+   DG D+NGRRVKQRL
Sbjct  344  AVMQTDGFDYLKRSCPSLLTELLKYLARLREHSVTAPGHPKDIFADGCDSNGRRVKQRL  402



>ref|XP_010551779.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Tarenaya hassleriana]
Length=448

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 4/63 (6%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHP--AIASKLLKE--AIQDGSDTNGRRVK  422
            AVMQT+GFEYL ESCP VLTELLEYVAR+ EH   A +S   KE  A+ DG D+NGRRVK
Sbjct  385  AVMQTEGFEYLNESCPSVLTELLEYVARLGEHSITAASSGHRKEVVALADGCDSNGRRVK  444

Query  423  QRL  431
            QRL
Sbjct  445  QRL  447



>ref|XP_008458543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Cucumis melo]
 gb|KGN46162.1| hypothetical protein Csa_6G061240 [Cucumis sativus]
Length=411

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI-ASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLKESCP VLTELLEYVARV EH  I  S      + DGS  NGRRV+QRL
Sbjct  351  AVMQTEGFEYLKESCPSVLTELLEYVARVTEHAVITCSGYGNGTVLDGSYVNGRRVRQRL  410



>ref|XP_004153182.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 2-like [Cucumis sativus]
Length=416

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI-ASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLKESCP VLTELLEYVARV EH  I  S      + DGS  NGRRV+QRL
Sbjct  356  AVMQTEGFEYLKESCPSVLTELLEYVARVTEHAVITCSGYGNGTVLDGSYVNGRRVRQRL  415



>ref|XP_009131718.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X2 [Brassica rapa]
Length=437

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK SCP +LTELL+Y+AR+ EH   A    K+   DG D+NGRRVKQRL
Sbjct  378  AVMQTDGFDYLKRSCPSLLTELLKYLARLREHSVTAPGHPKDIFADGCDSNGRRVKQRL  436



>emb|CDX70860.1| BnaC03g09440D [Brassica napus]
Length=440

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YLK SCP +LTELL+Y+AR+ EH   A    K+   DG D+NGRRVKQRL
Sbjct  381  AVMQTDGFDYLKRSCPSLLTELLKYLARLREHSVTAPGHPKDIFADGCDSNGRRVKQRL  439



>ref|XP_010524788.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 
X2 [Tarenaya hassleriana]
Length=407

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLK-EAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLKESCP +LTELLE+VAR+ EH   AS   K E + DG D NGRRVKQRL
Sbjct  347  AVMQTEGFEYLKESCPTLLTELLEHVARLGEHRMAASVYPKEEVLVDGCDANGRRVKQRL  406



>ref|XP_010103451.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
 gb|EXB95854.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
Length=412

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+T+GF+YLKESCP  LTELL+YVAR+ EH  IAS   K  + DGSD N RRVK RL
Sbjct  353  AVMETEGFQYLKESCPSALTELLQYVARIGEHSVIASGYGKVTLLDGSDVNRRRVKPRL  411



>ref|XP_009124937.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Brassica rapa]
Length=389

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   +G D NGRRVKQRL
Sbjct  330  AVMETDGFDYLKESCPCLLSELLEYVARLSEHSLASSGHGKELYVEGCDVNGRRVKQRL  388



>ref|XP_004296996.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Fragaria vesca subsp. vesca]
Length=409

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDG++YL ESCP V+TELL+YVAR+ EH  IA    K  + DGSD NGRRVK RL
Sbjct  350  AVIETDGYKYLTESCPSVITELLQYVARIGEHSFIAGGFGKGTLLDGSDMNGRRVKPRL  408



>emb|CDY18844.1| BnaAnng03090D [Brassica napus]
Length=429

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVM+TDGF+YLKESCP +L+ELLEYVAR++EH   +S   KE   +G D NGRRVKQRL
Sbjct  370  AVMETDGFDYLKESCPCLLSELLEYVARLSEHSLASSGHGKELYVEGCDVNGRRVKQRL  428



>ref|XP_002516797.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF45411.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=403

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP V+TELL+YVAR+ EH  IA     E++ DG D NGRRVKQR+
Sbjct  346  AVMQTDGFEYLKESCPCVITELLQYVARIGEHSGIACAHGNESL-DG-DLNGRRVKQRI  402



>ref|XP_006658050.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Oryza brachyantha]
Length=268

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+V EH +++  L    + DG D NGRRVK R+
Sbjct  211  AVMQTDGFDYLQQSCPSLLTELLEYVAKVGEH-SVSPCLYSNEVLDGGDANGRRVKPRI  268



>ref|XP_009356739.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Pyrus x bretschneideri]
Length=408

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +3

Query  213  PL*MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQD  392
            P+ +  I T      VMQTDG+++LKESCP VLTELLEYVA VNEH A   +   +   D
Sbjct  338  PVCLRFIATPGNLLGVMQTDGYKHLKESCPSVLTELLEYVASVNEHSASLGRHGNDL--D  395

Query  393  GSDTNGRRVKQRL  431
            GSD +GRRVKQRL
Sbjct  396  GSDIHGRRVKQRL  408



>ref|XP_009356740.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Pyrus x bretschneideri]
Length=407

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +3

Query  213  PL*MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQD  392
            P+ +  I T      VMQTDG+++LKESCP VLTELLEYVA VNEH A   +   +   D
Sbjct  337  PVCLRFIATPGNLLGVMQTDGYKHLKESCPSVLTELLEYVASVNEHSASLGRHGNDL--D  394

Query  393  GSDTNGRRVKQRL  431
            GSD +GRRVKQRL
Sbjct  395  GSDIHGRRVKQRL  407



>gb|ACF80834.1| unknown [Zea mays]
Length=56

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +3

Query  261  MQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            MQTDGF+YL++SCP +LTELLEYVA++ EH +++  L    + DG D NGRRVK R+
Sbjct  1    MQTDGFDYLQQSCPSLLTELLEYVAKIGEH-SVSPCLYSTEVLDGGDANGRRVKPRI  56



>gb|ABK94822.1| unknown [Populus trichocarpa]
Length=56

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +3

Query  261  MQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            MQTDGFEYLKESCP V+TELL+YVA+  EH  IA     + +   SD NGRRVKQR+
Sbjct  1    MQTDGFEYLKESCPSVITELLQYVAKNGEHSVIACTHGNDNLD--SDMNGRRVKQRI  55



>ref|XP_004958540.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Setaria italica]
Length=425

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+V EH A+   L    + DG D NGRRVK R+
Sbjct  368  AVMQTDGFDYLQQSCPSLLTELLEYVAKVGEH-AVTPCLYSTEVLDGGDANGRRVKPRI  425



>ref|XP_008353276.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=288

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDGF+YL+ESCP V+TELL YVA + EH  + S   K  + DG+D NGRRVK RL
Sbjct  229  AVIETDGFKYLRESCPSVITELLRYVASIGEHSFVTSGYGKGNLSDGTDGNGRRVKARL  287



>ref|XP_010695312.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Beta vulgaris subsp. vulgaris]
Length=405

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKE-AIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLK SCP V+TELLEYVAR+ EH   +     +  + DGSD NGRRVKQRL
Sbjct  345  AVMQTEGFEYLKVSCPSVITELLEYVARITEHSKTSFGYGNDVTMLDGSDMNGRRVKQRL  404



>ref|XP_009339952.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Pyrus x bretschneideri]
Length=343

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDGF+YL+ESCP V+TELL YVA + EH  + S   K  + DG+D NGRRVK RL
Sbjct  284  AVIETDGFKYLRESCPSVITELLRYVASIGEHSFVTSGYGKGNLSDGTDGNGRRVKARL  342



>gb|EEC82594.1| hypothetical protein OsI_27153 [Oryza sativa Indica Group]
Length=434

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+V EH +++  L    + DG D NGRRVK R+
Sbjct  377  AVMQTDGFDYLQQSCPSLLTELLEYVAKVGEH-SVSPCLYSNEVLDGGDANGRRVKPRI  434



>ref|NP_001060495.1| Os07g0655300 [Oryza sativa Japonica Group]
 dbj|BAC20790.1| putative zinc finger POZ domain protein [Oryza sativa Japonica 
Group]
 dbj|BAF22409.1| Os07g0655300 [Oryza sativa Japonica Group]
 dbj|BAG93366.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67726.1| hypothetical protein OsJ_25406 [Oryza sativa Japonica Group]
Length=434

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+V EH +++  L    + DG D NGRRVK R+
Sbjct  377  AVMQTDGFDYLQQSCPSLLTELLEYVAKVGEH-SVSPCLYSNEVLDGGDANGRRVKPRI  434



>ref|XP_009787612.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana sylvestris]
Length=407

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ++GF++LKESCP V+TELL+YVA +NEH AI S +    I DG+D NGRRVKQR+
Sbjct  349  AVMQSEGFDHLKESCPSVITELLKYVAGMNEH-AIISYVHGGHILDGTDVNGRRVKQRI  406



>ref|XP_009621647.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Nicotiana tomentosiformis]
Length=407

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ++GF++LKESCP V+TELL+YVA +NEH AI S +    I DG+D NGRRVKQR+
Sbjct  349  AVMQSEGFDHLKESCPSVITELLKYVAGMNEH-AIISYVHGGHILDGTDVNGRRVKQRI  406



>ref|XP_004229460.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Solanum lycopersicum]
Length=407

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ++GF++LKESCP V+TELL+YVA +NEH AI S +    I DG+D NGRRVKQR+
Sbjct  349  AVMQSEGFDHLKESCPSVITELLKYVAGMNEH-AIISYVHGGHILDGTDVNGRRVKQRI  406



>ref|XP_008340895.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Malus domestica]
Length=410

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDGF+YL+ESCP V+TELL YVA + EH  + S   K  + DG+D NGRRVK RL
Sbjct  351  AVIETDGFKYLRESCPSVITELLRYVASIGEHSFVTSGYGKGNLSDGTDGNGRRVKARL  409



>ref|NP_001140355.1| hypothetical protein [Zea mays]
 gb|ACF83655.1| unknown [Zea mays]
 tpg|DAA41632.1| TPA: hypothetical protein ZEAMMB73_935561 [Zea mays]
 gb|AIB05408.1| orphans transcription factor, partial [Zea mays]
Length=426

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA++ EH +++  L    + DG D NGRRVK R+
Sbjct  369  AVMQTDGFDYLQQSCPSLLTELLEYVAKIGEH-SVSPCLYSTEVLDGGDANGRRVKPRI  426



>gb|KDP40087.1| hypothetical protein JCGZ_02085 [Jatropha curcas]
Length=412

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP V+TELL+YVA++ EH  I      E++ DG D NGRRVKQR+
Sbjct  355  AVMQTDGFEYLKESCPSVITELLQYVAKMGEHSVITCGHGNESL-DG-DINGRRVKQRI  411



>gb|EPS58860.1| hypothetical protein M569_15950 [Genlisea aurea]
Length=404

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ++GFEYLKESCP VLTELLE+VARVNEH ++  K     + D +D + RRVKQRL
Sbjct  346  AVMQSEGFEYLKESCPDVLTELLEHVARVNEHLSVGGKQGIGHLMDRNDGSSRRVKQRL  404



>ref|XP_010090357.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
 gb|EXB39327.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis]
Length=404

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQR  428
              AVM+TDGFEYLK+SCP V+T+LL+Y+A V       SK   EA+ DGSD NGRRVKQR
Sbjct  349  LGAVMETDGFEYLKQSCPSVMTDLLQYIANV-----AVSKHGNEAVLDGSDINGRRVKQR  403

Query  429  L  431
            L
Sbjct  404  L  404



>ref|XP_002463303.1| hypothetical protein SORBIDRAFT_02g041470 [Sorghum bicolor]
 gb|EER99824.1| hypothetical protein SORBIDRAFT_02g041470 [Sorghum bicolor]
Length=426

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+V +H +++  L    + DG D NGRRVK R+
Sbjct  369  AVMQTDGFDYLQQSCPSLLTELLEYVAKVGDH-SVSPCLYSTEVLDGGDANGRRVKPRI  426



>ref|XP_011009015.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Populus euphratica]
Length=409

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP V+TELL+YVA+  EH  IA     + +   SD NGRRVKQR+
Sbjct  352  AVMQTDGFEYLKESCPSVITELLQYVAKNGEHSVIACTHGNDNVD--SDMNGRRVKQRI  408



>ref|XP_006339418.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006339419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
isoform X2 [Solanum tuberosum]
Length=407

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQ++GF++L+ESCP V+TELL+YVA +NEH AI S +    I DG+D NGRRVKQR+
Sbjct  349  AVMQSEGFDHLRESCPSVITELLKYVAGMNEH-AIISYVHGGHILDGTDVNGRRVKQRI  406



>gb|ACG38997.1| speckle-type POZ protein [Zea mays]
Length=422

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+  EH +++  L    + DG D NGRRVK R+
Sbjct  365  AVMQTDGFDYLQQSCPSLLTELLEYVAKAGEH-SVSPCLYSTEVLDGGDANGRRVKPRI  422



>ref|NP_001130519.1| speckle-type POZ protein [Zea mays]
 gb|ACF78765.1| unknown [Zea mays]
 gb|ACL52602.1| unknown [Zea mays]
 gb|ACR38478.1| unknown [Zea mays]
 tpg|DAA63939.1| TPA: speckle-type POZ protein [Zea mays]
 gb|AIB05424.1| orphans transcription factor, partial [Zea mays]
Length=422

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGF+YL++SCP +LTELLEYVA+  EH +++  L    + DG D NGRRVK R+
Sbjct  365  AVMQTDGFDYLQQSCPSLLTELLEYVAKAGEH-SVSPCLYSTEVLDGGDANGRRVKPRI  422



>dbj|BAJ97789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GF+YL++SCP +LTELLEYVA+V +H A+   L    + DG D NGRRVK RL
Sbjct  368  AVMQTEGFDYLQQSCPSLLTELLEYVAKVGDH-AVPPCLYSNEVLDGGDANGRRVKPRL  425



>ref|XP_006380054.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa]
 gb|ERP57851.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa]
Length=409

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP V+TELL+YVA+  EH  IA     + +   SD NGRRVKQR+
Sbjct  352  AVMQTDGFEYLKESCPSVITELLQYVAKNGEHSVIACTHGNDNLD--SDMNGRRVKQRI  408



>ref|XP_008223027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Prunus 
mume]
Length=409

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDG++YL+ESCP V+TELL  VA + EH  +A    K  + DGSDTNGRRVK RL
Sbjct  350  AVIETDGYKYLRESCPSVITELLHCVASIGEHSFVACGYGKGTLFDGSDTNGRRVKARL  408



>gb|EMT06101.1| Speckle-type POZ protein-like protein [Aegilops tauschii]
Length=426

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GF+YL++SCP +LTELLEYVA+V +H A+   L    + DG D NGRRVK RL
Sbjct  369  AVMQTEGFDYLQQSCPSLLTELLEYVAKVGDH-AVPPCLYSNEVLDGGDANGRRVKPRL  426



>ref|XP_007222747.1| hypothetical protein PRUPE_ppa006500mg [Prunus persica]
 gb|EMJ23946.1| hypothetical protein PRUPE_ppa006500mg [Prunus persica]
Length=409

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDG++YL+ESCP V+TELL  VA + EH  +A    K  + DGSDTNGRRVK RL
Sbjct  350  AVIETDGYKYLRESCPSVITELLHCVASIGEHSFVACGYGKGTLFDGSDTNGRRVKPRL  408



>ref|XP_003562549.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Brachypodium distachyon]
Length=443

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQR  428
            AVMQTDGF+YL++SCP +LTEL+EYVA+V EH  ++  L    + DG D NGRRVK R
Sbjct  386  AVMQTDGFDYLQQSCPSLLTELIEYVAKVGEH-IVSPCLYSNEVLDGGDANGRRVKPR  442



>ref|XP_002315535.1| speckle-type POZ family protein [Populus trichocarpa]
 gb|EEF01706.1| speckle-type POZ family protein [Populus trichocarpa]
Length=410

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP V+TELL+YVA+  E   I   L  + +   SD NGRRVKQR+
Sbjct  353  AVMQTDGFEYLKESCPSVITELLQYVAKNGERSVITCTLGNDTLD--SDMNGRRVKQRI  409



>ref|XP_009405866.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=416

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLK SCP +L ELL  VAR+ E+   +S    +A+ DGSD NGRRVK R+
Sbjct  358  AVMQTEGFEYLKVSCPSILIELLALVARIGENSLTSSVYSSDALLDGSDANGRRVKPRI  416



>ref|XP_009404705.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=417

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLK SCP +LTELL+YVAR+ E  ++++    +A+ DG D  GRRVK R+
Sbjct  360  AVMQTEGFEYLKVSCPSILTELLQYVARIGEISSVSNVCANDAL-DGCDITGRRVKPRI  417



>ref|XP_009352133.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Pyrus x bretschneideri]
Length=410

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++T+GF YL+ESCP V+TELL YVA   +H  + S   K  + DG+D NGRRVK RL
Sbjct  351  AVIETEGFNYLRESCPSVITELLRYVASSGDHSFVTSGYGKGNLLDGTDGNGRRVKARL  409



>ref|XP_011006874.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like 
[Populus euphratica]
Length=410

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQTDGFEYLKESCP V+TELL+YVA+  E   I      + +   SD NGRRVKQR+
Sbjct  353  AVMQTDGFEYLKESCPSVITELLQYVAKNGERSVITCTHGNDTLD--SDMNGRRVKQRI  409



>ref|XP_008390810.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Malus 
domestica]
Length=410

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV++TDGF YL+ESCP V+TELL YVA   +H    S   K  + D +D NGRRVK RL
Sbjct  351  AVIETDGFNYLRESCPSVITELLRYVASSGDHSFFTSGYGKGNLLDSTDGNGRRVKARL  409



>ref|XP_010695310.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Beta vulgaris subsp. vulgaris]
Length=407

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AVMQT+GFEYLK SCP V++ELL +VARV+EH         + + D  D NGRRVK R+
Sbjct  348  AVMQTEGFEYLKLSCPSVISELLAFVARVSEHSISVVGYGNDPMLDCGDMNGRRVKPRI  406



>ref|XP_009394086.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=152

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
            AV+Q++GF+YLK SCP +L ELL+YVA   E+ A++S    +A+ DGSD NGRRVK ++
Sbjct  95   AVVQSEGFKYLKVSCPSLLKELLQYVAGKGENSAVSSADTNDAL-DGSDANGRRVKPQI  152



>ref|NP_974236.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana]
 gb|AEE74359.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana]
Length=295

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  264  QTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNGRRVKQRL  431
             T+  E   ESCP +L+ELLEYVAR++EH   +S   KE   DG D NGRRVKQRL
Sbjct  239  NTNSLEVEAESCPSLLSELLEYVARLSEHSLTSSGHRKELFADGCDLNGRRVKQRL  294



>ref|XP_009762142.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=405

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+DGFEYLKE+CP + +ELL+ VA  ++  +     S+ +   + DG DTNGRRV
Sbjct  342  LAAVMQSDGFEYLKENCPSLQSELLKTVAGCDDDCSSGGGKSRSVWAQLSDGGDTNGRRV  401

Query  420  KQR  428
            +QR
Sbjct  402  RQR  404



>ref|XP_009606600.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana tomentosiformis]
Length=405

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+DGFEYLKE+CP + +ELL+ VA  ++  +     S+ +   + DG DTNGRRV
Sbjct  342  LAAVMQSDGFEYLKENCPSLQSELLKTVAGCDDDCSSGGGKSRSVWAQLSDGGDTNGRRV  401

Query  420  KQR  428
            +QR
Sbjct  402  RQR  404



>emb|CDY15754.1| BnaC04g15700D [Brassica napus]
Length=155

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEAIQDGSDTNG  410
            AVM+TDGF+YLKE CP +L+ELLEYV R++EH   +    KE   DG D  G
Sbjct  102  AVMETDGFDYLKEGCPCLLSELLEYVVRLSEHSLASLGHGKELYVDGCDVMG  153



>gb|KDO47647.1| hypothetical protein CISIN_1g015782mg [Citrus sinensis]
Length=400

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             AAVM++DGFEYLKE+CP + +ELL+ VA   E  +    S+ +   + DG DTNGRRV+
Sbjct  338  LAAVMRSDGFEYLKENCPSLQSELLKTVAGCEEDCSSGGKSRSVWAQLSDGGDTNGRRVR  397

Query  423  QR  428
            QR
Sbjct  398  QR  399



>ref|XP_006470186.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Citrus sinensis]
Length=400

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             AAVM++DGFEYLKE+CP + +ELL+ VA   E  +    S+ +   + DG DTNGRRV+
Sbjct  338  LAAVMRSDGFEYLKENCPSLQSELLKTVAGCEEDCSSGGKSRSVWAQLSDGGDTNGRRVR  397

Query  423  QR  428
            QR
Sbjct  398  QR  399



>ref|XP_011080496.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Sesamum indicum]
Length=402

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASK--LLKEAIQDGSDTNGRRVK  422
             AAVM++DGFEYLKESCP + +E+L+ VA  +E  +  SK   +   + DG DT GRRV+
Sbjct  340  LAAVMRSDGFEYLKESCPALQSEILKTVAGCDEDCSSGSKSRSVWAQLSDGGDTGGRRVR  399

Query  423  QR  428
            QR
Sbjct  400  QR  401



>emb|CDP09732.1| unnamed protein product [Coffea canephora]
Length=358

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFEYLKE+CP + +E+L+ VA   E  +     S+ +   + DG DTNGRRV
Sbjct  295  LAAVMRSDGFEYLKENCPSLQSEILKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTNGRRV  354

Query  420  KQR  428
            +QR
Sbjct  355  RQR  357



>ref|XP_004491160.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=399

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARV---NEHPAIASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFEY+KE CP + +E+L+ +A     +  P   S+ +   + DG DTNGRRV
Sbjct  336  LAAVMRSDGFEYMKEKCPWLQSEILKTIAGCEGDSCSPGEKSQSVWAQLSDGGDTNGRRV  395

Query  420  KQRL  431
            +QRL
Sbjct  396  RQRL  399



>ref|XP_006362728.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Solanum tuberosum]
Length=405

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+DGFEYLKE+CP + +ELL+ VA   +  +     S+ +   + DG DTNGRRV
Sbjct  342  LAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDDCSSGGGKSRSVWAQLSDGGDTNGRRV  401

Query  420  KQR  428
            + R
Sbjct  402  RHR  404



>ref|XP_004228476.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Solanum lycopersicum]
Length=405

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+DGFEYLKE+CP + +ELL+ VA   +  +     S+ +   + DG DTNGRRV
Sbjct  342  LAAVMQSDGFEYLKENCPSLQSELLKTVAGCEDDCSSGGGKSRSVWAQLSDGGDTNGRRV  401

Query  420  KQR  428
            + R
Sbjct  402  RHR  404



>gb|KHG12366.1| BTB/POZ and MATH domain-containing 4 -like protein [Gossypium 
arboreum]
Length=410

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQ  425
            AAVM++DGFEYLK++CP + +ELL+ +A   E  +    S+ +   + DG+DTNGRRV+Q
Sbjct  349  AAVMRSDGFEYLKDNCPLLQSELLKTIAGCEEDYSSGGKSRSVWAQLSDGTDTNGRRVRQ  408

Query  426  R  428
            R
Sbjct  409  R  409



>gb|ACM67640.1| BTB-POZ and MATH domain protein [Capsicum annuum]
Length=403

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+D FEYLKE+CP + +ELL+ VA   +  +     S+ +   + DG DTNGRRV
Sbjct  340  LAAVMQSDDFEYLKENCPSLQSELLKTVAGCEDDCSSGGGKSRSVWAQLSDGGDTNGRRV  399

Query  420  KQR  428
            +QR
Sbjct  400  RQR  402



>gb|EYU46143.1| hypothetical protein MIMGU_mgv1a007584mg [Erythranthe guttata]
Length=403

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFEYLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  340  LAAVMRSDGFEYLKENCPALQSELLKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTTGRRV  399

Query  420  KQR  428
            +QR
Sbjct  400  RQR  402



>ref|XP_004491159.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=421

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARV---NEHPAIASKLLKEAIQDGSDTNGRRVKQ  425
            AVM++DGFEY+KE CP + +E+L+ +A     +  P   S+ +   + DG DTNGRRV+Q
Sbjct  360  AVMRSDGFEYMKEKCPWLQSEILKTIAGCEGDSCSPGEKSQSVWAQLSDGGDTNGRRVRQ  419

Query  426  RL  431
            RL
Sbjct  420  RL  421



>ref|XP_009628011.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana tomentosiformis]
Length=409

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+DGFEYLKE  P + +ELL+ VA   +  +     SK +   + DG DTNGRRV
Sbjct  346  LAAVMQSDGFEYLKEHSPSLQSELLKTVAGCEDDCSSGGGKSKSVWAQLSDGGDTNGRRV  405

Query  420  KQR  428
            +QR
Sbjct  406  RQR  408



>ref|XP_009771203.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=409

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVMQ+DGFEYLKE  P + +ELL+ VA   +  +     SK +   + DG DTNGRRV
Sbjct  346  LAAVMQSDGFEYLKEHSPSLQSELLKTVAGCEDDCSSGGGKSKSVWAQLSDGGDTNGRRV  405

Query  420  KQR  428
            +QR
Sbjct  406  RQR  408



>ref|XP_006340346.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Solanum tuberosum]
Length=408

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEA---IQD  392
            + L ++    +AVMQ+DGFEYLKE+CP + +ELL+ VA   +  +      K     + D
Sbjct  336  VCLSFSAENLSAVMQSDGFEYLKENCPALQSELLKTVAGCEDDSSSGGGKSKSVWAQLSD  395

Query  393  GSDTNGRRVKQR  428
            G DTNGRR++QR
Sbjct  396  GGDTNGRRIRQR  407



>ref|XP_002961582.1| hypothetical protein SELMODRAFT_270271 [Selaginella moellendorffii]
 ref|XP_002971221.1| hypothetical protein SELMODRAFT_171839 [Selaginella moellendorffii]
 gb|EFJ27819.1| hypothetical protein SELMODRAFT_171839 [Selaginella moellendorffii]
 gb|EFJ36842.1| hypothetical protein SELMODRAFT_270271 [Selaginella moellendorffii]
Length=409

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASK--LLKEAIQDGSDTNGRRVK  422
             A VMQ+DGFEYL+ESCP + +ELL+ VA V E     +K   +   + DG D  GRRV+
Sbjct  347  LAVVMQSDGFEYLRESCPSLQSELLKTVAGVEEEAKAGTKNRTVWTHVADGGDGLGRRVR  406

Query  423  QRL  431
            Q++
Sbjct  407  QKI  409



>ref|XP_002313624.2| hypothetical protein POPTR_0009s15830g [Populus trichocarpa]
 gb|EEE87579.2| hypothetical protein POPTR_0009s15830g [Populus trichocarpa]
Length=398

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DTNGRRV
Sbjct  335  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTNGRRV  394

Query  420  KQR  428
            +QR
Sbjct  395  RQR  397



>ref|XP_007015536.1| BTB/POZ and MATH domain-containing protein 4 isoform 1 [Theobroma 
cacao]
 gb|EOY33155.1| BTB/POZ and MATH domain-containing protein 4 isoform 1 [Theobroma 
cacao]
Length=407

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             AAVM+TDGFEYLKE+CP + +ELL+ VA  +E  +    S+ +   + DG DT+GRRV+
Sbjct  346  LAAVMRTDGFEYLKENCPSLQSELLKTVAGCDEDRSSGGKSRSVWAQLSDG-DTSGRRVR  404

Query  423  QR  428
            QR
Sbjct  405  QR  406



>ref|XP_010266708.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Nelumbo nucifera]
Length=407

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
              AV+++DGFEYLKE+CP + +E+L+ VA   E  +    S+ +   + DG DTNGRRV+
Sbjct  345  LGAVVRSDGFEYLKENCPALQSEILKTVAGCEEECSSGGKSRSVWAQLSDGGDTNGRRVR  404

Query  423  QR  428
            QR
Sbjct  405  QR  406



>ref|XP_004251235.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Solanum 
lycopersicum]
Length=408

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEA---IQDGSDTNGRRV  419
             +AVMQ+DGFEYLKE+CP + +ELL+ VA   +  +      K     + DG DTNGRR+
Sbjct  345  LSAVMQSDGFEYLKENCPALQSELLKTVAGCEDDSSSGGGKSKSVWAQLSDGGDTNGRRI  404

Query  420  KQR  428
            +Q+
Sbjct  405  RQK  407



>ref|XP_011016310.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=398

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  335  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRV  394

Query  420  KQR  428
            +QR
Sbjct  395  RQR  397



>ref|XP_011043816.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Populus euphratica]
Length=398

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  335  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRV  394

Query  420  KQR  428
            +QR
Sbjct  395  RQR  397



>ref|XP_011043823.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X3 [Populus euphratica]
Length=397

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  334  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRV  393

Query  420  KQR  428
            +QR
Sbjct  394  RQR  396



>ref|XP_011016311.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X3 [Populus euphratica]
Length=397

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  334  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRV  393

Query  420  KQR  428
            +QR
Sbjct  394  RQR  396



>ref|XP_011043808.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 isoform 
X1 [Populus euphratica]
Length=434

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  371  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRV  430

Query  420  KQR  428
            +QR
Sbjct  431  RQR  433



>ref|XP_011016309.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5-like 
isoform X1 [Populus euphratica]
Length=434

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI---ASKLLKEAIQDGSDTNGRRV  419
             AAVM++DGF YLKE+CP + +ELL+ VA   E  +     S+ +   + DG DT GRRV
Sbjct  371  LAAVMRSDGFTYLKENCPSLQSELLKTVAGCEEDCSSEGGKSRSVWAQLSDGCDTTGRRV  430

Query  420  KQR  428
            +QR
Sbjct  431  RQR  433



>ref|XP_002970063.1| hypothetical protein SELMODRAFT_267336 [Selaginella moellendorffii]
 ref|XP_002985255.1| hypothetical protein SELMODRAFT_121807 [Selaginella moellendorffii]
 gb|EFJ13749.1| hypothetical protein SELMODRAFT_121807 [Selaginella moellendorffii]
 gb|EFJ29187.1| hypothetical protein SELMODRAFT_267336 [Selaginella moellendorffii]
Length=405

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 4/71 (6%)
 Frame = +3

Query  228  LIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIAS----KLLKEAIQDG  395
            L Y     +AVMQ++G++YL+ESCP +L +LL+ VA V +   + S      +   + DG
Sbjct  334  LKYAADNLSAVMQSEGYDYLRESCPVLLFDLLKTVAGVGKDLFVGSGGKGGYIWGQLSDG  393

Query  396  SDTNGRRVKQR  428
             D NGRRV+Q+
Sbjct  394  GDVNGRRVRQK  404



>ref|XP_006826332.1| hypothetical protein AMTR_s00004p00105320 [Amborella trichopoda]
 gb|ERM93569.1| hypothetical protein AMTR_s00004p00105320 [Amborella trichopoda]
Length=403

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDG  395
            + L Y     AAVM+T+GF +L+E CP + +ELL+ VA   E  + A  S+ +   + DG
Sbjct  332  VCLKYAAENLAAVMRTEGFGHLREKCPSLQSELLKTVAGCEEDCSSAGRSRSVWAQLSDG  391

Query  396  SDTNGRRVKQR  428
            +D NGRRV+QR
Sbjct  392  TDDNGRRVRQR  402



>gb|EPS71913.1| hypothetical protein M569_02844, partial [Genlisea aurea]
Length=407

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPA------IASKLLKEAIQDGSDTNG  410
             AAVM++DGFEYLKE+CP + +ELL+ VA  +E  +        S+ +   + DG DT G
Sbjct  341  LAAVMRSDGFEYLKENCPDLQSELLKTVAGCDEDCSSGGGGGGKSRSVWAQLSDGGDTVG  400

Query  411  RRVKQR  428
            RRV+Q+
Sbjct  401  RRVRQK  406



>gb|KDP42915.1| hypothetical protein JCGZ_23857 [Jatropha curcas]
Length=403

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++D FE+L+E+CP + +ELL+ VA   E  +     S+ +   + DG DTNGRRV
Sbjct  340  LAAVMRSDSFEHLRENCPSLQSELLKAVAGCEEDCSSGGGKSRSVWAQLSDGGDTNGRRV  399

Query  420  KQR  428
            +QR
Sbjct  400  RQR  402



>ref|XP_010685504.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=398

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFEYLKE CP + +ELL+ VA   +  + A   S+ +   + DG DTN RRV
Sbjct  335  LAAVMRSDGFEYLKEHCPSLQSELLKTVAGCEDDCSSAGGKSRSVWAQLSDGGDTNDRRV  394

Query  420  KQR  428
            + R
Sbjct  395  RPR  397



>ref|XP_009366506.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=435

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA  +E  +  +K   +     DG DTN R V+QR
Sbjct  341  AVMESDGFEYLKENCPLLQSELLKTVAGCDEELSGGAKTRSVWAQFSDGGDTNDRSVRQR  400



>ref|XP_008386876.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Malus domestica]
Length=435

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA  +E  +   K   +     DG DTN R V+QR
Sbjct  341  AVMESDGFEYLKENCPLLQSELLKTVAGCDEELSGGGKTRSVWAQFSDGGDTNDRSVRQR  400



>ref|XP_002533853.1| Speckle-type POZ protein, putative [Ricinus communis]
 gb|EEF28528.1| Speckle-type POZ protein, putative [Ricinus communis]
Length=397

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRR  416
             AAVM++DGFEYLKE+CP + +ELL+ VA   E  +     S+ +   + DG DTNGRR
Sbjct  321  LAAVMRSDGFEYLKENCPLLQSELLKTVAGCEEECSSGGGKSRSVWAQLSDGGDTNGRR  379



>ref|XP_001772248.1| predicted protein [Physcomitrella patens]
 gb|EDQ62901.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA------SKLLKEAIQDGSDTNG  410
             AAVMQ++GFEYL++SCP + +ELL+ VA V E   +       ++ +   + DG+D +G
Sbjct  336  LAAVMQSEGFEYLRDSCPTLQSELLKTVAGVCEESVVTGVISNRNRSVWGQLSDGTDASG  395

Query  411  RRVKQR  428
            RRV+ R
Sbjct  396  RRVRPR  401



>gb|ACN26698.1| unknown [Zea mays]
Length=159

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEH--PAIASKLLKEAIQDGSDTNGRRVK  422
             +AV++T+GF+YLK++CP + +E+L  VA   E     + S+ +   + DG DT+GRRV+
Sbjct  97   LSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSSGVKSQSVWAQLSDGGDTSGRRVR  156

Query  423  QRL  431
             R+
Sbjct  157  PRV  159



>ref|XP_009353080.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Pyrus x bretschneideri]
Length=435

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA  +E  +   K   +     DG DTN R V+QR
Sbjct  341  AVMESDGFEYLKENCPLLQSELLKTVAGCDEELSGGEKTRSVWGQFSDGGDTNDRSVRQR  400



>ref|XP_006384724.1| hypothetical protein POPTR_0004s20530g [Populus trichocarpa]
 gb|ERP62521.1| hypothetical protein POPTR_0004s20530g [Populus trichocarpa]
Length=397

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM +DGF  LKE+CP + +ELL+ VA   E  +     S+ +   + DG DTNGRRV
Sbjct  334  LAAVMLSDGFANLKENCPLLQSELLKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTNGRRV  393

Query  420  KQR  428
            +QR
Sbjct  394  RQR  396



>ref|XP_011006172.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Populus euphratica]
Length=397

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM +DGF  LKE+CP + +ELL+ VA   E  +     S+ +   + DG DTNGRRV
Sbjct  334  LAAVMLSDGFANLKENCPLLQSELLKTVAGCEEDCSSGGGKSRSVWAQLSDGGDTNGRRV  393

Query  420  KQR  428
            +QR
Sbjct  394  RQR  396



>ref|XP_008391713.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Malus 
domestica]
Length=435

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA  +E  +   K   +     DG DTN R V+QR
Sbjct  341  AVMESDGFEYLKENCPLLQSELLKTVAGCDEELSGGEKTRSVWGQFSDGGDTNDRSVRQR  400



>ref|XP_011090255.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Sesamum 
indicum]
Length=403

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFEYLKE+ P + +ELL+ VA  ++  +     S+ +   + DG DT+GRRV
Sbjct  340  LAAVMRSDGFEYLKENYPALQSELLKTVAGCDDDCSSGGGKSRSVWAQLSDGGDTSGRRV  399

Query  420  KQR  428
            +QR
Sbjct  400  RQR  402



>gb|AAO72687.1| zinc finger POZ domain protein [Oryza sativa Japonica Group]
Length=183

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  121  LSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVR  180

Query  423  QRL  431
             R+
Sbjct  181  PRV  183



>ref|XP_009343027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=435

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA  +E  +  +K   +     DG +TN R V+QR
Sbjct  341  AVMESDGFEYLKENCPLLQSELLKTVAGCDEELSGGAKTRSVWAQFSDGGETNDRSVRQR  400



>ref|XP_003554047.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Glycine max]
 ref|XP_006604260.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=432

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG DTN R V+Q+
Sbjct  342  AVMQSDGFEYLKENCPLLQSELLKTVAGCEEEFSGEGKCRSVWAQFSDGGDTNDRSVRQQ  401



>gb|KHN34655.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=409

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG DTN R V+Q+
Sbjct  319  AVMQSDGFEYLKENCPLLQSELLKTVAGCEEEFSGEGKCRSVWAQFSDGGDTNDRSVRQQ  378



>ref|XP_010921383.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=402

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQ  425
            AAVM+++GF+YLK++CP + +ELL+ +A   E  +    S+ +   + DG+D++GRRV+ 
Sbjct  341  AAVMRSNGFQYLKDTCPSLQSELLKIIAGCEEECSSGEKSRSVWAQLSDGADSSGRRVRP  400

Query  426  RL  431
            R+
Sbjct  401  RM  402



>ref|XP_007161865.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
 ref|XP_007161866.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
 gb|ESW33859.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
 gb|ESW33860.1| hypothetical protein PHAVU_001G104500g [Phaseolus vulgaris]
Length=431

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG DTN R V+Q+
Sbjct  341  AVMQSDGFEYLKENCPLLQSELLKTVAGCEEEFSGEGKCRSVWAQFSDGGDTNDRSVRQQ  400



>gb|KDP39652.1| hypothetical protein JCGZ_02672 [Jatropha curcas]
Length=424

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDG  395
            + L +T     AVM++DGFEYLKE+CP + +ELL+ VA   E  +    S+ +     DG
Sbjct  326  VCLKFTAENLVAVMRSDGFEYLKENCPLLQSELLKTVAGCEEDCSGGGKSRSVWGQFSDG  385

Query  396  SDTNGRRVKQR  428
             DTN R V+Q+
Sbjct  386  DDTNDRSVRQQ  396



>ref|XP_003548681.2| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=508

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG DTN R V+Q+
Sbjct  418  AVMQSDGFEYLKENCPLLQSELLKTVAGCEEEFSGEGKCRSVWAQFSDGGDTNDRSVRQQ  477



>gb|AGV54250.1| BTB/POZ and MATH domain-containing protein 4-like protein [Phaseolus 
vulgaris]
Length=431

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG DTN R V+Q+
Sbjct  341  AVMQSDGFEYLKENCPLLQSELLKTVAGCEEEFSGEGKCRSVWAQFSDGGDTNDRSVRQQ  400



>dbj|BAJ93826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   I DG DT+GRRV+
Sbjct  378  LSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQISDGGDTSGRRVR  437

Query  423  QRL  431
             R+
Sbjct  438  PRV  440



>tpg|DAA51835.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=243

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEH--PAIASKLLKEAIQDGSDTNGRRVK  422
             +AV++T+GF+YLK++CP + +E+L  VA   E     + S+ +   + DG DT+GRRV+
Sbjct  181  LSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSSGVKSQSVWAQLSDGGDTSGRRVR  240

Query  423  QRL  431
             R+
Sbjct  241  PRV  243



>ref|XP_004149104.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004163287.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN53904.1| hypothetical protein Csa_4G187830 [Cucumis sativus]
Length=428

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +3

Query  228  LIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGS  398
            L +T     AVMQ+DGFE+LKE+CP + +ELL+ VA   +        S+ +     DG 
Sbjct  329  LKFTAENLVAVMQSDGFEFLKENCPLLQSELLKTVAGCEDEELSGGGKSRSVWAQFSDGG  388

Query  399  DTNGRRVKQR  428
            DTN R V+Q+
Sbjct  389  DTNDRSVRQQ  398



>ref|XP_008667501.1| PREDICTED: uncharacterized protein LOC100273191 isoform X1 [Zea 
mays]
 tpg|DAA51837.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=428

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEH--PAIASKLLKEAIQDGSDTNGRRVKQ  425
            +AV++T+GF+YLK++CP + +E+L  VA   E     + S+ +   + DG DT+GRRV+ 
Sbjct  367  SAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSSGVKSQSVWAQLSDGGDTSGRRVRP  426

Query  426  RL  431
            R+
Sbjct  427  RV  428



>ref|XP_008442027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Cucumis melo]
Length=428

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +3

Query  228  LIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGS  398
            L +T     AVMQ+DGFE+LKE+CP + +ELL+ VA   +        S+ +     DG 
Sbjct  329  LKFTAENLVAVMQSDGFEFLKENCPLLQSELLKTVAGCEDEELSGGGKSRSVWAQFSDGG  388

Query  399  DTNGRRVKQR  428
            DTN R V+Q+
Sbjct  389  DTNDRSVRQQ  398



>gb|ABK24368.1| unknown [Picea sitchensis]
Length=411

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVK  422
             A VM++ GFEYLKE CP + +ELL+ VA   +  +   K   +   + DG+D NGRRV+
Sbjct  349  LAGVMRSKGFEYLKEKCPLLQSELLKTVAHFEDDCSSGGKTRSVWAQLSDGTDINGRRVR  408

Query  423  QR  428
             R
Sbjct  409  PR  410



>dbj|BAJ90220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  369  LSAVIRTDGFDYLKDTCPSLQSEILRTVAGCEEPCSSGGKSQSVWGQLSDGGDTSGRRVR  428

Query  423  QRL  431
             R+
Sbjct  429  PRI  431



>ref|XP_002976951.1| hypothetical protein SELMODRAFT_443336 [Selaginella moellendorffii]
 ref|XP_002980693.1| hypothetical protein SELMODRAFT_420185 [Selaginella moellendorffii]
 gb|EFJ18344.1| hypothetical protein SELMODRAFT_420185 [Selaginella moellendorffii]
 gb|EFJ22061.1| hypothetical protein SELMODRAFT_443336 [Selaginella moellendorffii]
Length=413

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNE------HPAIASKLLKEAIQDGSDTNG  410
             AAV+Q+DGF+YLKESCP + +ELL  VA V         P    + +   + DG+D  G
Sbjct  346  LAAVIQSDGFDYLKESCPSLQSELLRTVAGVEGGDDDELRPGSKRRSVWTHLADGTDGTG  405

Query  411  RRVK  422
            RRV+
Sbjct  406  RRVR  409



>ref|XP_006651896.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like, 
partial [Oryza brachyantha]
Length=428

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQ  425
            +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+ 
Sbjct  367  SAVIRTDGFDYLKDNCPSLQSEILRTVAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVRP  426

Query  426  RL  431
            R+
Sbjct  427  RV  428



>gb|EAZ28871.1| hypothetical protein OsJ_12909 [Oryza sativa Japonica Group]
Length=415

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  353  LSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVR  412

Query  423  QRL  431
             R+
Sbjct  413  PRV  415



>gb|AFD04128.1| speckle-type POZ, partial [Triticum aestivum]
Length=426

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNE--HPAIASKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E       S+ +   + DG DT+GRRV+
Sbjct  364  LSAVIRTDGFDYLKDNCPSLQSEILRTVAGCEEPCSSGGKSQSVWGQLSDGGDTSGRRVR  423

Query  423  QRL  431
             R+
Sbjct  424  PRI  426



>gb|EMT28882.1| Speckle-type POZ protein [Aegilops tauschii]
Length=612

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  550  LSAVIRTDGFDYLKDNCPSLQSEILRTVAGCEEPCSSGGKSQSVWGQLSDGGDTSGRRVR  609

Query  423  QRL  431
             R+
Sbjct  610  PRI  612



>gb|EAY92144.1| hypothetical protein OsI_13855 [Oryza sativa Indica Group]
Length=430

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  368  LSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVR  427

Query  423  QRL  431
             R+
Sbjct  428  PRV  430



>gb|AAO37987.1| expressed protein [Oryza sativa Japonica Group]
Length=430

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  368  LSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVR  427

Query  423  QRL  431
             R+
Sbjct  428  PRV  430



>ref|XP_009411294.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=399

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AVM++ GFEYLK+ CP + +ELL+ +A  +E  +    ++ +   + DG D+NGRRV+
Sbjct  334  LSAVMRSSGFEYLKDHCPSLQSELLKIIAGCDEECSSGGNNRSVWAELSDGEDSNGRRVR  393

Query  423  QR  428
             R
Sbjct  394  PR  395



>ref|NP_001051524.1| Os03g0792500 [Oryza sativa Japonica Group]
 gb|ABF99301.1| BTB/POZ domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13438.1| Os03g0792500 [Oryza sativa Japonica Group]
 dbj|BAG91122.1| unnamed protein product [Oryza sativa Japonica Group]
Length=431

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   + DG DT+GRRV+
Sbjct  369  LSAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVR  428

Query  423  QRL  431
             R+
Sbjct  429  PRV  431



>ref|XP_002525692.1| BTB and MATH domain-containing protein, putative [Ricinus communis]
 gb|EEF36675.1| BTB and MATH domain-containing protein, putative [Ricinus communis]
Length=367

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA   E  +    S+ +     DG DTN R V+Q+
Sbjct  280  AVMRSDGFEYLKENCPLLQSELLKTVAGCEEEFSGGGKSRSVWAQFSDGDDTNDRSVRQQ  339



>ref|XP_003557540.2| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Brachypodium 
distachyon]
Length=547

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             +AV++T GF+YLK++CP + +E+L  VA   E P I+   S+ +   + DG DT+GRRV
Sbjct  485  LSAVIRTSGFDYLKDNCPALQSEILRTVAGCEE-PCISGGKSQSVWGQLSDGGDTSGRRV  543

Query  420  KQRL  431
            + R+
Sbjct  544  RPRI  547



>ref|NP_001140637.1| speckle-type POZ protein [Zea mays]
 gb|ACF84225.1| unknown [Zea mays]
 gb|AFW67396.1| speckle-type POZ protein [Zea mays]
 gb|AIB05410.1| orphans transcription factor, partial [Zea mays]
Length=428

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNE--HPAIASKLLKEAIQDGSDTNGRRVKQ  425
            +AV++T+GF+YLK++CP + +E+L  VA   E     + S+ +   + DG DT+GRRV+ 
Sbjct  367  SAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEPCSSGLKSQSVWAQLSDGGDTSGRRVRP  426

Query  426  RL  431
            R+
Sbjct  427  RV  428



>ref|XP_002325436.2| speckle-type POZ family protein [Populus trichocarpa]
 gb|EEE99817.2| speckle-type POZ family protein [Populus trichocarpa]
Length=357

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDG  395
            + L ++     AV+Q+DGFEYLKE+CP + +ELL+ VA   E  +    S+ +     DG
Sbjct  260  VCLKFSAENLVAVVQSDGFEYLKENCPLLQSELLKTVAGCEEDVSGGGKSRSVWAQFSDG  319

Query  396  SDTNGRRVKQ  425
             DTN R V+Q
Sbjct  320  GDTNDRSVRQ  329



>ref|XP_006371199.1| hypothetical protein POPTR_0019s05580g [Populus trichocarpa]
 gb|ERP48996.1| hypothetical protein POPTR_0019s05580g [Populus trichocarpa]
Length=426

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDG  395
            + L ++     AV+Q+DGFEYLKE+CP + +ELL+ VA   E  +    S+ +     DG
Sbjct  329  VCLKFSAENLVAVVQSDGFEYLKENCPLLQSELLKTVAGCEEDVSGGGKSRSVWAQFSDG  388

Query  396  SDTNGRRVKQ  425
             DTN R V+Q
Sbjct  389  GDTNDRSVRQ  398



>ref|XP_007015538.1| BTB/POZ and MATH domain-containing protein 4 isoform 3 [Theobroma 
cacao]
 gb|EOY33157.1| BTB/POZ and MATH domain-containing protein 4 isoform 3 [Theobroma 
cacao]
Length=402

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
            FAA    DGFEYLKE+CP + +ELL+ VA  +E  +    S+ +   + DG DT+GRRV+
Sbjct  341  FAAENLADGFEYLKENCPSLQSELLKTVAGCDEDRSSGGKSRSVWAQLSDG-DTSGRRVR  399

Query  423  QR  428
            QR
Sbjct  400  QR  401



>ref|XP_003545187.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Glycine max]
Length=396

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFE++KE  P + +E+L+ +A      + A   S+ +   + DG DTNGRRV
Sbjct  333  LAAVMRSDGFEHMKEKGPWLQSEILKTIAGGEGEGSSAVEKSQSVWGQLSDGGDTNGRRV  392

Query  420  KQRL  431
            +QR+
Sbjct  393  RQRI  396



>gb|KHM99118.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=361

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFE++KE  P + +E+L+ +A      + A   S+ +   + DG DTNGRRV
Sbjct  298  LAAVMRSDGFEHMKEKGPWLQSEILKTIAGGEGEGSSAVEKSQSVWGQLSDGGDTNGRRV  357

Query  420  KQRL  431
            +QR+
Sbjct  358  RQRI  361



>ref|XP_010106318.1| hypothetical protein L484_004717 [Morus notabilis]
 gb|EXC10032.1| hypothetical protein L484_004717 [Morus notabilis]
Length=75

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +3

Query  261  MQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
            M++DGFE+LKESCP + ++LL+ +A  ++  +     ++ +   + DG DTNGRRV
Sbjct  1    MRSDGFEHLKESCPSLQSDLLKIIAGCDDDCSSGGGKTRSVWAQLSDGGDTNGRRV  56



>ref|XP_002277148.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X2 [Vitis vinifera]
Length=411

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM+++GF YLKE+ P + +E+L+ VA   E  +     ++ +   + DG DTNGRRV
Sbjct  348  LAAVMRSEGFNYLKENFPALQSEILKTVAGCEEDCSSGGGKTRSVWAQLSDGGDTNGRRV  407

Query  420  KQR  428
            +QR
Sbjct  408  RQR  410



>ref|XP_006443499.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
 ref|XP_006479172.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Citrus sinensis]
 gb|ESR56739.1| hypothetical protein CICLE_v10020215mg [Citrus clementina]
Length=434

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQR  428
            AVM++DGF+YLKE+CP + +ELL+ VA  +E  +    S+ +     DG DTN R V+Q+
Sbjct  345  AVMRSDGFQYLKENCPLLQSELLKTVAGCDEEVSGWGKSRSVWAQFSDGDDTNDRSVRQQ  404



>ref|XP_006479173.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Citrus sinensis]
Length=434

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQR  428
            AVM++DGF+YLKE+CP + +ELL+ VA  +E  +    S+ +     DG DTN R V+Q+
Sbjct  345  AVMRSDGFQYLKENCPLLQSELLKTVAGCDEEVSGWGKSRSVWAQFSDGDDTNDRSVRQQ  404



>gb|KDO66064.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis]
Length=434

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQR  428
            AVM++DGF+YLKE+CP + +ELL+ VA  +E  +    S+ +     DG DTN R V+Q+
Sbjct  345  AVMRSDGFQYLKENCPLLQSELLKTVAGCDEEVSGWGKSRSVWAQFSDGDDTNDRSVRQQ  404



>ref|XP_001776409.1| predicted protein [Physcomitrella patens]
 gb|EDQ58793.1| predicted protein [Physcomitrella patens]
Length=396

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 8/67 (12%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKE-------AIQDGSDTN  407
             AAVM ++GFEYL++SCP + +ELL+ VA V E   + + ++          + DG+D  
Sbjct  330  LAAVMHSEGFEYLRDSCPTLQSELLKTVAGVYEE-GVGTGVISNRNRSVWGQMSDGADAG  388

Query  408  GRRVKQR  428
            GRRV+ R
Sbjct  389  GRRVRPR  395



>ref|XP_003624698.1| Speckle-type POZ protein [Medicago truncatula]
 gb|ABD28533.1| BTB/POZ; MATH [Medicago truncatula]
 gb|AES80916.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=422

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDGSDTNGRRVKQR  428
            AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +   + DG +TN R V+Q+
Sbjct  333  AVMQSDGFEYLKENCPLLQSELLKTVAGGEEEFSGEGKCRSVWAQVSDGGETNDRSVRQQ  392



>gb|EYU19944.1| hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata]
Length=408

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 14/83 (17%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIAS------------  365
            + L +       VMQ++GF +L+ESCP +L+ELLE VA V+E P   S            
Sbjct  325  ICLKFAATNLGVVMQSEGFRHLEESCPSLLSELLETVASVDEKPNSVSGNNKKRSGSSIF  384

Query  366  --KLLKEAIQDGSDTNGRRVKQR  428
               L  + + +  + NGRR+++R
Sbjct  385  GLDLAADGVAESVNPNGRRLRRR  407



>gb|ACG37150.1| speckle-type POZ protein [Zea mays]
Length=428

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNE--HPAIASKLLKEAIQDGSDTNGRRVKQ  425
            +AV++T+GF+YLK++CP + +E+L  VA   E     + S+ +   + DG DT GRRV+ 
Sbjct  367  SAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEPCSSGLKSQSVWAQLSDGGDTCGRRVRP  426

Query  426  RL  431
            R+
Sbjct  427  RV  428



>ref|XP_003617061.1| Speckle-type POZ protein [Medicago truncatula]
 gb|AET00020.1| BTB/POZ/MATH-domain protein [Medicago truncatula]
Length=407

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFE +KE CP + +E+L+ VA  +         S+ +   + DG DT GRRV
Sbjct  344  LAAVMRSDGFESMKEKCPWLQSEILKTVAGCDGDSCSTGEKSQSVWAQLSDGGDTIGRRV  403

Query  420  KQR  428
            +QR
Sbjct  404  RQR  406



>ref|XP_001783005.1| predicted protein [Physcomitrella patens]
 gb|EDQ52168.1| predicted protein [Physcomitrella patens]
Length=401

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 6/66 (9%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEH---PAIAS---KLLKEAIQDGSDTNG  410
             AAVM ++GFEYL++SCP + +ELL+ VA V E      + S   + +   + DG+D  G
Sbjct  335  LAAVMHSEGFEYLRDSCPTLQSELLKTVAGVYEEGVGTGVTSNRNRSVWGQLSDGADAGG  394

Query  411  RRVKQR  428
            RRV+ R
Sbjct  395  RRVRPR  400



>ref|XP_011001713.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing 
protein 4 [Populus euphratica]
Length=433

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASK--LLKEAIQDG  395
            + L ++     AV+Q+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG
Sbjct  336  VCLKFSAENLVAVVQSDGFEYLKENCPLLQSELLKTVAGCEEDVSGGGKNPSVWGQFSDG  395

Query  396  SDTNGRRVKQ  425
             DTN R ++Q
Sbjct  396  GDTNDRSIRQ  405



>ref|XP_010520490.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Tarenaya 
hassleriana]
Length=412

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHP-------AIASKLLKE  380
            + L +T    AAV+QT+G+EY+K+ CP++ +ELL+ VA   E            S+ +  
Sbjct  335  VCLRFTAENLAAVLQTEGYEYVKDHCPKLQSELLKTVAGYEEASISISCGGGGKSQSVWA  394

Query  381  AIQDGSDTNGRRVKQRL  431
             + DG DT+ RR +QR+
Sbjct  395  QLSDGGDTSSRRGRQRI  411



>ref|XP_010918008.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=415

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRR  416
             AAVM+++GF+YLK++CP + +ELL+ +A   E  +    S+ +   + DG D+NGRR
Sbjct  340  LAAVMRSNGFQYLKDNCPSLQSELLKIIAGCEEECSSGGKSRSVWAQLSDGGDSNGRR  397



>ref|XP_003632235.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform 
X1 [Vitis vinifera]
Length=423

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = +3

Query  246  CFA--AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNG  410
            CF   AVM+++GF YLKE+ P + +E+L+ VA   E  +     ++ +   + DG DTNG
Sbjct  357  CFWHLAVMRSEGFNYLKENFPALQSEILKTVAGCEEDCSSGGGKTRSVWAQLSDGGDTNG  416

Query  411  RRVKQR  428
            RRV+QR
Sbjct  417  RRVRQR  422



>emb|CBI24397.3| unnamed protein product [Vitis vinifera]
Length=405

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = +3

Query  246  CFA--AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNG  410
            CF   AVM+++GF YLKE+ P + +E+L+ VA   E  +     ++ +   + DG DTNG
Sbjct  339  CFWHLAVMRSEGFNYLKENFPALQSEILKTVAGCEEDCSSGGGKTRSVWAQLSDGGDTNG  398

Query  411  RRVKQR  428
            RRV+QR
Sbjct  399  RRVRQR  404



>ref|XP_010036255.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Eucalyptus 
grandis]
 gb|KCW47780.1| hypothetical protein EUGRSUZ_K01525 [Eucalyptus grandis]
 gb|KCW47781.1| hypothetical protein EUGRSUZ_K01525 [Eucalyptus grandis]
Length=428

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEH-PAIASKLLKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA   E      ++ +     DG++TN R ++Q+
Sbjct  339  AVMRSDGFEYLKENCPSLQSELLKTVAGCEEQVSGGGNRSVFAQFSDGNETNDRSIRQQ  397



>gb|KHG25171.1| BTB/POZ and MATH domain-containing 4 -like protein [Gossypium 
arboreum]
Length=467

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQ  425
            +AVM++DGFEYLKE+CP + +ELL+ VA   E  +    S+ +   + DG DT  R V+Q
Sbjct  377  SAVMRSDGFEYLKENCPTLQSELLKTVAGCEEEFSGGGKSRSVWAHLSDGGDTINRSVRQ  436

Query  426  R  428
            +
Sbjct  437  Q  437



>ref|XP_006657481.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Oryza brachyantha]
Length=426

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++T+GF+YLK++CP + +E+L  +A   E  +    S+ +   + DG DT+GRRV+
Sbjct  364  LSAVIRTEGFDYLKDNCPSLQSEILRTLAGCEEECSSGGKSQSVWAQLSDGGDTSGRRVR  423

Query  423  QRL  431
             R+
Sbjct  424  PRI  426



>ref|XP_009411295.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009411297.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=393

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRV  419
             +AVM++ GFEYLK+ CP + +ELL+ +A  +E  +    ++ +   + DG D+NGRRV
Sbjct  334  LSAVMRSSGFEYLKDHCPSLQSELLKIIAGCDEECSSGGNNRSVWAELSDGEDSNGRRV  392



>ref|XP_010923233.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
[Elaeis guineensis]
Length=411

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKLLKEA------IQDGSDTNG  410
              AVMQT+GF YL+ +CP +L++LL  VA V++  +  S+    +      + D  D NG
Sbjct  345  LGAVMQTEGFNYLEATCPSLLSDLLATVAVVDDDSSPISRKRSGSSNIGLNLMDSVDLNG  404

Query  411  RRVKQRL  431
            RR+K+R+
Sbjct  405  RRMKRRM  411



>gb|KHN38451.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja]
Length=272

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA---SKLLKEAIQDGSDTNGRRV  419
             AAVM++DGFE++KE  P + +E+L+ +A        A   S+ +   + DG D NGRRV
Sbjct  209  LAAVMRSDGFEHMKEKGPWLQSEILKTIAGCEGDGCSAVEKSQSVWGQLSDGGDMNGRRV  268

Query  420  KQRL  431
            +QR+
Sbjct  269  RQRI  272



>ref|XP_008789435.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
isoform X1 [Phoenix dactylifera]
Length=402

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             AAVM+++GF+YL+++CP + +ELL+ +A   E  +    S+ +   + D  D+NGRRV+
Sbjct  340  LAAVMRSNGFQYLQDNCPSLQSELLKIIAGCEEECSSGGKSRSVWAQLSDDGDSNGRRVR  399

Query  423  QR  428
             R
Sbjct  400  PR  401



>ref|XP_007163464.1| hypothetical protein PHAVU_001G236400g [Phaseolus vulgaris]
 gb|ESW35458.1| hypothetical protein PHAVU_001G236400g [Phaseolus vulgaris]
Length=414

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 12/71 (17%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAI-------ASKLLKEAIQDGSDT--  404
             AVMQ++ F +LKESCP +L ELLE  A V+++ ++        S +  + + DG+ T  
Sbjct  343  GAVMQSEAFVHLKESCPAMLLELLETFASVDDNSSLTLSRKRSGSSIYAQDLADGAATES  402

Query  405  ---NGRRVKQR  428
               NGRRV++R
Sbjct  403  VNPNGRRVRRR  413



>ref|XP_009400061.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=402

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +3

Query  228  LIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASK--LLKEAIQDGSD  401
            L ++     AVM++ GF +LKE+CP + +ELL+ +A   +  +   K   +   + DG D
Sbjct  333  LKFSAENLGAVMRSSGFRHLKENCPSLQSELLKIIAGAGDESSDGGKDRSVWAQLSDGGD  392

Query  402  TNGRRVKQRL  431
            ++GRRV+ RL
Sbjct  393  SSGRRVRPRL  402



>gb|EMT17722.1| Speckle-type POZ protein [Aegilops tauschii]
Length=818

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +3

Query  252  AAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRV  419
            +AV++TDGF+YLK++CP + +E+L  VA   E  +    S+ +   I DG DT+GRR+
Sbjct  759  SAVIRTDGFDYLKDNCPALQSEILRTVAGCEEECSSGGKSQSVWGQISDGGDTSGRRI  816



>ref|XP_007029995.1| BTB-POZ and MATH domain 4 isoform 1 [Theobroma cacao]
 gb|EOY10497.1| BTB-POZ and MATH domain 4 isoform 1 [Theobroma cacao]
Length=423

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  255  AVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVKQR  428
            AVM++DGFEYLKE+CP + +ELL+ VA   E  +    S+ +     DG DT  R V+Q+
Sbjct  334  AVMRSDGFEYLKENCPSLQSELLKTVAGCEEEFSGGGKSRSVWAQFSDGGDTIDRSVRQQ  393



>gb|EMS49890.1| BTB/POZ and MATH domain-containing protein 4 [Triticum urartu]
Length=495

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNE--HPAIASKLLKEAIQDGSDTNGRRVK  422
             +AV++TDGF+ LK++CP + +E+L  VA   E       S+ +   + DG DT+GRRV+
Sbjct  433  LSAVIRTDGFDCLKDNCPSLQSEILRTVAGCEEPCSSGGKSQSVWGQLSDGGDTSGRRVR  492

Query  423  QRL  431
             R+
Sbjct  493  PRI  495



>ref|NP_001058976.1| Os07g0167200 [Oryza sativa Japonica Group]
 dbj|BAC07391.1| putative zinc finger POZ domain protein [Oryza sativa Japonica 
Group]
 dbj|BAF20890.1| Os07g0167200 [Oryza sativa Japonica Group]
 gb|EEC81579.1| hypothetical protein OsI_25033 [Oryza sativa Indica Group]
 gb|EEE66629.1| hypothetical protein OsJ_23221 [Oryza sativa Japonica Group]
Length=424

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIA--SKLLKEAIQDGSDTNGRRVK  422
             +AV++T+GF+YLK++CP + +E+L  +A   E  +    S+ +   + DG DT+GRRV+
Sbjct  362  LSAVIRTEGFDYLKDNCPSLQSEILRTLAGCEEECSSGGKSQSVWGQLSDGGDTSGRRVR  421

Query  423  QR  428
             R
Sbjct  422  PR  423



>ref|XP_004239913.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 13/84 (15%)
 Frame = +3

Query  108  QNLDVDTCIGTHMKKVAYQCPPHQRVKFWSPYSRTPL*MALIYTEYCFAAVMQTDGFEYL  287
            + ++VDT   T      ++CP  + +              L +       VMQ DGF++L
Sbjct  300  EEVNVDTVATTLSLAEQHRCPQLKAI-------------CLKFAATNLGVVMQKDGFKHL  346

Query  288  KESCPRVLTELLEYVARVNEHPAI  359
            +ESCP +L+ELLE VA V+E P++
Sbjct  347  EESCPLLLSELLETVASVDEKPSL  370



>ref|XP_004493213.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like 
[Cicer arietinum]
Length=442

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +3

Query  222  MALIYTEYCFAAVMQTDGFEYLKESCPRVLTELLEYVARVNEHPAIASKL--LKEAIQDG  395
            + L ++     AVMQ+DGFEYLKE+CP + +ELL+ VA   E  +   K   +     DG
Sbjct  342  ICLQFSAENLVAVMQSDGFEYLKENCPLLQSELLKTVAGCEEEFSGEGKCRSVWAQFSDG  401

Query  396  SDTNGRRVKQR  428
             + N R V+Q+
Sbjct  402  VEDNDRSVRQQ  412



>ref|NP_001141107.1| uncharacterized protein LOC100273191 [Zea mays]
 gb|ACF85419.1| unknown [Zea mays]
 tpg|DAA51838.1| TPA: hypothetical protein ZEAMMB73_694112 [Zea mays]
Length=427

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +3

Query  249  FAAVMQTDGFEYLKESCPRVLTELLEYVARVNEH--PAIASKLLKEAIQDGSDTNGRR  416
             +AV++T+GF+YLK++CP + +E+L  VA   E     + S+ +   + DG DT+GRR
Sbjct  366  LSAVIRTEGFDYLKDNCPSLQSEILRTVAGCEEQCSSGVKSQSVWAQLSDGGDTSGRR  423



>ref|XP_006355691.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like 
isoform X1 [Solanum tuberosum]
Length=408

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 13/84 (15%)
 Frame = +3

Query  108  QNLDVDTCIGTHMKKVAYQCPPHQRVKFWSPYSRTPL*MALIYTEYCFAAVMQTDGFEYL  287
            + ++VDT   T      ++CP  + +              L +       VMQ DGF++L
Sbjct  300  EEVNVDTVATTLSLAEQHRCPQLKAI-------------CLKFAATNLGVVMQKDGFKHL  346

Query  288  KESCPRVLTELLEYVARVNEHPAI  359
            +ESCP +L+ELLE VA V+E P++
Sbjct  347  EESCPLLLSELLETVASVDEKPSL  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1259863733868