BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25035_g2_i7 len=830 path=[2992:0-111 3104:112-135 3128:136-155
3148:156-176 3169:177-217 3209:218-222 3214:223-256 7202:257-311
3273:312-312 3274:313-344 13393:345-346 13252:347-361 5403:362-362
2036:363-398 13462:399-400 11984:401-423 3384:424-484 13517:485-496
12752:497-509 3470:510-533 3494:534-578 3538:579-601 96:602-628
13575:629-640 13186:641-650 389:651-695 13610:696-704 939:705-751
986:752-764 502:765-784 522:785-805 543:806-817 13672:818-829]

Length=830
                                                                      Score     E

ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    276   2e-88   Vitis vinifera
emb|CBI28276.3|  unnamed protein product                                278   4e-88   
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    265   6e-84   Vitis vinifera
ref|XP_006384780.1|  alcohol dehydroge family protein                   261   1e-82   
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             261   2e-82   
gb|AFK37606.1|  unknown                                                 260   4e-82   
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             259   9e-82   
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                258   1e-81   
gb|AFK46966.1|  unknown                                                 258   2e-81   
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   2e-81   
ref|XP_011088939.1|  PREDICTED: secoisolariciresinol dehydrogenas...    253   1e-79   
emb|CAN68176.1|  hypothetical protein VITISV_014635                     253   2e-79   Vitis vinifera
ref|XP_010246229.1|  PREDICTED: secoisolariciresinol dehydrogenas...    253   3e-79   
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    252   5e-79   
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   6e-79   
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   6e-79   
emb|CBI28275.3|  unnamed protein product                                266   1e-78   
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   1e-78   
ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   1e-78   
ref|XP_003540812.1|  PREDICTED: secoisolariciresinol dehydrogenase      251   1e-78   
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   5e-78   
gb|KEH29814.1|  short-chain dehydrogenase/reductase                     248   8e-78   
ref|XP_011089208.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   1e-77   
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   2e-77   Vitis vinifera
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    248   2e-77   
gb|KHN21175.1|  Momilactone A synthase                                  248   6e-77   
ref|XP_006481514.1|  PREDICTED: secoisolariciresinol dehydrogenas...    246   9e-77   
ref|XP_004506206.1|  PREDICTED: momilactone A synthase-like             246   1e-76   
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    246   1e-76   
gb|KEH29817.1|  short-chain dehydrogenase/reductase                     245   2e-76   
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    246   2e-76   
ref|XP_010040330.1|  PREDICTED: secoisolariciresinol dehydrogenas...    244   3e-76   
ref|XP_003538100.1|  PREDICTED: secoisolariciresinol dehydrogenase      244   3e-76   
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             244   4e-76   
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             244   7e-76   
ref|XP_009388139.1|  PREDICTED: momilactone A synthase-like             242   1e-75   
ref|XP_006481516.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   1e-75   
ref|XP_010040326.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   2e-75   
gb|AFK35915.1|  unknown                                                 243   2e-75   
ref|XP_006481517.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   2e-75   
ref|XP_006424148.1|  hypothetical protein CICLE_v10029025mg             243   2e-75   
ref|XP_007207105.1|  hypothetical protein PRUPE_ppa020955mg             242   2e-75   
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    242   2e-75   
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             243   3e-75   
gb|ACU18273.1|  unknown                                                 242   4e-75   Glycine max [soybeans]
ref|XP_010070261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   8e-75   
ref|XP_010049793.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   9e-75   
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    240   2e-74   
ref|XP_006388114.1|  alcohol dehydroge family protein                   240   2e-74   
gb|KDP34951.1|  hypothetical protein JCGZ_09239                         238   7e-74   
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   8e-74   
gb|KDP34955.1|  hypothetical protein JCGZ_09243                         238   1e-73   
gb|KEH29815.1|  short-chain dehydrogenase/reductase                     238   1e-73   
ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   1e-73   
ref|XP_006481515.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   2e-73   
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    236   4e-73   
gb|KDP34949.1|  hypothetical protein JCGZ_09237                         236   5e-73   
gb|KCW45306.1|  hypothetical protein EUGRSUZ_L01036                     235   5e-73   
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    236   8e-73   
gb|KHN21176.1|  Momilactone A synthase                                  236   9e-73   
ref|XP_002523859.1|  short chain alcohol dehydrogenase, putative        236   1e-72   Ricinus communis
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    235   1e-72   
gb|KHN11533.1|  Momilactone A synthase                                  235   2e-72   
ref|XP_006424147.1|  hypothetical protein CICLE_v10029025mg             234   3e-72   
gb|KHN21177.1|  Momilactone A synthase                                  236   4e-72   
gb|KCW58914.1|  hypothetical protein EUGRSUZ_H01537                     233   4e-72   
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       234   4e-72   
emb|CDP06869.1|  unnamed protein product                                234   7e-72   
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    233   1e-71   
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             233   1e-71   
ref|XP_007132471.1|  hypothetical protein PHAVU_011G096800g             233   1e-71   
ref|NP_001239862.1|  uncharacterized protein LOC100794412               233   1e-71   
ref|XP_003546632.1|  PREDICTED: secoisolariciresinol dehydrogenas...    232   3e-71   
ref|XP_007132474.1|  hypothetical protein PHAVU_011G097100g             232   3e-71   
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         232   3e-71   
gb|AEC10992.1|  alcohol dehydrogenase                                   232   4e-71   
gb|KCW83006.1|  hypothetical protein EUGRSUZ_C04389                     231   4e-71   
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       232   4e-71   
ref|XP_010050120.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   6e-71   
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    231   7e-71   Populus trichocarpa [western balsam poplar]
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         231   8e-71   
ref|XP_011094269.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   2e-70   
gb|KCW83009.1|  hypothetical protein EUGRSUZ_C04391                     229   4e-70   
ref|XP_010051779.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   5e-70   
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             228   9e-70   
emb|CDP06868.1|  unnamed protein product                                228   1e-69   
gb|ACU19531.1|  unknown                                                 227   2e-69   Glycine max [soybeans]
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 227   3e-69   
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    227   3e-69   
emb|CDP06870.1|  unnamed protein product                                226   4e-69   
ref|XP_002523206.1|  short chain alcohol dehydrogenase, putative        226   6e-69   Ricinus communis
ref|XP_007132473.1|  hypothetical protein PHAVU_011G097000g             225   1e-68   
dbj|BAC53872.1|  alcohol dehydroge                                      225   1e-68   Phaseolus lunatus
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             225   2e-68   
dbj|BAA13541.1|  CPRD12 protein                                         224   2e-68   Vigna unguiculata
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      225   2e-68   Cucumis sativus [cucumbers]
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             224   2e-68   
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         224   3e-68   
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       224   4e-68   
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   5e-68   
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         223   6e-68   
gb|AAK83035.1|AF286650_1  CTA                                           222   2e-67   Cucumis sativus [cucumbers]
ref|XP_009605456.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   2e-67   
ref|XP_010104810.1|  Momilactone A synthase                             222   2e-67   
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    222   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009605454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   2e-67   
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   3e-67   
emb|CDP06872.1|  unnamed protein product                                224   3e-67   
ref|XP_003632648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   4e-67   
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    221   4e-67   
ref|XP_009605455.1|  PREDICTED: secoisolariciresinol dehydrogenas...    220   6e-67   
ref|XP_002281462.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   6e-67   Vitis vinifera
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             221   7e-67   
ref|XP_007043248.1|  Short chain alcohol dehydrogenase                  220   1e-66   
emb|CAN78993.1|  hypothetical protein VITISV_001799                     224   1e-66   Vitis vinifera
ref|XP_010917564.1|  PREDICTED: momilactone A synthase-like             220   1e-66   
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    219   2e-66   
dbj|BAE72097.1|  Lactuca sativa short-chain dehydrogenase/reducta...    219   3e-66   Lactuca sativa [cultivated lettuce]
ref|XP_010061228.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   4e-66   
ref|XP_010061227.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   8e-66   
ref|XP_009773000.1|  PREDICTED: secoisolariciresinol dehydrogenas...    218   9e-66   
ref|XP_010104809.1|  Momilactone A synthase                             218   1e-65   
ref|XP_010059374.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-65   
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             218   2e-65   
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   217   2e-65   
ref|XP_007043243.1|  Short chain alcohol dehydrogenase                  217   2e-65   
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    216   3e-65   
ref|XP_004169912.1|  PREDICTED: short-chain dehydrogenase reducta...    216   4e-65   
ref|XP_011094266.1|  PREDICTED: secoisolariciresinol dehydrogenas...    216   4e-65   
ref|XP_006362152.1|  PREDICTED: secoisolariciresinol dehydrogenas...    216   5e-65   
gb|KDO58270.1|  hypothetical protein CISIN_1g044923mg                   214   5e-65   
gb|KDP34947.1|  hypothetical protein JCGZ_09235                         214   6e-65   
ref|XP_002309405.1|  alcohol dehydroge family protein                   216   6e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002308448.2|  alcohol dehydroge family protein                   216   6e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004244887.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   1e-64   
ref|XP_010246261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   2e-64   
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             214   2e-64   
ref|XP_010104811.1|  Momilactone A synthase                             214   2e-64   
ref|XP_010324818.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   2e-64   
ref|XP_011046907.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   2e-64   
ref|XP_010246256.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   4e-64   
ref|XP_004136700.1|  PREDICTED: momilactone A synthase-like             213   5e-64   
ref|XP_006367118.1|  PREDICTED: secoisolariciresinol dehydrogenas...    213   8e-64   
ref|XP_011094268.1|  PREDICTED: secoisolariciresinol dehydrogenas...    213   9e-64   
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            213   9e-64   
gb|KGN59171.1|  hypothetical protein Csa_3G778270                       213   1e-63   
ref|XP_004139590.1|  PREDICTED: short-chain dehydrogenase reducta...    212   1e-63   
ref|XP_006651946.1|  PREDICTED: zerumbone synthase-like                 213   1e-63   
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      212   1e-63   
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    212   2e-63   
ref|XP_007027908.1|  Short chain alcohol dehydrogenase, putative        212   2e-63   
gb|ADK56099.1|  alcohol dehydrogenase                                   211   4e-63   
ref|XP_003539841.1|  PREDICTED: secoisolariciresinol dehydrogenase      211   5e-63   
gb|ACU18308.1|  unknown                                                 211   5e-63   Glycine max [soybeans]
ref|XP_006367119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    210   8e-63   
ref|XP_002275723.3|  PREDICTED: secoisolariciresinol dehydrogenas...    210   1e-62   Vitis vinifera
ref|XP_008442883.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   1e-62   
gb|EMS67256.1|  Xanthoxin dehydrogenase                                 211   2e-62   
gb|AFV30207.1|  borneol dehydrogenase                                   209   2e-62   
gb|ABS87381.1|  short-chain dehydrogenase/reductase protein             209   2e-62   Lactuca sativa [cultivated lettuce]
gb|KCW90500.1|  hypothetical protein EUGRSUZ_A02619                     209   2e-62   
ref|XP_011094267.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   2e-62   
ref|XP_006338927.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   3e-62   
ref|XP_004981321.1|  PREDICTED: zerumbone synthase-like                 209   3e-62   
ref|XP_009399160.1|  PREDICTED: momilactone A synthase-like             208   4e-62   
ref|XP_009590019.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   4e-62   
ref|XP_009605329.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   4e-62   
ref|XP_004981317.1|  PREDICTED: zerumbone synthase-like                 210   5e-62   
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    208   5e-62   
ref|XP_011046906.1|  PREDICTED: secoisolariciresinol dehydrogenas...    208   6e-62   
emb|CAA11153.1|  short chain alcohol dehydrogenase                      208   6e-62   Nicotiana tabacum [American tobacco]
gb|KHG10215.1|  hypothetical protein F383_13541                         208   6e-62   
gb|KGN59172.1|  hypothetical protein Csa_3G778280                       208   6e-62   
ref|XP_009350131.1|  PREDICTED: secoisolariciresinol dehydrogenas...    208   7e-62   
ref|XP_007152489.1|  hypothetical protein PHAVU_004G135000g             207   7e-62   
ref|XP_010104812.1|  Momilactone A synthase                             207   8e-62   
gb|EMT02624.1|  Xanthoxin dehydrogenase                                 208   8e-62   
ref|XP_002466226.1|  hypothetical protein SORBIDRAFT_01g003880          208   8e-62   Sorghum bicolor [broomcorn]
ref|XP_010654128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    208   9e-62   
ref|XP_007152499.1|  hypothetical protein PHAVU_004G135300g             207   9e-62   
ref|XP_009420509.1|  PREDICTED: momilactone A synthase-like             207   1e-61   
ref|XP_002281290.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   1e-61   Vitis vinifera
ref|XP_008243484.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   1e-61   
ref|XP_002309404.1|  alcohol dehydroge family protein                   207   1e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009631422.1|  PREDICTED: xanthoxin dehydrogenase-like            207   2e-61   
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        206   3e-61   
ref|XP_002530513.1|  short chain alcohol dehydrogenase, putative        204   3e-61   Ricinus communis
ref|XP_002281352.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   4e-61   Vitis vinifera
ref|XP_010931582.1|  PREDICTED: LOW QUALITY PROTEIN: zerumbone sy...    206   4e-61   
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          206   4e-61   
ref|XP_010922188.1|  PREDICTED: zerumbone synthase-like                 206   5e-61   
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   6e-61   
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    206   6e-61   Forsythia x intermedia [cultivated forsythia]
ref|XP_002530176.1|  short chain alcohol dehydrogenase, putative        207   7e-61   Ricinus communis
ref|XP_007027905.1|  Short chain alcohol dehydrogenase, putative        205   7e-61   
ref|XP_008643649.1|  PREDICTED: short chain alcohol dehydrogenase...    205   8e-61   
ref|XP_010654129.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   1e-60   
ref|XP_004237829.1|  PREDICTED: xanthoxin dehydrogenase-like            205   1e-60   
ref|XP_010059357.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   1e-60   
emb|CBI18081.3|  unnamed protein product                                205   1e-60   
ref|XP_008808776.1|  PREDICTED: zerumbone synthase                      204   2e-60   
ref|XP_009618308.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   2e-60   
ref|XP_002526911.1|  short chain alcohol dehydrogenase, putative        204   2e-60   Ricinus communis
ref|XP_003563948.1|  PREDICTED: zerumbone synthase isoform X2           204   2e-60   
ref|XP_010654127.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   2e-60   
ref|XP_010227919.1|  PREDICTED: zerumbone synthase isoform X1           204   2e-60   
ref|XP_011046905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   3e-60   
emb|CDP20435.1|  unnamed protein product                                204   3e-60   
ref|XP_002275746.2|  PREDICTED: secoisolariciresinol dehydrogenas...    203   6e-60   Vitis vinifera
ref|XP_004305640.1|  PREDICTED: momilactone A synthase-like             203   6e-60   
ref|XP_007202842.1|  hypothetical protein PRUPE_ppa014608mg             202   6e-60   
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       203   6e-60   
ref|XP_004228706.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   7e-60   
ref|XP_009768564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   8e-60   
ref|XP_002530171.1|  short chain alcohol dehydrogenase, putative        203   8e-60   Ricinus communis
gb|KDP36096.1|  hypothetical protein JCGZ_08740                         202   9e-60   
ref|XP_011046902.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   9e-60   
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         202   1e-59   
ref|XP_011046903.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   1e-59   
ref|XP_004143392.1|  PREDICTED: zerumbone synthase-like                 202   1e-59   
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    203   1e-59   Vitis vinifera
ref|XP_004170965.1|  PREDICTED: zerumbone synthase-like                 202   1e-59   
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    203   1e-59   
gb|KDP36168.1|  hypothetical protein JCGZ_08812                         202   1e-59   
gb|KDP36152.1|  hypothetical protein JCGZ_08796                         202   1e-59   
sp|F1SWA0.1|ZERSY_ZINZE  RecName: Full=Zerumbone synthase               202   1e-59   
ref|XP_009592996.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   2e-59   
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    201   2e-59   
emb|CDP02837.1|  unnamed protein product                                203   2e-59   
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    201   3e-59   
ref|XP_010024677.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   3e-59   
gb|KDP32262.1|  hypothetical protein JCGZ_14783                         201   3e-59   
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    202   3e-59   
gb|KDP36166.1|  hypothetical protein JCGZ_08810                         201   3e-59   
ref|XP_009776711.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   4e-59   
gb|ACG37730.1|  sex determination protein tasselseed-2                  201   4e-59   Zea mays [maize]
ref|XP_008392031.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   4e-59   
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    201   5e-59   
ref|NP_001148513.1|  short chain alcohol dehydrogenase1                 199   5e-59   Zea mays [maize]
gb|KHG08861.1|  Xanthoxin dehydrogenase -like protein                   201   5e-59   
ref|NP_001275184.1|  short-chain dehydrogenase/reductase                200   6e-59   
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    201   6e-59   
ref|XP_006428245.1|  hypothetical protein CICLE_v10012415mg             200   7e-59   
ref|XP_009802753.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   8e-59   
ref|XP_009395947.1|  PREDICTED: zerumbone synthase                      200   9e-59   
ref|XP_006468252.1|  PREDICTED: short-chain dehydrogenase reducta...    201   1e-58   
gb|KDP42340.1|  hypothetical protein JCGZ_02813                         199   1e-58   
ref|XP_006424146.1|  hypothetical protein CICLE_v10030340mg             200   1e-58   
ref|XP_009618318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   1e-58   
ref|XP_002309402.2|  hypothetical protein POPTR_0006s22270g             199   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    200   1e-58   Vitis vinifera
ref|XP_002323404.1|  alcohol dehydroge family protein                   199   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010312221.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   2e-58   
ref|XP_006339150.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   2e-58   
ref|XP_010312220.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   2e-58   
ref|XP_008360614.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   2e-58   
ref|XP_006339148.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   2e-58   
gb|KDP25017.1|  hypothetical protein JCGZ_24000                         199   3e-58   
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   3e-58   
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    199   3e-58   
ref|NP_001275796.1|  short chain alcohol dehydrogenase                  199   3e-58   
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        199   3e-58   Ricinus communis
ref|XP_010917566.1|  PREDICTED: momilactone A synthase-like isofo...    197   3e-58   
ref|XP_006577090.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   5e-58   
ref|XP_010094675.1|  Sex determination protein tasselseed-2             201   5e-58   
gb|KDO36906.1|  hypothetical protein CISIN_1g040531mg                   198   5e-58   
ref|XP_010246244.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   6e-58   
gb|KDP36167.1|  hypothetical protein JCGZ_08811                         197   6e-58   
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    199   7e-58   
ref|XP_004499827.1|  PREDICTED: xanthoxin dehydrogenase-like            197   7e-58   
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   8e-58   
gb|KCW90498.1|  hypothetical protein EUGRSUZ_A02616                     197   1e-57   
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             197   1e-57   
gb|KHN33174.1|  Momilactone A synthase                                  198   1e-57   
gb|AFK45740.1|  unknown                                                 197   1e-57   
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      197   1e-57   
ref|XP_007204705.1|  hypothetical protein PRUPE_ppa009636mg             197   2e-57   
ref|XP_004249781.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   2e-57   
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             197   2e-57   
gb|EAY92297.1|  hypothetical protein OsI_14018                          196   2e-57   
ref|XP_011091814.1|  PREDICTED: xanthoxin dehydrogenase                 196   2e-57   
ref|NP_001051666.1|  Os03g0810800                                       196   2e-57   
ref|XP_007008811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    196   2e-57   
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             196   2e-57   
gb|KDP36159.1|  hypothetical protein JCGZ_08803                         196   2e-57   
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    197   3e-57   
ref|XP_002513344.1|  short chain alcohol dehydrogenase, putative        196   3e-57   
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      197   3e-57   
ref|XP_002297758.1|  GLUCOSE INSENSITIVE 1 family protein               196   4e-57   
gb|KDP36097.1|  hypothetical protein JCGZ_08741                         196   4e-57   
ref|XP_006431968.1|  hypothetical protein CICLE_v10003833mg             195   5e-57   
ref|XP_006361611.1|  PREDICTED: secoisolariciresinol dehydrogenas...    196   6e-57   
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    196   6e-57   
ref|XP_002323403.1|  alcohol dehydroge family protein                   195   7e-57   
gb|KDP32981.1|  hypothetical protein JCGZ_13012                         194   7e-57   
ref|XP_010314459.1|  PREDICTED: uncharacterized protein LOC100750...    195   7e-57   
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    196   8e-57   
ref|XP_002530170.1|  short chain alcohol dehydrogenase, putative        195   8e-57   
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    196   8e-57   
ref|XP_002513092.1|  short chain alcohol dehydrogenase, putative        195   9e-57   
gb|KEH24184.1|  short-chain dehydrogenase/reductase                     192   1e-56   
gb|KDP36160.1|  hypothetical protein JCGZ_08804                         194   1e-56   
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    195   1e-56   
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          194   1e-56   
ref|XP_011094346.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   2e-56   
ref|XP_008243483.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   2e-56   
gb|ADD70246.1|  secoisolariciresinol dehydrogenase                      194   2e-56   
gb|ACB87357.1|  secoisolariciresinol dehydrogenase                      194   2e-56   
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    194   2e-56   
gb|AHL21380.1|  secoisolariciresinol reductase                          194   2e-56   
ref|XP_003554452.1|  PREDICTED: secoisolariciresinol dehydrogenase      194   2e-56   
gb|KDP37624.1|  hypothetical protein JCGZ_06967                         194   2e-56   
ref|XP_006360738.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   3e-56   
ref|XP_010922187.1|  PREDICTED: zerumbone synthase-like                 194   3e-56   
ref|XP_003554453.1|  PREDICTED: secoisolariciresinol dehydrogenas...    193   3e-56   
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             193   3e-56   
ref|XP_011041828.1|  PREDICTED: short-chain dehydrogenase reducta...    194   4e-56   
gb|AFL56690.1|  ADH1                                                    193   4e-56   
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             193   4e-56   
ref|XP_006383023.1|  hypothetical protein POPTR_0005s10820g             190   5e-56   
gb|ACU23500.1|  unknown                                                 193   5e-56   
ref|XP_006361612.1|  PREDICTED: secoisolariciresinol dehydrogenas...    193   5e-56   
emb|CDO98188.1|  unnamed protein product                                193   6e-56   
gb|KDP36157.1|  hypothetical protein JCGZ_08801                         192   7e-56   
ref|XP_009789920.1|  PREDICTED: xanthoxin dehydrogenase-like            192   7e-56   
gb|ABK24197.1|  unknown                                                 192   1e-55   
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    193   1e-55   
gb|EYU42960.1|  hypothetical protein MIMGU_mgv1a011480mg                191   2e-55   
gb|ABD65462.1|  short chain alcohol dehydrogenase                       191   2e-55   
ref|XP_006354216.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   2e-55   
ref|XP_006591160.1|  PREDICTED: xanthoxin dehydrogenase-like            191   3e-55   
ref|XP_002325666.2|  hypothetical protein POPTR_0019s14650g             191   3e-55   
dbj|BAE72096.1|  Lactuca sativa short-chain dehydrogenase/reducta...    191   3e-55   
sp|Q94KL8.1|SILD_PODPE  RecName: Full=Secoisolariciresinol dehydr...    191   3e-55   
ref|XP_009618506.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   3e-55   
gb|KHN13691.1|  Xanthoxin dehydrogenase                                 191   3e-55   
ref|XP_006361625.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   4e-55   
ref|XP_004252563.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   4e-55   
ref|XP_004237828.1|  PREDICTED: xanthoxin dehydrogenase-like            190   4e-55   
ref|XP_008782768.1|  PREDICTED: sex determination protein tassels...    190   4e-55   
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         191   4e-55   
gb|ABN14311.1|  secoisolariciresinol dehydrogenase                      190   5e-55   
ref|XP_010551306.1|  PREDICTED: xanthoxin dehydrogenase                 190   5e-55   
ref|XP_006354115.1|  PREDICTED: secoisolariciresinol dehydrogenas...    190   5e-55   
ref|XP_007148993.1|  hypothetical protein PHAVU_005G031500g             190   5e-55   
ref|XP_010102621.1|  Sex determination protein tasselseed-2             191   7e-55   
ref|XP_008367851.1|  PREDICTED: xanthoxin dehydrogenase-like            190   7e-55   
ref|XP_002527336.1|  short chain alcohol dehydrogenase, putative        190   7e-55   
ref|XP_009417972.1|  PREDICTED: sex determination protein tassels...    191   8e-55   
ref|XP_010104808.1|  Momilactone A synthase                             191   1e-54   
ref|XP_006843399.1|  hypothetical protein AMTR_s00053p00124300          190   1e-54   
ref|XP_009631424.1|  PREDICTED: xanthoxin dehydrogenase-like            189   1e-54   
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             190   1e-54   
gb|ABK26187.1|  unknown                                                 189   1e-54   
ref|XP_003554454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   1e-54   
ref|XP_003538228.1|  PREDICTED: xanthoxin dehydrogenase-like            189   1e-54   
gb|ABK21151.1|  unknown                                                 189   1e-54   
ref|XP_002446247.1|  hypothetical protein SORBIDRAFT_06g009610          189   2e-54   
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    190   2e-54   
ref|XP_010246807.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   2e-54   
gb|ACU19262.1|  unknown                                                 189   2e-54   
ref|XP_003552289.1|  PREDICTED: short-chain dehydrogenase reducta...    189   2e-54   
ref|XP_009372539.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   2e-54   
ref|XP_004305639.1|  PREDICTED: momilactone A synthase-like             189   2e-54   
ref|XP_010671866.1|  PREDICTED: xanthoxin dehydrogenase-like            189   2e-54   
gb|KDP40503.1|  hypothetical protein JCGZ_24502                         189   2e-54   
gb|KCW47495.1|  hypothetical protein EUGRSUZ_K01263                     189   2e-54   
gb|KHN40676.1|  Sex determination protein tasselseed-2                  189   2e-54   
ref|XP_011043647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    188   3e-54   
gb|EYU18091.1|  hypothetical protein MIMGU_mgv1a011664mg                188   3e-54   
ref|XP_010035975.1|  PREDICTED: short-chain dehydrogenase reducta...    189   3e-54   
gb|ACN40590.1|  unknown                                                 188   4e-54   
gb|AAC35340.1|  short-chain alcohol dehydrogenase                       188   5e-54   
ref|XP_009611083.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   5e-54   
gb|ABK25445.1|  unknown                                                 188   5e-54   
gb|ABD39544.1|  tasselseed2-like short-chain dehydrogenase/reductase    187   6e-54   
ref|XP_007026535.1|  NAD(P)-binding Rossmann-fold superfamily pro...    188   6e-54   
gb|KDO58269.1|  hypothetical protein CISIN_1g044485mg                   187   6e-54   
gb|KDP36155.1|  hypothetical protein JCGZ_08799                         187   7e-54   
gb|KDP36165.1|  hypothetical protein JCGZ_08809                         189   8e-54   
gb|ABD39539.1|  tasselseed2-like short-chain dehydrogenase/reductase    186   9e-54   
gb|ABD39542.1|  tasselseed2-like short-chain dehydrogenase/reductase    186   1e-53   
ref|XP_006828171.1|  hypothetical protein AMTR_s00023p00118310          187   1e-53   
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    188   1e-53   
ref|XP_009626741.1|  PREDICTED: secoisolariciresinol dehydrogenas...    186   1e-53   
gb|KHN33244.1|  Sex determination protein tasselseed-2                  187   1e-53   
ref|XP_002513332.1|  short chain alcohol dehydrogenase, putative        186   2e-53   
ref|XP_007140172.1|  hypothetical protein PHAVU_008G089900g             187   2e-53   
ref|XP_009763487.1|  PREDICTED: secoisolariciresinol dehydrogenas...    186   2e-53   
gb|ABD39555.1|  tasselseed2-like short-chain dehydrogenase/reductase    185   2e-53   
gb|ABD39551.1|  tasselseed2-like short-chain dehydrogenase/reductase    185   2e-53   
gb|KHN02192.1|  Momilactone A synthase                                  197   2e-53   
ref|XP_010671863.1|  PREDICTED: zerumbone synthase-like                 186   2e-53   
gb|EYU18090.1|  hypothetical protein MIMGU_mgv1a010990mg                187   2e-53   
gb|KDP36156.1|  hypothetical protein JCGZ_08800                         186   2e-53   
ref|XP_010277608.1|  PREDICTED: xanthoxin dehydrogenase                 186   2e-53   
ref|XP_003534665.1|  PREDICTED: short-chain dehydrogenase reducta...    186   2e-53   
ref|XP_007134614.1|  hypothetical protein PHAVU_010G061700g             187   3e-53   
gb|ABD39543.1|  tasselseed2-like short-chain dehydrogenase/reductase    185   3e-53   
gb|AAC35342.1|  short-chain alcohol dehydrogenase                       186   3e-53   
ref|XP_008388874.1|  PREDICTED: short-chain dehydrogenase reducta...    186   3e-53   
ref|XP_010921066.1|  PREDICTED: LOW QUALITY PROTEIN: sex determin...    186   3e-53   
emb|CDP16984.1|  unnamed protein product                                186   4e-53   
ref|XP_010905491.1|  PREDICTED: secoisolariciresinol dehydrogenas...    185   4e-53   
gb|AER92598.1|  putative short-chain alcohol dehydrogenase              186   5e-53   
gb|KEH24173.1|  short-chain dehydrogenase/reductase                     185   6e-53   
ref|XP_009776783.1|  PREDICTED: short-chain dehydrogenase reducta...    186   6e-53   
ref|XP_006854739.1|  hypothetical protein AMTR_s00030p00244330          185   6e-53   
gb|ABK23507.1|  unknown                                                 186   7e-53   
gb|KHN29548.1|  Sex determination protein tasselseed-2                  186   7e-53   
ref|XP_003623493.1|  Sex determination protein tasselseed-2             185   8e-53   
ref|XP_010067756.1|  PREDICTED: xanthoxin dehydrogenase                 184   8e-53   
gb|EPS74091.1|  hypothetical protein M569_00663                         186   1e-52   
gb|KHG07244.1|  Sex determination tasselseed-2                          185   1e-52   
ref|XP_002533854.1|  short chain alcohol dehydrogenase, putative        184   1e-52   
gb|KDP36151.1|  hypothetical protein JCGZ_08795                         184   1e-52   
ref|XP_008437356.1|  PREDICTED: zerumbone synthase-like                 184   1e-52   
gb|ABD39530.1|  tasselseed2-like short-chain dehydrogenase/reductase    183   1e-52   
emb|CDY29039.1|  BnaC07g32450D                                          184   1e-52   
ref|XP_004143748.1|  PREDICTED: xanthoxin dehydrogenase-like            184   1e-52   
ref|XP_010671865.1|  PREDICTED: zerumbone synthase-like                 184   2e-52   
ref|XP_002894375.1|  hypothetical protein ARALYDRAFT_474354             184   2e-52   
ref|XP_010683578.1|  PREDICTED: short-chain dehydrogenase reducta...    184   2e-52   
gb|ABK24336.1|  unknown                                                 184   2e-52   
gb|ABK26305.1|  unknown                                                 184   2e-52   
ref|XP_010106398.1|  Xanthoxin dehydrogenase                            183   2e-52   
ref|XP_009782884.1|  PREDICTED: short-chain dehydrogenase reducta...    184   3e-52   
ref|XP_008370219.1|  PREDICTED: short-chain dehydrogenase reducta...    184   3e-52   
gb|AGT01914.1|  putative short chain alcohol dehydrogenase              180   3e-52   
ref|XP_010503863.1|  PREDICTED: short-chain dehydrogenase reducta...    184   3e-52   
gb|KEH24183.1|  short-chain dehydrogenase-reductase                     182   3e-52   
ref|XP_002877816.1|  short-chain dehydrogenase/reductase family p...    184   3e-52   
ref|XP_008351500.1|  PREDICTED: secoisolariciresinol dehydrogenas...    183   3e-52   
ref|XP_004492523.1|  PREDICTED: short-chain dehydrogenase reducta...    184   3e-52   
ref|XP_009349369.1|  PREDICTED: secoisolariciresinol dehydrogenas...    183   3e-52   
ref|XP_004303064.1|  PREDICTED: xanthoxin dehydrogenase-like            182   4e-52   
ref|XP_008669542.1|  PREDICTED: momilactone A synthase-like             182   5e-52   
ref|XP_003579668.1|  PREDICTED: momilactone A synthase-like             182   5e-52   
gb|ABR18410.1|  unknown                                                 183   5e-52   
ref|XP_006424145.1|  hypothetical protein CICLE_v10029347mg             179   5e-52   
ref|XP_011077500.1|  PREDICTED: short-chain dehydrogenase reducta...    183   6e-52   
ref|XP_004152436.1|  PREDICTED: zerumbone synthase-like                 182   6e-52   
ref|XP_010937967.1|  PREDICTED: sex determination protein tassels...    183   7e-52   
ref|XP_009615997.1|  PREDICTED: short-chain dehydrogenase reducta...    182   1e-51   
ref|NP_001052173.1|  Os04g0179100                                       181   1e-51   
ref|XP_006292209.1|  hypothetical protein CARUB_v10018415mg             182   1e-51   
gb|AAC35341.1|  short-chain alcohol dehydrogenase                       181   1e-51   
ref|XP_010101928.1|  Momilactone A synthase                             181   2e-51   
ref|XP_002526345.1|  short chain alcohol dehydrogenase, putative        181   2e-51   
ref|XP_006303255.1|  hypothetical protein CARUB_v10009938mg             181   2e-51   
ref|XP_008808791.1|  PREDICTED: zerumbone synthase-like                 182   2e-51   
gb|AAC35343.1|  short-chain alcohol dehydrogenase                       181   2e-51   
ref|XP_006338966.1|  PREDICTED: short-chain dehydrogenase reducta...    182   2e-51   
ref|XP_009136629.1|  PREDICTED: short-chain dehydrogenase reducta...    181   3e-51   
ref|XP_004975524.1|  PREDICTED: momilactone A synthase-like             180   3e-51   
ref|XP_004166485.1|  PREDICTED: LOW QUALITY PROTEIN: xanthoxin de...    180   4e-51   
gb|ACU21443.1|  unknown                                                 179   4e-51   
ref|XP_010529113.1|  PREDICTED: short-chain dehydrogenase reducta...    181   4e-51   
ref|XP_004249651.1|  PREDICTED: short-chain dehydrogenase reducta...    181   4e-51   
gb|ABD39549.1|  tasselseed2-like short-chain dehydrogenase/reductase    179   4e-51   
gb|ABK22004.1|  unknown                                                 180   4e-51   
ref|XP_008465699.1|  PREDICTED: xanthoxin dehydrogenase                 180   4e-51   
ref|XP_010312311.1|  PREDICTED: short-chain dehydrogenase reducta...    181   5e-51   
ref|XP_009373111.1|  PREDICTED: short-chain dehydrogenase reducta...    181   5e-51   
ref|XP_007218800.1|  hypothetical protein PRUPE_ppa009814mg             179   6e-51   
gb|ABD39548.1|  tasselseed2-like short-chain dehydrogenase/reductase    179   7e-51   
emb|CDP20942.1|  unnamed protein product                                179   9e-51   
ref|NP_001052709.1|  Os04g0405300                                       179   1e-50   
emb|CBI30353.3|  unnamed protein product                                178   1e-50   
ref|XP_007027881.1|  Short chain alcohol dehydrogenase                  179   1e-50   
ref|XP_008245281.1|  PREDICTED: xanthoxin dehydrogenase                 179   1e-50   
emb|CAH66125.1|  OSIGBa0109M01.3                                        179   1e-50   
ref|XP_006339318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    179   1e-50   
emb|CAH66124.1|  OSIGBa0109M01.2                                        178   2e-50   
ref|NP_190736.1|  short-chain dehydrogenase reductase 2a                179   2e-50   
gb|ABD39547.1|  tasselseed2-like short-chain dehydrogenase/reductase    177   2e-50   
ref|XP_009354435.1|  PREDICTED: xanthoxin dehydrogenase                 178   3e-50   
ref|XP_010104807.1|  Momilactone A synthase                             177   3e-50   
ref|XP_008809990.1|  PREDICTED: sex determination protein tassels...    178   3e-50   
emb|CDX78027.1|  BnaA09g32220D                                          178   3e-50   
ref|XP_002275768.1|  PREDICTED: tropinone reductase-like 1              177   4e-50   
ref|XP_009787721.1|  PREDICTED: xanthoxin dehydrogenase-like            177   5e-50   
ref|XP_010683629.1|  PREDICTED: secoisolariciresinol dehydrogenas...    177   5e-50   
gb|ABD39526.1|  tasselseed2-like short-chain dehydrogenase/reductase    176   7e-50   
emb|CDP19910.1|  unnamed protein product                                177   7e-50   
ref|XP_004959906.1|  PREDICTED: sex determination protein tassels...    178   7e-50   
ref|XP_009115857.1|  PREDICTED: short-chain dehydrogenase reducta...    177   1e-49   
gb|EPS72418.1|  short chain alcohol dehydrogenase                       176   1e-49   
gb|ABD39533.1|  tasselseed2-like short-chain dehydrogenase/reductase    175   1e-49   
gb|ABD39535.1|  tasselseed2-like short-chain dehydrogenase/reductase    175   1e-49   
emb|CDX90636.1|  BnaA03g41450D                                          176   2e-49   
ref|XP_010500833.1|  PREDICTED: xanthoxin dehydrogenase-like            176   2e-49   
gb|ABD39550.1|  tasselseed2-like short-chain dehydrogenase/reductase    174   2e-49   
ref|XP_010479742.1|  PREDICTED: xanthoxin dehydrogenase                 176   2e-49   
gb|ABD39536.1|  tasselseed2-like short-chain dehydrogenase/reductase    174   3e-49   
gb|ABD39522.1|  tasselseed2-like short-chain dehydrogenase/reductase    174   3e-49   
emb|CDP06416.1|  unnamed protein product                                176   3e-49   
gb|ABD39532.1|  tasselseed2-like short-chain dehydrogenase/reductase    174   3e-49   
gb|ABD39527.1|  tasselseed2-like short-chain dehydrogenase/reductase    174   3e-49   
ref|XP_006403893.1|  hypothetical protein EUTSA_v10010941mg             174   3e-49   



>ref|XP_002272549.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 188/238 (79%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            MVSSSLLS  A+RL+G+VA+ITGG GGIGS TAKLF QHGAKVLIAD +D++   +C+DL
Sbjct  1    MVSSSLLSAVARRLEGKVALITGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  ++ F+HCDVT E DV NA+++AV+ HG+LDIM NNAGI G K ++ILD D  +F N 
Sbjct  61   GPSSASFIHCDVTKELDVSNAIDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENT  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
             RVN LGAFLGTKHAARVM P  RG +IN+ASV   +GG   H+Y  SKHAI+GLT+NTA
Sbjct  121  MRVNVLGAFLGTKHAARVMVPAGRGCVINSASVCSVVGGICTHSYVSSKHAILGLTRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY++ T M+R +    +DD L DVYSNLKGV LM +DVAEAVLY
Sbjct  181  VELGKFGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYSNLKGVALMPQDVAEAVLY  238



>emb|CBI28276.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 195/256 (76%), Gaps = 9/256 (4%)
 Frame = +1

Query  88   VISSQEIDSRK-------MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAK  246
            + SS  ++ R+       MVSSSLLS  A+RL+G+VA+ITGG GGIGS TAKLF QHGAK
Sbjct  18   IFSSATLNPRRFYPEGEAMVSSSLLSAVARRLEGKVALITGGAGGIGSCTAKLFSQHGAK  77

Query  247  VLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIA  426
            VLIAD +D++   +C+DLG  ++ F+HCDVT E DV NA+++AV+ HG+LDIM NNAGI 
Sbjct  78   VLIADIQDEKGHLICRDLGPSSASFIHCDVTKELDVSNAIDEAVAKHGKLDIMFNNAGIL  137

Query  427  GAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-P  603
            G K ++ILD D  +F N  RVN LGAFLGTKHAARVM P  RG +IN+ASV   +GG   
Sbjct  138  GPKIINILDNDAAEFENTMRVNVLGAFLGTKHAARVMVPAGRGCVINSASVCSVVGGICT  197

Query  604  HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNL  780
            H+Y  SKHAI+GLT+NTA++LG++GIRVNCVSPY++ T M+R +    +DD L DVYSNL
Sbjct  198  HSYVSSKHAILGLTRNTAVELGKFGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYSNL  257

Query  781  KGVDLMAEDVAEAVLY  828
            KGV LM +DVAEAVLY
Sbjct  258  KGVALMPQDVAEAVLY  273



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 179/228 (79%), Gaps = 2/228 (1%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHC  330
            A+RL+G+VA+ITGG GGIGS TAKLFCQHGAKVLIAD + ++  S+CKDLG  ++ FVHC
Sbjct  11   ARRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHC  70

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFL  510
            DVT E DV NA++KA+S +G+LDIM NNAGI G    +ILD D  +F N  RVN LG FL
Sbjct  71   DVTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFL  130

Query  511  GTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRV  687
            GTKHAARVM P  RGSIINTASV   +GG   H+YT SKHAI+GLT+NTA++LG++GIRV
Sbjct  131  GTKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRV  190

Query  688  NCVSPYILSTQMTRNYFGLAEDDK-LDVYSNLKGVDLMAEDVAEAVLY  828
            NCVSPY++ T ++R +  L EDD  + VYSNLKGV L  EDVAEAVLY
Sbjct  191  NCVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLY  238



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SLLST A+RL+G+VA+ITGG  GIG +TA+ F +HGAKV+IADT+D+ + S+CKDL
Sbjct  1    MGSVSLLSTVARRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ F+HCDVT E+DV+NAVN A+S HG+LD+M NNAGI G    +++D   ++F  V
Sbjct  61   NSESASFIHCDVTKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +GAFLGTKHAARVMKP ++GSII T+SV G +GGF  HAYT SKH ++GL +N A
Sbjct  121  IRVNLVGAFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY ++T+M+RN+  + +D+    YSNLKG  L  EDVAEA LY
Sbjct  181  VELGQFGIRVNCVSPYTVATEMSRNFLKMTDDEIRSGYSNLKGAILTPEDVAEAALY  237



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 184/237 (78%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SLLST A+RL+G+VA+ITGG  GIG +TA+ F +HGAKV+IADT+D+ + S+CKDL
Sbjct  1    MGSVSLLSTVARRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ F+HCD+T E+DV+NAVN A+S HG+LD+M NNAGI G    +++D   ++F  V
Sbjct  61   NSESASFIHCDITKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +G FLGTKHAARVMKP ++GSII T+SV G +GGF  HAYT SKH ++GL +NTA
Sbjct  121  IRVNLVGPFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY ++T+M+RN+  + +D+    YSNLKG  L  EDVAEA LY
Sbjct  181  VELGQFGIRVNCVSPYTVATEMSRNFLKMTDDEIRSGYSNLKGAILTPEDVAEAALY  237



>gb|AFK37606.1| unknown [Medicago truncatula]
 gb|KEH29818.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 179/237 (76%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S  L+S A +RL+G+VA+ITGG  GIG ATA+LF  HGA+V+IAD +DD   S+C++L
Sbjct  1    MTSVPLVSAALRRLEGKVALITGGASGIGEATARLFSNHGAQVVIADIQDDIGHSICQEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E D++NAVN  VS HG+LDIM NNAGI G    +IL+   ++F  V
Sbjct  61   HKSSATYVHCDVTKEKDIENAVNTTVSKHGKLDIMFNNAGITGINKTNILENKLSEFQEV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              +N  G FLGTKHAARVM PV+RGSIINTASV G +GG   HAYT SKHA+VGL KNTA
Sbjct  121  IDINLTGVFLGTKHAARVMTPVRRGSIINTASVCGCIGGVASHAYTSSKHAVVGLMKNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG YGIRVNCVSPY++ T + +N+F L +D  LDVYSNLKG +L+ +DVAEA LY
Sbjct  181  IELGPYGIRVNCVSPYVVGTPLAKNFFKLDDDGVLDVYSNLKGANLLPKDVAEAALY  237



>ref|XP_004506207.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 183/237 (77%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +  L+ST+ KRL+G+VA+ITGG  GIG AT +LF +HGA+V+IAD +D+   S+CKDL
Sbjct  1    MATVPLISTSLKRLEGKVALITGGASGIGEATVRLFSKHGAQVVIADIQDEMGHSICKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
             + ++ FVHCD T E+DV+NAVN  VS +G+LDIM NNAGI+G    +IL+   ++F  V
Sbjct  61   NNSSASFVHCDTTKETDVENAVNTTVSKYGKLDIMFNNAGISGVNKTNILENKLSEFEEV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  657
             +VN +G FLGTKHA+RVM P +RGSIINTASV G +GG  PHAYT SKHA++GL +NTA
Sbjct  121  IKVNLIGVFLGTKHASRVMIPARRGSIINTASVGGSIGGAAPHAYTSSKHAVLGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG YGIRVNCVSPY+++T + + +  + ++  L VYSNLKGV+L+ EDVAEA LY
Sbjct  181  VELGPYGIRVNCVSPYLVATPLAKKFLKIDDEGILAVYSNLKGVNLVPEDVAEAALY  237



>gb|EYU26737.1| hypothetical protein MIMGU_mgv1a011831mg [Erythranthe guttata]
Length=269

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 181/238 (76%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++SLLS  AKRL+G+VA+ITGG G +GSATAKLF +HGAK+LIAD +DD  + +CK L
Sbjct  1    MANTSLLSAVAKRLEGKVALITGGAGRLGSATAKLFHEHGAKILIADVQDDLGRRICKTL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + ++HCD+T+ES V+NAV +A+S HG+LDIM NNAG+ G    D+L    +DF  V
Sbjct  61   SPQTASYIHCDITNESHVENAVEEAISKHGKLDIMFNNAGVMGPTNTDMLVETKSDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAARVMKP  RG+IINTASV+  +GG   HAYT SKHA++GLT+NTA
Sbjct  121  LNVNITGTFLGTKHAARVMKPAHRGTIINTASVSSVIGGACTHAYTSSKHAVLGLTRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLY  828
            ++LGRYGIRVNCVSPY  ++ M+R   G  +DD + D+YSNL G +L AEDVA+AVLY
Sbjct  181  VELGRYGIRVNCVSPYAFASPMSRGALGRDKDDPMVDIYSNLDGSNLTAEDVAQAVLY  238



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 180/238 (76%), Gaps = 4/238 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S A +RL+G+VA+ITGG  GIG ATA+LF +HGA+V+IAD +DD   S+CKDL
Sbjct  1    MASISLVSAALRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDDLGHSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               +  FVHC+VT E +V+ AVN AVS HG+LDIM NNAGI+G     IL+   ++F  V
Sbjct  61   ESAS--FVHCNVTKEDEVETAVNMAVSKHGKLDIMFNNAGISGNNNTSILNNTKSEFEQV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
            F VN  GAFLGTKHAARVM P +RGSIINTAS +G + GG PH YT SKHA+VGL +NTA
Sbjct  119  FSVNVSGAFLGTKHAARVMIPARRGSIINTASTSGVIGGGAPHPYTSSKHAVVGLMRNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLY  828
            ++L  YG+RVNCVSPY + T M +N+F L E+D++   YSNLKG DL+ EDVAEAVLY
Sbjct  179  VELEAYGVRVNCVSPYFVPTPMVKNFFKLGEEDEVPKFYSNLKGADLVPEDVAEAVLY  236



>ref|XP_010262932.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=268

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SSS+LS   KRL+G+VA+ITGG  GIG +T +LFC+HGAKV+IAD +DD   S+C D+
Sbjct  2    MGSSSVLSAVVKRLEGKVALITGGASGIGESTVRLFCRHGAKVVIADVQDDLGHSVCNDI  61

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDVT+ES ++ AV+  V+ +G+LDIM NNAGI G    +ILD D  +F  V
Sbjct  62   GSKAASFVHCDVTNESHIRKAVDTTVAKYGKLDIMFNNAGIVGTPNPNILDNDKGEFEQV  121

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAARVM P +RGSII+TASV   +GG   HAYTCSKHA+VGLTKN A
Sbjct  122  LAVNITGPFLGTKHAARVMIPARRGSIISTASVCSLVGGVASHAYTCSKHAVVGLTKNAA  181

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++G+RVNCVSPY++ T +T+ +F L E+    +YSNLKG  L  EDVAEAVLY
Sbjct  182  VELGKFGVRVNCVSPYLVVTPLTKKFFNLDENGSPGIYSNLKGRMLWPEDVAEAVLY  238



>ref|XP_011088939.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=270

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 179/238 (75%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++SLL   AKRL+G+VA+ITGG G +GS TAKLF +HGAKVLIAD +DD+   +C++L
Sbjct  1    MATTSLLFAVAKRLEGKVALITGGAGSLGSVTAKLFHEHGAKVLIADVQDDKGHLVCQNL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ F+HCDVT+ESD++ AV  AVS HG+LDIM NNAGI      D+L+ + TDF  V
Sbjct  61   SPESASFIHCDVTNESDIRKAVETAVSIHGKLDIMFNNAGIVDPVIPDMLNYNQTDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +GAFLGTKHAA  MK  +RGSIINTASV   +GG   H YT SKHAIVGLTKNTA
Sbjct  121  LRVNAVGAFLGTKHAACFMKQAKRGSIINTASVCSVIGGVATHGYTSSKHAIVGLTKNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLY  828
            ++LGRYGIRVNCVSPY   + M+R +F   EDD + D+ SNL+GV L  EDVAEAV+Y
Sbjct  181  VELGRYGIRVNCVSPYAFPSAMSRGFFERDEDDPIDDIGSNLEGVSLKPEDVAEAVVY  238



>emb|CAN68176.1| hypothetical protein VITISV_014635 [Vitis vinifera]
Length=265

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            KLFCQHGAKVLIAD +D++  S+CKDLG  ++ FVHCDVT E DV NA++KA+S +G+LD
Sbjct  34   KLFCQHGAKVLIADIQDEKGHSICKDLGPTSASFVHCDVTKELDVGNAIDKAISKYGKLD  93

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G    +ILD D  +F N  RVN LG FLGTKHAARVM P  RGSIINTASV
Sbjct  94   IMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAPAGRGSIINTASV  153

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               +GG   H+YT SKHAI+GLT+NTA++LG++GIRVNCVSPY++ T ++R +  L EDD
Sbjct  154  CSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVNCVSPYLVPTSLSRKFMNLGEDD  213

Query  757  K-LDVYSNLKGVDL  795
              ++VYSNLKGV L
Sbjct  214  PFVNVYSNLKGVSL  227



>ref|XP_010246229.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=274

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = +1

Query  127  SSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGH  306
            SSS+LS  A+RL+ +VA++T G  G+G + AKLF QHGAKV+IAD +D+   S+CK+LG 
Sbjct  4    SSSILSAVARRLEAKVALVTDGASGLGRSCAKLFSQHGAKVVIADIQDELGHSVCKELGP  63

Query  307  GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFR  486
             ++ F+HCDVT+ESDV+NAVN AV+ HG+LDIM+ NAGI G+  ++IL  D  DF  V  
Sbjct  64   SSASFIHCDVTNESDVENAVNGAVARHGKLDIMLINAGIIGSPTVNILANDRGDFQQVLN  123

Query  487  VNTLGAFLGTKHAARVMKPVQ-RGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  660
            VN +G FLGTKHAARVM      GSIIN AS+   +GG  PHAYT SKHA++GLT+NTA+
Sbjct  124  VNVIGPFLGTKHAARVMILANGGGSIINMASICSIIGGATPHAYTSSKHAVLGLTRNTAV  183

Query  661  DLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLY  828
            +LGR+GIRVNC+SPY ++T  +R +  L ED  + D YSNLKGV L  EDVAEA LY
Sbjct  184  ELGRFGIRVNCISPYAVATPQSRKFLKLEEDAAIVDAYSNLKGVALKPEDVAEAALY  240



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 185/238 (78%), Gaps = 3/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S A +RL+G+VA+ITGG  GIG + A+LF +HGAKV+IAD +D+   S+C++L
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
             + ++ FVHCDVT E DV+NAVN AVS HG+LDIM NNAG+ G+   +ILD D  +F  V
Sbjct  61   KNESASFVHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGVVGSPKPNILDNDKAEFEKV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +GAFLGTKHAARVM P +RGSII+TASV G +GG   HAYT SKH ++GL +NTA
Sbjct  121  ISVNIVGAFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY++ST + +++F L +D+K++ VYSNLK   L AEDVAEA L+
Sbjct  181  VELGQHGIRVNCVSPYLVSTPLAKDFFKL-DDNKVNRVYSNLKEAVLKAEDVAEAALF  237



>ref|XP_010049792.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   251 bits (642),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 173/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + +LLS AA+RL+G+VA+ITGG GGIG +TA+LF +HGA+V+IAD RDD  +S+CKDL
Sbjct  1    MATGALLSQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGKSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+SESD++NA+  AV  HG+LDIMVNNA I       ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P QRGSIIN  SV   +GG   HAYT SKHA++GLT+N A
Sbjct  121  VSVNLTGVFLGTKHAARAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYG+R+NC+SPY + T +T+  F + ED  + VYSN+ GV L  EDVAEA LY
Sbjct  181  AELGRYGVRINCLSPYFILTPLTKAIFQIDEDAGVRVYSNMDGVTLRQEDVAEAALY  237



>ref|XP_010651861.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=267

 Score =   251 bits (642),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S   +S AA+RL G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +D+   S+CKDL
Sbjct  1    MASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ FVHCDVT+E +V+NAVN AV+THG+LDIM NNAGIAG     ILD D T+F  V
Sbjct  61   SPTSASFVHCDVTNEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +GAFLGTKHAARVM P   GSII TASV   + GG  HAYT SKHA+VGL +N A
Sbjct  121  LNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG+YGIRVNCVSPY+++T + ++ F L +D    VYSNLKG  L AEDVAEA LY
Sbjct  181  VELGKYGIRVNCVSPYLVATPLAKDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALY  237



>emb|CBI28275.3| unnamed protein product [Vitis vinifera]
Length=861

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 179/228 (79%), Gaps = 2/228 (1%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHC  330
            A+RL+G+VA+ITGG GGIGS TAKLFCQHGAKVLIAD + ++  S+CKDLG  ++ FVHC
Sbjct  11   ARRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHC  70

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFL  510
            DVT E DV NA++KA+S +G+LDIM NNAGI G    +ILD D  +F N  RVN LG FL
Sbjct  71   DVTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFL  130

Query  511  GTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRV  687
            GTKHAARVM P  RGSIINTASV   +GG   H+YT SKHAI+GLT+NTA++LG++GIRV
Sbjct  131  GTKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRV  190

Query  688  NCVSPYILSTQMTRNYFGLAEDDK-LDVYSNLKGVDLMAEDVAEAVLY  828
            NCVSPY++ T ++R +  L EDD  + VYSNLKGV L  EDVAEAVLY
Sbjct  191  NCVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLY  238


 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 175/238 (74%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S   +S AA+RL G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +D+  QS+CK+L
Sbjct  594  MASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKEL  653

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
                S  FVHCDVTSE DV+NA+N AV+ +G+LDIM NNAGI G    +ILD D T+F  
Sbjct  654  SSPTSASFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEK  713

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  654
            +  VN +GAFLGTKHAARVM P   GSII TASV   +GG   HAYT SKHA+VGL +N 
Sbjct  714  ILNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNA  773

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            A++LG+YGIRVNCVSPY++ T + +++F L +D    VYSNLKG  L  EDVAEA LY
Sbjct  774  AVELGKYGIRVNCVSPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNPEDVAEAALY  831


 Score =   245 bits (626),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 153/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD +D+   S+CKDL   ++ FVHCDVT+E +V+NAVN AV+THG+LD
Sbjct  305  RLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKLD  364

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGIAG     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TASV
Sbjct  365  IMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTASV  424

Query  580  AGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               + GG  HAYT SKHA+VGL +N A++LG+YGIRVNCVSPY+++T + ++ F L +D 
Sbjct  425  CSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCVSPYLVATPLAKDLFKLDDDG  484

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               VYSNLKG  L AEDVAEA LY
Sbjct  485  VSGVYSNLKGKVLNAEDVAEAALY  508



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S A +RL+G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +D+   S+CK+L
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + F+HCDVT E DV+NAVN AVS +G+LDIM NNAGI G    +IL+ D  +F  +
Sbjct  61   EPEPASFIHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGIGGTPKTNILENDKAEFEKI  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +GAFLGTKHAARVM P +RGSII TASV   + GG  HAYT SKH ++GLT+NTA
Sbjct  121  ICVNLVGAFLGTKHAARVMIPARRGSIITTASVCAIIGGGLSHAYTSSKHGVLGLTRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG YGIRVNCVSPY + T + +N+F + +D+   +YSNLKG  L AED+AEA LY
Sbjct  181  VELGHYGIRVNCVSPYAVPTPLFKNFFKMNDDELKCIYSNLKGAVLQAEDIAEAALY  237



>ref|XP_008229671.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 178/234 (76%), Gaps = 3/234 (1%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
            SLL+ AA+RL+G+VA+ITGG  GIG + A+LF +HGAKV+IAD +DD ++S+C+DL   +
Sbjct  7    SLLAAAARRLEGKVAVITGGASGIGESAARLFSKHGAKVVIADVQDDLAESVCRDLSPSS  66

Query  313  SFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  492
            + FVHCDVT E DV+NAV  A + +G+LDIM NNAG+ G    +ILD D  +F  V RVN
Sbjct  67   TSFVHCDVTKEEDVENAVKTATNKYGKLDIMFNNAGVVGMTKPNILDNDKVEFEQVIRVN  126

Query  493  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLG  669
             +GAFLG KHAARVM P  +GSIINTASV   +GG  PHAYT SKH +VGL +NTA++LG
Sbjct  127  LVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCAPHAYTSSKHGLVGLVRNTAVELG  186

Query  670  RYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLY  828
            ++GIRVNCVSPYI+ST + + +F L +DDKL   YSNLKG  L AED+ EA LY
Sbjct  187  QHGIRVNCVSPYIVSTPLAKEFFKL-DDDKLHGAYSNLKGGVLKAEDIVEAALY  239



>ref|XP_003540812.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=269

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S   +RL+G+VAIITGG  GIG ATA+LF +HGA V+IAD +DD   S+CK L
Sbjct  1    MASVSLVSATGRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSICKHL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT+E+DV+N VN  VS HG+LDIM NNAGI G     ILD   ++F  V
Sbjct  61   E--SASYVHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RGSI+NTASV G +GG   HAYT SKHA+VGLTKNTA
Sbjct  119  INVNLVGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG +G+RVNCVSPY+++T + +N+F L +D    +YSNLKG DL+  DVAEA LY
Sbjct  179  VELGAFGVRVNCVSPYVVATPLAKNFFKLDDDGVQGIYSNLKGTDLVPNDVAEAALY  235



>ref|XP_009374964.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=270

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + SL++ AA+RL+G+VA+ITGG  GIG +TA++F +HGAKV+IAD +DD  +S+C+DL
Sbjct  1    MGTFSLVTAAARRLEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCRDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ FVHCDVT E D++NAV  A S +G+LDIM NNAGI G    +ILD    +F  V
Sbjct  61   NSSSASFVHCDVTKEEDIENAVKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +GAFLG KHAARVM P  +GSIINTASV   MGG   HAYT SKH +VGL KN A
Sbjct  121  IRVNLVGAFLGIKHAARVMIPAGQGSIINTASVCSTMGGIASHAYTSSKHGVVGLMKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG+YGIRVNCVSPY+++T + +++F L +D    VYSNLKG  L  EDVAEA LY
Sbjct  181  VELGQYGIRVNCVSPYLVATPLAKHFFNLEDDGVHGVYSNLKGKVLRPEDVAEAALY  237



>gb|KEH29814.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=265

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGA+V+IAD +DD+  S+CK+L   +S +V CDVT E D++NAVN  V  +G+LD
Sbjct  28   RLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKLD  87

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI+G     IL+   ++F +V +VN  G FLGTKHAARVM P +RGSIINTASV
Sbjct  88   IMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHAARVMIPARRGSIINTASV  147

Query  580  AGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
             G +GG  PHAYT SKHA+VGL +NTA++LG +GIRVNCVSPY L+T M  N+F L +  
Sbjct  148  GGSIGGCAPHAYTSSKHAVVGLMRNTAIELGPFGIRVNCVSPYFLATPMVTNFFKLDDGG  207

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
             LD++SNLKG +L+ +DVAEA LY
Sbjct  208  ALDIFSNLKGTNLVPKDVAEAALY  231



>ref|XP_011089208.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=278

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 180/246 (73%), Gaps = 10/246 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SSS+LS AAKRL+G+VA+ITGG GG+GS TAKLF +HGAKVLIAD RDD    +C++L
Sbjct  1    MPSSSVLSAAAKRLEGKVALITGGAGGLGSVTAKLFHEHGAKVLIADARDDRGHLICQNL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + F+HCDVTSESD+QNAV  AVST+G+LDIM NNAGI      ++L+    DF +V
Sbjct  61   SPERASFIHCDVTSESDIQNAVETAVSTYGKLDIMFNNAGILDPVIPNVLNYSQADFEHV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-----FPHA----YTCSKHAI  633
             RVN +GAFLGTKHAA  MK  +RGSIINT SV   +GG      P +    Y  SKHA+
Sbjct  121  LRVNVVGAFLGTKHAASFMKQAKRGSIINTGSVCSVIGGDDNKRDPRSRSDHYASSKHAV  180

Query  634  VGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLMAEDV  810
            +GLT+NTA++LGRYGIRVNCVSPY+  + M+R   G  EDD + D+ SNL+GV L  EDV
Sbjct  181  LGLTRNTAVELGRYGIRVNCVSPYVFPSSMSRGLLGRDEDDPVDDIGSNLEGVSLKPEDV  240

Query  811  AEAVLY  828
            AEAV+Y
Sbjct  241  AEAVVY  246



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 175/238 (74%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S   +S AA+RL G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +D+  QS+CK+L
Sbjct  1    MASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKEL  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
                S  FVHCDVTSE DV+NA+N AV+ +G+LDIM NNAGI G    +ILD D T+F  
Sbjct  61   SSPTSASFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEK  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  654
            +  VN +GAFLGTKHAARVM P   GSII TASV   +GG   HAYT SKHA+VGL +N 
Sbjct  121  ILNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNA  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            A++LG+YGIRVNCVSPY++ T + +++F L +D    VYSNLKG  L  EDVAEA LY
Sbjct  181  AVELGKYGIRVNCVSPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNPEDVAEAALY  238



>ref|XP_008229660.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=270

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + SLL+ AA+RL+G+VA+ITGG  GIG +TA+LF +HGA+V+IAD +DD ++S+C+DL
Sbjct  1    MGNFSLLAAAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDDLAESVCRDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ FVHCDVT E DV+NAV  A   +G+LDIM NNAG  G    +ILD D  +F  V
Sbjct  61   SSSSTSFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGIAKPNILDNDKAEFEQV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
             RVN +GAFLG KHAARVM P  +GSIINTASV   + GG  HAYT SKH IVGL +NTA
Sbjct  121  IRVNLVGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLVRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPYI++T + +N+F L +D     YSNLKG  L AED+A+A LY
Sbjct  181  VELGQHGIRVNCVSPYIVATPLAKNFFKLDDDGVHGAYSNLKGAVLKAEDIAQAALY  237



>gb|KHN21175.1| Momilactone A synthase [Glycine soja]
Length=304

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 170/237 (72%), Gaps = 7/237 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S   +RL+G+VAIITGG         +LF +HGA V+IAD +DD   S+CK L
Sbjct  1    MASVSLVSATGRRLEGKVAIITGGAEATA----RLFSKHGAHVVIADIQDDLGLSICKHL  56

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               +  +VHCDVT+E+DV+N VN  VS HG+LDIM NNAGI G     ILD   ++F  V
Sbjct  57   ESAS--YVHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEV  114

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RGSI+NTASV G +GG   HAYT SKHA+VGLTKNTA
Sbjct  115  INVNLVGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTA  174

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG +G+RVNCVSPY+++T + +N+F L +D    +YSNLKG DL+  DVAEA LY
Sbjct  175  VELGAFGVRVNCVSPYVVATPLAKNFFKLDDDGVQGIYSNLKGTDLVPNDVAEAALY  231



>ref|XP_006481514.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=276

 Score =   246 bits (628),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 177/243 (73%), Gaps = 8/243 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S++S AA+RL G+VA+ITGG G IG  TA+LF +HGAKVLIAD +DD  +S+C+D+
Sbjct  1    MGSASIVSAAARRLQGKVALITGGAGSIGECTARLFSKHGAKVLIADIKDDLGESVCEDI  60

Query  301  ------GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDG  462
                   +G S+ VHCDVT E D++NAVN AVS +G+LDIM NNAGI      +ILD D 
Sbjct  61   SSSSSSANGCSY-VHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQ  119

Query  463  TDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVG  639
             +F  +  VN +GAFLGTKHAARVMKP  RGSII+TASV G +GG   HAYT SKH +VG
Sbjct  120  AEFERILSVNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVG  179

Query  640  LTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEA  819
            L KNTA++LGR+GIRVNCVSPY +S+ M + +  L +D    +YSNL G  L  EDVAEA
Sbjct  180  LMKNTAVELGRFGIRVNCVSPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEA  239

Query  820  VLY  828
             LY
Sbjct  240  ALY  242



>ref|XP_004506206.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +  L+S + +RL+G+VA+ITGG  GIG ATA+LF +HGA+V+IAD +D+   S+CKDL
Sbjct  1    MTTVPLVSASLRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDEMGHSICKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + +VHCD T E D++NAVN  VS +G+LDIM NNAGI G    +IL+   ++F  V
Sbjct  61   NKSTASYVHCDTTKEKDIENAVNTTVSKYGKLDIMFNNAGIVGVNKTNILENKLSEFEEV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
             +VN +G FLGTKHA+RVM P +RGSIINTASV G + GG  HA T SKHA++GL KNTA
Sbjct  121  IKVNLIGVFLGTKHASRVMIPARRGSIINTASVCGSIGGGASHACTSSKHAVLGLMKNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG YGIRVNCVSPY+++T + + +F L ++    VYSNLKGV+L+ EDVAEA LY
Sbjct  181  VELGPYGIRVNCVSPYVVATPLAKKFFKLDDEGIQGVYSNLKGVNLVPEDVAEAALY  237



>ref|XP_008230130.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 174/233 (75%), Gaps = 1/233 (0%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
            SLL+ AA+RL+G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +DD ++S+C+DL   +
Sbjct  7    SLLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDFAESVCRDLSPSS  66

Query  313  SFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  492
            + FVHCDVT E DV+NAV  A + +G LDIM NNAGI G    +ILD D  +F  V RVN
Sbjct  67   TSFVHCDVTKEEDVENAVQTATNKYGELDIMFNNAGIIGTNKPNILDNDRVEFEQVIRVN  126

Query  493  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLG  669
             +GAFLG KHAARVM P  +GSIINTASV   +GG   HAYT SKH +VGL +NTA++LG
Sbjct  127  LVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAVELG  186

Query  670  RYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++GIRVNCVSPY++ T + + +F L +D     YSNLKG  L AED+AEA LY
Sbjct  187  QHGIRVNCVSPYVVPTPLAKEFFKLDDDGVHGAYSNLKGGVLRAEDIAEAALY  239



>gb|KEH29817.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGA+V+IAD +DD+  S+CKDL   ++ +VHCDVT E D++NAVN  +S +G+LD
Sbjct  34   RLFTEHGAQVIIADIQDDKGYSVCKDLHKSSASYVHCDVTKEKDIENAVNTTISMYGKLD  93

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI GA   +IL+   ++F  V  VN +G FLGTKHA+RVM P +RGSIINTASV
Sbjct  94   IMFNNAGIVGANKTNILEYKLSEFEEVINVNLVGVFLGTKHASRVMIPARRGSIINTASV  153

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
             G +GG   HAYT SKHA++GL +NTA++LG + IRVNCVSPYI++T M +N+  L ++ 
Sbjct  154  CGSIGGMASHAYTSSKHAVLGLMRNTAIELGPFSIRVNCVSPYIVATPMAKNFLKLDDEG  213

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
             L +YSNLKG +L+ +DVAEA LY
Sbjct  214  LLGLYSNLKGTNLVPKDVAEASLY  237



>ref|XP_010651860.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=288

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 153/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD +D+   S+CKDL   ++ FVHCDVT+E +V+NAVN AV+THG+LD
Sbjct  55   RLFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKLD  114

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGIAG     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TASV
Sbjct  115  IMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTASV  174

Query  580  AGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               + GG  HAYT SKHA+VGL +N A++LG+YGIRVNCVSPY+++T + ++ F L +D 
Sbjct  175  CSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCVSPYLVATPLAKDLFKLDDDG  234

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               VYSNLKG  L AEDVAEA LY
Sbjct  235  VSGVYSNLKGKVLNAEDVAEAALY  258



>ref|XP_010040330.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=253

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (72%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + +LLS AA+RL+G+VA+ITGG GGIG +TA+LF +HGA+V+I D RDD  +S+CKDL
Sbjct  1    MATGALLSQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIGDIRDDLGKSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+SESD++NA+  AV  HG+LDIMVNNA I       ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHA R M P QRGSIIN  SV   +GG   HAYT SKHA++GLT+  A
Sbjct  121  VSVNLTGVFLGTKHATRAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRKVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYG+R+NC+SPY + T +T+  F + ED  + VYSN+ GV L  EDVAEA L+
Sbjct  181  AELGRYGVRINCLSPYFILTPLTKAIFQIDEDAGVRVYSNMDGVTLRQEDVAEAALF  237



>ref|XP_003538100.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN08820.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 176/237 (74%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S +S   +RL+G+VA+I+GG  GIG ATA+LF +HGA V+IAD +DD   S+CK L
Sbjct  1    MASISTVSVLDRRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT+E+DVQNAVN A+S +G LDIM NNAGI       ILD    DF  V
Sbjct  61   E--SASYVHCDVTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RGSIINTASVAG F GG  HAYT SKHA++GL KNTA
Sbjct  119  ISVNLVGPFLGTKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY+++T +T+  F L ED   ++YSNLKGV L+  DVAEA LY
Sbjct  179  VELGQFGIRVNCLSPYVVATPLTKKCFNLDEDRNGEIYSNLKGVHLVPNDVAEAALY  235



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 178/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + SLL+ AA+RL+G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +D+ ++S+C+DL
Sbjct  1    MGNFSLLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDNLAESICRDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ FVHCDVT E DV+NAV  A S +G+LDIM NNAGIAG    +ILD D  +F  V
Sbjct  61   SSSSTSFVHCDVTKEEDVENAVKTATSKYGKLDIMFNNAGIAGIAKTNILDNDKAEFEQV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  657
              VN +G FLG KHAARVM P  +GSIINTAS    +GG   HAYT SKH ++GL +NTA
Sbjct  121  IGVNLVGVFLGIKHAARVMIPAGQGSIINTASACSTIGGCASHAYTSSKHGVLGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPYI++T + +++F L +D    VYSNLKG  L AED+AEA LY
Sbjct  181  IELGQHGIRVNCVSPYIVATPLAKDFFKLDDDGVHGVYSNLKGGVLKAEDIAEAALY  237



>ref|XP_007206815.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
 gb|EMJ08014.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
Length=272

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 173/233 (74%), Gaps = 1/233 (0%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
            SLL+ AA+RL+G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +DD ++S+C+DL    
Sbjct  7    SLLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDLAESVCRDLSPSP  66

Query  313  SFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  492
            + FVHCDVT E DV+NAV    + +G LDIM NNAGI G    +ILD D  +F  V RVN
Sbjct  67   TLFVHCDVTKEEDVENAVQTTTNKYGELDIMFNNAGIIGTNKPNILDNDKVEFEQVIRVN  126

Query  493  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLG  669
             +GAFLG KHAARVM P  +GSIINTASV   +GG   HAYT SKH +VGL +NTA++LG
Sbjct  127  LVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAVELG  186

Query  670  RYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++GIRVNCVSPY ++T++ + +F + +D     YSNLKG  L AED+AEA LY
Sbjct  187  QHGIRVNCVSPYAVATKLAKEFFKIDDDGVHGAYSNLKGRVLKAEDIAEAALY  239



>ref|XP_009388139.1| PREDICTED: momilactone A synthase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 175/237 (74%), Gaps = 5/237 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SS LL +AAKRL+G+VA+ITG   GIG ATAKLF +HGA+++IAD +DD+  ++C  L
Sbjct  1    MQSSPLLFSAAKRLEGKVALITGAASGIGEATAKLFARHGARIVIADVQDDKGHALCSAL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + +VHCDVT+ESDVQ AV+  VS HG+LD+M NNAGI G   L +L+ + +DF +V
Sbjct  61   GPSVASYVHCDVTNESDVQQAVDATVSHHGKLDVMFNNAGIIGEPCLRLLESEKSDFEHV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
               N +G++LGTKHAAR M P +RGSI+ TASVA  +    P AYTCSKHA++GL K+ A
Sbjct  121  VATNLVGSYLGTKHAARAMLPARRGSIVITASVASVIASITPVAYTCSKHAVLGLMKSAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            L+LG++GIRVNCVSPY L T +    FG+ E++    ++ LKGV L AEDVAEAV+Y
Sbjct  181  LELGQFGIRVNCVSPYALPTPLAMKAFGMGEEE----HATLKGVRLKAEDVAEAVVY  233



>ref|XP_006481516.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 179/242 (74%), Gaps = 6/242 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S++S AA+RL G+VA+ITGG  GIG  TA+LF +HGAKVLIAD +DD  +S+CKD+
Sbjct  1    MGSASVVSAAARRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDI  60

Query  301  GHGNSF-----FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGT  465
            G  +S      +VHCDVT E D++NAVN AV+ +G+LDIM NNAG       +ILD D  
Sbjct  61   GSSSSSASGCSYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQA  120

Query  466  DFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGL  642
            +F  +  +N +GAFLGTKHAARVMKP  RGSII+TASV G +GG   HAY  SKH ++GL
Sbjct  121  EFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGL  180

Query  643  TKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAV  822
             KNTA++LGR+GIRVNCVSPY++ST + +++  LA+D    +YSNLKG  L  ED+AEA 
Sbjct  181  MKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAA  240

Query  823  LY  828
            LY
Sbjct  241  LY  242



>ref|XP_010040326.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW45304.1| hypothetical protein EUGRSUZ_L01033 [Eucalyptus grandis]
Length=270

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 175/237 (74%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + +LLS AA+RL+G+VA+ITGG GGIG +TA+LF +HGA+V+IAD RDD  +S+CKDL
Sbjct  1    MATGALLSRAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGESVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+SESDV+ A+N AV  HG+LDIMVNNA        +ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDVEKAINTAVDKHGKLDIMVNNAATGEPVKANILDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P +RGSIIN  SV+  +GG  PHAYT SKH +VGLT+N A
Sbjct  121  VSVNLTGVFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVVGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNC+SPY + + ++R +F +  + ++ VYSNL GV L  EDVAEA L+
Sbjct  181  AELGRYGIRVNCLSPYFILSPLSREFFNVVRNGRVGVYSNLDGVSLQKEDVAEASLF  237



>gb|AFK35915.1| unknown [Medicago truncatula]
Length=272

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 182/238 (76%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +  L+S A +RL+G+VA+ITGG  GIG ATA+LF +HGA+V+IAD +DD+  S+CK+L
Sbjct  1    MSTVPLVSNALRRLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               +S +V CDVT E D++NAVN  V  +G+LDIM NNAGI+G     IL+   ++F +V
Sbjct  61   QKSSSSYVRCDVTKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
             +VN  G FLGTKHA+RVM P +RGSIINTASV G +GG  PHAYT +KHA+VGL +NTA
Sbjct  121  IKVNLTGVFLGTKHASRVMIPARRGSIINTASVCGSIGGVAPHAYTSAKHAVVGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYF-GLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LGR+GIRVNCVSPYI++T + + YF    +DD LDVYSNLKG +L+ +DVAEA LY
Sbjct  181  IELGRFGIRVNCVSPYIVATPLVKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALY  238



>ref|XP_006481517.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 178/243 (73%), Gaps = 8/243 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S++S AA+RL G+VA+ITGG  G G  TA+LF +HGAKVLIAD +DD  +S+CKD+
Sbjct  1    MGSASIVSAAARRLLGKVALITGGASGFGECTARLFSRHGAKVLIADIKDDLGESVCKDI  60

Query  301  G------HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDG  462
            G      +G S+ VHCDVT E +++NAVN AVS +G+LDIM NNAGI      +ILD D 
Sbjct  61   GSSSSSANGCSY-VHCDVTKEKEIENAVNTAVSQYGKLDIMFNNAGIVDEAKHNILDNDQ  119

Query  463  TDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVG  639
             +F  V  VN +G FLGTKHAARVMKP  RGSII+TASV G +GG   HAYT SKH +VG
Sbjct  120  AEFELVLSVNLVGVFLGTKHAARVMKPAGRGSIISTASVCGVIGGVASHAYTSSKHGVVG  179

Query  640  LTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEA  819
            L KN A++LGR+GIRVNCVSPY+++T + ++++ L +D    +YSNL G  L  EDVAEA
Sbjct  180  LMKNAAVELGRFGIRVNCVSPYVVATPLAKDFYKLDDDGLSAIYSNLSGAVLKPEDVAEA  239

Query  820  VLY  828
             LY
Sbjct  240  ALY  242



>ref|XP_006424148.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37388.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=276

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 175/243 (72%), Gaps = 8/243 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S++S AA+RL G+VA+ITGG G IG   A+LF +HGAKVLIAD +DD  +S+C+D+
Sbjct  1    MGSASIVSAAARRLQGKVALITGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDI  60

Query  301  ------GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDG  462
                   +G S+ VHCDVT E D++NAVN AVS +G+LDIM NNAGI      +ILD D 
Sbjct  61   SSSSSSANGCSY-VHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQ  119

Query  463  TDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVG  639
             +F  +  VN +GAFLGTKHAARVMKP  RGSII+TASV G +GG   HAYT SKH +VG
Sbjct  120  AEFERILSVNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVG  179

Query  640  LTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEA  819
            L KNTA++LGR+GIRVN VSPY +S+ M + +  L +D    +YSNL G  L  EDVAEA
Sbjct  180  LMKNTAVELGRFGIRVNSVSPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEA  239

Query  820  VLY  828
             LY
Sbjct  240  ALY  242



>ref|XP_007207105.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
 gb|EMJ08304.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
Length=270

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 174/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SLL+ AA+RL+G+VA+ITGG  GIG +TA+LF +HGA+V+IAD +D  ++S+C+DL
Sbjct  1    MGSFSLLAAAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDGLAESVCRDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               +  FVHCDVT E DV+NAV  A   +G+LDIM NNAG  G    +ILD D  +F  V
Sbjct  61   SSSSISFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGVAKPNILDNDKAEFEQV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
             RVN +GAFLG KHAARVM P  +GSIINTASV   + GG  HAYT SKH IVGL +NTA
Sbjct  121  IRVNLIGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPYI++T + +N+F L ++     YSNLKG  L  ED+AEA LY
Sbjct  181  VELGQHGIRVNCVSPYIVATPLAKNFFKLDDNGVHGAYSNLKGGVLKVEDIAEAALY  237



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 177/238 (74%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S L+ AA+RL+G+VA+ITGG  GIG  TA+LF +HGAKV+IAD +DD  QS+CK+L
Sbjct  1    MASISALTAAARRLEGKVALITGGASGIGEYTAELFTKHGAKVMIADIQDDLGQSVCKNL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGA-KGLDILDCDGTDFVN  477
            G   + ++HCDVT+E+ VQNAV+  V+ + +LDIM NNAGIAG+   L+ILD   ++F  
Sbjct  61   GPSVASYIHCDVTNEAHVQNAVDSTVAKYEKLDIMFNNAGIAGSYPKLNILDITQSEFEE  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  654
            + +VN +G FLGTKHAARVM P ++GSII TAS    +GG  PHAYT SKH IVGLT+NT
Sbjct  121  IIKVNLIGPFLGTKHAARVMIPAKQGSIITTASTCSVIGGGAPHAYTSSKHGIVGLTRNT  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            A++LG+YGIRVNCVSP+++ST + +N+  L ++     YSNLKG     EDVA A L+
Sbjct  181  AVELGKYGIRVNCVSPHVISTPLVKNFLKLDDEGVSKFYSNLKGASCKVEDVANAALF  238



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD +D+   S+C++L   ++ FVHCDVT E DV+NAVN AVS HG+LD
Sbjct  68   RLFAKHGAKVVIADVQDELGHSVCEELKTESASFVHCDVTQEKDVENAVNTAVSKHGKLD  127

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G    +ILD D  +F  V  VN +GAFLGTKHAARVM PV+RGSII+TASV
Sbjct  128  IMFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGTKHAARVMIPVRRGSIISTASV  187

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
             G +GG   HAYT SKH ++GL +NTA++LG++GIRVNCVSPY++ T + +++F L +D+
Sbjct  188  CGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNCVSPYVVLTPLVKDFFKLDDDE  247

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               +YSNLK   L AED+AEA L+
Sbjct  248  VNRLYSNLKEAVLKAEDIAEAALF  271



>gb|ACU18273.1| unknown [Glycine max]
Length=269

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 174/237 (73%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S +S   +RL+G+VA+I+GG  GIG ATA+LF +HGA V+IAD +DD   S+CK L
Sbjct  1    MASISTVSVLDRRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               +  +VHCDVT+E+DVQNAVN A+S +G LDIM NNAGI       ILD    DF  V
Sbjct  61   ESAS--YVHCDVTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RGSIINTASVAG F GG  HAYT SKHA++GL KNTA
Sbjct  119  ISVNLVGPFLGTKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY+++T +T+  F L ED   ++YSNLK V L+  DVAEA LY
Sbjct  179  VELGQFGIRVNCLSPYVVATPLTKKCFNLDEDRNGEIYSNLKSVHLVPNDVAEAALY  235



>ref|XP_010070261.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + +LLS AA+RL+G+VA+ITGG  GIG +TA+LF +HGAKV+IAD  DD  +S+CK+L
Sbjct  1    MAARTLLSLAARRLEGKVAVITGGACGIGESTARLFSKHGAKVIIADINDDLGKSVCKNL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+SE DV+NAV  AV  HG+LDIMVNNA I     L+ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSEPDVENAVATAVDKHGKLDIMVNNAAIGDPTKLNILDNDKADFEKV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P QRGSIIN  SV+  +GG   HAY  SKHAIVGL++N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSQRGSIINVGSVSSSVGGVASHAYASSKHAIVGLSRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNC+SPY + T +T   F L E+ +  VYSNL GV L  EDVAEA L+
Sbjct  181  AELGRYGIRVNCLSPYFIRTPLTEEMFKLDENPEFRVYSNLDGVTLQEEDVAEAALF  237



>ref|XP_010049793.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW82605.1| hypothetical protein EUGRSUZ_C03995 [Eucalyptus grandis]
Length=270

 Score =   241 bits (615),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 173/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + +LLS AA+RL+G+VA+ITGG G IG +TA+LF +HGA+V+IAD RDD  +S+CKDL
Sbjct  1    MATGALLSRAARRLEGKVAMITGGAGDIGESTARLFSKHGARVIIADIRDDLGESVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+SESDV+ A+N AV  HG+LDIMVNNA        +ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDVEKAINTAVEKHGKLDIMVNNAATGEPVKANILDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P +RGSIIN  SV+  +GG  PHAYT SKH ++GLT+N A
Sbjct  121  VSVNLTGVFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVLGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNC+SPY + + +TR +F +  +  + VYSNL GV L  EDVAEA ++
Sbjct  181  AELGRYGIRVNCLSPYFILSPLTREFFNVVRNGGVGVYSNLDGVSLQKEDVAEAAVF  237



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S A +RL+G+VA+ITGG  GIG + A+LF +HGAKV+IAD +D+    +C++L
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHFVCEEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
             + ++ FVHCDVT E DV+NAVN AVS HG+LDIM NNAG A     +ILD D  +F  V
Sbjct  61   KNESASFVHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGAADTPKPNILDNDKAEFEKV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +GAFLGTKHAARVM P +RGSII+TASV G +GG   HAYT SKH ++GL +NTA
Sbjct  121  LSVNIVGAFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY++ T + +++F L +++    YSNL+   L AED+AEA L+
Sbjct  181  VELGQHGIRVNCVSPYVVLTPLVKDFFKLDDNEVNRFYSNLREAVLKAEDIAEAALF  237



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 174/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL+S A +RL+G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +D+   S+CK+L
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + F+HCDVT E DV+NAVN AVS +G+LDIM NNAG  G    +I++ D  +F  +
Sbjct  61   EPEPASFIHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGTGGTPKTNIIENDKAEFEKI  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
               N +GAFLGTKHAARVM P +RGSII TASV   + GG  HAYT SKH ++GL +NTA
Sbjct  121  ICANLVGAFLGTKHAARVMIPARRGSIITTASVCAIIGGGSSHAYTSSKHGVLGLMRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG+YGIRVNCVSPY + T + +N+F + +D+   +YSNLK   L AED+AEA LY
Sbjct  181  VELGQYGIRVNCVSPYAVPTPLFKNFFKMNDDEVSCIYSNLKEAVLEAEDIAEAALY  237



>gb|KDP34951.1| hypothetical protein JCGZ_09239 [Jatropha curcas]
Length=246

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++ LL   A+RL+G+VA+ITGG   IG++ A+ FC+HGAKV+I D +DD  QS+ K+L
Sbjct  1    MATNFLLPINARRLEGKVALITGGATSIGASIARTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDVT ESD++NAV+ A+S  G+LDI+VNNA I   +   I+D D  DF  V
Sbjct  61   GTDKAVFVHCDVTIESDIENAVDTAISIFGKLDIIVNNAAIGDPRKPSIVDNDVVDFKRV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             +VN +G FLG KHAARVM P ++GSII   SV   +GG   HAYT +KH IVGL KN A
Sbjct  121  VKVNLIGVFLGPKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGIVGLAKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LG++GIRVNC+S Y + T +T N+F + ED K  VYSNLKGV L  EDVAEA +Y
Sbjct  181  AELGQFGIRVNCLSSYFIETPLTMNFFKMKEDGKSGVYSNLKGVKLKEEDVAEAAIY  237



>ref|XP_009340877.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=263

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            ++F +HGAKV+IAD +DD  +S+ +DL   ++ FVHCDVT E D++NAV  A S +G+LD
Sbjct  27   RVFSKHGAKVVIADVQDDLGESVFRDLNSSSASFVHCDVTKEEDIENAVKTATSKYGKLD  86

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G    +ILD D  +F  V  VN +G+FLG KHAARVM P  +GSIINTASV
Sbjct  87   IMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGIKHAARVMIPAGQGSIINTASV  146

Query  580  AGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               + GG PHAYT SKH +VGL KN A++LG+YGIRVNCVSPY+++T + +++F L +D 
Sbjct  147  CSTIGGGAPHAYTSSKHGVVGLMKNAAVELGQYGIRVNCVSPYLVATPLAKDFFNLDDDG  206

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               VYSNLKG  L  EDVAEA LY
Sbjct  207  VHGVYSNLKGKVLRPEDVAEAALY  230



>gb|KDP34955.1| hypothetical protein JCGZ_09243 [Jatropha curcas]
Length=270

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +S LL   A+RL+G+VA+ITGG  GIG++ A  FC+HGAKV+I D +DD  QS+ K+L
Sbjct  1    MATSFLLPINARRLEGKVALITGGATGIGASIATTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDVT ESD++NAV+ A+S   +LDIMVNNA IA  + L I+D D +DF  V
Sbjct  61   GTDKAIFVHCDVTIESDIKNAVDIAISIFRKLDIMVNNAAIADPRKLSIVDNDISDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             +VN +G FLGTKHAARVM P ++GSII   SV   +GG   HAYT +KH +VGL KN A
Sbjct  121  VKVNLIGVFLGTKHAARVMIPARQGSIITLGSVCSSVGGVAFHAYTSTKHGVVGLAKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGR+GIRVNC+S Y + T +T N+F + ED K  VYSNL+GV L  EDVA+A +Y
Sbjct  181  AELGRFGIRVNCLSCYFIETPLTMNFFKMEEDGKSGVYSNLEGVKLKEEDVAQAAIY  237



>gb|KEH29815.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGA+V+IAD +DD+  S+CK+L   +S +V CDVT E D++NAVN  V  +G+LD
Sbjct  28   RLFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKLD  87

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI+G     IL+   ++F +V +VN  G FLGTKHA+RVM P +RGSIINTASV
Sbjct  88   IMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHASRVMIPARRGSIINTASV  147

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF-GLAED  753
             G +GG  PHAYT +KHA+VGL +NTA++LGR+GIRVNCVSPYI++T + + YF    +D
Sbjct  148  CGSIGGVAPHAYTSAKHAVVGLMRNTAIELGRFGIRVNCVSPYIVATPLVKKYFKLDDDD  207

Query  754  DKLDVYSNLKGVDLMAEDVAEAVLY  828
            D LDVYSNLKG +L+ +DVAEA LY
Sbjct  208  DVLDVYSNLKGANLVPKDVAEAALY  232



>ref|XP_009340879.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=273

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            ++F +HGAKV+IAD +DD  +S+C DL   +  FVHCDVT E D++NAV  A S +G+LD
Sbjct  37   RVFSKHGAKVVIADVQDDLGESVCTDLNSSSVSFVHCDVTKEEDIENAVKTATSKYGKLD  96

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G    +ILD D  +F  V  VN +G+FLGTKHAARVM P  +GSIINTASV
Sbjct  97   IMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGTKHAARVMIPAGQGSIINTASV  156

Query  580  AGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               + GG  HAYT SKH +VGL KN A++LG+YGIRVNCVSPY+++T + +++F L +D 
Sbjct  157  CSTIGGGSSHAYTSSKHGVVGLMKNAAVELGQYGIRVNCVSPYLVATPLAKDFFNLDDDG  216

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               VYSNLKG  L  EDVAEA LY
Sbjct  217  VHGVYSNLKGKVLRPEDVAEAALY  240



>ref|XP_006481515.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=273

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 151/210 (72%), Gaps = 8/210 (4%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDL------GHGNSFFVHCDVTSESDVQNAVNKAVS  381
            +LF +HGAKVLIAD +DD  +S+C+D+       +G S+ VHCDVT E D++NAVN AVS
Sbjct  31   RLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSY-VHCDVTKEKDIENAVNTAVS  89

Query  382  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  561
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  90   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  149

Query  562  INTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF  738
            I+TASV G +GG   HAYT SKH +VGL KNTA++LGR+GIRVNCVSPY +S+ M + + 
Sbjct  150  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNCVSPYAVSSPMAKGFL  209

Query  739  GLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             L +D    +YSNL G  L  EDVAEA LY
Sbjct  210  KLDDDGMSGIYSNLSGAVLKPEDVAEAALY  239



>ref|XP_008246119.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Prunus 
mume]
Length=257

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 150/204 (74%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD +DD ++S+C+DL   ++ FVHCDVT E DV+NAV  A S +G+LD
Sbjct  21   RLFSKHGAKVVIADVQDDLAESICRDLSSSSTSFVHCDVTKEEDVENAVKTATSKYGKLD  80

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGIAG    +ILD D  +F  V  VN +G FLG KHAARVM    +GSIINTAS 
Sbjct  81   IMFNNAGIAGTAKTNILDNDKAEFEQVIGVNLVGVFLGIKHAARVMISAGQGSIINTASA  140

Query  580  AGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               +GG   HAYT SKH ++GL +NTA++LG++GIRVNCVSPYI++T + +++F L +D 
Sbjct  141  CSTIGGCASHAYTSSKHGVLGLVRNTAIELGQHGIRVNCVSPYIVATPLAKDFFKLDDDG  200

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               VYSNLKG  L AED+AEA LY
Sbjct  201  VHGVYSNLKGEVLKAEDIAEAALY  224



>gb|KDP34949.1| hypothetical protein JCGZ_09237 [Jatropha curcas]
Length=270

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 167/237 (70%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+ LL   A+RL+G+VA+ITGG   IG++  + FC+HGAKV+I D +DD  QS+ K+L
Sbjct  1    MASNFLLPFNARRLEGKVALITGGATSIGASIVRTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDVT ESD++NAV+ A+    +LDIMVNNA I   +   I+D D  DF  V
Sbjct  61   GTDKAIFVHCDVTIESDIENAVDTAIFIFKKLDIMVNNAAIGDPRKPSIVDNDIADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             +VN +G FLGTKHAARVM P ++GSII   SV   +GG   HAYT +KH +VGL KN A
Sbjct  121  VKVNLIGVFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGVVGLAKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGR+GIRVNC+SPY + T ++ N+F + ED K  VYSNL+GV L  EDVA+A +Y
Sbjct  181  AELGRFGIRVNCLSPYFIETPLSMNFFKMKEDGKSGVYSNLEGVKLTEEDVAQAAIY  237



>gb|KCW45306.1| hypothetical protein EUGRSUZ_L01036, partial [Eucalyptus grandis]
Length=230

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 164/230 (71%), Gaps = 1/230 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + +LLS AA+RL+G+VA+ITGG GGIG +TA+LF +HGA+V+I D RDD  +S+CKDL
Sbjct  1    MATGALLSQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIGDIRDDLGKSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+SESD++NA+  AV  HG+LDIMVNNA I       ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHA R M P QRGSIIN  SV   +GG   HAYT SKHA++GLT+  A
Sbjct  121  VSVNLTGVFLGTKHATRAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRKVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAED  807
             +LGRYG+R+NC+SPY + T +T+  F + ED  + VYSN+ GV L  ED
Sbjct  181  AELGRYGVRINCLSPYFILTPLTKAIFQIDEDAGVRVYSNMDGVTLRQED  230



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   236 bits (602),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 176/237 (74%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + S +S   +RL+G+VAIITGG  GIG ATA+LF +HGA V+IAD +DD   S+CK L
Sbjct  1    MATVSAVSAPIRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+N VN AVS +G+LDIM+NNAGI       ILD + +DF +V
Sbjct  61   E--SASYVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM   +RGSIINTASVAG +GG   HAYT SKHA++GL K+TA
Sbjct  119  ISVNLVGPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY++ T +T+ +  + E+   ++YSNLKGV L+  DVAEA LY
Sbjct  179  VELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALY  235



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   236 bits (601),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 176/237 (74%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + S +S   +RL+G+VAIITGG  GIG ATA+LF +HGA ++IAD +DD   S+CK L
Sbjct  1    MATVSAVSAPIRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+N VN AVS +G+LDIM+NNAGI       ILD + +DF +V
Sbjct  61   E--SASYVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM   +RGSIINTASVAG +GG   HAYT SKHA++GL K+TA
Sbjct  119  ISVNLVGPFLGTKHAARVMIAAKRGSIINTASVAGILGGVATHAYTSSKHALIGLMKSTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY++ T +T+ +  + E+   ++YSNLKGV L+  DVAEA LY
Sbjct  179  VELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALY  235



>ref|XP_002523859.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38585.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=272

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 174/238 (73%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + SLLS A +RL+G+VA+ITG   GIG   A+LF +HGA ++IAD +D+   S+C++L
Sbjct  1    MSTLSLLSGALRRLEGKVALITGAASGIGECAARLFSKHGANLVIADVQDELGHSVCREL  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
               +S  ++HC+VT E DV+NAVN AVS +G+LDIM NNAG+ G    +ILD D  +F  
Sbjct  61   DSPSSVSYIHCNVTREEDVENAVNTAVSKYGKLDIMFNNAGVVGIAKPNILDNDKAEFEK  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  654
            +  VN +GAFLGTKHAARVM P ++GSIINTASV   +GG   HAYT SKH +VGLT+NT
Sbjct  121  IISVNLVGAFLGTKHAARVMIPNRKGSIINTASVCSIIGGVASHAYTSSKHGVVGLTRNT  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            A++LGR+GIRVNCVSPY+++T + +++F L +D    VYS LK   L  EDVAEA LY
Sbjct  181  AVELGRHGIRVNCVSPYLVATPLAKDFFKLDDDGVYRVYSVLKEAVLGPEDVAEAALY  238



>ref|XP_009340878.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=274

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            ++F + GAKV+IAD +DD  +S+C+DL   ++ FVHCDVT E D+++AV  A S +G+LD
Sbjct  38   RVFSKLGAKVVIADVQDDLGESVCRDLNSSSASFVHCDVTKEEDIEHAVKTATSKYGKLD  97

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G    +ILD    +F  V RVN +GAFLG KHAARVM P  +GSIINTASV
Sbjct  98   IMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLGIKHAARVMIPAGQGSIINTASV  157

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               MGG   HAYT SKH +VGL KN A++LG+YGIRVNCVSPY+++T + +++F L +D 
Sbjct  158  CSTMGGIASHAYTSSKHGVVGLMKNAAVELGQYGIRVNCVSPYLVATPLAKHFFNLEDDG  217

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               VYSNLKG  L  EDVAEA LY
Sbjct  218  VHGVYSNLKGKVLRPEDVAEAALY  241



>gb|KHN11533.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S +S   +RLDG+VAIITGG  G+G+ATA+LF +HGA V+IAD +DD   S+ K+L
Sbjct  1    MASVSSVSAPFRRLDGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT+E+DV+N VN AVS +G+LDIM NNAGI       I+D   +DF  V
Sbjct  61   E--SASYVHCDVTNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P ++G IINTASVAG + GG  HAYT SKHA++GLTKNTA
Sbjct  119  IGVNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY++ T +++ YF + ED   ++YSNLKG  L+  DVAEA LY
Sbjct  179  VELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALY  235



>ref|XP_006424147.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37387.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=273

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 150/210 (71%), Gaps = 8/210 (4%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDL------GHGNSFFVHCDVTSESDVQNAVNKAVS  381
            +LF +HGAKVLIAD +DD  +S+C+D+       +G S+ VHCDVT E D++NAVN AVS
Sbjct  31   RLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSY-VHCDVTKEKDIENAVNTAVS  89

Query  382  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  561
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  90   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  149

Query  562  INTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF  738
            I+TASV G +GG   HAYT SKH +VGL KNTA++LGR+GIRVN VSPY +S+ M + + 
Sbjct  150  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNSVSPYAVSSPMAKGFL  209

Query  739  GLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             L +D    +YSNL G  L  EDVAEA LY
Sbjct  210  KLDDDGMSGIYSNLSGAVLKPEDVAEAALY  239



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 177/237 (75%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S +S   +RL+G+VAIITGG  GIG ATA+LF +HGA ++IAD +DD   S+CK L
Sbjct  70   MASASAVSAHVRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL  129

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+N VN AVS +G+LDIM+NNAGI       ILD + +DF +V
Sbjct  130  E--SASYVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESV  187

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM   +RGSIINTASVAG +GG   HAYT SKHA++GL K+TA
Sbjct  188  ISVNLVGPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTA  247

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY++ T +T+ +  + E+   ++YSNLKGV L+  DVAEA LY
Sbjct  248  VELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALY  304



>gb|KCW58914.1| hypothetical protein EUGRSUZ_H01537, partial [Eucalyptus grandis]
Length=235

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 144/204 (71%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  DD  +S+CK+LG   + FVHCDV+SE DV+NAV  AV  HG+LD
Sbjct  4    RLFSKHGAKVIIADINDDLGKSVCKNLGPETASFVHCDVSSEPDVENAVATAVDKHGKLD  63

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IMVNNA I     L+ILD D  DF  V  VN  G FLGTKHAAR M P QRGSIIN  SV
Sbjct  64   IMVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVFLGTKHAARAMIPSQRGSIINVGSV  123

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            +  +GG   HAY  SKHAIVGL++N A +LGRYGIRVNC+SPY + T +T   F L E+ 
Sbjct  124  SSSVGGVASHAYASSKHAIVGLSRNAAAELGRYGIRVNCLSPYFIRTPLTEEMFKLDENP  183

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
            +  VYSNL GV L  EDVAEA L+
Sbjct  184  EFRVYSNLDGVTLQEEDVAEAALF  207



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 176/241 (73%), Gaps = 6/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S LS+  +RL+G+VA+ITGG  GIG +TAKLF +HGAKV I D  D+   S+ K +
Sbjct  1    MAYFSTLSSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS ++HCDVT+E DV+NAV+K VST+G+LDIM NNAGIA    L I+D +  DF  V
Sbjct  61   GPSNSTYIHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P + G+II+TAS+A  MGG   HAYTCSKHA+VGLT+N+A
Sbjct  121  LAVNVTGVFLGMKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVL  825
            ++LG+YGIRVNC+SPY L++ ++R Y G+ ED++L+      +NLKG  L A+D+A A L
Sbjct  181  IELGQYGIRVNCMSPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAAL  239

Query  826  Y  828
            +
Sbjct  240  F  240



>emb|CDP06869.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 174/242 (72%), Gaps = 11/242 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + ++ S   KRL G+VA+ITG   GIG + A+LF +HGAKV++AD +DD +Q +C+DL
Sbjct  1    MANMAVASNVMKRLQGKVALITGAASGIGESAARLFVKHGAKVVVADIQDDLAQKVCQDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++  VHCDVT ESD++NAVN AVS +G+LDIM NNAGI G++  +ILD   +DF  V
Sbjct  61   DPSSASHVHCDVTQESDIENAVNTAVSKYGKLDIMFNNAGIGGSRTSNILDDKKSDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLG KHAARVM P + GSIINTASV   + GG PHAY  SKHA+VGLT+NTA
Sbjct  121  ISVNLVGIFLGAKHAARVMIPNRCGSIINTASVCSTLGGGAPHAYVSSKHAVVGLTRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQ-----MTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAV  822
            +DLGRYGIRVNC+SPY +ST      + R Y G+++     VY+ L G +L AEDVA+A 
Sbjct  181  VDLGRYGIRVNCLSPYFVSTPSAADFVERIYGGVSK-----VYTYLDGAELKAEDVADAA  235

Query  823  LY  828
            LY
Sbjct  236  LY  237



>ref|XP_010262933.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262934.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262935.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=277

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 174/242 (72%), Gaps = 7/242 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M    LLS   +RL+G+VA+ITGG  GIG +TA+LF  HGAKV+IAD  D+   S+C+++
Sbjct  1    MEGGPLLSNITRRLEGKVALITGGASGIGRSTARLFANHGAKVVIADVEDELGHSICEEV  60

Query  301  G-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G  G   F+HCDVT ++DV+NAV+  V  HG+LDIM +NAGI G+    ILD D  +F  
Sbjct  61   GSEGTICFIHCDVTKDADVRNAVDSTVDKHGKLDIMFSNAGITGSPTKKILDSDNENFRK  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  654
            V  VNT GAFLG KHA RVM P+++G+II T+SVA  + G  P+AY  SKHA+VGLTKN 
Sbjct  121  VLEVNTFGAFLGAKHATRVMIPLKKGTIIFTSSVASVIAGDTPYAYAASKHAVVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAV  822
            +++LG+YGIRVNC+SPY L+T M R   GL E++K++ Y    +NLKGV L AEDVAEA 
Sbjct  181  SVELGQYGIRVNCISPYGLATPMLRTATGL-EEEKIEAYLSGGANLKGVVLKAEDVAEAA  239

Query  823  LY  828
            LY
Sbjct  240  LY  241



>ref|XP_009411944.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 171/240 (71%), Gaps = 5/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + S L   AK+L+G+VA+ITGG  GIG  TAKLFC+HGAKV++AD +D+   ++C  L
Sbjct  1    MATCSDLPADAKKLEGKVALITGGASGIGECTAKLFCRHGAKVVVADVQDELGTAVCSGL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   SF +HCDVTSE DV  AV+ AV+  GRLDIM NNAGI GA   +IL C+ +DF  V
Sbjct  61   GPAASF-IHCDVTSEDDVSAAVDHAVAKFGRLDIMFNNAGITGAACHNILQCEKSDFERV  119

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P ++GSII T+S+AG +G    HAYTCSKHA+VGLTKN A
Sbjct  120  VGVNLVGPFLGTKHAARVMIPARKGSIITTSSLAGVIGAAAAHAYTCSKHAVVGLTKNAA  179

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LG++G+RVNCVSP   +T +   Y GL   A D  +   +NLKGV L  EDVA+AVLY
Sbjct  180  AELGQFGVRVNCVSPAAAATPLAMRYVGLEGEAFDMAMTAVANLKGVSLGTEDVADAVLY  239



>ref|XP_007132471.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
 gb|ESW04465.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
Length=269

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 171/237 (72%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +  L+S A KRL+G+VA+ITGG  GIG ATA+LF +HGA V+IAD +D    S+ K+L
Sbjct  1    MATLPLISAAGKRLEGKVAMITGGASGIGEATARLFSKHGAHVVIADIQDHLGLSLSKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ ++HCDVT+E  V+NAVN  VS HG+LD M NNAGI GA    ILD   ++F  V
Sbjct  61   E--SASYIHCDVTNEDHVENAVNTVVSKHGKLDTMFNNAGITGANKTSILDNTKSEFEAV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P  RGSI+NTASV G +GG   HAYT SKH +VGLT+NTA
Sbjct  119  INVNLVGVFLGTKHAARVMIPAGRGSIVNTASVCGSIGGVASHAYTSSKHGVVGLTRNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG +G+RVNCVSPY+++T + +N+F L +     VY+NLKG  L  +DVAEA LY
Sbjct  179  VELGAFGVRVNCVSPYVVATPLAKNFFKLDDKGVHGVYTNLKGAVLEPKDVAEAALY  235



>ref|NP_001239862.1| uncharacterized protein LOC100794412 [Glycine max]
 gb|ACU19399.1| unknown [Glycine max]
 gb|KHN44551.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 175/237 (74%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S +    +RLDG+VAIITGG  G+G+ATA+LF +HGA V+IAD +DD   S+ K+L
Sbjct  1    MASVSSVLAPFRRLDGKVAIITGGASGLGAATARLFSKHGAYVVIADIQDDLGLSVAKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+N VN  VS +G+LDIM NNAG++      ILD + +DF  V
Sbjct  61   E--SASYVHCDVTKEEDVENCVNTTVSKYGKLDIMFNNAGVSDEIKTSILDNNKSDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P ++G IINTASVAG + GG  HAYT SKHA++GLTKNTA
Sbjct  119  ISVNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY++ T +++ YF + ED   ++YSNLKG  L+  DVAEA LY
Sbjct  179  VELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALY  235



>ref|XP_003546632.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=269

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 176/237 (74%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S +S   +RL+G+VAIITGG  G+G+ATA+LF +HGA V+IAD +DD   S+ K+L
Sbjct  1    MASVSSVSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCD T+E+DV+N VN AVS +G+LDIM NNAGI       I+D   +DF  V
Sbjct  61   E--SASYVHCDATNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P ++G IINTASVAG + GG  HAYT SKHA++GLTKNTA
Sbjct  119  IGVNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY++ T +++ YF + ED   ++YSNLKG  L+  DVAEA LY
Sbjct  179  VELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALY  235



>ref|XP_007132474.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
 gb|ESW04468.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
Length=268

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 171/237 (72%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S++S A KRL+G+VAIITGG  GIG ATA+LF +HGA V+IAD +DD   S+C +L
Sbjct  1    MAHVSVVSAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+  VN AVS +G+LDI++NNAG        I++    DF  V
Sbjct  61   E--SAVYVHCDVTKEEDVEKCVNVAVSKYGKLDIVLNNAGTCDEFKRSIVENSKCDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RG IINT+SVAG +GG  PHAYT SKH +VGLTKNTA
Sbjct  119  INVNLVGPFLGTKHAARVMIPAKRGCIINTSSVAGCIGGGAPHAYTISKHGLVGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY+++T +   YF L E+   + YSNLKG  L+  DVAEA LY
Sbjct  179  VELGQFGIRVNCVSPYVVATPLLNKYFNLDEEGVREAYSNLKGSYLVPNDVAEAALY  235



>gb|KDP26161.1| hypothetical protein JCGZ_22863 [Jatropha curcas]
Length=270

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF--FVHCDVTSESDVQNAVNKAVSTHGR  393
            +LF +HGA+V+IAD +D+   S+ K++     +  FVHCDVT E DV+NAVN AVS +G 
Sbjct  31   RLFSKHGAQVVIADIQDELGHSVRKEIDRDGKYCSFVHCDVTKEEDVENAVNSAVSKYGE  90

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            LDIM NNAGI GA   +ILD +  +F  +  VN +GAFLGTKHAARVM P ++GSI+ TA
Sbjct  91   LDIMFNNAGIVGAVKPNILDNEKAEFEKIISVNLVGAFLGTKHAARVMIPNRKGSIMTTA  150

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVA  +GG  PHAYT SKH +VGL +NTA++LG++GIRVNC+SPY+++T + R++F L +
Sbjct  151  SVASTIGGLAPHAYTSSKHGVVGLMRNTAVELGQHGIRVNCISPYVVNTPLARDFFKLDD  210

Query  751  DDKLDVYSNLKGVDLMAEDVAEAVLY  828
                DVYSNLK   L  EDVA+A LY
Sbjct  211  HGVYDVYSNLKEAVLEPEDVAQAALY  236



>gb|AEC10992.1| alcohol dehydrogenase [Camellia sinensis]
Length=277

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S+LS AA+RL+G+VA+ITGG  GIG  TA+LF +HGAKV+IAD +DD   S+CKDL
Sbjct  1    MASFSILSAAARRLEGKVALITGGASGIGECTARLFSKHGAKVMIADIQDDLGLSVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               +  FVHCDVT+E+ V NAV+ AV+  G+LDIM NNAGI G    +ILD D  +F  +
Sbjct  61   DEKSVSFVHCDVTNETHVMNAVDAAVAQFGKLDIMYNNAGIVGLAKPNILDNDKDEFEKI  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +GAFLGTK AARVM   +RG+II TASV   +GG   HAYT SKH + GLTKN A
Sbjct  121  IRVNLVGAFLGTKQAARVMILNRRGTIITTASVCSPIGGVASHAYTSSKHGVAGLTKNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++ G++GIRVNCVSPY++ T + ++++ L ++    VYSNLKG  L  EDVA+A LY
Sbjct  181  VEFGQHGIRVNCVSPYLVGTPLAKDFYKLDDEGVYGVYSNLKGAVLRPEDVAQAALY  237



>gb|KCW83006.1| hypothetical protein EUGRSUZ_C04389, partial [Eucalyptus grandis]
Length=265

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +++LL   A+RL+G+VA+ITGG GGIG +TA+LF +HGAKV+IAD RDD  + +CKDL
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+ ESDV+NA+  AV   G+LDIMVNNA I+     +ILD D  DF  V
Sbjct  61   GAETASFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHA+VGLT+N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNCVSPY + T +T+ +F + E   + VYSNL GV L  EDVA+A +Y
Sbjct  181  AELGRYGIRVNCVSPYFILTPLTKEFFKVDESSGVRVYSNLDGVSLQEEDVAKAAVY  237



>gb|AHH81853.1| short-chain alcohol dehydrogenase [Perilla frutescens]
Length=277

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 175/241 (73%), Gaps = 6/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S LS+  +RL+G+VA+ITGG  GIG +TAKLF +HGAKV I D  D+   S+ K +
Sbjct  1    MAYFSTLSSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS ++HCDVT+E DV+NAV+K VST+G+LDIM NNAGIA    L I+D +  DF  V
Sbjct  61   GPSNSTYIHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G F G KHAARVM P + G+II+TAS+A  MGG   HAYTCSKHA+VGLT+N+A
Sbjct  121  LAVNVTGVFQGMKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVL  825
            ++LG+YGIRVNC+SPY L++ ++R Y G+ ED++L+      +NLKG  L A+D+A A L
Sbjct  181  IELGQYGIRVNCMSPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAAL  239

Query  826  Y  828
            +
Sbjct  240  F  240



>ref|XP_010050120.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 171/237 (72%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +++LL   A+RL+G+VA+ITGG GGIG +TA+LF +HGAKV+IAD RDD  + +CKDL
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+ ESDV+NA+  AV   G+LDIMVNNA I+     +ILD D  DF  V
Sbjct  61   GAETASFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHA+VGLT+N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNCVSPY + T +T+ +F + E   + VYSNL GV L  EDVA+A +Y
Sbjct  181  AELGRYGIRVNCVSPYFILTPLTKEFFKVDESSGVRVYSNLDGVSLQEEDVAKAAVY  237



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   231 bits (589),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 175/241 (73%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +++ +ST A+RL G+VA+ITGG  GIG  TAK+F  HGAKV+IAD +D+   S+ + L
Sbjct  1    MSTTAFISTIARRLQGKVALITGGASGIGECTAKVFSHHGAKVVIADIQDELGHSVVEAL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +V CDVT E+ ++NAV+KA+ST+G+LDIM+NNAGIA      I+D +  DF  V
Sbjct  61   GPSNSTYVRCDVTEEAQIKNAVDKAISTYGKLDIMLNNAGIADDSKARIIDNEMADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             ++N  G FLG KHAARVM P + G+II+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LKINVTGVFLGIKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVL  825
             +LG++GIRVNC+SPY L+T + R + G+ +D+ L++    ++NLKGV L  EDVA A L
Sbjct  181  AELGQFGIRVNCLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF--FVHCDVTSESDVQNAVNKAVSTHGR  393
            +LF +HGA+V+IAD +D+   S+CK++     +  FVHCDVT E DV+NA+N AVS +G+
Sbjct  31   RLFSKHGAQVVIADIQDELGHSLCKEIDRDGKYCSFVHCDVTKEEDVENALNSAVSKYGK  90

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            LDIM NNAGI G    +ILD +  +F  +  VN +GAFLGTKHAARVM P ++GSII TA
Sbjct  91   LDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLVGAFLGTKHAARVMIPNRKGSIITTA  150

Query  574  SVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            S+   +GG   HAYT SKH +VGL +NTA++LG++GIRVNCVSPY+++T + R++F L +
Sbjct  151  SICSTIGGVASHAYTSSKHGVVGLMRNTAVELGQHGIRVNCVSPYVVNTPLARDFFKLDD  210

Query  751  DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +   DVYSNLK   L  EDVA+A LY
Sbjct  211  NGIYDVYSNLKEAVLQPEDVAQAALY  236



>ref|XP_011094269.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=276

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 174/240 (73%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+SL+S   +RL+G+VA++TGG  GIG  TAKLF +HGAKV IAD +D+ + S+   +
Sbjct  1    MASASLVSALTRRLEGKVALVTGGASGIGECTAKLFSKHGAKVAIADIQDELAHSVVNSI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            GH NS ++HCDVT+E  V+NAV+K VST+G+LDIM NNAGIA      I+D + +DF  V
Sbjct  61   GHSNSTYIHCDVTNEDHVKNAVDKTVSTYGKLDIMFNNAGIADRPKPRIIDNEKSDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  657
              +N  G FLG KHAARVM P + G+II+TAS+ +G  G   HAYTCSKHA+VGLT+N A
Sbjct  121  MSINVTGVFLGMKHAARVMVPARSGTIISTASLGSGIGGAATHAYTCSKHAVVGLTRNLA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY L+T + + +  L +   ++ +   +NLKGV L AEDVA A L+
Sbjct  181  VELGQFGIRVNCLSPYALATPLAKKFLELDDEGVENAMSYMANLKGVTLKAEDVANAALF  240



>gb|KCW83009.1| hypothetical protein EUGRSUZ_C04391, partial [Eucalyptus grandis]
Length=287

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +++LL   A+RL+G+VA+ITGG GGIG +TA+LF +HGAKV+IAD RDD  +S+C DL
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+ ESDV+NA+  AV   G+LDIMVNNA I+     +ILD D  DF  V
Sbjct  61   GAETASFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHAIVGLT+N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNC+SPY + T +T+ +F + E+  + VYSNL GV L  EDVA+A +Y
Sbjct  181  SELGRYGIRVNCLSPYFILTPLTKEFFKIDENAGVRVYSNLDGVSLQEEDVAKAAVY  237



>ref|XP_010051779.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=318

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 172/237 (73%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +++LL   A+RL+G+VA+ITGG GGIG +TA+LF +HGAKV+IAD RDD  +S+C DL
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+ ESDV+NA+  AV   G+LDIMVNNA I+     +ILD D  DF  V
Sbjct  61   GAETASFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHAIVGLT+N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGRYGIRVNC+SPY + T +T+ +F + E+  + VYSNL GV L  EDVA+A +Y
Sbjct  181  SELGRYGIRVNCLSPYFILTPLTKEFFKIDENAGVRVYSNLDGVSLQEEDVAKAAVY  237



>ref|XP_007132475.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
 gb|ESW04469.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
Length=268

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 166/234 (71%), Gaps = 3/234 (1%)
 Frame = +1

Query  130  SSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHG  309
            S + S  A+RL+G+VA+ITGG  GIG  TA+LF +HGAKV+IAD +D+   S+CKD+   
Sbjct  5    SGVSSAVARRLEGKVALITGGASGIGECTARLFAKHGAKVVIADIQDELGHSVCKDID--  62

Query  310  NSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRV  489
            +SF+VHCDVT E  V+ AVN AVS  G+LDIM NNAGI G    +I+    +DF  V R 
Sbjct  63   SSFYVHCDVTKEEHVERAVNTAVSRFGKLDIMHNNAGIIGVWNPNIIHNKKSDFEEVIRT  122

Query  490  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDL  666
            N +G FLG KHAARVM P +RGSII TAS  G +GG   HAYTCSKH IVGL +N A++L
Sbjct  123  NLVGVFLGMKHAARVMAPSRRGSIIATASTCGRIGGMASHAYTCSKHGIVGLVRNAAVEL  182

Query  667  GRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            G  GIRVNCVSPY + T M++++    ++    +YSNLKGV L  +DVAEAV+Y
Sbjct  183  GPLGIRVNCVSPYAVPTPMSKSFLNTDDEGIAALYSNLKGVTLKPQDVAEAVVY  236



>emb|CDP06868.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 170/242 (70%), Gaps = 11/242 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + ++ S   KRL G+VA+ITG   GIG + A+LF +HGAKV+IAD +DD ++ +C+DL
Sbjct  1    MANMAIASNIMKRLQGKVALITGAASGIGESAARLFVKHGAKVVIADIQDDLAKKVCQDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++  VHCD T ESD++NAVN  VS +G+LDIM NNAGIAG+   +ILD   +DF  V
Sbjct  61   DPSSASHVHCDTTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P + GSIINTAS    + GG PHAY  SKHA+VGLT+NTA
Sbjct  121  ISVNLVGVFLGTKHAARVMIPNRCGSIINTASSCSTLGGGAPHAYVSSKHAVVGLTRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMT-----RNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAV  822
            +DLGRYGIRVNC+SPY + T +      R Y G+++     VY  L G +L AEDVA+A 
Sbjct  181  IDLGRYGIRVNCLSPYYVPTPLAADVVERIYGGVSK-----VYKFLDGAELKAEDVADAA  235

Query  823  LY  828
            LY
Sbjct  236  LY  237



>gb|ACU19531.1| unknown [Glycine max]
Length=269

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 175/237 (74%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S +S   +RL+G+VAIITGG  G+G+ATA+LF +HGA V+IAD +DD   S+ K+L
Sbjct  1    MASVSSVSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT+E DV+N VN AVS +G+LDI+ NNAGI       I+D   +DF  V
Sbjct  61   E--SASYVHCDVTNEIDVENCVNTAVSKYGKLDIIFNNAGIIDEIKTSIVDNSKSDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              V  +G FLGTKHAARVM P ++G IINTASVAG + GG  HAYT SKHA++GLTKNTA
Sbjct  119  IGVILVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY++ T +++ YF + ED   ++YSNLKG  L+  DVAEA LY
Sbjct  179  VELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALY  235



>ref|XP_004139501.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004159104.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN64962.1| TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 169/239 (71%), Gaps = 4/239 (2%)
 Frame = +1

Query  124  VSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG  303
            +S  LL   A+RL+G+VA+ITGG  GIG  TAKLF +HGAKV+IAD +D   Q++CKDLG
Sbjct  1    MSIQLLPAIARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLG  60

Query  304  HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGI-AGAKGLDILDCDGTDFVNV  480
              +S FVHCDVT E DV+ AV+ AVS +G+LDIM+NNAG+   +   DIL  D   F  V
Sbjct  61   QSSSVFVHCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDILKDDPLTFQRV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
              VN +GAFLGTKHAARVMKP  RGSI+ TAS+   +GG   HAYT SKH ++GL +N A
Sbjct  121  VNVNLVGAFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLM-AEDVAEAVLY  828
            +DLGRYGIRVNCVSP ++ T+M R  F + +  +    Y +LK  D++  EDV EAV+Y
Sbjct  181  VDLGRYGIRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVY  239



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 173/241 (72%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +++ +S+ AKRL G+VA+ITGG  GIG  TAK+F  HGAKV+IAD +D+   S+ + L
Sbjct  1    MSTTAFISSIAKRLQGKVALITGGASGIGECTAKVFSHHGAKVIIADIQDELGHSVVEAL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +V CDVT E+ ++N V+ A+ST+G+LDIM+NNAGIA      I+D +  DF  V
Sbjct  61   GPSNSTYVRCDVTEEAQIKNVVDTAISTYGKLDIMLNNAGIADDNKSRIIDNEMADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             ++N  G FLG KHAARVM P + G+II+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LKINVTGVFLGIKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVL  825
             +LG++GIRVNC+SPY L+T + R + G+ +D+ L++    ++NLKGV L  EDVA A L
Sbjct  181  AELGQFGIRVNCLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>emb|CDP06870.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 170/238 (71%), Gaps = 11/238 (5%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
            ++ S   KRL G+VA+ITG   GIG +TA+LF ++GAKV+IAD +DD ++ +C+DL   +
Sbjct  2    AIASNIMKRLQGKVALITGAASGIGESTARLFVKYGAKVVIADIQDDLAKKVCQDLDPSS  61

Query  313  SFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  492
            +  VHCD T ESD++NAVN  VS +G+LDIM NNAGIAG+   +ILD   +DF  V  VN
Sbjct  62   ASHVHCDTTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVISVN  121

Query  493  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDLG  669
             +G FLGTKHAARVM P + GSIINTASV   + GG PHAY  SKHA+VGLT+NTA+DLG
Sbjct  122  LVGVFLGTKHAARVMIPNRCGSIINTASVCSTLGGGAPHAYVSSKHAVVGLTRNTAIDLG  181

Query  670  RYGIRVNCVSPYILSTQMT-----RNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            RYGIRVNC+SPY + T +      R Y G+++     VY  L G +L AEDVA+A LY
Sbjct  182  RYGIRVNCLSPYFVPTPLAADVVERIYGGVSK-----VYKFLDGAELKAEDVADAALY  234



>ref|XP_002523206.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF39237.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=270

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 161/237 (68%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++ LL  AA+RL+G+VA+ITG    IG   A+ FC+HGAKV+IAD +DD  QS+ KD 
Sbjct  1    MATNLLLPPAARRLEGKVALITGAATSIGECIARSFCKHGAKVVIADIQDDLGQSVAKDH  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDV+ ESDV+NAV+ AVS  G+LDIMVNNA     +   I+D D  D    
Sbjct  61   GQDVAMFVHCDVSVESDVKNAVDTAVSIFGKLDIMVNNAATGEPRKPSIVDNDLADVERA  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +G FLGTKHAARVM P ++GSII   SV   +GG   H+YT +KH IVGL +N A
Sbjct  121  LRVNLIGPFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHSYTIAKHGIVGLARNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGR+GIRVN +SPY + T ++   F   ED +  VYSNL+GV L  EDVAEA +Y
Sbjct  181  AELGRFGIRVNYLSPYFIETPLSMKLFEEEEDGRSGVYSNLEGVKLKQEDVAEAAIY  237



>ref|XP_007132473.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
 gb|ESW04467.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
Length=269

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 168/237 (71%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S++S A KRL+G+VAIITGG  GIG ATA+LF +HGA V+IAD +DD   S+C +L
Sbjct  1    MAHVSVVSAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+N VN AVS +G+LDIM NNAG +      ILD   +DF  V
Sbjct  61   E--SAVYVHCDVTEEEDVENCVNIAVSKYGKLDIMFNNAGSSDLFKRSILDNTKSDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RG IINTAS+AG + GG  HAYT +KH ++GL KNTA
Sbjct  119  LSVNLVGPFLGTKHAARVMIPAKRGCIINTASIAGCIGGGATHAYTSAKHGLLGLMKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG +GIRVNCVSP+++ T +   YF L E+     Y+NLKG   +A DVAEA LY
Sbjct  179  VELGEFGIRVNCVSPHLVVTPLLNKYFNLNEEGARKSYTNLKGWHPVANDVAEAALY  235



>dbj|BAC53872.1| alcohol dehydroge [Phaseolus lunatus]
Length=274

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 169/237 (71%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S +S A KRL+G+VAIITGG  GIG+ATA+LF +HGA V+IAD +DD   S+C +L
Sbjct  1    MAHVSAVSAAVKRLEGKVAIITGGASGIGAATARLFSEHGAHVVIADIQDDLGLSVCNEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E DV+  VN  VS +G+LDIM+NNAG        I+D   ++F  V
Sbjct  61   K--SAVYVHCDVTKEEDVEKCVNVTVSKYGKLDIMLNNAGTCHELKDSIVDNITSEFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RG IINT+S+AG  G G PHAY  SKH + GLTKNTA
Sbjct  119  ISVNVVGPFLGTKHAARVMIPAKRGCIINTSSIAGCRGTGSPHAYVVSKHGLEGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSPY+++T M + YF L E+   + YSNLKG  L+  DVAEA L+
Sbjct  179  VELGQFGIRVNCVSPYLVATPMLKKYFNLDEEGVREAYSNLKGSYLVPNDVAEAALF  235



>ref|XP_009387285.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 170/241 (71%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S+LS+  +RL+G+VA+ITGG  GIG  TAKLF QHGA+V++ D +DD+  S+C DL
Sbjct  1    MGSTSILSSIVRRLEGKVALITGGASGIGECTAKLFAQHGARVVVVDIQDDKGHSLCADL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + +VHCDVT E+DV++AV+ AVS HG+LDIM NNAG+        L+C+ + F  V
Sbjct  61   GPAVASYVHCDVTIEADVKHAVDTAVSLHGKLDIMFNNAGVVDDLSSGFLNCEKSAFEMV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFPH-AYTCSKHAIVGLTKNTA  657
              VN LGA+LGTKHAARVM P + GSI+ TAS A  MGG    AYTCSKHA+VGL +  A
Sbjct  121  VAVNVLGAYLGTKHAARVMAPARAGSIVTTASAASVMGGLASPAYTCSKHAVVGLMRCAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL----DVYSNLKGVDLMAEDVAEAVL  825
             +LG + +R NCVSP+ ++T M +   G  +D++L    +  +NLKG  L A+D+AEAVL
Sbjct  181  AELGPFRVRANCVSPHAVATPMAKTALGFTDDEELERLVEATANLKGTMLKAQDLAEAVL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>dbj|BAA13541.1| CPRD12 protein [Vigna unguiculata]
Length=267

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 165/237 (70%), Gaps = 3/237 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + S+LS   KRL+G+VAIITGG  GIG ATA+LF QHGA V++AD +DD   S+C +L
Sbjct  1    MANGSVLSPVVKRLEGKVAIITGGASGIGEATARLFSQHGAHVVVADIQDDVGLSLCNEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++ +VHCDVT E D++  V+ AVS  G+LDIM NNAG        ILD   +DF  V
Sbjct  61   K--SAIYVHCDVTKEEDIEKCVDTAVSKFGKLDIMFNNAGTGDEFKKSILDNTKSDFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLGTKHAARVM P +RG IINTASVAG + GG  HAYT SKHA+VGLTKNTA
Sbjct  119  ISVNLVGPFLGTKHAARVMIPARRGCIINTASVAGCIGGGATHAYTSSKHALVGLTKNTA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSP+ + T +   YF L E+     Y NLKG   +  DVAEA LY
Sbjct  179  VELGQFGIRVNCVSPFAIVTPLLNKYFNLDEEGVRKTYMNLKGWYPVPNDVAEAALY  235



>gb|AAK83036.1|AF286651_1 TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = +1

Query  124  VSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG  303
            +S  LL   A+RL+G+VA+ITGG  GIG  TAKLF +HGAKV+IAD +D   Q++CKDLG
Sbjct  1    MSIQLLPAIARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLG  60

Query  304  HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGI-AGAKGLDILDCDGTDFVNV  480
              +S FVHCDVT E DV+ AV+ AVS +G+LDIM+NNAG+   +   D L  D   F  V
Sbjct  61   QSSSVFVHCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDFLKDDPLTFQRV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
              VN +GAFLGTKHAARVMKP  RGSI+ TAS+   +GG   HAYT SKH ++GL +N A
Sbjct  121  VNVNLVGAFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLM-AEDVAEAVLY  828
            +DLGRYGIRVNCVSP ++ T+M R  F + +  +    Y +LK  D++  EDV EAV+Y
Sbjct  181  VDLGRYGIRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVY  239



>ref|XP_006430117.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43357.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=275

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SS +LS   +RL+G+VA ITGG  GIG+ TAK+F Q GAKV+IAD ++    S+ + +
Sbjct  1    MASSGVLSAITRRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +VHCDVT+ES ++NA+++ V+THG+LDIM NNAGI GA    I+D +  DF  V
Sbjct  61   GTSNSSYVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P + GSI++TASV+  +G    HAY C+KHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY L+T +  ++ G+ ++D    ++  +NLKGV L  ED+A A LY
Sbjct  181  VELGQFGIRVNCLSPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALY  240



>gb|KDP36171.1| hypothetical protein JCGZ_08815 [Jatropha curcas]
Length=276

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 175/239 (73%), Gaps = 4/239 (2%)
 Frame = +1

Query  124  VSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG  303
            +++S +S  A+RL+G+VA+ITGG  GIG  TAK+F  HGAK++IAD +D+  Q++ + LG
Sbjct  1    MAASFISAVARRLEGKVALITGGASGIGECTAKVFAHHGAKIVIADVQDELGQAVSQALG  60

Query  304  HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVF  483
              NS +VHC+VT+E+ ++NAV+KAV+T+G+LDIM NNAGI       I+D +  DF  V 
Sbjct  61   PSNSTYVHCNVTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVL  120

Query  484  RVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  660
             VN  G FLG KHAARVM P ++GSII TAS++  +G    HAYTCSKHA++GLT+N A+
Sbjct  121  SVNVTGVFLGIKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAI  180

Query  661  DLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +LG++G+RVNC+SPY L+T +   + GL +   ++ +D  ++LKGV L AEDVA A LY
Sbjct  181  ELGQFGVRVNCLSPYALATPLATKFVGLDDEGLENLMDSLASLKGVTLKAEDVANAALY  239



>gb|AHH81851.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=275

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S LS   +RL+G+VA+ITGG  GIG   AKLF +HGAKV+IAD +D   +++ + +
Sbjct  1    MASFSTLSVVTRRLEGKVALITGGANGIGECAAKLFSKHGAKVVIADIQDQLGEAVVRQI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +VHCDVT E+DV+NAV+KAVST+G+LDIM NNA         I+D +  DF  V
Sbjct  61   GPENSTYVHCDVTDENDVRNAVDKAVSTYGKLDIMYNNAATIDFGAHPIVDNEKKDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM PV+RG II+TAS+AG +GG   HAYTCSKHA++GL+KN A
Sbjct  121  MAVNVTGVFLGMKHAARVMIPVRRGVIISTASIAGHLGGTATHAYTCSKHAVIGLSKNLA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAED--DKLDV-YSNLKGVDLMAEDVAEAVLY  828
            ++LG+YGIRVNCVSPY L+T++++ Y  L  +  +K+     NL+G  L  +D+A A L+
Sbjct  181  IELGQYGIRVNCVSPYALATKLSKKYLKLDHELFEKMSHDKGNLQGATLKPDDIANAALF  240



>ref|XP_006481701.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=275

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SS +LS   +RL+G+VA ITGG  GIG+ TAK+F Q GAKV+IAD +++   S+ + +
Sbjct  1    MASSGVLSAITRRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +VHCDVT+ES ++NA+++ V+THG+LDIM NNAGI G     I+D +  DF  V
Sbjct  61   GTSNSSYVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P + GSI++TASV+  +G    HAY C+KHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY L+T +  ++ G+ ++D    ++  +NLKGV L  ED+A A LY
Sbjct  181  VELGQFGIRVNCLSPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALY  240



>gb|KDP36172.1| hypothetical protein JCGZ_08816 [Jatropha curcas]
Length=277

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 175/239 (73%), Gaps = 4/239 (2%)
 Frame = +1

Query  124  VSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG  303
            +++S +S  A+RL+G+VA+ITGG  GIG  TAK+F  HGAK++IAD +D+  Q++ + LG
Sbjct  1    MAASFISAVARRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADVQDELGQAVSQALG  60

Query  304  HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVF  483
              NS +VHC+VT+E+ ++NAV+KAV+T+G+LDIM NNAGI       I+D +  DF  V 
Sbjct  61   PSNSTYVHCNVTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVL  120

Query  484  RVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  660
             VN  G FLG KHAARVM P ++GSII TAS++  +G    HAYTCSKHA++GLT+N A+
Sbjct  121  SVNVTGVFLGIKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAI  180

Query  661  DLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +LG++G+RVNC+SPY L+T +   + GL +   ++ +D  ++LKGV L AEDVA A LY
Sbjct  181  ELGQFGVRVNCLSPYALATPLATKFVGLDDEGLENLMDSLASLKGVTLKAEDVANAALY  239



>gb|AAK83035.1|AF286650_1 CTA [Cucumis sativus]
Length=271

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = +1

Query  124  VSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG  303
            +S  LL   A+RL+G+VA+ITGG  GIG  TAKLF +HGAKV+IAD +D   Q++CKDLG
Sbjct  1    MSIQLLPAIARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLG  60

Query  304  HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGI-AGAKGLDILDCDGTDFVNV  480
              +S FVHCDVT E DV+ AV+ AVS +G+LDIM+NNAG+   +   DIL  D   F  V
Sbjct  61   QSSSVFVHCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDILKDDPLTFQRV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
              VN +GA LGT+HAARVMKP  RGSI+ TAS+   +GG   HAYT SKH ++GL +N A
Sbjct  121  VNVNLVGASLGTRHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYSNLKGVDLM-AEDVAEAVLY  828
            +DLGRYGIRVNCVSP ++ T+M R  F + +  +    Y +LK  D++  EDV EAV+Y
Sbjct  181  VDLGRYGIRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVY  239



>ref|XP_009605456.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=263

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 161/227 (71%), Gaps = 1/227 (0%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHC  330
            A+RL+GRVAIITG   GIG A A+LF +H AKV+IAD +DD SQ +CK+L   ++ FVHC
Sbjct  6    ARRLEGRVAIITGAASGIGEAAARLFSKHRAKVVIADIQDDLSQKVCKELDPSSTTFVHC  65

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFL  510
            DVT E +++NAVN AVS +G+LDIM NNAGI GA   +ILD + ++F  V  +N +G FL
Sbjct  66   DVTKEEELENAVNIAVSKYGKLDIMYNNAGIMGAVKSNILDNEKSEFEKVISINLVGTFL  125

Query  511  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  687
            G K AARVM P ++GSII T SV   +GG  PHAYT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKQAARVMIPRRQGSIIVTGSVCSSIGGVCPHAYTSSKHGVLGLTRNAAVDLGRYGIRV  185

Query  688  NCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            NCVSPY++ TQM  +       +  DVYS L G  L   DVAE  ++
Sbjct  186  NCVSPYVVLTQMAFDSLKKMGKEGSDVYSTLNGAILTPNDVAETAVF  232



>ref|XP_010104810.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01951.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 169/240 (70%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++SLLS  ++RLDG+V +ITGG  GIG + AKLF  HGAKV+IAD +D+   S+C+ +
Sbjct  1    MATTSLLSAVSRRLDGKVVLITGGASGIGESAAKLFAHHGAKVVIADIQDNLGHSVCESI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +VHCDVT ES V+NAV++A+ T+G+LDIM NNAGI       I + +   F +V
Sbjct  61   GQTNSKYVHCDVTDESQVKNAVDEAIKTYGKLDIMFNNAGIIDKSSPRITENEKAVFEHV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P + G II+TAS++  +GG   HAYTC+KHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPARSGCIISTASLSSCIGGTASHAYTCAKHAVLGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNCVSP+ ++T M   Y G + +D    +   +NLK V L AEDVA A L+
Sbjct  181  VELGQFGIRVNCVSPFGVATPMAIKYAGSSAEDLENGMSFLANLKNVTLKAEDVANAALF  240



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 148/208 (71%), Gaps = 6/208 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            K+F  HGAKV++AD +D+  +S+ K LG  NS +VHCDVT E+ V+NAVN AV+T+G+LD
Sbjct  30   KVFAHHGAKVVVADIQDESGRSLAKALGPSNSTYVHCDVTDEAQVKNAVNAAVTTYGKLD  89

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGIA      I+D +  DF  V + N  G FLG KHAARVM P + G+II+TASV
Sbjct  90   IMFNNAGIADESKARIIDNEKVDFERVLQTNVTGVFLGIKHAARVMIPGRNGTIISTASV  149

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            +  +G    HAY CSKHA++GLTKN A++LG++GIRVNC+SPY L+T + +   GL +D+
Sbjct  150  SSKVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIRVNCLSPYALATPLAKQVIGL-DDE  208

Query  757  KLD----VYSNLKGVDLMAEDVAEAVLY  828
            +L+     +  LKGV L AEDVA A LY
Sbjct  209  QLENLMHAFGTLKGVTLQAEDVANAALY  236



>ref|XP_009605454.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nicotiana tomentosiformis]
Length=263

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 160/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  136  LLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNS  315
            + S  A+RL G+VAIITG   GIG A A+LF  HGAKV+IAD +D+ +Q +CKDL   ++
Sbjct  1    MASNVARRLKGKVAIITGAASGIGEAAARLFSIHGAKVVIADIQDELAQKVCKDLDPTST  60

Query  316  FFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNT  495
             FVHCD+T E D++NA N AV  +G+LDIM NNAGI G    +IL+ +  +F  V  VN 
Sbjct  61   TFVHCDITKEEDLENAANTAVDKYGKLDIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNL  120

Query  496  LGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGR  672
            +G FLGTK AARVM P  RGSII TAS+   +GG   HAYTCSKH ++GLT+N A+DLGR
Sbjct  121  VGTFLGTKQAARVMIPNGRGSIITTASITATIGGSGSHAYTCSKHGVLGLTRNAAVDLGR  180

Query  673  YGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +GIRVNCVSPY++ T +  +Y  +      DVYS L G  L  +DVAE  L+
Sbjct  181  FGIRVNCVSPYLVLTPLALDYLKMNGKKASDVYSTLNGATLTPKDVAETALF  232



>ref|XP_010059365.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90499.1| hypothetical protein EUGRSUZ_A02618 [Eucalyptus grandis]
Length=277

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 164/240 (68%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS +S AAKRL+G+VA+ITGG  GIG  TA++F  HGAKV+IAD  D    S+   L
Sbjct  1    MAGSSFISAAAKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSIRDSL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               N+ FVHCDVT ES V+ AV +AVST+G+LDIM NNAGI G     I+D D  DF  V
Sbjct  61   SRDNASFVHCDVTDESQVKAAVAEAVSTYGKLDIMFNNAGITGPNKSRIVDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M PV+RG IINTAS+ +G  G   HAYTC+KHA++GLT+N A
Sbjct  121  LAVNVTGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGITSHAYTCAKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SP   +T +   +FG+     +  +D  +NLKGV L  EDVA A L+
Sbjct  181  VELGQFGIRVNCLSPNACATPLATKFFGMGPAELEAAIDAVTNLKGVTLKVEDVANAALF  240



>emb|CDP06872.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 168/237 (71%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + ++ S   KRL G+VA+ITGG  GIG +TA+LF +HGAKV+IAD +DD ++ +C+DL
Sbjct  1    MANMAIASNIMKRLQGKVALITGGASGIGESTARLFVKHGAKVVIADIQDDLAKKVCQDL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               ++  VHCD T ESD++NAVN AVS +G+LDIM NNAGIAG+   +ILD   + F  V
Sbjct  61   DPSSASHVHCDTTQESDIENAVNTAVSKYGKLDIMFNNAGIAGSGTSNILDDKKSGFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  657
              VN +G FLG KHAARVM P + GSIINTASV +  +G  PHAY  SKHA+VGLT+NTA
Sbjct  121  ISVNLVGVFLGAKHAARVMIPNRCGSIINTASVCSTIVGAAPHAYVSSKHAVVGLTRNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +DLGRYGIRVNC+SPY + T M  ++          VY+ L G  L A+DVA+A LY
Sbjct  181  VDLGRYGIRVNCLSPYFVPTPMAVDFIERINGGVSKVYTYLDGAVLKADDVADAALY  237



>ref|XP_003632648.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=275

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 167/240 (70%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +SS LS   +RL+G+VA+ITGG  GIG  TA+ F QHGAKV+IAD +D+   S+ + L
Sbjct  1    MAASSFLSAITRRLEGKVALITGGASGIGKCTAETFTQHGAKVVIADIQDELGHSVIEAL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  N+ +VHCDVT ES ++ AV+K  +THG+LDIM NNAGI       I+D +  DF  V
Sbjct  61   GQTNASYVHCDVTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              +N  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LSINVTGVFLGMKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY L+T +  N+  L  ++    ++  +NLKGV L A+DVA A LY
Sbjct  181  IELGQFGIRVNCLSPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDVANAALY  240



>ref|XP_007027886.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY08388.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=276

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            MV+SSL+S   +RL+G+VA+ITGG  GIG  TAK+F  HGAKV+IAD +D+   S+C+ +
Sbjct  1    MVASSLISAVTRRLEGKVALITGGASGIGKCTAKVFAHHGAKVVIADIQDELGHSVCEAV  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  N  +VHC+VT E  ++NAV+KAV+THG+LDIM NNAGI       I+D + +DF  V
Sbjct  61   GPSNCSYVHCNVTDEDQIKNAVDKAVATHGKLDIMFNNAGITDPIKARIIDNEKSDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P + GSII+TASV+  +G    HAY  SKHA++GLT+N A
Sbjct  121  LSVNVTGVFLGIKHAARVMVPARSGSIISTASVSSTVGAAATHAYCASKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SP+ L+T +     G+ +++    + + +NLKGV L AED+A A LY
Sbjct  181  VELGQFGIRVNCLSPFALATPLATEVLGINDEELEKGMGLVANLKGVTLKAEDIANAALY  240



>ref|XP_009605455.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nicotiana tomentosiformis]
Length=250

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF  HGAKV+IAD +D+ +Q +CKDL   ++ FVHCD+T E D++NA N AV  +G+LD
Sbjct  16   RLFSIHGAKVVIADIQDELAQKVCKDLDPTSTTFVHCDITKEEDLENAANTAVDKYGKLD  75

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G    +IL+ +  +F  V  VN +G FLGTK AARVM P  RGSII TAS+
Sbjct  76   IMYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVMIPNGRGSIITTASI  135

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               +GG   HAYTCSKH ++GLT+N A+DLGR+GIRVNCVSPY++ T +  +Y  +    
Sbjct  136  TATIGGSGSHAYTCSKHGVLGLTRNAAVDLGRFGIRVNCVSPYLVLTPLALDYLKMNGKK  195

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
              DVYS L G  L  +DVAE  L+
Sbjct  196  ASDVYSTLNGATLTPKDVAETALF  219



>ref|XP_002281462.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=275

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 167/240 (70%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +SS LS   +RL+G+VA+ITGG  GIG  TA+ F QHGAKV+IAD +D+   S+ + L
Sbjct  1    MAASSFLSVFTRRLEGKVALITGGASGIGKCTAETFTQHGAKVVIADIQDELGHSVIEAL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  N+ +VHCDVT ES ++ AV+K  +THG+LDIM NNAGI       I+D +  DF  V
Sbjct  61   GQTNASYVHCDVTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              +N  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LSINVTGVFLGMKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY L+T +  N+  L  ++    ++  +NLKGV L A+DVA A LY
Sbjct  181  IELGQFGIRVNCLSPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDVANAALY  240



>ref|XP_004136701.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004164972.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=278

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 169/243 (70%), Gaps = 7/243 (3%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCK  294
            M S+ ++ST    +RL+G+VA+ITGG  GIG  TAKLF  HGAKV+IAD +DD   ++C 
Sbjct  1    MASNEIISTTTWQRRLEGKVALITGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCA  60

Query  295  D-LGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDF  471
            + LG  NS +VHCDVT ES VQ AV  AV T G+LDIM+NNAGIA      I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTEESQVQEAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDF  120

Query  472  VNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  648
              V  +N  G FLG KHAA+ M P + GSI++TASVA + GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLSINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYTGGSASHAYTCSKHAVVGLTK  180

Query  649  NTALDLGRYGIRVNCVSPYILSTQMTRNYFGL--AEDDK-LDVYSNLKGVDLMAEDVAEA  819
            N A++LG++GIRVNC+SP+ L T +   + GL   E +K +   +NLKGV L AEDVA A
Sbjct  181  NAAVELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANA  240

Query  820  VLY  828
             L+
Sbjct  241  ALF  243



>ref|XP_007043248.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99079.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 165/237 (70%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  +S L  AA+RL+G+VA+ITGG  GIG   A+LFC+HGAKV+IAD +D+  QS+CKD+
Sbjct  1    MACASRLPPAARRLEGKVALITGGASGIGECIARLFCEHGAKVIIADIQDELGQSVCKDI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCD+  ESDV+ AVN A+S HG+LDIMVNNA +       I++ +  DF  V
Sbjct  61   GLAVASFVHCDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRG-SIINTASVAGFMGGFPHAYTCSKHAIVGLTKNTA  657
              VN  G FLGTKHAARVM P ++G  I   +  +   G   HAYT SKHAI+GLTKN A
Sbjct  121  ISVNLTGVFLGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHAILGLTKNVA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGR+GIRVNC+S Y ++T+   N+F L  D++  VYSNLKGV L  EDVA+A LY
Sbjct  181  AELGRFGIRVNCLSSYFIATRSAMNFFKLDGDERPRVYSNLKGVVLQQEDVADAALY  237



>emb|CAN78993.1| hypothetical protein VITISV_001799 [Vitis vinifera]
Length=388

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 170/246 (69%), Gaps = 4/246 (2%)
 Frame = +1

Query  103  EIDSRKMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQ  282
            E  S+ M +SS LS   +RL+G+VA+ITGG  GIG  TA+ F QHGAKV+IAD +D+   
Sbjct  108  EDGSKAMAASSFLSVFTRRLEGKVALITGGASGIGKXTAETFTQHGAKVVIADIQDELGH  167

Query  283  SMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDG  462
            S+ + LG  N+ +VHCDVT ES ++ AV+K  +THG+LDIM NNAGI       I+D + 
Sbjct  168  SVIEALGQTNASYVHCDVTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEK  227

Query  463  TDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVG  639
             DF  V  +N  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++G
Sbjct  228  ADFERVLSINVTGVFLGMKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLG  287

Query  640  LTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD---KLDVYSNLKGVDLMAEDV  810
            LT+N A++LG++GIRVNC+SPY L+T +  N+  L  ++    ++  +NLKGV L A+DV
Sbjct  288  LTRNAAIELGQFGIRVNCLSPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDV  347

Query  811  AEAVLY  828
            A A LY
Sbjct  348  ANAALY  353



>ref|XP_010917564.1| PREDICTED: momilactone A synthase-like [Elaeis guineensis]
Length=270

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 176/235 (75%), Gaps = 4/235 (2%)
 Frame = +1

Query  136  LLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNS  315
            +L++AA+RL+G+VA+ITGG  GIG ATAKLF +HGA+V+IAD +DD+ +++C+ LG   +
Sbjct  1    MLTSAARRLEGKVALITGGASGIGEATAKLFTRHGARVMIADVQDDKGRALCESLGSSVA  60

Query  316  FFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNT  495
             +VHCD+T ES V++AV+ AVS HG+LDIM NNAGI G+  + IL  +  DF  V  +N 
Sbjct  61   SYVHCDMTDESHVRDAVDAAVSRHGKLDIMFNNAGIIGSPCMQILKSEKADFERVVGINL  120

Query  496  LGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGR  672
            +G++LGTKHAARVM P +RGSI+ TASVA       P AYTCSKHA++GL ++ A++LG+
Sbjct  121  VGSYLGTKHAARVMIPARRGSIVMTASVASVDPAMTPVAYTCSKHAVLGLMRSAAVELGQ  180

Query  673  YGIRVNCVSPYILSTQMTRNYFGLAEDDKLDV---YSNLKGVDLMAEDVAEAVLY  828
            +G+RVNCVSPY L+T +    FG+  ++  D    ++ LKGV L AED+AEAVL+
Sbjct  181  FGVRVNCVSPYALATPLAATAFGMGGEELEDFMHEHAILKGVRLKAEDIAEAVLF  235



>ref|XP_010917565.1| PREDICTED: momilactone A synthase-like isoform X1 [Elaeis guineensis]
Length=272

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  130  SSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHG  309
            +S+L++AA RL+G+VA+ITGG  GIG ATAKLF +HGA+V+IAD +DD+ +++C+ LG  
Sbjct  4    TSVLTSAAGRLEGKVALITGGASGIGEATAKLFTRHGARVMIADIQDDKGRALCESLGSA  63

Query  310  NSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRV  489
             + +VHCDVT ES V++AV+ AVS HG+LDIM NNAGIAG+  + I + +  DF  V  +
Sbjct  64   VASYVHCDVTDESHVRDAVDAAVSRHGKLDIMFNNAGIAGSLCMQIRESEKADFERVMGI  123

Query  490  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDL  666
            N +G++LGTKHAARVM P +RGSI+ T SVA    G    AYTCSK A+VGL ++ A++L
Sbjct  124  NLVGSYLGTKHAARVMIPARRGSIVMTGSVASAAPGIGSAAYTCSKPAVVGLMRSAAVEL  183

Query  667  GRYGIRVNCVSPYILSTQMTRNYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLY  828
            G++G+RVNCVSPY ++T +    FG+  ++    +  ++ LKGV L  EDVAEAVL+
Sbjct  184  GQFGVRVNCVSPYGVATPLATTSFGIGVEEVEEFMHKHAILKGVRLKVEDVAEAVLF  240



>dbj|BAE72097.1| Lactuca sativa short-chain dehydrogenase/reductase 2
Length=271

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 165/234 (71%), Gaps = 4/234 (2%)
 Frame = +1

Query  139  LSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF  318
            ++T  +RL+G+VA+ITG   GIG   AKLF +HGAK++IAD +D   Q++C+ +G  NS 
Sbjct  1    MATTTRRLEGKVALITGAASGIGECAAKLFAEHGAKIVIADIQDQLGQAVCEAIGSSNSI  60

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            ++HCDVT+E DV+ AV+ A++T+G+LDIM  NAGI       I+D + +DF  V  VN  
Sbjct  61   YIHCDVTNEEDVRKAVDIAIATYGKLDIMFCNAGIIDPNKDHIIDNEKSDFERVLSVNVT  120

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRY  675
            G FL  KHAARVM P + GSII+TASV   +GG  PHAYTCSKHA+ GLTKN A++LG++
Sbjct  121  GVFLSMKHAARVMVPTRAGSIISTASVVSNIGGLCPHAYTCSKHAVAGLTKNLAVELGQF  180

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLY  828
            GIRVNC+SPY + T     + GL  +D   K++  +NLKGV L  +DVA+A ++
Sbjct  181  GIRVNCLSPYAIDTPQATGFTGLKGEDFKNKVNSVANLKGVTLTTDDVAKAAVF  234



>ref|XP_010061228.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW68145.1| hypothetical protein EUGRSUZ_F01817 [Eucalyptus grandis]
Length=277

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 163/240 (68%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS +S A KRL+G+VA+ITGG  GIG  TA++F  HGAKV+IAD  D    S+   L
Sbjct  1    MAGSSFISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + FVHCDVT ES ++ AV +AVST+G+LDIM NNAGI G     I+D D  DF  V
Sbjct  61   SRDTASFVHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M PV+RG IINTAS+ +G  G   HAYTC+KHA++GLT+N A
Sbjct  121  LAVNVTGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SP   +T +   +FG++    +  +D  +NLKGV L  EDVA A L+
Sbjct  181  VELGQFGIRVNCLSPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALF  240



>ref|XP_010061227.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Eucalyptus grandis]
Length=307

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 163/240 (68%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS +S A KRL+G+VA+ITGG  GIG  TA++F  HGAKV+IAD  D    S+   L
Sbjct  31   MAGSSFISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSL  90

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
                + FVHCDVT ES ++ AV +AVST+G+LDIM NNAGI G     I+D D  DF  V
Sbjct  91   SRDTASFVHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERV  150

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M PV+RG IINTAS+ +G  G   HAYTC+KHA++GLT+N A
Sbjct  151  LAVNVTGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAA  210

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SP   +T +   +FG++    +  +D  +NLKGV L  EDVA A L+
Sbjct  211  VELGQFGIRVNCLSPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALF  270



>ref|XP_009773000.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=263

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 159/227 (70%), Gaps = 1/227 (0%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHC  330
            A+RL+G+VA+ITG   GIG A A+LF +HGAKV+IAD +DD +Q +CK+L   ++ FVHC
Sbjct  6    ARRLEGKVAVITGAASGIGEAAARLFSRHGAKVVIADIQDDLAQKVCKELDTSSTTFVHC  65

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFL  510
            +VT E D++NAVN AVS +G+LDIM NNAGI GA   +ILD + ++F  V  VN +G FL
Sbjct  66   NVTKEEDLENAVNIAVSKYGKLDIMYNNAGIMGAIKSNILDNEKSEFEKVISVNLVGTFL  125

Query  511  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  687
            G K AARVM P ++GSII T SV   +GG   HAYT SKH ++GL +N  +DLGRYGIRV
Sbjct  126  GIKQAARVMIPRRQGSIIVTGSVCSSIGGVCSHAYTSSKHGVLGLARNATVDLGRYGIRV  185

Query  688  NCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            NCVSPY + TQM  +       +  DVYS L G  L  +DVAE  ++
Sbjct  186  NCVSPYAVLTQMAFDSLKKMGKEGWDVYSTLNGATLTPKDVAETAVF  232



>ref|XP_010104809.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01950.1| Momilactone A synthase [Morus notabilis]
Length=277

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 165/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +   LS   +RL+G+VA+ITGG  GIG  TAK+F  HGAK++IAD +DD   S+ + +
Sbjct  1    MATIPSLSAVPRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGYSVVESI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  +  +VHCDVT ES V+NAV++AV T+G+LDIM+NNAGIA      I+D +  DF  V
Sbjct  61   GQTSCKYVHCDVTDESHVKNAVDEAVKTYGKLDIMLNNAGIADENKARIIDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P +RGSII TAS+   + GG  HAYT SKHA++GL +N A
Sbjct  121  MSVNVTGVFLGIKHAARVMIPARRGSIITTASMCSHIGGGSSHAYTASKHAVLGLARNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVL  825
            ++LG++GIRVNC+SP+ L T MT  YFG    + L+     + NLK V L AEDVA A L
Sbjct  181  VELGQFGIRVNCLSPFPLLTPMTSKYFGSTNQEVLENTFKSWGNLKHVTLKAEDVANAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_010059374.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=321

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 161/240 (67%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS +S A KRL+G+VA+ITGG  GIG  TA++F  HGAKV+IAD  D    S+C  L
Sbjct  45   MAGSSFISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSL  104

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHC+VT ES  + AV +AVST G+LDIM NNAGI G     I+D D  DF  V
Sbjct  105  GRDTASFVHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERV  164

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M P +RG IINTAS++  +GG   HAYTC+KHA++GLT+N A
Sbjct  165  LAVNVTGVFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAA  224

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVNC+SPY   T +   + G+     +  +   +NLKGV L AEDVA A L+
Sbjct  225  VELGQFGIRVNCLSPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAALF  284



>ref|XP_006430116.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43356.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=312

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 148/207 (71%), Gaps = 4/207 (2%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            K+F Q GAKV+IAD ++    S+ + +G  NS +VHCDVT+ES ++NA+++ V+THG+LD
Sbjct  71   KVFAQQGAKVVIADIQEQLGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKLD  130

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI GA    I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TASV
Sbjct  131  IMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTASV  190

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            +  +G    HAY C+KHA++GLTKN A++LG++GIRVNC+SPY L+T +  ++ G+ ++D
Sbjct  191  SSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCLSPYALATPLATSFVGITDED  250

Query  757  K---LDVYSNLKGVDLMAEDVAEAVLY  828
                ++  +NLKGV L  ED+A A LY
Sbjct  251  LEGFMNSAANLKGVTLRTEDIAYAALY  277



>gb|KDO35956.1| hypothetical protein CISIN_1g046809mg, partial [Citrus sinensis]
Length=269

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 148/207 (71%), Gaps = 4/207 (2%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            K+F Q GAKV+IAD +++   S+ + +G  NS +VHCDVT+ES ++NA+++ V+THG+LD
Sbjct  28   KVFAQQGAKVVIADIQEELGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKLD  87

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI G     I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TASV
Sbjct  88   IMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTASV  147

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            +  +G    HAY C+KHA++GLTKN A++LG++GIRVNC+SPY L+T +  ++ G+ ++D
Sbjct  148  SSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCLSPYALATPLATSFVGITDED  207

Query  757  K---LDVYSNLKGVDLMAEDVAEAVLY  828
                ++  +NLKGV L  ED+A A LY
Sbjct  208  LEGFMNSAANLKGVTLRTEDIAYAALY  234



>ref|XP_007043243.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99074.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 163/237 (69%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  +SLL  AA+RL+G+VA+ITGG  G+G   A+LFC+HGAKV+I D +D+  QS+CKD+
Sbjct  1    MACASLLPPAARRLEGKVALITGGASGLGECIARLFCEHGAKVIITDIQDELGQSVCKDI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FV CD+  ESDV+ AVN A+S HG+LDIMVNNA +       I++ +  DF  V
Sbjct  61   GLAVASFVLCDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRG-SIINTASVAGFMGGFPHAYTCSKHAIVGLTKNTA  657
              +N  G FLGTKHAARVM P ++G  I   +  +   G   HAYT SKH ++GLTKN A
Sbjct  121  ISINLTGVFLGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHGVIGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGR+GIRVNC+S Y ++T +T N+F L  ++   VYSNLKGV L  EDVAEA LY
Sbjct  181  AELGRFGIRVNCLSSYFIATPLTTNFFKLDRNESDRVYSNLKGVFLQKEDVAEAALY  237



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 166/238 (70%), Gaps = 2/238 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S S  + AA+RL+G+VA+ITGG  GIG+ TAKLF +HGAKV+IA+ +DD   S+CK L
Sbjct  1    MASISAFTAAARRLEGKVALITGGASGIGACTAKLFTKHGAKVMIAEIQDDLGLSVCKSL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGA-KGLDILDCDGTDFVN  477
                + ++HCDVT+E  VQNAV+  V+ + +LDIM NNAGIAG+    +ILD   +DF  
Sbjct  61   DPSVASYIHCDVTNEDHVQNAVDSTVAKYKKLDIMFNNAGIAGSHPKPNILDITQSDFEE  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNT  654
              + N +G FLGTKHAARVM P ++GSII TASV   +GG  PHAYT SKH ++GLT++T
Sbjct  121  TVKTNLIGPFLGTKHAARVMIPARQGSIITTASVCSIIGGVAPHAYTSSKHGVLGLTRST  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             ++ G+YGIRVNCVSP+ + T +   +  L ++    +YSNLKG     EDVA A L+
Sbjct  181  TVEFGQYGIRVNCVSPHAVPTPLFNKFLQLDDEGISKIYSNLKGTWCKVEDVANAALF  238



>ref|XP_004169912.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
Length=274

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 169/236 (72%), Gaps = 4/236 (2%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
             LL  AA+RL+G+VAIITGG  GIG + AK F  HGAKV+IAD  DD   S+   L   +
Sbjct  4    PLLPAAARRLEGKVAIITGGARGIGESIAKHFFNHGAKVVIADILDDLGNSLSNHLSSSS  63

Query  313  SFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  492
            + FVHC+VT E+DV+N VN AVS +G+LDIM NNAGI GA   +IL+ + +DF NV  VN
Sbjct  64   TSFVHCNVTKETDVENVVNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVN  123

Query  493  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLG  669
             +GAFLGTKHAA+ M P  +GSII TASV   +GG  P+AYT SKH ++GL +N  +DLG
Sbjct  124  LVGAFLGTKHAAKAMIPAGQGSIIITASVCSSIGGIGPYAYTSSKHGLLGLMRNATIDLG  183

Query  670  RYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYS-NLKGVDLM-AEDVAEAVLY  828
            RYGI+VNCVSP+++ TQMTR +F L + D+  DVYS N K  D++  EDVAE  LY
Sbjct  184  RYGIKVNCVSPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLY  239



>ref|XP_011094266.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Sesamum indicum]
Length=284

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 164/240 (68%), Gaps = 6/240 (3%)
 Frame = +1

Query  127  SSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGH  306
            S  L+S+ AKRL+G+VA+ITGG  GIG  TA+LF QHGAKV+IAD +D+  Q+ C+D+G 
Sbjct  8    SKELISSMAKRLEGKVAVITGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGS  67

Query  307  GNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVF  483
                 +VHCDVT+E+DV+N VN AVS +G+LDIM +NAG+ G     IL  D  D   VF
Sbjct  68   SEVISYVHCDVTNETDVENVVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVF  127

Query  484  RVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  660
             VN  G FL  KHAARVM P +RGSI+ T+SVA    G  PHAY  SKHA+VGLTKN  +
Sbjct  128  DVNVFGGFLCAKHAARVMIPAKRGSIVFTSSVASVTHGVVPHAYVASKHAVVGLTKNLCI  187

Query  661  DLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLY  828
            +LG YGIRVNCVSP+ ++T M      L E  K++      +NLKG  + A DVAEAV++
Sbjct  188  ELGEYGIRVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAVIF  247



>ref|XP_006362152.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 138/204 (68%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            KLF ++GAKV+IAD +DD +  +CKDL   ++ FVHCDVT E D++N VN  V  +G+LD
Sbjct  29   KLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKLD  88

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI GA   +IL+ + +DF  V   N +G FLG K AARVM P  +GSII T SV
Sbjct  89   IMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIPRGQGSIITTGSV  148

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               +GG  PHAYT SKH ++GLT+N A+DLGRYGIRVNCVSPY++ T    N       +
Sbjct  149  CSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRVNCVSPYVILTASALNTLKKMGKE  208

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
              DVYS+LKG  L   DVAE  ++
Sbjct  209  DSDVYSSLKGATLTPNDVAETAVF  232



>gb|KDO58270.1| hypothetical protein CISIN_1g044923mg, partial [Citrus sinensis]
Length=214

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 136/185 (74%), Gaps = 8/185 (4%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDL------GHGNSFFVHCDVTSESDVQNAVNKAVS  381
            +LF +HGAKVLIAD +DD  +S+C+D+       +G S+ VHCDVT E D++NAVN AVS
Sbjct  31   RLFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSY-VHCDVTKEKDIENAVNTAVS  89

Query  382  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  561
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  90   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  149

Query  562  INTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF  738
            I+TASV G +GG   HAYT SKH +VGL KNTA++LGR+GIRVNCVSPY +S+ M + + 
Sbjct  150  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNCVSPYAVSSPMAKGFL  209

Query  739  GLAED  753
             L +D
Sbjct  210  KLDDD  214



>gb|KDP34947.1| hypothetical protein JCGZ_09235 [Jatropha curcas]
Length=232

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++ LL   A+RL+G VA+ITGG   IG++ A+ FC+HGAKV+I D +DD  QS+ K+L
Sbjct  1    MAANLLLPINARRLEGTVALITGGATSIGASIARTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + FVHCDVT ESD++NAV+  +S  G+LDIMVNNA         I+D +  DF  V
Sbjct  61   GTDKAIFVHCDVTIESDIENAVDTVISIFGKLDIMVNNAATGDPHKPSIVDNNVADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             +VN +G F+GTKHAARVM P ++GSII   SV   +GG   H YT +KH +VGL KN A
Sbjct  121  VKVNLIGVFIGTKHAARVMIPARQGSIITIGSVCSSVGGVASHVYTSTKHGVVGLAKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVA  813
             +LG++ IRVNC+S Y + T ++ N   + ED K  VYSNLKGV L  EDVA
Sbjct  181  AELGQFRIRVNCLSCYFIETPLSMNLLKMNEDAKSGVYSNLKGVKLTEEDVA  232



>ref|XP_002309405.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE92928.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 168/241 (70%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SSS L++ AKRL G+VAIITGG  GIG +T++LF +HGA V+IAD +D   QS+CK+L
Sbjct  1    MNSSSSLASFAKRLAGKVAIITGGASGIGESTSRLFVEHGANVIIADVQDQVGQSLCKEL  60

Query  301  G-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   N ++VHCDVTS++DV+N V+ A+S +G+LDIM NNAGI G     IL  +  +F  
Sbjct  61   GTENNVYYVHCDVTSDTDVKNVVDFAISKYGKLDIMYNNAGITGNIDPTILGTENENFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNT  654
            VF VN  G FLG KHAARVM PV++G I+ T+SVA    G  PHAYT SKHA+VGL KN 
Sbjct  121  VFEVNVYGGFLGAKHAARVMIPVKKGVILFTSSVASMACGESPHAYTMSKHAVVGLMKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVL  825
             ++LG+YGIRVNC+SP  L+T + RN  G  +     V    +NLKGV    +DVAEA L
Sbjct  181  CVELGQYGIRVNCISPCALATPLLRNAMGADKSFVEHVVCESANLKGVVPSPKDVAEAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_002308448.2| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE91971.2| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 167/242 (69%), Gaps = 6/242 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SSLL+  +KRL+G+VA+ITGG  GIG ++ +LF +HGAKV+IAD +DD   S+C+++
Sbjct  1    MKGSSLLAPVSKRLEGKVALITGGASGIGESSTRLFVRHGAKVVIADIQDDLGHSVCEEI  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   S  +VHCDVT ESDV+ AVN AVS +G+LDI  +NAGI G         D  +F  
Sbjct  61   GSDESLSYVHCDVTRESDVEKAVNTAVSKYGKLDIFFSNAGILGKGDPQASAIDYDNFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNT  654
            VF  N  GAFLG KHA+RVM P ++GSII T+SV    +G  PHAYT SKHAIVGLTKN 
Sbjct  121  VFDTNVYGAFLGAKHASRVMIPEKKGSIIYTSSVVSVIVGNVPHAYTASKHAIVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYF-GLAEDDKLDVYS---NLKGVDLMAEDVAEAV  822
              +LG++GIRVNC+SP  + T + RN F G+  +  L++ S   +LKGV L  EDVAEA 
Sbjct  181  CAELGQFGIRVNCISPAAVPTPLMRNAFGGINRNAALEIASATAHLKGVMLEEEDVAEAA  240

Query  823  LY  828
            LY
Sbjct  241  LY  242



>ref|XP_004244887.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=263

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 158/227 (70%), Gaps = 1/227 (0%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHC  330
            A+RL+G+VAIITG   GIG A+AKLF ++G+KV+IAD +DD +Q++CKDL   ++ FVHC
Sbjct  6    ARRLEGKVAIITGAASGIGEASAKLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHC  65

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFL  510
            DVT E D++N VN  V  +G+LDIM NNAGI GA   +IL+ + +DF  V   N +G FL
Sbjct  66   DVTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFL  125

Query  511  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  687
            G K AARVM P  +GSII T SV   +GG  PH+YT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKQAARVMIPRGQGSIITTGSVCASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRV  185

Query  688  NCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            NCVSPY++ T    +       +  DVYS L G  L   DVAEA ++
Sbjct  186  NCVSPYVIRTTSALDTLKKMGKEDSDVYSTLNGPTLTPYDVAEAAVF  232



>ref|XP_010246261.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nelumbo nucifera]
Length=281

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 172/245 (70%), Gaps = 9/245 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + S+LST  +RL G+VA+ITGG  GIG +TA+LF +HGAKV++AD +D+  +++C D+
Sbjct  1    MAAGSVLSTIVRRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDI  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   +  + HCDV+ ++ V++AV+ +VS +G+LDIM NNA I G    +IL  D  DF  
Sbjct  61   GSEETICYAHCDVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  654
            V  VN  GAFLG KHAARVM P++RGSI+ T+SVA  + G  PHAY+ +KHA+VGLTKN 
Sbjct  121  VVDVNLYGAFLGAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNY---FGLAEDDKLDVYSN----LKGVDLMAEDVA  813
             ++LGRYGIRVNC+SPY + T M R      G  E++K++   +    LKGV + AED+A
Sbjct  181  CVELGRYGIRVNCISPYGVVTGMLRKVMAELGFTEEEKVEELVSRSTVLKGVKVTAEDMA  240

Query  814  EAVLY  828
            EA LY
Sbjct  241  EAALY  245



>ref|XP_009387234.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 172/244 (70%), Gaps = 6/244 (2%)
 Frame = +1

Query  115  RKMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCK  294
            + M S S+ S+ A+RL+G+VA+ITGG  GIG  T KLF +HGA+V++AD +D++ +S+C 
Sbjct  12   QAMASVSVGSSIARRLEGKVAVITGGASGIGECTVKLFVRHGARVVVADIKDEKGRSLCA  71

Query  295  DLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCD--GTD  468
             LG   + +VHCDVTSE+DV+NAV+ AVS HG+LDIM NNAG+A  +    L+ +   + 
Sbjct  72   ALGLDVASYVHCDVTSEADVKNAVDTAVSLHGKLDIMFNNAGVALGRDHGFLNGEHSASL  131

Query  469  FVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLT  645
            F  +  VN LG +LGTKHAARVM P + G I+ TAS    +GG  P  YTCSK+A+VGL 
Sbjct  132  FERMMAVNVLGVYLGTKHAARVMAPARSGCIVTTASSVSALGGMAPAFYTCSKYAVVGLM  191

Query  646  KNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDK---LDVYSNLKGVDLMAEDVAE  816
            ++ A +LG++G+R NCVSP++L+T MT    G+ +++    LD  +NLKGV    ED+AE
Sbjct  192  RSAAAELGKFGVRANCVSPHLLATPMTSAALGMTDEEVERLLDAGANLKGVTAKPEDIAE  251

Query  817  AVLY  828
            AVLY
Sbjct  252  AVLY  255



>ref|XP_010104811.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01952.1| Momilactone A synthase [Morus notabilis]
Length=272

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 167/240 (70%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++SLLS  ++RL+G+VA+ITGG  GIG  TAK+F  HGAK++IAD +D    S+C+ +
Sbjct  1    MATTSLLSAVSRRLEGKVAVITGGASGIGECTAKVFAHHGAKLIIADIQDALGHSLCQSI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
               N  +VHCDVT E+ V+NAV+KAV  +G+LDI+ NNAG +    L IL     DF  V
Sbjct  61   DETNCKYVHCDVTDETHVKNAVDKAVKAYGKLDIIFNNAGTSDKSYLRILKDQKNDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHA+RVM P + GSII+TASV  ++GG   HAYT SKHA++GLTK+ A
Sbjct  121  MSVNATGVFLGIKHASRVMIPARSGSIISTASVCSYIGGAASHAYTASKHAVLGLTKSAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYS---NLKGVDLMAEDVAEAVLY  828
            ++LG+YGIRVNC+SPY ++T +   + G  + D  +++S   NLK V L AEDVA A LY
Sbjct  181  VELGQYGIRVNCLSPYGVATPLVEKFLGRKKGDIENLFSSAANLKNVTLEAEDVANAALY  240



>ref|XP_010324818.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=256

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 139/204 (68%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            KLF ++G+KV+IAD +DD +Q++CKDL   ++ FVHCDVT E D++N VN  V  +G+LD
Sbjct  22   KLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKLD  81

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI GA   +IL+ + +DF  V   N +G FLG K AARVM P  +GSII T SV
Sbjct  82   IMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIPRGQGSIITTGSV  141

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               +GG  PH+YT SKH ++GLT+N A+DLGRYGIRVNCVSPY++ T    +       +
Sbjct  142  CASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRVNCVSPYVIRTTSALDTLKKMGKE  201

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
              DVYS L G  L   DVAEA ++
Sbjct  202  DSDVYSTLNGPTLTPYDVAEAAVF  225



>ref|XP_011046907.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Populus euphratica]
Length=277

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 167/241 (69%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SSS L++ AKRL G+VAIITGG  GIG +T++LF +HGAKV+IAD +D   QS+CK+L
Sbjct  1    MNSSSSLASFAKRLAGKVAIITGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSLCKEL  60

Query  301  -GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
                N  +VHCDVTS++DV+N V+ A+S +G+LDIM NNAGI G     IL  D  DF  
Sbjct  61   LTEDNVCYVHCDVTSDTDVKNVVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNEDFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNT  654
            VF VN  G FLG KHAARVM PV++G I+ T+SVA    G  PHAYT SKHA+VGL KN 
Sbjct  121  VFEVNVYGGFLGAKHAARVMIPVKKGVILFTSSVASVACGESPHAYTMSKHAVVGLMKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVL  825
             ++LG+YGIRVNC+SP  L+T + RN  G  +     V    +NLKGV    +DVAEA L
Sbjct  181  CVELGQYGIRVNCISPCALATPLLRNAMGADKSFVEHVVCESANLKGVVPSPKDVAEAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_010246256.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nelumbo nucifera]
Length=281

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 172/245 (70%), Gaps = 9/245 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M ++SLL+   KRL G+VA+ITGG  GIG +TA+LF +HGAKV++AD +D+  +++C D+
Sbjct  1    MKAASLLAPITKRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDI  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   +  + HCDV+ ++ V++AV+ +VS +G+LDIM NNA I G    +IL  D  DF  
Sbjct  61   GSEETICYAHCDVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  654
            V  VN  GAFLG KHAARVM P++RGSI+ T+SVA  + G  PHAY+ +KHA+VGLTKN 
Sbjct  121  VVDVNLYGAFLGAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNY---FGLAEDDKLDVYSN----LKGVDLMAEDVA  813
             ++LGRYGIRVNC+SPY + T M R      G  E++K++   +    LKGV + AED+A
Sbjct  181  CVELGRYGIRVNCISPYGVVTGMLRKVMAELGFTEEEKVEELVSRSTVLKGVKVTAEDMA  240

Query  814  EAVLY  828
            EA LY
Sbjct  241  EAALY  245



>ref|XP_004136700.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004173253.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=277

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 173/243 (71%), Gaps = 7/243 (3%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCK  294
            M SS ++ST    +RL+G+VAIITGG  GIG  TAKLF  HGAKV++AD +DD  +++C 
Sbjct  1    MTSSEVISTTTGQRRLEGKVAIITGGASGIGECTAKLFVHHGAKVVVADIQDDLGRALCA  60

Query  295  D-LGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDF  471
            + LG  NS +VHCDVT ES VQ AV  AV T G+LDIM+NNAGIA      I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTDESQVQAAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKQDF  120

Query  472  VNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  648
              V  VN  G FLG KHAA+ M PV+ GSI++TASVA ++GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLSVNITGVFLGIKHAAQAMIPVKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTK  180

Query  649  NTALDLGRYGIRVNCVSPYILSTQMTRNYFGL--AEDDKL-DVYSNLKGVDLMAEDVAEA  819
            N A++LG++GIRVNC+SPY+L+T +   +  L  AE +K     +NLKGV L AEDVA A
Sbjct  181  NAAVELGQFGIRVNCLSPYVLATPLATEFVDLDGAEFEKYASSRANLKGVTLKAEDVANA  240

Query  820  VLY  828
             L+
Sbjct  241  ALF  243



>ref|XP_006367118.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   213 bits (541),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 136/204 (67%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            KLF ++GAKV+IAD +DD +  +CKDL   ++ FVHCDVT E D++N VN  V  +G+LD
Sbjct  29   KLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKLD  88

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI GA   +IL+ + +DF  V   N +G FLG K AAR M P  +GSII T SV
Sbjct  89   IMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARDMIPRGQGSIITTGSV  148

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
               +GG  PHAYT SKH ++GLT+N A+DLGRYGIRVNCVSPY++ T    N       +
Sbjct  149  CSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRVNCVSPYVILTASALNTLKKMGKE  208

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
              DVYS LKG  L   DVAE  ++
Sbjct  209  DSDVYSTLKGATLTPNDVAETTVF  232



>ref|XP_011094268.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=275

 Score =   213 bits (541),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 166/237 (70%), Gaps = 5/237 (2%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
            +LL+ A +RL+G+VAIITGG  G G +TA+LF +HGAKV+IAD +DD  QS+C+DL   +
Sbjct  3    TLLNHAPRRLEGKVAIITGGASGFGESTARLFARHGAKVVIADVQDDRGQSLCRDLNLPD  62

Query  313  SF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRV  489
               +VHCDVTS+SDV+N V+ AVS +G LDIM NNAGI G     I D D  +F  VF V
Sbjct  63   QISYVHCDVTSDSDVRNVVDFAVSKYGNLDIMFNNAGIPGNLDFTIADADNDNFKRVFEV  122

Query  490  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDL  666
            N  GAFLG KHAARVM P ++G I+ T+SVA  + G  P++Y+ SKHA+VGL KN  ++L
Sbjct  123  NVYGAFLGAKHAARVMIPERKGVILFTSSVASVVSGECPYSYSASKHAVVGLMKNLCVEL  182

Query  667  GRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            G+YGIRVN +SP  ++T M     GL +   DD +   +NLKGV   AEDVAEA LY
Sbjct  183  GQYGIRVNSISPCAVATPMLTGAVGLDKAVVDDIIRASANLKGVMPTAEDVAEAALY  239



>ref|XP_006359043.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 151/214 (71%), Gaps = 11/214 (5%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKV I D +D+  Q +C+ LG   S  F+HCDVTSE+DV NAV+ AV   G L
Sbjct  36   RLFHKHGAKVCIVDIQDELGQRVCESLGDEESACFIHCDVTSETDVSNAVDFAVEKFGTL  95

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAG+ GA   +ILD D + F NV  VN  G FLG KHAAR+M P +RGSI++ +S
Sbjct  96   DIMVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMIPRKRGSIVSLSS  155

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQM--------TR  729
            VAG +GG  PHAYT SK A++GLT+N A ++G++GIRVNCVSPY ++T++         R
Sbjct  156  VAGSIGGLGPHAYTASKFAVLGLTQNVAAEMGKHGIRVNCVSPYAVATELGLSHLPPEQR  215

Query  730  NYFGLAE-DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            N   +A+ +     ++NLKGVDLMA+DVA AVL+
Sbjct  216  NDDAIADFNSYFGKFANLKGVDLMAQDVANAVLF  249



>gb|KGN59171.1| hypothetical protein Csa_3G778270 [Cucumis sativus]
Length=277

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 173/243 (71%), Gaps = 7/243 (3%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCK  294
            M SS ++ST    +RL+G+VAIITGG  GIG  TAKLF  HGAKV++AD +DD  +++C 
Sbjct  1    MTSSEVISTTTGQRRLEGKVAIITGGASGIGECTAKLFVHHGAKVVVADIQDDLGRALCA  60

Query  295  D-LGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDF  471
            + LG  NS +VHCDVT ES VQ AV  AV T G+LDIM+NNAGIA      I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTDESQVQAAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDF  120

Query  472  VNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  648
              V  +N  G FLG KHAA+ M PV+ GSI++TASVA ++GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLSINVTGVFLGIKHAAQAMIPVKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTK  180

Query  649  NTALDLGRYGIRVNCVSPYILSTQMTRNYFGL--AEDDKL-DVYSNLKGVDLMAEDVAEA  819
            N A++LG++GIRVNC+SPY+L+T +   +  L  AE +K     +NLKGV L AEDVA A
Sbjct  181  NAAVELGQFGIRVNCLSPYVLATPLATEFVDLDGAEFEKYASSRANLKGVTLKAEDVANA  240

Query  820  VLY  828
             L+
Sbjct  241  ALF  243



>ref|XP_004139590.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN64963.1| hypothetical protein Csa_1G168890 [Cucumis sativus]
Length=274

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 167/236 (71%), Gaps = 4/236 (2%)
 Frame = +1

Query  133  SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGN  312
             LL  AA+RL+G+ AIITGG  GIG + AK F   GAKV+IAD  DD   S+   L   +
Sbjct  4    PLLPAAARRLEGKAAIITGGARGIGESIAKHFFNPGAKVVIADILDDLGNSLSNHLSSSS  63

Query  313  SFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  492
            + FVHC+VT E+DV+N VN AVS +G+LDIM NNAGI GA   +IL+ + +DF NV  VN
Sbjct  64   TSFVHCNVTKETDVENVVNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVN  123

Query  493  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLG  669
             +GAFLGTKHAA+ M P  +GSI+ TASV   +GG  P+AYT SKH ++GL +N  +DLG
Sbjct  124  LVGAFLGTKHAAKAMIPAGQGSIVITASVCSSIGGIGPYAYTSSKHGLLGLMRNATIDLG  183

Query  670  RYGIRVNCVSPYILSTQMTRNYFGLAEDDKL-DVYS-NLKGVDLM-AEDVAEAVLY  828
            RYGI+VNCVSP+++ TQMTR +F L + D+  DVYS N K  D++  EDVAE  LY
Sbjct  184  RYGIKVNCVSPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLY  239



>ref|XP_006651946.1| PREDICTED: zerumbone synthase-like [Oryza brachyantha]
Length=297

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 162/240 (68%), Gaps = 15/240 (6%)
 Frame = +1

Query  148  AAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG-HGNSFFV  324
            AAKRL+G+VA++TGG  GIG A  +LF +HGAKV IAD +D+  Q +   LG   ++ F+
Sbjct  28   AAKRLEGKVALVTGGASGIGEAIVRLFREHGAKVCIADIKDEAGQKLWDSLGGDQHALFL  87

Query  325  HCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGA  504
            HCDVT E +V  AV+      G LDI+VNNAGI G K  DI + D  +F  V  +N +G 
Sbjct  88   HCDVTVEEEVSRAVDATAEKFGTLDIIVNNAGITGNKITDIRNVDFAEFRKVIDINLVGV  147

Query  505  FLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGI  681
            F G KHAARVM P +RGSII+ ASVA  MGG  PHAYT SKHA+VGLTKN A +LG++GI
Sbjct  148  FHGMKHAARVMIPNKRGSIISLASVASVMGGLGPHAYTASKHAVVGLTKNVAAELGKHGI  207

Query  682  RVNCVSPYILSTQMTRNYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLY  828
            RVNCVSPY + T ++  Y  L ED++ D             +NLKGVDL+ +DVAEAVLY
Sbjct  208  RVNCVSPYAVPTALSMPY--LPEDERKDDALKGFLAFVGGEANLKGVDLLPKDVAEAVLY  265



>ref|XP_003553613.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN02191.1| Momilactone A synthase [Glycine soja]
Length=280

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 163/240 (68%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M+ SS +++ AK L+G+VAIITGG  GIG+ATAKLF QHGAKV+IAD +D+  Q  CK L
Sbjct  1    MIKSSSMASIAKMLEGKVAIITGGASGIGAATAKLFVQHGAKVIIADVQDELGQFHCKTL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  N  +VHCDVTS+SDV+N V  AVS +G+LDIM NNAGI+G     I   D   F NV
Sbjct  61   GTTNIHYVHCDVTSDSDVKNVVEFAVSKYGKLDIMYNNAGISGDSNRSITTSDNEGFKNV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  657
            F VN  GAFLG KHAARVM P +RG I+ T+SVA  +GG   HAY  SKHA+VGL KN  
Sbjct  121  FGVNVYGAFLGAKHAARVMIPAKRGVILFTSSVASLLGGETTHAYAVSKHAVVGLMKNLC  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVLY  828
            ++LG +GIRVNCV P  + T M  N   + + +  +V      LKG  L AED+A+A +Y
Sbjct  181  VELGEHGIRVNCVCPGGIPTPMLNNALKMNKKETQEVLCKVAVLKGTVLEAEDIAKAAVY  240



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 166/235 (71%), Gaps = 8/235 (3%)
 Frame = +1

Query  136  LLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNS  315
            + S   KRL+G+VA+ITGG  GIG  TA+LF QHGAKV++AD +D+  +S+C  +G   +
Sbjct  1    MTSALVKRLEGKVAVITGGASGIGECTARLFSQHGAKVVVADIQDERGRSVCDTIG---A  57

Query  316  FFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNT  495
             FVHCDVT ESDVQ A++ AV+ HG+LDIM NNAGI  A G  I D   +DF  V  V  
Sbjct  58   TFVHCDVTKESDVQKAIDTAVTGHGKLDIMFNNAGIIDA-GKPITDTALSDFHKVIDVIV  116

Query  496  LGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGR  672
             GAFLGTKHAARVM P  RGSII+TASVA  +GG   HAYT +KHA+ GLT++ A++LGR
Sbjct  117  TGAFLGTKHAARVMVPAGRGSIISTASVASVIGGVGTHAYTAAKHAVAGLTRSAAVELGR  176

Query  673  YGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +G+RVNCVSPY ++T++   +  + E   ++ +  ++ L+G  L  EDVA AVLY
Sbjct  177  FGVRVNCVSPYAVATRLAVEFARIDEKVFEEAMSKFATLQGTLLKPEDVAMAVLY  231



>ref|XP_007027908.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08410.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=274

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 162/234 (69%), Gaps = 5/234 (2%)
 Frame = +1

Query  142  STAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFF  321
            S+  KRL+G+VA+ITGG  G+G +TA+LF QHGAKVLIAD +D+   S+C++LG     +
Sbjct  5    SSVTKRLEGKVALITGGASGLGESTARLFVQHGAKVLIADIQDELGHSLCQELGTETISY  64

Query  322  VHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLG  501
            VHCDVT ESDVQNAV  AVS + +LDIM+NNAGI G   + + D D  +F  VF +N LG
Sbjct  65   VHCDVTCESDVQNAVELAVSKYRKLDIMLNNAGIMGHHEVRVTDADTENFKTVFDINVLG  124

Query  502  AFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRYG  678
             FLG KHAARVM P ++G I+ TAS+A  +  G PHAY  SKHA+VGLTK+ +++LG YG
Sbjct  125  GFLGAKHAARVMVPAKKGCILFTASLASKISMGTPHAYKASKHAVVGLTKSLSVELGEYG  184

Query  679  IRVNCVSPYILSTQMTRNYFGLAEDDK----LDVYSNLKGVDLMAEDVAEAVLY  828
            IRVNC+SP+ ++T + +   G+ +  K    +   + LKG  L  ED A A LY
Sbjct  185  IRVNCISPHAVATPLFQKTLGVFDKKKGEEAVSASAVLKGAVLEPEDFANAALY  238



>gb|ADK56099.1| alcohol dehydrogenase [Artemisia annua]
Length=265

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 136/204 (67%), Gaps = 3/204 (1%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  DD  + +C+DLG   + FVHCDVT ESD++N +N  ++ HG+LD
Sbjct  30   RLFVKHGAKVVIADVNDDLGKLLCQDLGSKFACFVHCDVTIESDIENLINTTIAKHGQLD  89

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IMVNNAG      L ILD + +DF  V  +N  G FLGTKHAARVM P   GSII TAS+
Sbjct  90   IMVNNAGTVDEPKLSILDNEKSDFDRVVSINLAGVFLGTKHAARVMIPKCSGSIITTASI  149

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
                GG   HAYT SKH +VGL KN A +LG+Y IRVNCVSPY + T++   +  +  D+
Sbjct  150  CSVTGGVASHAYTSSKHGVVGLAKNAAAELGKYNIRVNCVSPYFVPTKLAFKFLNM--DE  207

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
                YSNL+G  L  +D+A A L+
Sbjct  208  TSSFYSNLQGKTLGPQDIANATLF  231



>ref|XP_003539841.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN21178.1| Momilactone A synthase [Glycine soja]
Length=273

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 140/204 (69%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD +D+   S+CKDL   ++ ++HCDVT E ++++AVN  VS +G+LD
Sbjct  36   RLFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTKEENIEHAVNTTVSKYGKLD  95

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM ++AGI GA    IL    + F  V  VN +G FLG KHAARVM P  RGSI+  AS+
Sbjct  96   IMHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKHAARVMIPSGRGSIVAMASI  155

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
             G +GG   HAYT SKH IVGL +NTA++LG  GIRVN VSPY + T M++ +    ++ 
Sbjct  156  CGRIGGVASHAYTSSKHGIVGLVRNTAVELGTLGIRVNSVSPYAVPTPMSKTFLNTDDEG  215

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               +YSNLKG  L  +DVAEAVLY
Sbjct  216  IAALYSNLKGTVLKPQDVAEAVLY  239



>gb|ACU18308.1| unknown [Glycine max]
Length=273

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 140/204 (69%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD +D+   S+CKDL   ++ ++HCDVT E ++++AVN  VS +G+LD
Sbjct  36   RLFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTKEENIEHAVNTTVSKYGKLD  95

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM ++AGI GA    IL    + F  V  VN +G FLG KHAARVM P  RGSI+  AS+
Sbjct  96   IMHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKHAARVMIPSGRGSIVAMASI  155

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
             G +GG   HAYT SKH IVGL +NTA++LG  GIRVN VSPY + T M++ +    ++ 
Sbjct  156  CGRIGGVASHAYTSSKHGIVGLVRNTAVELGTLGIRVNSVSPYAVPTPMSKTFLNTDDEG  215

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
               +YSNLKG  L  +DVAEAVLY
Sbjct  216  IAALYSNLKGTVLKPQDVAEAVLY  239



>ref|XP_006367119.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 156/227 (69%), Gaps = 1/227 (0%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHC  330
            A+RL+G+VAIITG   GIG   A+LF +HGA V+IAD +DD +Q +C++L   +  +VHC
Sbjct  6    ARRLEGKVAIITGAASGIGEVAARLFTRHGAVVVIADIQDDLAQKVCENLDPSSITYVHC  65

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFL  510
            DVT E D++N VN AVS +G+LDIM NNAGI      +ILD + ++F  V  +N +G F+
Sbjct  66   DVTKEDDLKNVVNTAVSKYGKLDIMYNNAGIVDEIKSNILDNEKSEFEKVININLIGTFV  125

Query  511  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  687
            G K AARVM P  +GSII+TASV   +GG   HAYT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKEAARVMIPRGQGSIISTASVCASIGGVCSHAYTSSKHGVLGLTRNAAVDLGRYGIRV  185

Query  688  NCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            NCVSPY + T M          D  +VYSNLKG  L   DVAEA ++
Sbjct  186  NCVSPYTVLTTMGLYTLKKIGKDSSNVYSNLKGATLTPNDVAEAAVF  232



>ref|XP_002275723.3| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=277

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 7/210 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNS-FFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKV++AD +D   +S+C+++G   + F+VHCDVT ++D+QNAV+ A+S +G+L
Sbjct  32   RLFVKHGAKVIVADVQDQLGRSLCQEIGSEETIFYVHCDVTCDADIQNAVDTAISKYGKL  91

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM +NAGI+G     I+  D T+F  VF VN  GAFL  KHAARVM P + G II TAS
Sbjct  92   DIMFSNAGISGEMESRIILSDNTNFKRVFDVNAYGAFLAGKHAARVMIPAKTGCIIFTAS  151

Query  577  VAGFM--GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            V   +  G  P+AY  SKHA+VGL  N  ++LG+YGIRVNC+SP+ ++T M R   G+ E
Sbjct  152  VVSVVAEGAIPYAYVASKHAVVGLANNLCVELGQYGIRVNCISPFGVATPMLRQGAGMIE  211

Query  751  DDKLD----VYSNLKGVDLMAEDVAEAVLY  828
              K++      +NLKG+ L AEDVA+A LY
Sbjct  212  KSKVEDLVSSSANLKGIVLEAEDVAKAALY  241



>ref|XP_008442883.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=275

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 171/243 (70%), Gaps = 7/243 (3%)
 Frame = +1

Query  121  MVSSSLLS--TAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCK  294
            M SS ++S  T  +RL+G+VA+ITGG  GIG  TAK+F  HGAKV+IAD +DD   ++C 
Sbjct  1    MTSSEVISLTTGQRRLEGKVALITGGASGIGECTAKIFVHHGAKVVIADIQDDLGHALCA  60

Query  295  D-LGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDF  471
            + LG  NS +VHCDVT ES VQ AV  AV T G+LD+M+NNAGI       I+D D +DF
Sbjct  61   NVLGSTNSLYVHCDVTDESQVQAAVAAAVETFGKLDVMMNNAGIVDPSKPRIIDNDRSDF  120

Query  472  VNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  648
              V  +N  G FLG KHAA+ M P + GSI++TASVA ++GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLNINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTK  180

Query  649  NTALDLGRYGIRVNCVSPYILSTQMTRNYFGL--AE-DDKLDVYSNLKGVDLMAEDVAEA  819
            N A++LG++GIRVNC+SPY L T +   + GL  AE ++ +   +NLKGV L AEDVA A
Sbjct  181  NAAVELGQFGIRVNCLSPYALVTPLATKFVGLNGAEFEEVMGSKANLKGVTLKAEDVANA  240

Query  820  VLY  828
             L+
Sbjct  241  ALF  243



>gb|EMS67256.1| Xanthoxin dehydrogenase [Triticum urartu]
Length=317

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 140/214 (65%), Gaps = 11/214 (5%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLG-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF QHGAKV IAD +D+  Q +C  LG   +  FVHCDVT E D+  AV+ A    G L
Sbjct  72   RLFRQHGAKVCIADVQDEAGQQLCDSLGGDPDVLFVHCDVTVEEDISRAVDVAAEKFGTL  131

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAGI G K  DI + D  D   VF +N  G  LG KHAARVM P ++GSI++ AS
Sbjct  132  DIMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGMLLGMKHAARVMIPSKKGSIVSLAS  191

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  +GG  PHAYT SKHA+VGLTK+ AL+LGR+GIRVNCVSPY + T ++  +    E 
Sbjct  192  VASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIRVNCVSPYAVPTALSMPHLPQGEH  251

Query  754  DKLDVY---------SNLKGVDLMAEDVAEAVLY  828
                V          +NLKGVDL+ +DVAEAVLY
Sbjct  252  KGDAVRDFLAFVGSEANLKGVDLLPKDVAEAVLY  285



>gb|AFV30207.1| borneol dehydrogenase [Lavandula x intermedia]
Length=259

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 163/233 (70%), Gaps = 11/233 (5%)
 Frame = +1

Query  136  LLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNS  315
            + ST  +RL+G+VA+ITG   GIG + A+LF +HGAKV+IAD +D+ + ++CKDLG   S
Sbjct  1    MASTVLRRLEGKVALITGAASGIGESAARLFSRHGAKVVIADIQDELALNICKDLG---S  57

Query  316  FFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNT  495
             FVHCDVT E DV+ AVN AVST+G+LDIM+NNAGI+GA    I +   +DF  V  VN 
Sbjct  58   TFVHCDVTKEFDVETAVNTAVSTYGKLDIMLNNAGISGAPKYKISNTQLSDFKRVVDVNL  117

Query  496  LGAFLGTKHAARVMKPVQRG-SIINTASVAGFMGGFPHAYTCSKHAIVGLTKNTALDLGR  672
            +G FLGTKHAARVM P + G  I   ++      G P+ Y CSKH +VGLT+N A+++G 
Sbjct  118  VGVFLGTKHAARVMIPNRSGSIISTASAATAAAAGTPYPYICSKHGVVGLTRNAAVEMGG  177

Query  673  YGIRVNCVSPYILSTQMTRNYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLY  828
            +GIRVNCVSPY ++T MTR      +DD +   +SNLKG  L AEDVAEA LY
Sbjct  178  HGIRVNCVSPYYVATPMTR------DDDWIQGCFSNLKGAVLTAEDVAEAALY  224



>gb|ABS87381.1| short-chain dehydrogenase/reductase protein [Lactuca sativa]
Length=271

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 163/234 (70%), Gaps = 4/234 (2%)
 Frame = +1

Query  139  LSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF  318
            +S  AKRL+G+VA+ITG   GIG   AKLF  HGAKV+IAD +D   Q++ + +G  NS 
Sbjct  1    MSIPAKRLEGKVALITGAASGIGECCAKLFAAHGAKVIIADVQDQLGQAVSEAIGSSNSM  60

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            ++HCD+T+E +V+N ++ AV+T+G+LDIM NNAGIA A    I+D +  D   V  VN +
Sbjct  61   YIHCDITNEEEVKNTIDTAVATYGKLDIMFNNAGIADAFKPRIMDNEKKDIERVLGVNVI  120

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRY  675
            G FL  KHAARVM P + GSII T+S+   +GG   HAY+CSKHA+VGLT+N A++L  +
Sbjct  121  GTFLCMKHAARVMVPQKSGSIITTSSLTSHLGGMASHAYSCSKHALVGLTRNLAVELAPF  180

Query  676  GIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            GIRVNCVSP+ ++T MT ++ GL     ++ ++  +NLKGV    +DVA A LY
Sbjct  181  GIRVNCVSPFGIATPMTADFIGLEREVFENMINGVANLKGVTHKPDDVAYAALY  234



>gb|KCW90500.1| hypothetical protein EUGRSUZ_A02619 [Eucalyptus grandis]
Length=283

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 159/241 (66%), Gaps = 4/241 (2%)
 Frame = +1

Query  118  KMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKD  297
            K VS S+      RL+G+VA+ITGG  GIG  TA++F  HGAKV+IAD  D    S+C  
Sbjct  6    KQVSFSMHFLKFHRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDS  65

Query  298  LGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            LG   + FVHC+VT ES  + AV +AVST G+LDIM NNAGI G     I+D D  DF  
Sbjct  66   LGRDTASFVHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFER  125

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  654
            V  VN  G FLG KHAA+ M P +RG IINTAS++  +GG   HAYTC+KHA++GLT+N 
Sbjct  126  VLAVNVTGVFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNA  185

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVL  825
            A++LG++GIRVNC+SPY   T +   + G+     +  +   +NLKGV L AEDVA A L
Sbjct  186  AVELGQFGIRVNCLSPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAAL  245

Query  826  Y  828
            +
Sbjct  246  F  246



>ref|XP_011094267.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Sesamum indicum]
Length=280

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 140/209 (67%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF QHGAKV+IAD +D+  Q+ C+D+G      +VHCDVT+E+DV+N VN AVS +G+L
Sbjct  35   RLFVQHGAKVVIADVQDELGQTACRDIGSSEVISYVHCDVTNETDVENVVNTAVSKYGKL  94

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM +NAG+ G     IL  D  D   VF VN  G FL  KHAARVM P +RGSI+ T+S
Sbjct  95   DIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFLCAKHAARVMIPAKRGSIVFTSS  154

Query  577  VAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA    G  PHAY  SKHA+VGLTKN  ++LG YGIRVNCVSP+ ++T M      L E 
Sbjct  155  VASVTHGVVPHAYVASKHAVVGLTKNLCIELGEYGIRVNCVSPFGVATPMLMRTVELDEK  214

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
             K++      +NLKG  + A DVAEAV++
Sbjct  215  AKVEELVSGIANLKGEKMEAVDVAEAVIF  243



>ref|XP_006338927.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=279

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 165/233 (71%), Gaps = 8/233 (3%)
 Frame = +1

Query  154  KRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHC  330
            KRL+G+VA+ITGG  GIG A  +LF +HGAKV++AD +DD  Q++CK+LG  ++  F HC
Sbjct  12   KRLEGKVAVITGGASGIGEAATRLFTKHGAKVVVADIQDDLGQALCKELGSNDTISFTHC  71

Query  331  DVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAG-AKGLDILDCDGTDFVNVFRVNTLGAF  507
            DVT+E+D++NA+++AVS +G+LDIM +NAGI G  K   IL  D  +F NVF VN  GAF
Sbjct  72   DVTNENDMENAIDRAVSRYGKLDIMFSNAGITGNMKDPSILATDYNNFKNVFDVNVYGAF  131

Query  508  LGTKHAARVMKPVQRGSIINTASVAGFMGGF--PHAYTCSKHAIVGLTKNTALDLGRYGI  681
            LG K AA+ M P ++GSI+ T+SVA  +GG   P  Y  SKHA+VGLT + A++LG+YGI
Sbjct  132  LGAKIAAKAMIPTKKGSILFTSSVASVIGGIGSPITYASSKHAVVGLTNHLAVELGKYGI  191

Query  682  RVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLY  828
            RVNC+SPY ++T + R   G  + +K +      +NLKG  L  ED+AEA +Y
Sbjct  192  RVNCISPYTVATPLVREILGKMDKEKAEEIIMETANLKGGILEPEDIAEAAVY  244



>ref|XP_004981321.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=282

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 141/214 (66%), Gaps = 11/214 (5%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNS-FFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF  HGAKV IAD +D+  Q +   LG G+   FVHCDVT E DV  AV+      G L
Sbjct  37   RLFKNHGAKVCIADIQDEAGQKLRDALGGGDDVMFVHCDVTVEEDVSAAVDAVAQRFGAL  96

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            D+MVNNAGI G+K  DI + D  +   VF +N  G F+G KHAARVM P +RGSI++ AS
Sbjct  97   DVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFMGMKHAARVMIPRKRGSIVSLAS  156

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF--GLA  747
            VA  +GG  PHAYT SKHA+ GLTK+ A +LGR+G+RVNCVSPY + T ++  +   G  
Sbjct  157  VASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRVNCVSPYAVPTALSMPHLPKGAR  216

Query  748  EDDKLDVY-------SNLKGVDLMAEDVAEAVLY  828
             DD +  +       +NLKGVDLM EDVAEAVLY
Sbjct  217  ADDAVKDFLAFAGGAANLKGVDLMPEDVAEAVLY  250



>ref|XP_009399160.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 166/240 (69%), Gaps = 6/240 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S+LS+ A+RL+G+VA+ITGG  GIG  TAKLF +HGA+V++AD +DD+ +++C  L
Sbjct  1    MGSASILSSVARRLEGKVALITGGASGIGECTAKLFARHGARVIVADIQDDKGRALCAAL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  +  +VHCDVT E+DV+ AV+ AV+ HG+LD+M NNAG+        L  D   F  V
Sbjct  61   GPAS--YVHCDVTDEADVERAVDTAVALHGKLDVMFNNAGVMDPPVNGFLASDRAAFERV  118

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFPH-AYTCSKHAIVGLTKNTA  657
               N LGAFLGTKHAARVM P + GSI++TAS+   +GG    AYTCSKHA+VGL ++ A
Sbjct  119  MATNALGAFLGTKHAARVMVPARAGSIVSTASLVSAVGGVASAAYTCSKHAVVGLMRSAA  178

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LGR+G+R NCVSPY ++T +      L     +  ++   NLKGV L A DVAEAVLY
Sbjct  179  AELGRFGVRANCVSPYGVATPLAMAGMQLTTEEMEAAMEAMGNLKGVRLKAADVAEAVLY  238



>ref|XP_009590019.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 162/241 (67%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SSSL S  AK+L+G+VA ITGG  GIG+AT +LF QHGAKV IAD +D+   S+  ++
Sbjct  1    MASSSLQSPIAKKLEGKVAFITGGASGIGAATTRLFVQHGAKVTIADIQDNLGTSLVHEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + F+HC+V  ESDVQNAV+  +   G+LDIM +NAG+ G     IL+ D      V
Sbjct  61   GTEKAIFIHCNVAIESDVQNAVDATIEKFGKLDIMFSNAGVLGKPISSILEVDYDIIKTV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
            F VN +GAF   KHAARVM P ++GSII TASVA  + G  PHAY  SK A++GL+KN  
Sbjct  121  FDVNIIGAFFCAKHAARVMIPFKKGSIIFTASVATVVSGLVPHAYAASKCAVLGLSKNIG  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVL  825
            ++LG+YGI+VNCVSPY + T +  N  G+A+ +  D +     NLKG  L  E+VA+AVL
Sbjct  181  VELGKYGIKVNCVSPYYVGTPLALNMLGIADREMADKWIAEAGNLKGALLNEEEVAKAVL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_009605329.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=284

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 166/241 (69%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL S  AKRL+G+VA+ITGG  GIG+ATA+LF QHGAKV IAD +D+   S+ +++
Sbjct  1    MASYSLPSPIAKRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G+ ++ FVHC+V  ESDVQN V+  ++  G+LDIM +NAGI G     ILD D      V
Sbjct  61   GNEHTIFVHCNVAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
            F VN +GAF   KHAARVM P ++GSII TAS A  + G  PHAY+ SK A++G +KN  
Sbjct  121  FDVNIVGAFFCAKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIG  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVL  825
            ++LG+YGI+VNCVSP+ +ST +  N  G+AE +  + +     NLKG  L  E+VA+AVL
Sbjct  181  VELGKYGIKVNCVSPHYISTPLVLNALGIAEREMAEKWFAAGGNLKGALLDEEEVAKAVL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_004981317.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=329

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 140/213 (66%), Gaps = 10/213 (5%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAK+ IAD +D+  Q +   LG  +  FVHCDVT E +V  AV+      G LD
Sbjct  85   RLFREHGAKICIADIQDEAGQQLRDALGDQDVMFVHCDVTVEDEVSAAVDAVAQRFGSLD  144

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            +MVNNAGI G+K  DI + D  +   VF +N  G FLG KHAARVM P +RGSI++ ASV
Sbjct  145  VMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFLGMKHAARVMIPQKRGSIVSLASV  204

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF--GLAE  750
            A  +GG  PHAYT SKHA+ GLTK+ A +LGR+G+RVNCVSPY + T ++  +   G   
Sbjct  205  ASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRVNCVSPYAVPTALSMPHLPQGARA  264

Query  751  DDKLDVY-------SNLKGVDLMAEDVAEAVLY  828
            DD L  +       +NLKGVDLM  DVAEAVLY
Sbjct  265  DDALKDFLAFVGGEANLKGVDLMPRDVAEAVLY  297



>ref|XP_008462605.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=279

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 160/232 (69%), Gaps = 5/232 (2%)
 Frame = +1

Query  148  AAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FV  324
            ++KRL+G+VA+ITG   G G +TA+LF QHGA+V++AD +D+ +Q +CK+LG   S  ++
Sbjct  7    SSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEESVSYI  66

Query  325  HCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGA  504
            HCDVTS+SDV+NAV+ AV  +G+LDIM NNAGI G     IL  DG +F  VF VN  G 
Sbjct  67   HCDVTSDSDVKNAVDFAVERYGKLDIMYNNAGITGQMDPTILGTDGENFKKVFEVNVYGG  126

Query  505  FLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGI  681
            FLG KHAARVM P + G I+ T+SVA    G  PHAY  SKHA+VGL +N  ++LG +GI
Sbjct  127  FLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEFGI  186

Query  682  RVNCVSPYILSTQMTRNYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVLY  828
            RVN VSP  ++T + RN  G  + +  +V  +   LKGV   AEDVAEA LY
Sbjct  187  RVNSVSPGAIATPLLRNALGFTKKELEEVVRSSAILKGVVATAEDVAEAALY  238



>ref|XP_011046906.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Populus euphratica]
Length=281

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 167/245 (68%), Gaps = 9/245 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAK----RLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSM  288
            M SSS L++ AK    RL G+VAIITGG  GIG +T++LF +HGAKV+IAD +D   QS+
Sbjct  1    MNSSSSLASFAKSFCCRLAGKVAIITGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSL  60

Query  289  CKDL-GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGT  465
            CK+L    N  +VHCDVTS++DV+N V+ A+S +G+LDIM NNAGI G     IL  D  
Sbjct  61   CKELLTEDNVCYVHCDVTSDTDVKNVVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNE  120

Query  466  DFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGL  642
            DF  VF VN  G FLG KHAARVM PV++G I+ T+SVA    G  PHAYT SKHA+VGL
Sbjct  121  DFKRVFEVNVYGGFLGAKHAARVMIPVKKGVILFTSSVASVACGESPHAYTMSKHAVVGL  180

Query  643  TKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY---SNLKGVDLMAEDVA  813
             KN  ++LG+YGIRVNC+SP  L+T + RN  G  +     V    +NLKGV    +DVA
Sbjct  181  MKNLCVELGQYGIRVNCISPCALATPLLRNAMGADKSFVEHVVCESANLKGVVPSPKDVA  240

Query  814  EAVLY  828
            EA LY
Sbjct  241  EAALY  245



>emb|CAA11153.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
 emb|CAA11154.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
Length=284

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 166/241 (69%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S SL S  AKRL+G+VA+ITGG  GIG+ATA+LF QHGAKV IAD +D+   S+ +++
Sbjct  1    MASYSLPSPIAKRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G+ ++ FVHC+V  ESDVQN V+  ++  G+LDIM +NAGI G     ILD D      V
Sbjct  61   GNEHTIFVHCNVAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
            F VN +GAF   KHAARVM P ++GSII TAS A  + G  PHAY+ SK A++G +KN  
Sbjct  121  FDVNIVGAFFCAKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIG  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVL  825
            ++LG+YGI+VNCVSP+ +ST +  N  G+AE +  + +     NLKG  L  E+VA+AVL
Sbjct  181  VELGKYGIKVNCVSPHYISTPLVLNALGIAEREIAEKWFAAGGNLKGALLDEEEVAKAVL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>gb|KHG10215.1| hypothetical protein F383_13541 [Gossypium arboreum]
Length=272

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 162/235 (69%), Gaps = 6/235 (3%)
 Frame = +1

Query  142  STAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-  318
            S+ AKRL+G+VA+ITGG  GIG +T ++F +HGA VL+AD +D+  QS+CK LG   +  
Sbjct  6    SSVAKRLEGKVALITGGASGIGESTTRVFVEHGATVLVADIQDELGQSLCKQLGSPETVS  65

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            + HCDV SESDVQNAV+ AVS +G+LDIM NNAGIAG     ++  +  +F  VF VN L
Sbjct  66   YTHCDVKSESDVQNAVDTAVSRYGKLDIMFNNAGIAGEAEPRLIASNLHNFKRVFDVNVL  125

Query  499  GAFLGTKHAARVMKPVQRGSIINTAS-VAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRY  675
            G FLG KHAARVM P ++G I+ TAS V+    G  HAYT SKHA+VGLT+N A++LG Y
Sbjct  126  GGFLGAKHAARVMIPAKKGCILFTASIVSKICMGLSHAYTTSKHAVVGLTENLAVELGEY  185

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDK----LDVYSNLKGVDLMAEDVAEAVLY  828
            GIRVNC+SPY + T + +   G+++ +K    L     LKG  L   DVA+A L+
Sbjct  186  GIRVNCISPYAIVTPLFQKTSGVSKKEKVEGILSAAGVLKGAILEPSDVAQAALF  240



>gb|KGN59172.1| hypothetical protein Csa_3G778280 [Cucumis sativus]
Length=272

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 165/243 (68%), Gaps = 13/243 (5%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCK  294
            M S+ ++ST    +RL+G+VA+ITGG  GIG  TAKLF  HGAKV+IAD +DD   ++C 
Sbjct  1    MASNEIISTTTWQRRLEGKVALITGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCA  60

Query  295  D-LGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDF  471
            + LG  NS +VHCDVT ES        AV T G+LDIM+NNAGIA      I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTEESQA------AVETFGKLDIMMNNAGIADPSKPRIIDNDKHDF  114

Query  472  VNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  648
              V  +N  G FLG KHAA+ M P + GSI++TASVA + GG   HAYTCSKHA+VGLTK
Sbjct  115  DRVLSINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYTGGSASHAYTCSKHAVVGLTK  174

Query  649  NTALDLGRYGIRVNCVSPYILSTQMTRNYFGL--AEDDK-LDVYSNLKGVDLMAEDVAEA  819
            N A++LG++GIRVNC+SP+ L T +   + GL   E +K +   +NLKGV L AEDVA A
Sbjct  175  NAAVELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANA  234

Query  820  VLY  828
             L+
Sbjct  235  ALF  237



>ref|XP_009350131.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009350149.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=276

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 174/241 (72%), Gaps = 6/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS+LS  ++RL+G+VA+ITGG  GIG  TAK+F QHGAKV+IAD +DD   S+ + +
Sbjct  1    MAFSSVLSAVSRRLEGKVALITGGASGIGECTAKIFVQHGAKVVIADVQDDLGHSVRESI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  +  FVHCDVT E+ +++AV+K+V+T+G+LDIM NNAG+       I+D +  DF  V
Sbjct  61   GPSDCTFVHCDVTDEAQIKDAVHKSVATYGKLDIMFNNAGVVDPNKARIIDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              +N  G FLG KHAA+ M P + GSII+TAS++ ++GG   HAY CSKHA+ GLTKN A
Sbjct  121  LSINVTGVFLGIKHAAQAMIPARTGSIISTASISSYVGGAASHAYCCSKHAVNGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVL  825
            ++LG++GIRVNC+SPY L+T + RN+ G+ ED++L+      +NLKGV L A DVA A L
Sbjct  181  VELGQFGIRVNCLSPYALATPLARNFVGV-EDEELENVMGSLANLKGVTLKAVDVANAAL  239

Query  826  Y  828
            Y
Sbjct  240  Y  240



>ref|XP_007152489.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
 gb|ESW24483.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
Length=270

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 169/237 (71%), Gaps = 1/237 (0%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M     L   A+RLDG+VA+ITGG  GIG   AKLFC+HGAKV+IAD RD   Q++  ++
Sbjct  1    MARIQQLPLLAQRLDGKVALITGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + +VHCDV+ E+DV+NAVN  VS +G+LDIMVNNA I+     +ILD D TDF  V
Sbjct  61   GTECATYVHCDVSKETDVENAVNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
             RVN +G FLGTKHAARVM P +RGSII   SV+  +GG   HAYT SKHAIVGL KNTA
Sbjct  121  VRVNLVGPFLGTKHAARVMIPAKRGSIIIVGSVSSSVGGVASHAYTSSKHAIVGLAKNTA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             +LG++GIRVN +S Y +  ++ +++F L ++   ++YSNLKGV L  EDVA+A LY
Sbjct  181  AELGQFGIRVNSLSCYCIHNELAKDFFKLDDEGFSNIYSNLKGVTLKEEDVAQAALY  237



>ref|XP_010104812.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01953.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   207 bits (528),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SSLLS  ++RL+G+VA+ITGG  GIG  TAK+F  HGAK++IAD +DD   S+C+ L
Sbjct  1    MAISSLLSAVSRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGHSVCESL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +VHC+VT ES V+NAV++AV T+GRLDIM NNAGIA      I+D +  DF  V
Sbjct  61   GQTNSKYVHCNVTDESHVENAVDEAVKTYGRLDIMFNNAGIADENKARIIDSEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M P + GSII+TAS++ ++GG   HAY CSKHA++GLTKN A
Sbjct  121  MSVNVTGVFLGIKHAAQAMIPSRSGSIISTASISSYVGGAASHAYCCSKHAVIGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GIRVN +SPY L+T +   + GL +   ++ ++   NLK V L AEDVA A LY
Sbjct  181  VELGQFGIRVNSLSPYALATPLATKFVGLDDEGLENLMNSLGNLKHVTLKAEDVANAALY  240



>gb|EMT02624.1| Xanthoxin dehydrogenase [Aegilops tauschii]
Length=285

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 138/214 (64%), Gaps = 11/214 (5%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLG-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF QHGAKV IAD +D+  Q +   LG   +  FVHCDVT E D+  AV+      G L
Sbjct  40   RLFRQHGAKVCIADVQDEAGQQLRDSLGGDPDVLFVHCDVTVEEDISRAVDATAEKFGTL  99

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAGI G K  DI + D  D   VF +N  G  LG KHAARVM P ++GSI++ AS
Sbjct  100  DIMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGMLLGMKHAARVMIPSKKGSIVSLAS  159

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  +GG  PHAYT SKHA+VGLTK+ AL+LGR+GIRVNCVSPY + T ++  +    E 
Sbjct  160  VASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIRVNCVSPYAVPTALSMPHLPQGEQ  219

Query  754  DKLDVY---------SNLKGVDLMAEDVAEAVLY  828
                V          +NLKGVDL+ +DVAEAVLY
Sbjct  220  KGDAVRDFLAFVGSEANLKGVDLLPKDVAEAVLY  253



>ref|XP_002466226.1| hypothetical protein SORBIDRAFT_01g003880 [Sorghum bicolor]
 gb|EER93224.1| hypothetical protein SORBIDRAFT_01g003880 [Sorghum bicolor]
Length=282

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 143/216 (66%), Gaps = 14/216 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNS---FFVHCDVTSESDVQNAVNKAVSTHG  390
            +LF +HGAKV IAD +D+  Q +   LG G++    FVHCDVTSE DV  AV+ A    G
Sbjct  36   RLFTEHGAKVCIADIQDEAGQQLRDALG-GDAQGVMFVHCDVTSEEDVSRAVDAAAERFG  94

Query  391  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  570
             LD+MVNNAG+ GAK  DI   D  +   V  +N  G FLG KHAARVM P +RGSI++ 
Sbjct  95   ALDVMVNNAGVTGAKVTDIRAVDFAEVRRVLDINVHGVFLGMKHAARVMIPQKRGSIVSL  154

Query  571  ASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF--G  741
            ASVA  +GG  PHAYT SKHA+VGLTK+ A +LGR+G+RVNCVSPY + T ++  +   G
Sbjct  155  ASVASAIGGLGPHAYTASKHAVVGLTKSVAAELGRHGVRVNCVSPYAVPTALSMPHLPQG  214

Query  742  LAEDDKLDVY-------SNLKGVDLMAEDVAEAVLY  828
               DD L  +       +NLKGVD M +DVA+AVLY
Sbjct  215  ARADDALTDFLAFVGGEANLKGVDAMPKDVAQAVLY  250



>ref|XP_010654128.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=282

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNS-FFVHCDVTSESDVQNAVNKAVSTHGRL  396
            KLF +HGAKV++ D +D   +S+CK++G   + F+ HCDVT +SDVQNAV+ A+S +G+L
Sbjct  31   KLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQNAVDTAISKYGKL  90

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM +NAGI+G    +IL  D T+F  VF VN  GAFL  KHAARVM P + G II T+S
Sbjct  91   DIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMIPAKTGCIIFTSS  150

Query  577  VAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  + G   HAY  SKHA+VGL  N  ++LG+YG+RVNCVSP+ + T M +   G+ E 
Sbjct  151  VASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRVNCVSPFGVPTPMLQKGVGIMEK  210

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
             K++      +NLKG  L AED+AEA LY
Sbjct  211  RKVEELVSSAANLKGAALEAEDIAEAALY  239



>ref|XP_007152499.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
 gb|ESW24493.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
Length=270

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 168/231 (73%), Gaps = 1/231 (0%)
 Frame = +1

Query  139  LSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF  318
            L   A+RLDG+VA+ITGG  GIG   AKLFC+HGAKV+IAD RD   Q++  ++G   + 
Sbjct  7    LPLLAQRLDGKVALITGGARGIGEFMAKLFCKHGAKVVIADIRDQLGQALQHEIGTECAT  66

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            +VHCDV+ E+DV+NAVN  VS +G+LDIMVNNA I+     +ILD D TDF  V RVN +
Sbjct  67   YVHCDVSKETDVENAVNITVSKYGKLDIMVNNAAISDDAKPNILDNDVTDFERVVRVNLV  126

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRY  675
            G FLGTKHAARVM P +RGSII   SV+  +GG   HAYT SKHAIVGL KNTA +LG++
Sbjct  127  GPFLGTKHAARVMIPAKRGSIIIVGSVSSSVGGVASHAYTSSKHAIVGLAKNTAAELGQF  186

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            GIRVN +S Y +  ++ +++F L ++   ++YSNLKGV L  EDVA+A LY
Sbjct  187  GIRVNSLSCYCIHNELAKDFFKLDDEGFSNIYSNLKGVTLKEEDVAQAALY  237



>ref|XP_009420509.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=266

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 165/234 (71%), Gaps = 4/234 (2%)
 Frame = +1

Query  139  LSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF  318
            L ++AKRL+G+VA+ITGG  GIG +TAKLF ++GA+V+IAD +DD+ +++C  LG  ++ 
Sbjct  8    LPSSAKRLEGKVAVITGGASGIGESTAKLFVRYGARVVIADIQDDKGRALCDLLGTADAC  67

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            +VHCDVT ESD++NAV+ AV+  G+LDIM +NAG     G  + D D  +F  V  VN +
Sbjct  68   YVHCDVTDESDMRNAVDTAVARFGKLDIMFSNAGTLREFGKGLADSDKAEFERVMAVNVV  127

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRY  675
            GAFL TKHAARVM P +RGSI+ T S A  +GG  P +Y CSKHA+VGL K+ A +LG +
Sbjct  128  GAFLATKHAARVMAPARRGSIVITGSTASVLGGVVPLSYVCSKHAVVGLMKSAAAELGAH  187

Query  676  GIRVNCVSPYILSTQMTRNYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            G+RVNCVSP+ + T +     G+   A +  ++  +NLKGV   AEDVAEAV Y
Sbjct  188  GVRVNCVSPHGVMTPLMMGVMGMDEAATEAFVERSANLKGVKATAEDVAEAVAY  241



>ref|XP_002281290.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=282

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNS-FFVHCDVTSESDVQNAVNKAVSTHGRL  396
            KLF +HGAKV++ D +D   +S+CK++G   + F+ HCDVT +SDVQNAV+ A+S +G+L
Sbjct  31   KLFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQNAVDTAISKYGKL  90

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM +NAGI+G    +IL  D T+F  VF VN  GAFL  KHAARVM P + G II T+S
Sbjct  91   DIMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMIPAKTGCIIFTSS  150

Query  577  VAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  + G   HAY  SKHA+VGL  N  ++LG+YG+RVNCVSP+ + T M +   G+ E 
Sbjct  151  VASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRVNCVSPFGVPTPMLQKGVGIMEK  210

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
             K++      +NLKG  L AED+AEA LY
Sbjct  211  RKVEELVSSAANLKGAALEAEDIAEAALY  239



>ref|XP_008243484.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=276

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 171/241 (71%), Gaps = 6/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS+LS   +RL+G+VA+ITGG  GIG  TAK+F QHGAK++IAD +DD   S+ + +
Sbjct  1    MAFSSVLSAVTRRLEGKVALITGGASGIGECTAKIFAQHGAKIVIADVQDDLGHSVRESI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  +  FVHCDVT E+ ++NAV+KAV+T+G+LDIM NNAGI       I+D +  DF  V
Sbjct  61   GPTDCTFVHCDVTDEAQIKNAVHKAVATYGKLDIMFNNAGIVDDNKARIIDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M P + GSII+TAS++ ++GG   HAY CSKHA+ GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAAQAMIPARAGSIISTASISSYVGGAASHAYCCSKHAVNGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVL  825
            ++LG++GIRVNC+SPY L T + R + GL ED++++      +NLKGV L A DVA A L
Sbjct  181  VELGQFGIRVNCLSPYALVTPLARKFVGL-EDEEMENAMSALANLKGVTLKAVDVANAAL  239

Query  826  Y  828
            Y
Sbjct  240  Y  240



>ref|XP_002309404.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE92927.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=276

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 165/243 (68%), Gaps = 10/243 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SSL +  AKRL+G+VA+ITG   GIG  TA+LF QHGAKV+IAD +D+   S+C ++
Sbjct  1    MNDSSLPAPLAKRLEGKVALITGAASGIGETTARLFVQHGAKVVIADIQDELGHSVCNEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAK-GLDILDCDGTDFVN  477
            G   S +VHCDVTSE DVQNAV   +S HG+LDIM +NAGIA AK  + IL  +  D+  
Sbjct  61   G---SDYVHCDVTSEIDVQNAVETTISKHGKLDIMFSNAGIADAKLDISILAFEHEDYKK  117

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG--FPHAYTCSKHAIVGLTKN  651
            VF VN  GAFL  KHAA+VM P ++GSII T+S A    G   P+AY  SKHA+VGLTKN
Sbjct  118  VFDVNMYGAFLSAKHAAKVMIPAKKGSIIFTSSFASVCYGAMLPYAYAVSKHALVGLTKN  177

Query  652  TALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEA  819
              ++LG+YGIRVNC+SP+ ++T + R   G  +   ++ +    +NLK   L A DVAEA
Sbjct  178  LCVELGQYGIRVNCISPFGVATPLLRKGLGGIDQKTVEEFICTSANLKEAVLKASDVAEA  237

Query  820  VLY  828
             LY
Sbjct  238  ALY  240



>ref|XP_009631422.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 146/215 (68%), Gaps = 14/215 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV IAD +D   Q +C+ LG   S F+HCDVT+E+D+  AV+ AV   G LD
Sbjct  36   RLFHKHGAKVCIADIQDKLGQRVCESLGDDQSAFIHCDVTAEADISQAVDFAVQKFGTLD  95

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            I+VNNAG+ G    DI D + + F NV  VN  G FLG KHAAR+M P+++GSI++ +S 
Sbjct  96   ILVNNAGLTGTTYTDIRDYELSVFDNVIDVNVKGVFLGMKHAARIMIPLKKGSIVSLSSA  155

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            A  +GG  PHAYT SKHA+ GLTKN A +LG++GIRVNCVSPY ++T +  ++  L ED 
Sbjct  156  ASAIGGLAPHAYTASKHAVSGLTKNVAAELGQHGIRVNCVSPYAVATGLGLSH--LPEDQ  213

Query  757  KLD-----------VYSNLKGVDLMAEDVAEAVLY  828
            + D            ++NL+GVDL+ EDVA AVL+
Sbjct  214  RDDDAIADFHAYFGKFANLQGVDLLVEDVANAVLF  248



>ref|XP_007027903.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08405.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=277

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 144/209 (69%), Gaps = 7/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF   GAKV+IAD +DD  QS+C++LGH +  +VHCDVT +SDV+NAV+ AVST+G LD
Sbjct  34   RLFVHQGAKVVIADIQDDLGQSICEELGHQSISYVHCDVTRDSDVRNAVDLAVSTYGSLD  93

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGIAG     I+  D   F  V  VN  G +LG K+AA+VM P ++G I+ T+SV
Sbjct  94   IMFNNAGIAGPDK-SIVSSDDEKFKKVLDVNVFGGYLGAKYAAKVMIPARKGCILFTSSV  152

Query  580  AGFMGGF--PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
               +GG    HAY  SKHA+VGL KN  ++LG+YGIRVNC+SP+ ++T + R  FG+ E 
Sbjct  153  FSVIGGTDAGHAYVTSKHALVGLAKNLCVELGQYGIRVNCISPFGVATPLLRKPFGMMEK  212

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
            +K++      +NLKG  L  +DVA+A LY
Sbjct  213  EKVEELVSKGANLKGTVLKPDDVAQAALY  241



>ref|XP_002530513.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF31845.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=226

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 155/214 (72%), Gaps = 3/214 (1%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  +SL+S  A+RL+G+VA+ITGG  GIG+ TAK+F  HGAKV+IAD +D+   S+ + L
Sbjct  1    MAPTSLISAVARRLEGKVALITGGASGIGACTAKVFAHHGAKVVIADVQDELGHSVSESL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  NS +VHC+VT ES ++ AV+KAVST+G+LDIM NNAGI       I+D +  DF  V
Sbjct  61   GPSNSTYVHCNVTDESHIKIAVDKAVSTYGKLDIMFNNAGIVDVNKPRIVDNEKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPSRSGSIISTASVSSSVGAAASHAYCCSKHAVLGLTKNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDK  759
            ++LG++GIRVNC+SPY L+T +   + GL  DD+
Sbjct  181  VELGQFGIRVNCLSPYALATPLATKFVGL--DDQ  212



>ref|XP_002281352.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFF-VHCDVTSESDVQNAVNKAVSTHGRL  396
            KLF +HGAKV++AD +D   +S+C+++G   + F VHCDVT +SDVQNAV+ A+S +G+L
Sbjct  31   KLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFDVHCDVTCDSDVQNAVDTAISKYGKL  90

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM +NAG+ G     I+  D T+F  VF VN  GAFL  KHAARVM P + G II T+S
Sbjct  91   DIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFLAAKHAARVMIPAKTGCIIFTSS  150

Query  577  VAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  +     HAY  SKHA+VGL  N  ++LG+YGIRVNC+SP+ ++T M +   G+ E 
Sbjct  151  VASVVSEEISHAYVASKHAVVGLANNLCVELGQYGIRVNCISPFGVATPMLQKGLGIMEK  210

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
             K++      +NLKGV L AED+AEA LY
Sbjct  211  RKVEELVSSAANLKGVVLEAEDIAEAALY  239



>ref|XP_010931582.1| PREDICTED: LOW QUALITY PROTEIN: zerumbone synthase-like [Elaeis 
guineensis]
Length=277

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 145/215 (67%), Gaps = 15/215 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF--FVHCDVTSESDVQNAVNKAVSTHGR  393
            +LF +HGAK+ + D +D+  Q +CK LG G+ +  F HCDVT E DV+ AV+     +G 
Sbjct  35   RLFRKHGAKICVVDIQDNLGQQLCKSLG-GDPYVCFFHCDVTIEDDVRRAVDFTADKYGT  93

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            +DIMVNNAGI G+K  DI D D  +F  VF VN  G FLG KHAAR+M P ++GSII+ A
Sbjct  94   IDIMVNNAGITGSKVKDIRDADFNEFKKVFDVNVNGVFLGMKHAARIMIPQRKGSIISLA  153

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVA   GG  PH YT SKHA++GLTKN A +LG+ GIRVNCVSPY   T ++  +  L E
Sbjct  154  SVASTTGGLGPHGYTGSKHAVLGLTKNVAAELGKRGIRVNCVSPYATPTSLSMPH--LPE  211

Query  751  DDKLD---------VYSNLKGVDLMAEDVAEAVLY  828
            +++ +          ++NLKGVDLM +DVA+AVLY
Sbjct  212  EERQEDAXFLSFVGSHANLKGVDLMVDDVAQAVLY  246



>ref|XP_006854740.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
 gb|ERN16207.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
Length=276

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 142/209 (68%), Gaps = 8/209 (4%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVST-HGRL  396
            +LF QHGA+V+IAD +DD  QS    +   N+ + HCDVT+E D+  A++ A +   G+L
Sbjct  39   RLFSQHGARVIIADIQDDLGQSTASSIP--NATYTHCDVTNEEDICQAIDLATTLGDGKL  96

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM NNAGI       IL+   +DF  V  VN +GAFLGTKHAARVM P Q G I+ TAS
Sbjct  97   DIMFNNAGIVDPPKPSILEYSLSDFDRVLGVNLVGAFLGTKHAARVMIPAQSGCILYTAS  156

Query  577  VAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            V+  +GG   HAY C+KHA+ GLTKN A++LG +GIRVNC+SPY L+T + + + GL +D
Sbjct  157  VSSVIGGAATHAYACTKHALAGLTKNAAVELGEFGIRVNCISPYCLATPLAKKFVGLEQD  216

Query  754  DKLD----VYSNLKGVDLMAEDVAEAVLY  828
             +L+     ++NLKGV L +EDVA A LY
Sbjct  217  KELEEVMGAHANLKGVVLKSEDVARAALY  245



>ref|XP_010922188.1| PREDICTED: zerumbone synthase-like [Elaeis guineensis]
Length=280

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 168/245 (69%), Gaps = 13/245 (5%)
 Frame = +1

Query  130  SSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHG  309
             S+L  + +RL+G+VA++TGG  GIG    +LF +HGAK+ + D +D+  Q +C+ LG G
Sbjct  6    ESVLPLSPQRLEGKVALVTGGATGIGEGIVRLFRKHGAKICVVDIQDNLGQQLCESLG-G  64

Query  310  NSF--FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVF  483
            + +  F HC+VT E DV +A++  V  +G +DIMVNNAGI G+K +DI D D  +F  VF
Sbjct  65   DPYVCFFHCNVTIEDDVHHAIDFTVRKYGTIDIMVNNAGITGSKVVDIRDVDFNEFKKVF  124

Query  484  RVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTAL  660
             VN  G FLG KHAARVM P ++GSII+ ASVA  +GG  PH YT +KHA++GLT+N A 
Sbjct  125  DVNVNGVFLGMKHAARVMIPKKKGSIISLASVASVIGGMGPHGYTGTKHAVLGLTRNVAA  184

Query  661  DLGRYGIRVNCVSPYILSTQMTRNYFGLAE--DDKLD-------VYSNLKGVDLMAEDVA  813
            +LG++GIRVNCVSPY   T+++  +    E  +D L+        ++NLKGVDL  +DVA
Sbjct  185  ELGKHGIRVNCVSPYATPTRLSMPHLPENERQEDALNGFLSFVGTHANLKGVDLAVDDVA  244

Query  814  EAVLY  828
            +AVLY
Sbjct  245  QAVLY  249



>ref|XP_006354114.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=277

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 161/236 (68%), Gaps = 6/236 (3%)
 Frame = +1

Query  139  LSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF  318
            +S+ AKRL+G+VAIITGG  GIG AT +LF +HGAKVLIAD +DD  QS+ K++G     
Sbjct  4    ISSIAKRLEGKVAIITGGASGIGEATTRLFTKHGAKVLIADVQDDHGQSIIKEIGENRDV  63

Query  319  -FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNT  495
             +VHCDV  E DV+N V+ A+S +G+LDIM +NAG+ G     IL  D  +F NVF VN 
Sbjct  64   SYVHCDVKVEKDVKNVVDMAISKYGKLDIMFSNAGVPGQPDTTILKLDYENFKNVFDVNV  123

Query  496  LGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDLGR  672
             GA +  KHA RVM P ++GSII T+S+A    G   H Y  SKHAIVGL KN  ++LG+
Sbjct  124  FGALMCAKHATRVMIPPKKGSIIFTSSIASVTYGDVAHTYLASKHAIVGLAKNLGVELGQ  183

Query  673  YGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLY  828
            +GIRVNCVSP+ ++T M  N  G+ + ++++ +    SNLKG  L  EDVA+A LY
Sbjct  184  HGIRVNCVSPFGVATPMLMNGLGIHDKEEVEEFVSQISNLKGTILEGEDVAQAALY  239



>sp|Q94KL7.1|SILD_FORIN RecName: Full=Secoisolariciresinol dehydrogenase, partial [Forsythia 
x intermedia]
 gb|AAK38665.1| stem secoisolariciresinol dehydrogenase [Forsythia x intermedia]
Length=277

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 166/239 (69%), Gaps = 5/239 (2%)
 Frame = +1

Query  127  SSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGH  306
            +S +L+  A+RL+G+VA+ITGG  GIG  TAKLF QHGAKV IAD +D+   S+ + +G 
Sbjct  4    TSQVLTAIARRLEGKVALITGGASGIGETTAKLFSQHGAKVAIADVQDELGHSVVEAIGT  63

Query  307  GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFR  486
             NS ++HCDVT+E  V+NAV+  VST+G+LDIM +NAGI+      I+D +  DF  VF 
Sbjct  64   SNSTYIHCDVTNEDGVKNAVDNTVSTYGKLDIMFSNAGISDPNRPRIIDNEKADFERVFS  123

Query  487  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALD  663
            VN  G FL  KHAARVM P + G+II+TAS++  M GG  HAY  SKHA++GLT+N A++
Sbjct  124  VNVTGVFLCMKHAARVMIPARSGNIISTASLSSTMGGGSSHAYCGSKHAVLGLTRNLAVE  183

Query  664  LGRYGIRVNCVSPYILSTQMTRNYFGLAEDDK----LDVYSNLKGVDLMAEDVAEAVLY  828
            LG++GIRVNC+SP+ L T + + + G+  +++    ++   NLKG     EDVA A LY
Sbjct  184  LGQFGIRVNCLSPFGLPTALGKKFSGIKNEEEFENVINFAGNLKGPKFNVEDVANAALY  242



>ref|XP_002530176.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32231.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=340

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 166/239 (69%), Gaps = 5/239 (2%)
 Frame = +1

Query  127  SSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGH  306
            S+S+  + AKRL G+VAIITGG  GIG+ T+ LF Q+GAKV+IAD ++   QS+C+++G 
Sbjct  4    STSVALSNAKRLAGKVAIITGGASGIGAITSALFAQNGAKVIIADIQESLGQSLCQEIGK  63

Query  307  -GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVF  483
             GN  +VHCDVTS+ DV+N V+ A+S +G+LDIM NNAGI+G     IL  D  +F  VF
Sbjct  64   DGNVSYVHCDVTSDKDVKNIVDFAMSKYGKLDIMYNNAGISGNNDPTILGTDNENFKRVF  123

Query  484  RVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGF-MGGFPHAYTCSKHAIVGLTKNTAL  660
             +N  G FLG KHAARVM P ++G I+ T+SVA    G  PHAYT SKHA+VGL KN  +
Sbjct  124  EINVYGGFLGAKHAARVMIPAKKGVILFTSSVASVNCGESPHAYTMSKHAVVGLMKNLCV  183

Query  661  DLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            +LG+YG+RVNC+SP  L+T + RN  G  +   +  +   +NLKGV    EDVAEA LY
Sbjct  184  ELGQYGVRVNCISPCALATPLLRNAMGTDKSFVEHVVCASANLKGVVPQPEDVAEAALY  242



>ref|XP_007027905.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08407.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=281

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 163/235 (69%), Gaps = 6/235 (3%)
 Frame = +1

Query  142  STAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-  318
            S  AKRL+G+VA+ITGG  GIG +TA+LF +HGAKVLIAD +D+   S+CK+LG  +   
Sbjct  6    SLVAKRLEGKVALITGGASGIGESTARLFVKHGAKVLIADIQDELGHSLCKELGTPDFIS  65

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            ++HCDVT E+DVQNAV+ AVS +G+LDIM NNAGI G   +  +  D  +F  V  VN  
Sbjct  66   YIHCDVTCETDVQNAVDLAVSEYGKLDIMFNNAGIPGDLEIRAITSDIENFKRVLDVNVF  125

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRY  675
            GAFLG KHAARVM P ++G I+ TASVA  +  G  HAYT SKHA+VG+TK+ +++LG Y
Sbjct  126  GAFLGAKHAARVMIPAKKGCILFTASVASLVCLGISHAYTTSKHAVVGMTKSLSVELGEY  185

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDK----LDVYSNLKGVDLMAEDVAEAVLY  828
            GIRVNC+SP+ + T + +   G+ +  K    L   + LKG  L  EDVA+A L+
Sbjct  186  GIRVNCISPHAVVTPLLQKTLGILDKRKGEEILSTTAVLKGTILEPEDVAQAALF  240



>ref|XP_008643649.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X2 [Zea 
mays]
 gb|AFW67244.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 139/215 (65%), Gaps = 12/215 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLG--HGNSFFVHCDVTSESDVQNAVNKAVSTHGR  393
            +LF +HGAKV IAD +D+  Q +   LG     + FVHCDVTSE DV  AV+ A    G 
Sbjct  37   RLFMEHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFGA  96

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            LD+MVNNAG+ G K  DI + D  +   V  VN  G FLG KHAAR M P +RGSI++ A
Sbjct  97   LDVMVNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVFLGMKHAARAMIPRKRGSIVSLA  156

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF--GL  744
            SVA  +GG  PH YT SKHA+VGLTK+ A +LGR+G+RVNCVSPY + T ++  +   G 
Sbjct  157  SVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCVSPYAVPTALSMPHLPQGA  216

Query  745  AEDDKLDVY-------SNLKGVDLMAEDVAEAVLY  828
              DD L  +       +NLKGVD M EDVA+AVLY
Sbjct  217  RADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLY  251



>ref|XP_010654129.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 142/209 (68%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFF-VHCDVTSESDVQNAVNKAVSTHGRL  396
            KLF +HGAKV++AD +D   +S+C+++G   + F VHCDVT +SDVQNAV+ A+S +G+L
Sbjct  31   KLFVKHGAKVIVADVQDQLGRSLCQEIGPAETVFHVHCDVTCDSDVQNAVDTAISKYGKL  90

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM +NAG+ G     I+  D T+F  VF VN  GAFL  KHAARVM P + G II T+S
Sbjct  91   DIMFSNAGVHGEMESRIILSDNTNFKRVFDVNVYGAFLAAKHAARVMIPAKTGCIIFTSS  150

Query  577  VAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  +     HAY  SKHA+VGL  N  ++LG+YGIRVNC+SP+ ++T M +   G+ E 
Sbjct  151  VASVVSEEISHAYVASKHAVVGLANNLCVELGQYGIRVNCISPFGVATPMLQKGLGIMEK  210

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
             K++      +NLKG  L AED+AEA LY
Sbjct  211  RKVEELVSSAANLKGAVLEAEDIAEAALY  239



>ref|XP_004237829.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 149/216 (69%), Gaps = 15/216 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKV I D +D   + +C+ LG  +S  F+HCDVTSE+DV NAV+ AV   G L
Sbjct  36   RLFHKHGAKVCIVDIQDAFGKRVCESLGDEDSACFIHCDVTSETDVSNAVDFAVERFGTL  95

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DI+VNNAG+ GA   +ILD D + F NV  VN  G FLG KHAAR+M P +RGSI++  S
Sbjct  96   DIIVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMIPRKRGSIVSLCS  155

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VAG +GG  PHAYT SK A++GLT+N A ++G++G+RVNCVSPY ++T++      L  +
Sbjct  156  VAGSIGGLGPHAYTASKFALLGLTQNVAAEMGKHGVRVNCVSPYAVATEL--GLLHLPPE  213

Query  754  DKLD-----------VYSNLKGVDLMAEDVAEAVLY  828
             + D            ++NLKGVDLMA+DVA+AVL+
Sbjct  214  QRTDDAIADFNSHFGKFANLKGVDLMAQDVAKAVLF  249



>ref|XP_010059357.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90497.1| hypothetical protein EUGRSUZ_A02615 [Eucalyptus grandis]
Length=284

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 165/244 (68%), Gaps = 5/244 (2%)
 Frame = +1

Query  112  SRKMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMC  291
            S K ++ S  +   KRL+G+VAIITGG GGIG +TA+LF +HGAKV++AD +D    S+C
Sbjct  5    SEKNMNGSSAALTPKRLEGKVAIITGGAGGIGESTARLFVRHGAKVVVADVQDKLGPSLC  64

Query  292  KDLG-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTD  468
            ++LG  G   +VHCDVT + DV+NAV+ AV+ +G+LDIM NNAGI G     +LD DG D
Sbjct  65   EELGAEGAVSYVHCDVTRDEDVKNAVDFAVAKYGKLDIMYNNAGITGKVYPTVLDADGED  124

Query  469  FVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLT  645
            F  V  +N  GAFLG KHAARVM P +RG I+ TAS+A    G  PHAYT SKHA+VGL 
Sbjct  125  FKRVLDINVCGAFLGAKHAARVMIPAKRGVILFTASIASTCAGESPHAYTTSKHAVVGLM  184

Query  646  KNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSN---LKGVDLMAEDVAE  816
            KN  ++LG+YGIRVN +SP  ++T +  N  GL +    +V S    LKG     EDVAE
Sbjct  185  KNLCVELGQYGIRVNAISPCGIATPLLVNAVGLEKSMLAEVLSASAVLKGPVPEPEDVAE  244

Query  817  AVLY  828
            A LY
Sbjct  245  AALY  248



>emb|CBI18081.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 142/210 (68%), Gaps = 14/210 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  D    ++   L    +F VHCDV+ E D++N +N  VS +GRLD
Sbjct  50   RLFARHGAKVVIADVEDTLGAALASSLAPSVTF-VHCDVSLEEDIENVINSTVSRYGRLD  108

Query  400  IMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            I+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG KHAARVM P   G II+TA
Sbjct  109  ILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGIKHAARVMVPRGMGCIISTA  168

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVAG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ ++T M R      E
Sbjct  169  SVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLR------E  222

Query  751  DDKLDVY----SNLKGVDLMAEDVAEAVLY  828
             +K++ +    +NLKG  L A+D+AEA LY
Sbjct  223  VEKMEEFVSGLANLKGHILRAKDIAEAALY  252



>ref|XP_008808776.1| PREDICTED: zerumbone synthase [Phoenix dactylifera]
Length=280

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 167/248 (67%), Gaps = 17/248 (7%)
 Frame = +1

Query  127  SSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGH  306
            + S+   + +RL+G+VA++TGG  GIG +  +LF +HGAK+ + D +D+  Q +CK LG 
Sbjct  5    AGSVPPLSPRRLEGKVALVTGGAMGIGESIVRLFREHGAKICVVDIQDNLGQQLCKSLG-  63

Query  307  GNSF--FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G+ +  F HCDVT E DV  AV+  V  +G +DI+VNNAGI G+K +DI + D  +F  V
Sbjct  64   GDPYVVFFHCDVTIEDDVHRAVDFTVRKYGTIDILVNNAGITGSKVVDIRNVDLKEFKKV  123

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  657
            F VN  G FLG KHA+RVM P  +GSII+ ASVA  +GG  PH YT SKHA++GLT+N A
Sbjct  124  FDVNVNGVFLGMKHASRVMIPKSKGSIISLASVASVIGGMGPHGYTGSKHAVLGLTRNVA  183

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDV-----------YSNLKGVDLMAE  804
             +LGR+GIRVNCVSPY   T ++  +  L E+++ +            ++NLKG +LM +
Sbjct  184  AELGRHGIRVNCVSPYATPTSLSMPH--LPENERREAALKGFLSFAGSHANLKGAELMVD  241

Query  805  DVAEAVLY  828
            DVA+AVLY
Sbjct  242  DVAQAVLY  249



>ref|XP_009618308.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 165/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S L+  ++RL+G+VAIITGG  G G +T +LF Q+GAKV+IAD +D+  QS+C +L
Sbjct  1    MNGCSPLAPTSRRLEGKVAIITGGASGFGESTVRLFLQNGAKVVIADVQDNIGQSLCNNL  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
             + N   ++HCDVTS+SDV+N ++  +S +G+LDIM NNAGI G    +I+D D  +F  
Sbjct  61   NYPNDVTYIHCDVTSDSDVKNLIDTTISKYGKLDIMFNNAGIPGNLDFNIVDSDNENFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  654
            VF VN  G+FLG K+AA+VM P ++G I+ T+SVA    G  PH+YT SKHA+VGLTKN 
Sbjct  121  VFDVNVYGSFLGAKYAAKVMIPAKKGVILFTSSVASVNSGESPHSYTVSKHAVVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFG---LAEDDKLDVYSNLKGVDLMAEDVAEAVL  825
              +LG+YGIRVNCVSP  ++T +     G   +  D  +   +NLKGV   AEDVAEA L
Sbjct  181  CAELGQYGIRVNCVSPCAVATPLLVKAMGADKIVVDGIICSSANLKGVVPTAEDVAEAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_002526911.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35464.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 164/237 (69%), Gaps = 13/237 (5%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF--FV  324
            AKRL+G+VA+ITGG  G+G ++A+LF +HGAKV++AD +D+   S+CK+LG       ++
Sbjct  11   AKRLEGKVALITGGASGMGESSARLFVKHGAKVVVADVQDELGYSLCKELGSDQEIISYI  70

Query  325  HCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGA  504
            HCDVT +SDVQNAV+ AVS +G+LDIM +NAG+AG     I+D +  DF  VF +N  GA
Sbjct  71   HCDVTCDSDVQNAVDFAVSKYGKLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGA  130

Query  505  FLGTKHAARVMKPVQRGSIINTA---SVAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRY  675
            FL  KHAARVM P ++G I+ T    SV+ F     H Y  SKHAI+GL+KN +++LG++
Sbjct  131  FLAAKHAARVMIPAKKGCILFTCSYLSVSCFQA--IHPYVASKHAILGLSKNLSVELGQH  188

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDK------LDVYSNLKGVDLMAEDVAEAVLY  828
            GIRVNCVSP+++ T M R   G+ E +K      +   +NLK V L AED+AEA LY
Sbjct  189  GIRVNCVSPFVVITPMMRKAMGVMEAEKEKLQEVVSASANLKNVMLEAEDIAEAALY  245



>ref|XP_003563948.1| PREDICTED: zerumbone synthase isoform X2 [Brachypodium distachyon]
Length=282

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 139/216 (64%), Gaps = 13/216 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHG---NSFFVHCDVTSESDVQNAVNKAVSTHG  390
            +LF QHGAKV IAD +D+  Q +   LG     +  FVHCDVT E DV  AV+ A    G
Sbjct  35   RLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGTDVLFVHCDVTVEEDVSRAVDAAAEKFG  94

Query  391  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  570
             LDIMVNNAGI G K  DI + D  +   VF +N  G  LG KHAARVM P ++GSI++ 
Sbjct  95   TLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGMLLGMKHAARVMIPGKKGSIVSL  154

Query  571  ASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLA  747
            ASVA  MGG  PHAYT SKHA+VGLTK+ AL+LG++GIRVNCVSPY + T ++  +    
Sbjct  155  ASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGIRVNCVSPYAVPTALSMPHLPQG  214

Query  748  EDDKLDVY---------SNLKGVDLMAEDVAEAVLY  828
            E     V          +NLKGVDL+ +DVA+AVLY
Sbjct  215  EHKGDAVRDFLAFVGGEANLKGVDLLPKDVAQAVLY  250



>ref|XP_010654127.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=282

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 144/209 (69%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNS-FFVHCDVTSESDVQNAVNKAVSTHGRL  396
            KLF +HGAKV++AD +D    S+CK++G   + F+VHCDVT +SDVQNAV+ A+S +G+L
Sbjct  31   KLFVKHGAKVIVADVQDQLGLSVCKEIGPEETVFYVHCDVTCDSDVQNAVDTAISKYGKL  90

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT-A  573
            DIM +NAGI+G     IL  D T+F  VF VN  GAFL  KHAARVM P + G II T +
Sbjct  91   DIMFSNAGISGEMESGILLVDNTNFKRVFDVNVYGAFLAAKHAARVMIPAKTGCIIFTSS  150

Query  574  SVAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            +V+    G  HAY  SKHA+VGL  N  ++LG+YGIRVNC+SP+ ++T + R   G+ E 
Sbjct  151  AVSVVSVGATHAYVASKHAVVGLANNLCVELGQYGIRVNCISPFGVATPILRKGLGIMEK  210

Query  754  DKLDVY----SNLKGVDLMAEDVAEAVLY  828
             K++      +NLKGV L AED+AEA LY
Sbjct  211  RKVEELVCSAANLKGVVLEAEDIAEAALY  239



>ref|XP_010227919.1| PREDICTED: zerumbone synthase isoform X1 [Brachypodium distachyon]
Length=283

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 139/216 (64%), Gaps = 13/216 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHG---NSFFVHCDVTSESDVQNAVNKAVSTHG  390
            +LF QHGAKV IAD +D+  Q +   LG     +  FVHCDVT E DV  AV+ A    G
Sbjct  36   RLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGTDVLFVHCDVTVEEDVSRAVDAAAEKFG  95

Query  391  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  570
             LDIMVNNAGI G K  DI + D  +   VF +N  G  LG KHAARVM P ++GSI++ 
Sbjct  96   TLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGMLLGMKHAARVMIPGKKGSIVSL  155

Query  571  ASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLA  747
            ASVA  MGG  PHAYT SKHA+VGLTK+ AL+LG++GIRVNCVSPY + T ++  +    
Sbjct  156  ASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGIRVNCVSPYAVPTALSMPHLPQG  215

Query  748  EDDKLDVY---------SNLKGVDLMAEDVAEAVLY  828
            E     V          +NLKGVDL+ +DVA+AVLY
Sbjct  216  EHKGDAVRDFLAFVGGEANLKGVDLLPKDVAQAVLY  251



>ref|XP_011046905.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 165/243 (68%), Gaps = 10/243 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SSL +  AKRL+G+VA+ITG   GIG + A+LF QHGAKV+IAD +D+   S+C ++
Sbjct  1    MNDSSLPAPVAKRLEGKVALITGAASGIGESAARLFVQHGAKVVIADIQDELGHSVCNEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAK-GLDILDCDGTDFVN  477
            G   S +VHCDVTSE DVQNAV   +S +G+LDIM +NAGIA AK  + IL  +  D+  
Sbjct  61   G---SDYVHCDVTSEIDVQNAVETTISKYGKLDIMFSNAGIAEAKLDISILAFEHEDYKK  117

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG--FPHAYTCSKHAIVGLTKN  651
            VF VN  GAFL  KHAA+VM P ++GSII T+S A    G   P+AY  SKHA+VGL+KN
Sbjct  118  VFDVNLYGAFLSAKHAAKVMIPAKKGSIIFTSSFASVCYGAMLPYAYAVSKHALVGLSKN  177

Query  652  TALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEA  819
              ++LG+YGIRVNC+SP+ ++T + R   G  +   ++ +    +NLK   L A DVAEA
Sbjct  178  LCVELGQYGIRVNCISPFGVATPLLRKGLGGIDQKTVEEFICTSANLKEAVLKANDVAEA  237

Query  820  VLY  828
             LY
Sbjct  238  ALY  240



>emb|CDP20435.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 5/208 (2%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGH-GNSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF QHGA+V+IAD +DD   S+ ++L   G+  FVHCDVT + DV+N V+ A+S +G+L
Sbjct  37   RLFVQHGARVIIADVQDDLGHSLREELSSSGDVTFVHCDVTKDIDVKNLVDLAMSQYGKL  96

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM NNAGI G     I+D D  +F  VF VN  GAFLG K+AA+VM P ++G I+ T+S
Sbjct  97   DIMYNNAGIPGNLDFTIVDADNENFKRVFDVNVYGAFLGAKYAAKVMIPAKKGVILFTSS  156

Query  577  VAGF-MGGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGL---  744
            +A    G  PH+YT SKHA+VGLTKN  ++LG+YGIRVNC+SP  ++T + RN  GL   
Sbjct  157  LASVSCGESPHSYTVSKHAVVGLTKNLCVELGQYGIRVNCISPCAVATPLLRNAMGLDQK  216

Query  745  AEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            A +  +   +NLKGV   AEDVAEA LY
Sbjct  217  AVEGIICASANLKGVVPTAEDVAEAALY  244



>ref|XP_002275746.2| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=280

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 156/217 (72%), Gaps = 5/217 (2%)
 Frame = +1

Query  151  AKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLG-HGNSFFVH  327
             KRL+G+VAIITGG  GIG +TA+LF +HGAKV+IAD +DD   S+C+ LG HG + FVH
Sbjct  11   GKRLEGKVAIITGGASGIGESTARLFVRHGAKVIIADVQDDIGLSICEALGSHGTASFVH  70

Query  328  CDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAF  507
            CDVTS+SDV+N V+ AVS +G+LDIM NNAGI+G     IL  +  +F  VF VN  GAF
Sbjct  71   CDVTSDSDVKNVVDTAVSKYGKLDIMFNNAGISGNLDPTILGTENENFRRVFDVNVYGAF  130

Query  508  LGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIR  684
            LG KHAARVM P ++G I+ T+SVA    G  PHAYT SKHA+VGLTKN  ++LG++GIR
Sbjct  131  LGAKHAARVMIPAKKGVILFTSSVASVTSGESPHAYTMSKHAVVGLTKNLCVELGQHGIR  190

Query  685  VNCVSPYILSTQMTRNYFGLAEDDKLDVY---SNLKG  786
            VNC+SP  ++T + RN  GL +     +    +NLKG
Sbjct  191  VNCISPCAIATPLLRNAMGLEKKTVEGIVCASANLKG  227



>ref|XP_004305640.1| PREDICTED: momilactone A synthase-like [Fragaria vesca subsp. 
vesca]
Length=278

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 4/207 (2%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            + F  HGAKV+IAD +D+ + S+ + +G  N  FVHCDV  E+ ++NAV +AV+T+G+LD
Sbjct  33   RTFVNHGAKVVIADVQDELAHSVVESIGSENCTFVHCDVRDEAQIKNAVEQAVATYGKLD  92

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGIA      I+D    DF  V  VN  G FLG KHA++ M   + G II+TAS+
Sbjct  93   IMFNNAGIADENKARIIDNTKDDFERVLGVNVTGVFLGIKHASQPMIRARTGCIISTASI  152

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE--  750
            + ++GG   HAY CSKHAI GLTKN A++LG++GIRVNCVSPY L+T +   + GL +  
Sbjct  153  SSYIGGAASHAYACSKHAINGLTKNAAVELGQFGIRVNCVSPYALATPLATQFVGLDDEG  212

Query  751  -DDKLDVYSNLKGVDLMAEDVAEAVLY  828
             ++ ++  +NLKGV L A+DVA A LY
Sbjct  213  LENVMNSLANLKGVTLKAQDVANAALY  239



>ref|XP_007202842.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
 gb|EMJ04041.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
Length=263

 Score =   202 bits (515),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 148/208 (71%), Gaps = 6/208 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            K+F QHGAK++IAD +DD   S+ + +G  +  FVHCDVT E+ ++NAV+KAV+T+G+LD
Sbjct  21   KIFAQHGAKIVIADVQDDLGHSVRESMGPTDCTFVHCDVTDEAQIKNAVHKAVATYGKLD  80

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI       I+D +  DF  +  VN  G FLG KHAA+VM P + GSII+TAS+
Sbjct  81   IMFNNAGIVDDNKARIIDNEKADFERILSVNVTGVFLGIKHAAQVMIPARAGSIISTASI  140

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            + ++GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+SPY L T + R + GL ED+
Sbjct  141  SSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCLSPYALVTPLARKFVGL-EDE  199

Query  757  KLD----VYSNLKGVDLMAEDVAEAVLY  828
            +++      +NLKGV L A DVA A LY
Sbjct  200  EMENTMSALANLKGVTLKAVDVANAALY  227



>gb|KGN48288.1| hypothetical protein Csa_6G454360 [Cucumis sativus]
Length=279

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 159/234 (68%), Gaps = 5/234 (2%)
 Frame = +1

Query  142  STAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-  318
            + ++KRL+G+VA+ITG   G G +TA+LF QHGA+V++AD +D+ +Q +CK+LG   +  
Sbjct  5    TISSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVS  64

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            ++HCDVT +SDV+ AV+ AV  +G+LDIM NNAGI G     IL  +G +F  VF VN  
Sbjct  65   YIHCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVY  124

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRY  675
            G FLG KHAARVM P + G I+ T+SVA    G  PHAY  SKHA+VGL +N  ++LG +
Sbjct  125  GGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEF  184

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVLY  828
            GIRVN VSP  ++T + RN  G  E +  +V  +   LKGV   AEDVAEA LY
Sbjct  185  GIRVNSVSPGAIATPLLRNALGFTEKELEEVVRSSAILKGVVATAEDVAEAALY  238



>ref|XP_004228706.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 163/239 (68%), Gaps = 5/239 (2%)
 Frame = +1

Query  127  SSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGH  306
            +S+ +ST+AKRL+G+VA+ITGG  GIG+ TAKLF ++GAKV+I D +DD  +S C ++G 
Sbjct  4    TSNSVSTSAKRLEGKVAVITGGASGIGATTAKLFVKNGAKVVILDVQDDLGRSFCNEIGL  63

Query  307  GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFR  486
             +  +VHCDVT E  V+ A++  VS HG++DIM NNAGI G+    I   D  +   VF 
Sbjct  64   EHISYVHCDVTIEKQVEEAIDFVVSKHGKIDIMYNNAGITGSISSGITTTDYENLRKVFD  123

Query  487  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALD  663
            +N  GAFLG KHAARVM P ++G I+ TASV   + G  PH Y  SKHA++GL+ N  ++
Sbjct  124  INVFGAFLGAKHAARVMIPARKGVILFTASVTAVVAGMSPHTYASSKHAVIGLSNNLCVE  183

Query  664  LGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLY  828
            LG+YGIRVNC++P++++T M  N+ G  +  K+D      +NLK V L  EDVA A +Y
Sbjct  184  LGQYGIRVNCITPHVVATPMLSNFVGGIDGSKVDEAVIKSANLKEVKLETEDVAAAAVY  242



>ref|XP_009768564.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=280

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 164/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M   S L+  ++RL+G+VAIITGG  G G +T +LF Q+GAKV+IAD +D+  QS+C+ L
Sbjct  1    MNGCSPLAPTSRRLEGKVAIITGGASGFGESTVRLFLQNGAKVVIADVQDNIGQSLCESL  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
             + N   ++HCDVTS+SDV+N ++  +S +G+LDIM NNAGI G    +I+D D  +F  
Sbjct  61   NYPNDVTYIHCDVTSDSDVKNLIDTTISKYGKLDIMFNNAGIPGNLDFNIVDSDNENFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  654
            VF VN  G+FLG K+AARVM P ++G I+ T+S A    G  PH+YT SKHA+VGLTKN 
Sbjct  121  VFDVNVYGSFLGAKYAARVMIPAKKGVILFTSSAASVNAGESPHSYTVSKHAVVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVL  825
              +LG++GIRVNCVSP  ++T +     G  +   D  +   +NLKGV   AEDVAEA L
Sbjct  181  CAELGQFGIRVNCVSPCAVATPLLVKAMGAGKSVVDGIICSSANLKGVVPTAEDVAEAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_002530171.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32226.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 144/214 (67%), Gaps = 13/214 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF--FVHCDVTSESDVQNAVNKAVSTHGR  393
            +LF +HGAKV++AD +D+   S+C++LG       ++HCDVT +SDVQNAV+ AVS +G+
Sbjct  34   RLFVKHGAKVVVADVQDELGHSLCRELGPDQEIISYIHCDVTCDSDVQNAVDFAVSKYGK  93

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            LDIM +NAG+AG     I+D +  DF  VF +N  GAFL  KHAARVM P ++G I+ T 
Sbjct  94   LDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAFLAAKHAARVMIPAKKGCILFTC  153

Query  574  ---SVAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGL  744
               SV+ F     H Y  SKHAI+GL+KN +++LG++GIRVNCVSP+++ T M R   G+
Sbjct  154  SYLSVSCFQA--IHPYVASKHAILGLSKNLSVELGQHGIRVNCVSPFVVITPMMRKAMGV  211

Query  745  AEDDK------LDVYSNLKGVDLMAEDVAEAVLY  828
             E +K      +   +NLK V L AED+AEA LY
Sbjct  212  MEAEKEKLQEVVSASANLKNVTLEAEDIAEAALY  245



>gb|KDP36096.1| hypothetical protein JCGZ_08740 [Jatropha curcas]
Length=269

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 157/237 (66%), Gaps = 7/237 (3%)
 Frame = +1

Query  139  LSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNS-  315
            ++T AKRL G+VA+ITGG  GIG ATA+LF + GAKV+I D + D   S+   +   ++ 
Sbjct  1    MATLAKRLQGKVALITGGASGIGEATARLFARQGAKVVITDIQSDLGHSVSNQIESESNQ  60

Query  316  --FFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRV  489
               ++HCDV+ ESDVQNAVN AVS HG LDIM NNAGI G     IL  +  DF  V  +
Sbjct  61   PVSYIHCDVSKESDVQNAVNAAVSMHGHLDIMFNNAGITGNYNPSILSIEREDFKKVMDI  120

Query  490  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDL  666
            N  G  LG KHAARVM P ++G+I+ T+SVA    GG PHAYT SKHAIVGLTKN A++L
Sbjct  121  NVYGGLLGAKHAARVMIPEKKGAILFTSSVAAVTYGGVPHAYTTSKHAIVGLTKNLAVEL  180

Query  667  GRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLD---VYSNLKGVDLMAEDVAEAVLY  828
            G+YGIRVNC+SP  ++T       G+ E    +     +NLKGV + A D+AEA LY
Sbjct  181  GKYGIRVNCISPAAVATPSVVKALGMDEKQIEEFNLAIANLKGVKVDANDMAEAALY  237



>ref|XP_011046902.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 164/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S +  +   KRL+G+VA+ITGG  GIG+ TA+LF QHGAKVLIAD +DD   S C++ 
Sbjct  1    MSSITSATPVTKRLEGKVALITGGASGIGACTARLFVQHGAKVLIADIQDDLGHSFCQEF  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   +  +VHC+VT +SDVQNAV+ AVS +G+LDIM NNAGI G +   IL CD  +F  
Sbjct  61   GPQETISYVHCNVTCDSDVQNAVDTAVSKYGKLDIMFNNAGIPGDRKSGILTCDNENFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNT  654
            V  VN  G FLG KHAARVM P ++G I+ T+SVA  + G   HAYT SK+AIVGL KN 
Sbjct  121  VLDVNVYGGFLGAKHAARVMIPAKKGCILFTSSVASVLYGELAHAYTASKNAIVGLAKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVL  825
            +++LG+YGIRVN +SPY ++T +  +   +   A ++ +   + LK V L  EDV++A L
Sbjct  181  SVELGQYGIRVNSISPYAVATPLLTDGLSMTKEAAEELVASAATLKDVVLEPEDVSQAAL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>gb|KDP36095.1| hypothetical protein JCGZ_08739 [Jatropha curcas]
Length=275

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 141/211 (67%), Gaps = 9/211 (4%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDL----GHGNSFFVHCDVTSESDVQNAVNKAVSTH  387
            +LF +HGAKVLIAD ++   QS+ +++    G   S+ + CDVT E+DV+NAVN AVS H
Sbjct  34   RLFARHGAKVLIADVQNKLGQSLSEEIRSETGQPVSY-IQCDVTQETDVENAVNTAVSMH  92

Query  388  GRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  567
            G+LDIM NNAGI G    +IL  +  DF +V  +N  GAFLG KHAARVM P ++G+I+ 
Sbjct  93   GKLDIMYNNAGIIGKFDPNILSLEREDFKSVMDINLYGAFLGAKHAARVMVPEKKGNILF  152

Query  568  TASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGL  744
            TASVA    GG P  Y  SKHA+VGLTKN A++LG+YGIRVNC+SP  + T M     G 
Sbjct  153  TASVAAVTYGGTPLPYAASKHAVVGLTKNLAVELGKYGIRVNCISPAGIPTPMAAKIMGA  212

Query  745  AEDDKLDV---YSNLKGVDLMAEDVAEAVLY  828
                  +V    +NLKGV + A+DVAEA LY
Sbjct  213  DIKTVQEVSMAVANLKGVKIEADDVAEAALY  243



>ref|XP_011046903.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
 ref|XP_011046904.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=277

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 163/242 (67%), Gaps = 6/242 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SSLL+  +KRL+G+VA+ITGG  GIG ++A+LF +HGAKV+IAD +DD   S+C+++
Sbjct  1    MKGSSLLAPVSKRLEGKVALITGGASGIGESSARLFVRHGAKVVIADIQDDPGHSVCEEI  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
                S  +V CDVT ESDV+ AVN AVS +G+LDI  +NAGI G         D  +F  
Sbjct  61   CSNESLSYVRCDVTRESDVEKAVNTAVSKYGKLDIFFSNAGIFGKGDPQASAIDYDNFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS-VAGFMGGFPHAYTCSKHAIVGLTKNT  654
            VF  N  GAFLG KHA+RVM P ++GSII ++S V+  +G  PHAYT SKHAIVGLTKN 
Sbjct  121  VFDTNVYGAFLGAKHASRVMIPEKKGSIIYSSSLVSVIVGNVPHAYTASKHAIVGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD----KLDVYSNLKGVDLMAEDVAEAV  822
              +LG++GIRVNC+SP  + T + RN FG    +         ++LKGV L  EDVA+A 
Sbjct  181  CAELGQFGIRVNCISPAAVPTPLMRNAFGGISRNAALEIASAAAHLKGVMLEEEDVAQAA  240

Query  823  LY  828
            LY
Sbjct  241  LY  242



>ref|XP_004143392.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
Length=284

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 159/234 (68%), Gaps = 5/234 (2%)
 Frame = +1

Query  142  STAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-  318
            + ++KRL+G+VA+ITG   G G +TA+LF QHGA+V++AD +D+ +Q +CK+LG   +  
Sbjct  5    TISSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVS  64

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            ++HCDVT +SDV+ AV+ AV  +G+LDIM NNAGI G     IL  +G +F  VF VN  
Sbjct  65   YIHCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVY  124

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRY  675
            G FLG KHAARVM P + G I+ T+SVA    G  PHAY  SKHA+VGL +N  ++LG +
Sbjct  125  GGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEF  184

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVLY  828
            GIRVN VSP  ++T + RN  G  E +  +V  +   LKGV   AEDVAEA LY
Sbjct  185  GIRVNSVSPGAIATPLLRNALGFTEKELEEVVRSSAILKGVVATAEDVAEAALY  238



>ref|XP_002277487.2| PREDICTED: short-chain dehydrogenase reductase 2a-like [Vitis 
vinifera]
Length=294

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 171/265 (65%), Gaps = 27/265 (10%)
 Frame = +1

Query  112  SRKMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMC  291
            + K +    +S++ KRL+G+VA++TGG  GIG A  +LF +HGAKV+IAD  DD +    
Sbjct  2    TEKTLQGENISSSPKRLEGKVALVTGGARGIGEAIVRLFVRHGAKVIIADI-DDATGLPL  60

Query  292  KDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLD---ILDCDG  462
             +L H ++ + HCDVT E D++N++N AVS +G+LDI+ NNAG+ G +  +   I + D 
Sbjct  61   ANLLHPSTVYAHCDVTVEGDIENSINLAVSQYGKLDILFNNAGVLGNQSKNKICIANFDA  120

Query  463  TDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVG  639
             +F ++ RVN  G  LG KHAARVM P + G II+TASVAG MGG  PHAYT SKHAIVG
Sbjct  121  DEFDHIMRVNVRGVALGMKHAARVMVPKRSGCIISTASVAGLMGGLGPHAYTASKHAIVG  180

Query  640  LTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDK--------------------  759
            LTKNTA +LGRYGIRVNC+SP+ ++T M  N +  +E++                     
Sbjct  181  LTKNTACELGRYGIRVNCISPFGVATSMLVNAWRKSEEEDDGEECLHFQAPCEKEVEEME  240

Query  760  --LDVYSNLKGVDLMAEDVAEAVLY  828
              +   +NLKGV L AE +AEA +Y
Sbjct  241  EFVGGIANLKGVKLRAECIAEAAVY  265



>ref|XP_004170965.1| PREDICTED: zerumbone synthase-like, partial [Cucumis sativus]
Length=281

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 159/234 (68%), Gaps = 5/234 (2%)
 Frame = +1

Query  142  STAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-  318
            + ++KRL+G+VA+ITG   G G +TA+LF QHGA+V++AD +D+ +Q +CK+LG   +  
Sbjct  5    TISSKRLNGKVALITGAASGFGKSTARLFVQHGARVVLADVQDNLAQPLCKELGSEETVS  64

Query  319  FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTL  498
            ++HCDVT +SDV+ AV+ AV  +G+LDIM NNAGI G     IL  +G +F  VF VN  
Sbjct  65   YIHCDVTRDSDVKEAVDFAVERYGKLDIMYNNAGITGQMDPTILGTNGENFKKVFEVNVY  124

Query  499  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRY  675
            G FLG KHAARVM P + G I+ T+SVA    G  PHAY  SKHA+VGL +N  ++LG +
Sbjct  125  GGFLGAKHAARVMIPNRSGVILFTSSVASVNSGESPHAYAMSKHAVVGLMRNLCVELGEF  184

Query  676  GIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVLY  828
            GIRVN VSP  ++T + RN  G  E +  +V  +   LKGV   AEDVAEA LY
Sbjct  185  GIRVNSVSPGAIATPLLRNALGFTEKELEEVVRSSAILKGVVATAEDVAEAALY  238



>ref|XP_004137687.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 ref|XP_004156632.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN58711.1| hypothetical protein Csa_3G730750 [Cucumis sativus]
Length=308

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 142/227 (63%), Gaps = 24/227 (11%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  D   Q++   L      FVHCDV+SE DV+N V+  V  HG++D
Sbjct  53   RLFAKHGAKVVIADVEDILGQALANTLSPSPVSFVHCDVSSEDDVENLVSTTVCLHGQVD  112

Query  400  IMVNNAGIAGAKG---LDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  570
            I+ NNAG+ G +      ILD D  +F  V RVN  G  LG KHAARVM P   G II+T
Sbjct  113  IIFNNAGVLGNQSNSHKSILDFDPDEFERVMRVNVKGVALGIKHAARVMIPRATGCIIST  172

Query  571  ASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF---  738
            ASVAG +GG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ ++T M  N +   
Sbjct  173  ASVAGVLGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRAD  232

Query  739  -------------GLAEDDKLDVY----SNLKGVDLMAEDVAEAVLY  828
                           AE DK++ +    +NLKG  L  +D+A+A LY
Sbjct  233  VEEEEECMNYGVPSAAEVDKMEEFVRGLANLKGPTLKPKDIAQAALY  279



>gb|KDP36168.1| hypothetical protein JCGZ_08812 [Jatropha curcas]
Length=277

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 163/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS L+ AAKRL G+VAIITGG  GIG+AT+ LF +HGAKV+I D +DD  QS+CK++
Sbjct  1    MNCSSSLAVAAKRLAGKVAIITGGASGIGAATSTLFVKHGAKVVIGDVQDDLGQSLCKEI  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
               ++  ++HCDVT +SDV+N V+  VS +G+LDIM NNAGI G     IL  D  +F  
Sbjct  61   DQNDTVSYLHCDVTDDSDVKNVVDFTVSKYGKLDIMYNNAGITGDVDPKILGSDNENFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNT  654
            VF VN  G FLG KHAARVM P  +G I+ T+SVA    G  PHAYT SKHA+VGL KN 
Sbjct  121  VFDVNVYGGFLGAKHAARVMIPKNKGVILFTSSVASKTTGESPHAYTMSKHAVVGLMKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVL  825
             ++LG+YGIRVNC+SP  ++T + R   G  ++    V    +NLKGV    EDVAEA +
Sbjct  181  CVELGQYGIRVNCISPCAIATPLLRKAMGSDKNFVEQVVCASANLKGVVPQPEDVAEAAV  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>gb|KDP36152.1| hypothetical protein JCGZ_08796 [Jatropha curcas]
Length=274

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF + GAKVLIAD +DD   S+C++  +     ++HC+VTS+SDV+NAV+ AVS +G+L
Sbjct  30   RLFVEQGAKVLIADVQDDLGHSICQEFNNQEIISYIHCNVTSDSDVKNAVDTAVSRYGKL  89

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM NNAG++G+ G +IL  D  +F  VF VN  G FLG KHAARVM P ++G I+ TAS
Sbjct  90   DIMFNNAGVSGSPGANILGSDNEEFKKVFDVNVFGPFLGAKHAARVMIPEKKGCILFTAS  149

Query  577  -VAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGL---  744
             V+  +G   HAY  SKHA+VGL KN +++LG+YGIRVN +SP+ + T M ++  G+   
Sbjct  150  AVSVCLGESSHAYAASKHAVVGLAKNLSVELGKYGIRVNAISPFTVVTPMMKSLLGISDK  209

Query  745  -AEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
             A ++ +    NLK V L  ED+A A LY
Sbjct  210  RAAEEFISSIGNLKTVLLEPEDIANAALY  238



>sp|F1SWA0.1|ZERSY_ZINZE RecName: Full=Zerumbone synthase [Zingiber zerumbet]
 dbj|BAK09296.1| short-chain dehydrogenase/reductase1 [Zingiber zerumbet]
Length=267

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 143/214 (67%), Gaps = 11/214 (5%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLG-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAK+ I D +D+  Q + + LG   ++ + HCDVT E DV+ AV+     +G +
Sbjct  23   RLFIEHGAKICIVDVQDELGQQVSQRLGGDPHACYFHCDVTVEDDVRRAVDFTAEKYGTI  82

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAGI G K +DI D D  +F  VF +N  G FLG KHAAR+M P  +GSI++ AS
Sbjct  83   DIMVNNAGITGDKVIDIRDADFNEFKKVFDINVNGVFLGMKHAARIMIPKMKGSIVSLAS  142

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE-  750
            V+  + G  PH YT +KHA+VGLTK+ A +LGR+GIRVNCVSPY + T+++  Y   +E 
Sbjct  143  VSSVIAGAGPHGYTGAKHAVVGLTKSVAAELGRHGIRVNCVSPYAVPTRLSMPYLPESEM  202

Query  751  -DDKLDVY-------SNLKGVDLMAEDVAEAVLY  828
             +D L  +       +NLKGVDLM  DVAEAVLY
Sbjct  203  QEDALRGFLTFVRSNANLKGVDLMPNDVAEAVLY  236



>ref|XP_009592996.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=258

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 162/243 (67%), Gaps = 7/243 (3%)
 Frame = +1

Query  121  MVSS-SLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKD  297
            M SS S + + AKRL+G+VA ITGG  GIG A A+LF +HGAK++IAD +DD  QS+  +
Sbjct  1    MASSFSSIGSVAKRLEGKVAFITGGASGIGEAAARLFIKHGAKIVIADIQDDLGQSIIDE  60

Query  298  LGH-GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFV  474
            +G  G   ++HCDV  E +V+NAV+ A+S + +LDIM +NAGI       IL+ D  +F 
Sbjct  61   IGERGEVSYIHCDVKVEKNVENAVDMAISKYRKLDIMFSNAGIPEELNSTILNIDYDNFK  120

Query  475  NVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKN  651
            NV  VN  GA +  KHAARVM P  +GSII T+SVA     G  H Y  SKHA+VG  KN
Sbjct  121  NVIEVNVFGALMCAKHAARVMIPANKGSIIFTSSVASVTHSGVAHTYLASKHAVVGFAKN  180

Query  652  TALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY----SNLKGVDLMAEDVAEA  819
              ++LG++GIRVNCVSP+ ++T M RN F + E +K + +    +NLKG  L AEDVAEA
Sbjct  181  LGVELGQHGIRVNCVSPFCVATPMLRNGFRIKEKEKTEEFVSEVANLKGTILEAEDVAEA  240

Query  820  VLY  828
             LY
Sbjct  241  ALY  243



>ref|XP_010264500.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X4 [Nelumbo nucifera]
Length=273

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 145/224 (65%), Gaps = 22/224 (10%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  D+   ++   L    ++ +HCDV+ E DV+N +N  VS HGRLD
Sbjct  22   RLFARHGAKVVIADVEDEIGIALSNSLAPCVTY-IHCDVSLEEDVENLINSTVSWHGRLD  80

Query  400  IMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            I+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+TA
Sbjct  81   ILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTA  140

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVAG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ ++T M  N +   +
Sbjct  141  SVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCD  200

Query  751  D--------------DKLDVY----SNLKGVDLMAEDVAEAVLY  828
            D              +K++ +    +NLKG  L A+D+AEA LY
Sbjct  201  DEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALY  244



>emb|CDP02837.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 146/204 (72%), Gaps = 1/204 (0%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            ++F  HGAKV+  D  ++  +S+C DLG  N+ F++CDVT ESD++NA+N+ V  HG+LD
Sbjct  105  RVFVNHGAKVVCVDINEELGRSVCDDLGAENASFLYCDVTKESDIENAINRTVHEHGKLD  164

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM+NNAGIA      ILD D +DF  V R+N  G FLG KHAARVM P + G IIN  S+
Sbjct  165  IMINNAGIADEGKTSILDNDLSDFERVMRLNLSGVFLGIKHAARVMIPARSGGIINLGSI  224

Query  580  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            +G +GG   H+Y+ SKHA+VGLT+N A +LG++GIRVNC+S +++ T +++N+F   E+ 
Sbjct  225  SGSIGGITSHSYSSSKHAVVGLTRNAAAELGKHGIRVNCLSSHVVLTPLSQNFFNFGEEG  284

Query  757  KLDVYSNLKGVDLMAEDVAEAVLY  828
            +  VY+NL+G+ L  ED+A A +Y
Sbjct  285  QSRVYTNLEGMVLKPEDLANAAVY  308



>ref|XP_010264499.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X3 [Nelumbo nucifera]
Length=280

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 145/224 (65%), Gaps = 22/224 (10%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  D+   ++   L    ++ +HCDV+ E DV+N +N  VS HGRLD
Sbjct  29   RLFARHGAKVVIADVEDEIGIALSNSLAPCVTY-IHCDVSLEEDVENLINSTVSWHGRLD  87

Query  400  IMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            I+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+TA
Sbjct  88   ILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTA  147

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVAG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ ++T M  N +   +
Sbjct  148  SVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCD  207

Query  751  D--------------DKLDVY----SNLKGVDLMAEDVAEAVLY  828
            D              +K++ +    +NLKG  L A+D+AEA LY
Sbjct  208  DEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALY  251



>ref|XP_010024677.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=277

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 159/240 (66%), Gaps = 4/240 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M  SS +S   +RL+GRVA+ITGG  GIG  TA++F  HGAKV+IAD  D   QS+   L
Sbjct  1    MGGSSFISAFTRRLEGRVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGQSVRDSL  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G   + +VHCDVT+ES ++ AV +AVS +G+LDIM NNAGI       I+D D  DF  V
Sbjct  61   GQDTASYVHCDVTNESQIKAAVAEAVSAYGKLDIMFNNAGITDPNKARIVDNDKADFERV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  657
              VN  G FLG KHAA+ M   +RG IINTAS++  +GG   HAYTC+KHA++GLT+N A
Sbjct  121  LAVNVTGVFLGVKHAAQAMIAARRGCIINTASISSNIGGSASHAYTCAKHAVLGLTRNAA  180

Query  658  LDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLY  828
            ++LG++GI VNC+SP+   T +   + GL     +  +   +NLKGV L AEDVA A L+
Sbjct  181  VELGQFGIWVNCLSPFGCGTPLATKFVGLGPVEMEALIGATANLKGVTLKAEDVANAALF  240



>gb|KDP32262.1| hypothetical protein JCGZ_14783 [Jatropha curcas]
Length=277

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 166/241 (69%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M + S +++ ++RLDG+VA+ITGG  GIG ++A+LF + GAKV+IAD +D+  QS+CK+L
Sbjct  1    MSTDSSVTSISRRLDGKVALITGGASGIGESSARLFVKQGAKVVIADIQDELGQSLCKEL  60

Query  301  GHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G      ++HCDVT++S+VQNAV+ AVS +G+LDIM +NAGIAG     IL  +  DF  
Sbjct  61   GSEEIISYIHCDVTNDSNVQNAVDLAVSKYGKLDIMFSNAGIAGNLDPRILATEKEDFKR  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSII-NTASVAGFMGGFPHAYTCSKHAIVGLTKNT  654
            VF VN  GAFL  KHAA+VM P ++G+II N ++V+    G PH Y  SKHA+VGL KN 
Sbjct  121  VFDVNVFGAFLAAKHAAKVMIPAKKGNIIFNASAVSVTCVGTPHPYVVSKHALVGLAKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVL  825
            +++LG YGIRVNC+SP+++ T   +    L E    +V    +NLK   L  ED+AEA +
Sbjct  181  SVELGEYGIRVNCISPFLVITPQLKRTMELPEKTIEEVTYAAANLKEAILKQEDIAEAAV  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>ref|XP_010264496.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Nelumbo nucifera]
Length=301

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 145/224 (65%), Gaps = 22/224 (10%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  D+   ++   L    ++ +HCDV+ E DV+N +N  VS HGRLD
Sbjct  50   RLFARHGAKVVIADVEDEIGIALSNSLAPCVTY-IHCDVSLEEDVENLINSTVSWHGRLD  108

Query  400  IMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            I+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+TA
Sbjct  109  ILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTA  168

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVAG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ ++T M  N +   +
Sbjct  169  SVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCD  228

Query  751  D--------------DKLDVY----SNLKGVDLMAEDVAEAVLY  828
            D              +K++ +    +NLKG  L A+D+AEA LY
Sbjct  229  DEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALY  272



>gb|KDP36166.1| hypothetical protein JCGZ_08810 [Jatropha curcas]
Length=281

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 141/212 (67%), Gaps = 9/212 (4%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKVLIAD +DD  QS+C++     +  +VHC+V+S+SDV+NAV+ AVS +G+L
Sbjct  34   RLFVKHGAKVLIADIQDDLGQSLCQEFSSPETISYVHCNVSSDSDVKNAVDLAVSRYGKL  93

Query  397  DIMVNNAGIAGAKGLD---ILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  567
            DIM NNAGI G        IL  +  DF  V  VN  GAFLGTKHAAR+M P ++G I+ 
Sbjct  94   DIMFNNAGILGNPDFSNTRILPTENQDFKKVIDVNVFGAFLGTKHAARIMIPNKKGCILF  153

Query  568  TASVAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGL  744
            TAS+        PHAY  SKHA+VGL KN  ++LG+YGIRVN +SP+  +T M RN FG+
Sbjct  154  TASLVSVCCLDSPHAYAASKHAVVGLAKNLCVELGQYGIRVNSISPFAAATPMLRNAFGM  213

Query  745  AE----DDKLDVYSNLKGVDLMAEDVAEAVLY  828
             E    ++ +   + LKGV L  ED+A A L+
Sbjct  214  MEKKEAEEVISSIATLKGVVLETEDIANAALF  245



>ref|XP_009776711.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=284

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 160/241 (66%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M +S L S  AK+L G+VA ITGG  GIG+ATA+LF QHGAKV+IAD +D  + S+ +++
Sbjct  1    MANSPLQSPIAKKLQGKVAFITGGASGIGAATARLFVQHGAKVIIADIQDSLATSVVQEI  60

Query  301  GHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNV  480
            G  N+ F+HCDV  ESDVQNAV+  V+  G+LDIM +NAG+ G     IL+ D      V
Sbjct  61   GTENATFIHCDVAIESDVQNAVDATVAKFGKLDIMYSNAGVLGKPISSILEVDYDIIKTV  120

Query  481  FRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG--FMGGFPHAYTCSKHAIVGLTKNT  654
            F VN +G F   KHAARVM P ++G I+ TAS +   +    PH Y+ SK+A++GL+KN 
Sbjct  121  FDVNIVGKFFCAKHAARVMIPAKKGVILFTASASTEVYGAAVPHTYSASKNALLGLSKNV  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVL  825
             ++LG YGIRVNCVSPY +ST +  N FG+ +   D       NLKG  L  EDVA+AVL
Sbjct  181  GVELGEYGIRVNCVSPYYISTPLVLNGFGIDKQMADKWFAAGGNLKGALLGVEDVAKAVL  240

Query  826  Y  828
            Y
Sbjct  241  Y  241



>gb|ACG37730.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 137/215 (64%), Gaps = 12/215 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLG--HGNSFFVHCDVTSESDVQNAVNKAVSTHGR  393
            +LF +HGAKV IAD +D+  Q +   LG     + FVHCDVTSE DV  AV+ A    G 
Sbjct  37   RLFMEHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFGA  96

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            LD+MVNNAG+ G K  DI   D  +   V  VN  G FL  KHAAR M P +RGSI++ A
Sbjct  97   LDVMVNNAGVTGTKVTDIRTVDFAEARRVLDVNVHGVFLVMKHAARAMIPRKRGSIVSLA  156

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF--GL  744
            SVA  +GG  PH YT SKHA+VGLTK+ A +LGR+G+RVNCVSPY + T ++  +   G 
Sbjct  157  SVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCVSPYAVPTALSMPHLPQGA  216

Query  745  AEDDKLDVY-------SNLKGVDLMAEDVAEAVLY  828
              DD L  +       +NLKGVD M EDVA+AVLY
Sbjct  217  RADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLY  251



>ref|XP_008392031.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Malus 
domestica]
Length=268

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 147/207 (71%), Gaps = 4/207 (2%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            K+F QHGAKV+IAD +DD   S+ + +G  +  FVHCDVT ES +++AV+KAV+T+G+LD
Sbjct  26   KIFVQHGAKVVIADVQDDLGHSVRESIGPSDCTFVHCDVTDESQIKDAVHKAVATYGKLD  85

Query  400  IMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASV  579
            IM NNAGI       I+D +  DF  V  +N  G FLG KHAA+ M P + GSII+TAS+
Sbjct  86   IMFNNAGIVDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIPARTGSIISTASI  145

Query  580  AGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDD  756
            + ++GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+SPY L+T + R + G+ +++
Sbjct  146  SSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCLSPYALATPLARTFVGVDDEE  205

Query  757  KLDV---YSNLKGVDLMAEDVAEAVLY  828
              +V    +NLKGV L A DVA A LY
Sbjct  206  LENVMGSLANLKGVTLKAVDVANAALY  232



>ref|XP_010264497.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Nelumbo nucifera]
Length=291

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 145/224 (65%), Gaps = 22/224 (10%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLD  399
            +LF +HGAKV+IAD  D+   ++   L    ++ +HCDV+ E DV+N +N  VS HGRLD
Sbjct  40   RLFARHGAKVVIADVEDEIGIALSNSLAPCVTY-IHCDVSLEEDVENLINSTVSWHGRLD  98

Query  400  IMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            I+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+TA
Sbjct  99   ILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTA  158

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVAG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ ++T M  N +   +
Sbjct  159  SVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCD  218

Query  751  D--------------DKLDVY----SNLKGVDLMAEDVAEAVLY  828
            D              +K++ +    +NLKG  L A+D+AEA LY
Sbjct  219  DEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALY  262



>ref|NP_001148513.1| short chain alcohol dehydrogenase1 [Zea mays]
 ref|XP_008643650.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X1 [Zea 
mays]
 gb|ACG31792.1| sex determination protein tasselseed-2 [Zea mays]
 gb|ACG45115.1| sex determination protein tasselseed-2 [Zea mays]
 gb|AFW67240.1| sex determination protein tasselseed-2 isoform 1 [Zea mays]
 gb|AFW67241.1| sex determination protein tasselseed-2 isoform 2 [Zea mays]
 gb|AFW67242.1| sex determination protein tasselseed-2 isoform 3 [Zea mays]
 gb|AFW67243.1| sex determination protein tasselseed-2 isoform 4 [Zea mays]
Length=244

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 136/211 (64%), Gaps = 12/211 (6%)
 Frame = +1

Query  232  QHGAKVLIADTRDDESQSMCKDLG--HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIM  405
            +HGAKV IAD +D+  Q +   LG     + FVHCDVTSE DV  AV+ A    G LD+M
Sbjct  2    EHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFGALDVM  61

Query  406  VNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG  585
            VNNAG+ G K  DI + D  +   V  VN  G FLG KHAAR M P +RGSI++ ASVA 
Sbjct  62   VNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVFLGMKHAARAMIPRKRGSIVSLASVAS  121

Query  586  FMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF--GLAEDD  756
             +GG  PH YT SKHA+VGLTK+ A +LGR+G+RVNCVSPY + T ++  +   G   DD
Sbjct  122  AIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCVSPYAVPTALSMPHLPQGARADD  181

Query  757  KLDVY-------SNLKGVDLMAEDVAEAVLY  828
             L  +       +NLKGVD M EDVA+AVLY
Sbjct  182  ALKDFLAFVGGEANLKGVDAMPEDVAQAVLY  212



>gb|KHG08861.1| Xanthoxin dehydrogenase -like protein [Gossypium arboreum]
Length=282

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 145/216 (67%), Gaps = 15/216 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHG-NSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKV I D +D+    +C+ LG+G N  F HCDVT E  V+ AV+ AV   G L
Sbjct  38   RLFHKHGAKVCIVDVQDNLGLQVCQSLGNGPNVCFFHCDVTIEEQVRAAVDYAVEKFGTL  97

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAG++G    DI + D +DF  V  VN  G FLG KHAAR+M P ++GSII+T S
Sbjct  98   DIMVNNAGLSGPPYNDIRNYDLSDFEKVMNVNVKGVFLGMKHAARIMIPHEKGSIISTCS  157

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            V+G +GG  PHAYT SKHA++GLT+N A +LG+YGIRVNCVSPY ++T++   +  L ED
Sbjct  158  VSGVIGGLGPHAYTGSKHAVLGLTRNVASELGKYGIRVNCVSPYAVATELA--FAHLHED  215

Query  754  DKL-DVYS----------NLKGVDLMAEDVAEAVLY  828
            ++  DV +          NL GVDL  E VA AVL+
Sbjct  216  ERTEDVRTGFRAFIGKNANLNGVDLTVEHVANAVLF  251



>ref|NP_001275184.1| short-chain dehydrogenase/reductase [Solanum tuberosum]
 gb|AAT75153.1| short-chain dehydrogenase/reductase [Solanum tuberosum]
Length=275

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 147/216 (68%), Gaps = 15/216 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGH-GNSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKV IAD RD+  Q +C+ LG+  N  F+HCDVT E+DV NAV+  V   G L
Sbjct  31   RLFHKHGAKVCIADIRDEVGQHVCETLGNDQNVCFIHCDVTVEADVSNAVDFTVQKFGTL  90

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAG++G    DI D + + F NV  VN  GAFLG KHAAR+M P+++G+I++  S
Sbjct  91   DIMVNNAGLSGPPIRDIRDYELSVFENVLDVNLKGAFLGMKHAARIMIPLKKGAIVSLCS  150

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VA  +GG  PH Y  SK+A++GLT+N A ++G++G+RVNCVSPY ++T +   +  L ED
Sbjct  151  VASAIGGIGPHGYAASKYAVLGLTQNVAAEMGKHGVRVNCVSPYAVATGLALAH--LPED  208

Query  754  DKLD-----------VYSNLKGVDLMAEDVAEAVLY  828
            +K D             +NL+GV+LMA DVA AVL+
Sbjct  209  EKTDDAMEGFRDFVARNANLQGVELMANDVANAVLF  244



>ref|XP_010039348.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
 gb|KCW88250.1| hypothetical protein EUGRSUZ_A00637 [Eucalyptus grandis]
Length=304

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 173/267 (65%), Gaps = 27/267 (10%)
 Frame = +1

Query  100  QEIDSRKMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDES  279
            QEI+   M+ +   +   +RL+G++AI+TGGV GIG AT +LF +HGAKV+IAD  D   
Sbjct  12   QEIN--LMLGNENTTPGPRRLEGKIAIVTGGVKGIGEATVRLFARHGAKVVIADIEDLLG  69

Query  280  QSMCKDLGHGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAG--AKGLDILD  453
             ++   L   +  +VHCDV+SE DV+N V   VS +GRLD+M NNAG+ G  +K   I+D
Sbjct  70   TALANSLSP-SVTYVHCDVSSEEDVENLVTSTVSRYGRLDVMFNNAGLLGNQSKRKSIMD  128

Query  454  CDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHA  630
             D  +F +V  +N  G+ LG KHAARVM P + G II+TASVAG MGG  PHAYT SKHA
Sbjct  129  FDVGEFESVMSINVKGSALGIKHAARVMAPRRSGCIISTASVAGVMGGLGPHAYTASKHA  188

Query  631  IVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYF----GLAED-------------DK  759
            IVGLTKN A +LGRYGIRVNC+SP+ ++T M  N +    G  ED             +K
Sbjct  189  IVGLTKNAACELGRYGIRVNCISPFGVATSMLINAWRSSDGEEEDEGMSFGVPSEGEVEK  248

Query  760  LDVY----SNLKGVDLMAEDVAEAVLY  828
            ++ +    +NLKG  L A+D+AEA LY
Sbjct  249  MEEFVRGLANLKGATLRAKDIAEAALY  275



>ref|XP_006428245.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428246.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428251.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428253.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428254.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428256.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006480290.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Citrus sinensis]
 ref|XP_006480291.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Citrus sinensis]
 ref|XP_006480292.1| PREDICTED: xanthoxin dehydrogenase isoform X3 [Citrus sinensis]
 ref|XP_006480293.1| PREDICTED: xanthoxin dehydrogenase isoform X4 [Citrus sinensis]
 gb|ESR41485.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41486.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41491.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41493.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41494.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41496.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|KDO45361.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45362.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45363.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45364.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
Length=280

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 144/216 (67%), Gaps = 15/216 (7%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLG-HGNSFFVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF +HGAKV IAD +D+  Q +C+ LG   ++FF HCDVT E DV +AV+  V   G L
Sbjct  36   RLFHKHGAKVCIADVQDNLGQQVCQSLGGEPDTFFCHCDVTKEEDVCSAVDLTVEKFGTL  95

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIMVNNAGI+GA   DI + D ++F  VF +N  G F G KHAAR+M P  +G+II+  S
Sbjct  96   DIMVNNAGISGAPCPDIREADLSEFEKVFDINVKGVFHGMKHAARIMIPQTKGTIISICS  155

Query  577  VAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED  753
            VAG +GG  PHAYT SKHA++GL KN A +LG+YGIRVNCVSPY ++T +   +  L E+
Sbjct  156  VAGAIGGLGPHAYTGSKHAVLGLNKNVAAELGKYGIRVNCVSPYAVATGLALAH--LPEE  213

Query  754  DKLD-----------VYSNLKGVDLMAEDVAEAVLY  828
            ++ +             +N++G +L A DVA AVL+
Sbjct  214  ERTEDAMVGFRNFVARNANMQGTELTANDVANAVLF  249



>ref|XP_009802753.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
 ref|XP_009802755.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=276

 Score =   200 bits (508),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 163/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S LST  KRL+G+VAI+TGG  GIG ATAKLF +HGAKV+IAD +D+ S S+   L
Sbjct  1    MASASFLSTIGKRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDERSNSVSNAL  60

Query  301  GH-GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   +S ++HCDVT+E  VQNAV++ +ST G+LDI++ NAGI+      I+D    DF  
Sbjct  61   GSPSHSIYIHCDVTNEDHVQNAVDRTISTFGKLDIIICNAGISDETKPRIIDNTKEDFER  120

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  654
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  121  VLSINVTGVFLCMKHAARVMVPARSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNL  180

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVL  825
            A++LG++GIRVNC+SPY + T +     GL     +  L +  NLKG  L  +DVA+A L
Sbjct  181  AVELGQFGIRVNCLSPYAMVTPLATKVVGLENEMFETALSMAGNLKGAILRVDDVAKAAL  240

Query  826  Y  828
            +
Sbjct  241  F  241



>ref|XP_009395947.1| PREDICTED: zerumbone synthase [Musa acuminata subsp. malaccensis]
Length=283

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 142/216 (66%), Gaps = 14/216 (6%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF--FVHCDVTSESDVQNAVNKAVSTHGR  393
            KLF +HGAK+ + D +D   Q +C+ LG G+ +  F HCDVT E DV+ AV+ A   +G 
Sbjct  38   KLFRKHGAKICVVDVQDAVGQQLCEFLG-GDPYACFFHCDVTVEDDVRRAVDFAAERYGT  96

Query  394  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  573
            +DIMVNNAGI G K +DI + +  +F  VF +N  G FLG KHAARVM P  +GSII+  
Sbjct  97   IDIMVNNAGITGEKVVDIRNVNFDEFKRVFDINVNGVFLGMKHAARVMIPQGKGSIISLG  156

Query  574  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAE  750
            SVA   GG  PH YT SKHA+VGLTKN A +LG++GIRVNCVSPY + T+++  +   +E
Sbjct  157  SVASVNGGMGPHGYTGSKHAVVGLTKNVAGELGKHGIRVNCVSPYAVPTKLSMPHLPESE  216

Query  751  DDKLDVY----------SNLKGVDLMAEDVAEAVLY  828
              + D            +NLKGVDL+  DVAEAVLY
Sbjct  217  RQEEDAVEGFLTFVRSCANLKGVDLLRNDVAEAVLY  252



>ref|XP_006468252.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Citrus 
sinensis]
Length=302

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 165/257 (64%), Gaps = 21/257 (8%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            +++    S  AKRL+G++AI+TGG  GIG AT +LF +HGAKV+IAD  D    ++   L
Sbjct  17   LITKDSCSALAKRLEGKIAIVTGGARGIGEATVRLFVKHGAKVVIADIDDAAGIALADSL  76

Query  301  GHGNSF--FVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAG--AKGLDILDCDGTD  468
               +    ++HCDV+ E D+QN +N  +S HGRLDI+ NNAG+ G  +K   I D D  +
Sbjct  77   LSSSPLVTYLHCDVSLEQDIQNLINVTISKHGRLDILFNNAGVLGNQSKHKSITDFDANE  136

Query  469  FVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLT  645
            F N+ R+N  GA LG K+AA+VM P + G II+TASVA  MGG  PHAYT SKHAIVGLT
Sbjct  137  FDNIIRINVRGAALGMKYAAKVMVPRRSGCIISTASVASLMGGLGPHAYTVSKHAIVGLT  196

Query  646  KNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAED----------------DKLDVYSN  777
            KNTA +LG+YGIRVNC+SP+ ++T M  N +   ED                + +   +N
Sbjct  197  KNTACELGKYGIRVNCISPFGVATSMLVNAWKSCEDCMDSGKPCEEEEEKMEELVRGLAN  256

Query  778  LKGVDLMAEDVAEAVLY  828
            LKGV L A D+AEA LY
Sbjct  257  LKGVTLKARDIAEAALY  273



>gb|KDP42340.1| hypothetical protein JCGZ_02813 [Jatropha curcas]
Length=270

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 162/242 (67%), Gaps = 7/242 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M SSS  +  AKRL+G+VA+ITGG  GIG  TA+LF +HGAKV+IAD + +  +S+ + +
Sbjct  1    MASSSSPAPTAKRLEGKVALITGGASGIGECTARLFARHGAKVIIADVQSELGRSVAEKI  60

Query  301  GHGNS---FFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDF  471
            G        +V C+VT ESDV+NAVN AVS HG+LDIM NNAGIAG     IL  +  DF
Sbjct  61   GSETGQPVTYVDCNVTVESDVENAVNTAVSLHGKLDIMFNNAGIAGNNHDKILSTEREDF  120

Query  472  VNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFPHAYTCSKHAIVGLTKN  651
            + V  +N  G  LG KHAARVM P ++G I+ TASV+  + G P+AYT SKHA+VGL KN
Sbjct  121  MRVLDINIYGGVLGAKHAARVMIPEKKGCILFTASVSSALYGGPYAYTASKHAVVGLAKN  180

Query  652  TALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYS---NLKGVDLMAEDVAEAV  822
             A++LG++GIRVNC+SP  + T + +   GL+E    +  S   NLK V L   D+AEA 
Sbjct  181  LAIELGQHGIRVNCISPGAVQTGLAKQ-LGLSEQQVQEWSSALANLKVVKLEVNDIAEAA  239

Query  823  LY  828
            LY
Sbjct  240  LY  241



>ref|XP_006424146.1| hypothetical protein CICLE_v10030340mg, partial [Citrus clementina]
 gb|ESR37386.1| hypothetical protein CICLE_v10030340mg, partial [Citrus clementina]
Length=285

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 161/243 (66%), Gaps = 21/243 (9%)
 Frame = +1

Query  118  KMVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKD  297
            +M S+S++S AA+RL G+VA+ITGG  GIG   A+LF +HGAKVLIAD +DD  +S+CKD
Sbjct  24   RMGSASVVSAAARRLQGKVALITGGARGIGECIARLFSKHGAKVLIADIKDDLGESICKD  83

Query  298  LG------HGNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCD  459
            +G      +G S+ VHCDVT E D++NAVN AVS +G+LDIM NNAG       +ILD D
Sbjct  84   IGSSSSSANGCSY-VHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGTVDEAKPNILDND  142

Query  460  GTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFPHAYTCSKHAIVG  639
              +F  +  +N +GAFLG            R  ++    + G  G   HAYT SKH ++G
Sbjct  143  QAEFERILSINLVGAFLG------------RNMLLGVCGIIG--GAATHAYTSSKHGLLG  188

Query  640  LTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGLAEDDKLDVYSNLKGVDLMAEDVAEA  819
            L KNTA++LGR+GIRVNCVSPY +ST + +++  LA+D    +YSNLKG  L  ED AEA
Sbjct  189  LMKNTAVELGRFGIRVNCVSPYAVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDAAEA  248

Query  820  VLY  828
             LY
Sbjct  249  ALY  251



>ref|XP_009618318.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 163/241 (68%), Gaps = 5/241 (2%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDESQSMCKDL  300
            M S+S LST  KRL+G+VAI+TGG  GIG ATAKLF +HGAKV+IAD +D+   S+   L
Sbjct  15   MASASFLSTIGKRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDELGNSVSNAL  74

Query  301  GH-GNSFFVHCDVTSESDVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVN  477
            G   +S ++HCDVT+E  VQNAV++ +ST G+LDIM+ NAGI+      I+D    DF  
Sbjct  75   GSPSHSIYIHCDVTNEDHVQNAVDRTISTFGKLDIMICNAGISDETKPRIIDNMKEDFER  134

Query  478  VFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  654
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  135  VLSINVTGVFLSMKHAARVMVPTRSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNL  194

Query  655  ALDLGRYGIRVNCVSPYILSTQMTRNYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVL  825
            A++LG++GIRVNC+SPY + T +     GL   A +  L    NL+GV L  +DVA+A L
Sbjct  195  AVELGQFGIRVNCLSPYAMVTPLAVKVVGLENEAFEKALSSAGNLQGVTLKVDDVAKAAL  254

Query  826  Y  828
            +
Sbjct  255  F  255



>ref|XP_002309402.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
 gb|EEE92925.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
Length=275

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 140/208 (67%), Gaps = 5/208 (2%)
 Frame = +1

Query  220  KLFCQHGAKVLIADTRDDESQSMCKDLGHGNSF-FVHCDVTSESDVQNAVNKAVSTHGRL  396
            +LF QHGAKVLIAD +DD   S C++ G   +  +VHC+VT +SDVQNAV+ AV  +G+L
Sbjct  21   RLFVQHGAKVLIADIQDDLGHSFCQEFGPQETISYVHCNVTCDSDVQNAVDTAVFKYGKL  80

Query  397  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  576
            DIM NNAGI G +   IL CD  +F  V  VN  G FLG KHAARVM P ++G I+ T+S
Sbjct  81   DIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFLGAKHAARVMIPAKKGCILFTSS  140

Query  577  VAGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYILSTQMTRNYFGL---  744
            VA  + G   HAYT SK+AIVGL KN +++LG+YGIRVN +SPY ++T +  +   +   
Sbjct  141  VASVLYGELAHAYTASKNAIVGLAKNLSVELGQYGIRVNSISPYAVATPLLTDGLSMTKE  200

Query  745  AEDDKLDVYSNLKGVDLMAEDVAEAVLY  828
            A ++ +   + LK V L  EDV++A LY
Sbjct  201  AAEELVASAATLKDVVLEPEDVSQAALY  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1578431504286