BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25035_g2_i5 len=985 path=[2992:0-111 3104:112-135 3128:136-155
13309:156-159 12062:160-176 3169:177-217 13158:218-222 3214:223-256
13363:257-263 3255:264-281 3273:282-282 3274:283-314 13393:315-316
3307:317-368 13462:369-370 13464:371-376 13470:377-392 5462:393-454
13517:455-466 3457:467-479 3470:480-503 3494:504-548 3538:549-571
96:572-598 13575:599-610 3598:611-687 3675:688-815 13703:816-881
3867:882-984]

Length=985
                                                                      Score     E

ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    292   6e-94   Vitis vinifera
ref|XP_011088939.1|  PREDICTED: secoisolariciresinol dehydrogenas...    292   7e-94   
emb|CBI28276.3|  unnamed protein product                                292   4e-93   
gb|AFK46966.1|  unknown                                                 285   3e-91   
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                285   4e-91   
gb|AFK37606.1|  unknown                                                 283   1e-90   
ref|XP_011089208.1|  PREDICTED: secoisolariciresinol dehydrogenas...    283   4e-90   
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    281   6e-90   
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    280   3e-89   Vitis vinifera
ref|XP_003540812.1|  PREDICTED: secoisolariciresinol dehydrogenase      279   7e-89   
ref|XP_006481514.1|  PREDICTED: secoisolariciresinol dehydrogenas...    278   2e-88   
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    277   5e-88   
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             277   5e-88   
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    276   6e-88   
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             276   8e-88   
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    274   5e-87   Vitis vinifera
gb|KHN21175.1|  Momilactone A synthase                                  275   6e-87   
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    274   7e-87   
ref|XP_006424148.1|  hypothetical protein CICLE_v10029025mg             274   9e-87   
ref|XP_006384780.1|  alcohol dehydroge family protein                   274   9e-87   
ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    273   1e-86   
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    273   2e-86   
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             272   4e-86   
ref|XP_003538100.1|  PREDICTED: secoisolariciresinol dehydrogenase      272   4e-86   
ref|XP_006388114.1|  alcohol dehydroge family protein                   271   1e-85   
ref|XP_004506206.1|  PREDICTED: momilactone A synthase-like             270   2e-85   
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    270   3e-85   
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             270   5e-85   
ref|XP_006481516.1|  PREDICTED: secoisolariciresinol dehydrogenas...    269   8e-85   
ref|XP_006481515.1|  PREDICTED: secoisolariciresinol dehydrogenas...    268   1e-84   
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    267   2e-84   
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             267   4e-84   
ref|XP_002523859.1|  short chain alcohol dehydrogenase, putative        267   4e-84   Ricinus communis
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    267   4e-84   
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   5e-84   
ref|XP_006481517.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   1e-83   
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             266   1e-83   
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   1e-83   
ref|XP_010246229.1|  PREDICTED: secoisolariciresinol dehydrogenas...    266   1e-83   
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    265   1e-83   
gb|KHN21176.1|  Momilactone A synthase                                  265   2e-83   
ref|XP_006424147.1|  hypothetical protein CICLE_v10029025mg             265   3e-83   
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         265   3e-83   
ref|XP_003546632.1|  PREDICTED: secoisolariciresinol dehydrogenas...    264   7e-83   
gb|KHN21177.1|  Momilactone A synthase                                  266   8e-83   
gb|KHN11533.1|  Momilactone A synthase                                  263   9e-83   
emb|CBI28275.3|  unnamed protein product                                279   1e-82   
ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    263   1e-82   
ref|XP_007132471.1|  hypothetical protein PHAVU_011G096800g             263   1e-82   
gb|KEH29817.1|  short-chain dehydrogenase/reductase                     263   1e-82   
emb|CDP06868.1|  unnamed protein product                                263   2e-82   
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    263   2e-82   
ref|XP_007207105.1|  hypothetical protein PRUPE_ppa020955mg             263   2e-82   
gb|ACU18273.1|  unknown                                                 262   2e-82   Glycine max [soybeans]
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             261   4e-82   
emb|CDP06870.1|  unnamed protein product                                261   7e-82   
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    261   1e-81   
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         260   2e-81   
ref|XP_010040326.1|  PREDICTED: secoisolariciresinol dehydrogenas...    260   2e-81   
emb|CDP06869.1|  unnamed protein product                                259   4e-81   
gb|ACU19531.1|  unknown                                                 259   5e-81   Glycine max [soybeans]
gb|AFK35915.1|  unknown                                                 259   5e-81   
ref|NP_001239862.1|  uncharacterized protein LOC100794412               258   1e-80   
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    258   2e-80   
ref|XP_007132474.1|  hypothetical protein PHAVU_011G097100g             256   5e-80   
ref|XP_010061228.1|  PREDICTED: secoisolariciresinol dehydrogenas...    256   5e-80   
gb|KEH29814.1|  short-chain dehydrogenase/reductase                     256   6e-80   
ref|XP_010049793.1|  PREDICTED: secoisolariciresinol dehydrogenas...    256   7e-80   
gb|KDP34949.1|  hypothetical protein JCGZ_09237                         255   1e-79   
ref|XP_010061227.1|  PREDICTED: secoisolariciresinol dehydrogenas...    256   2e-79   
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    254   2e-79   
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             254   2e-79   
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    254   5e-79   
ref|XP_010070261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    254   5e-79   
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         253   8e-79   
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    253   8e-79   Populus trichocarpa [western balsam poplar]
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    253   9e-79   
gb|KEH29815.1|  short-chain dehydrogenase/reductase                     253   1e-78   
ref|XP_003632648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    252   3e-78   
gb|AEC10992.1|  alcohol dehydrogenase                                   252   3e-78   
ref|XP_002281462.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   5e-78   Vitis vinifera
emb|CDP06872.1|  unnamed protein product                                253   6e-78   
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    251   7e-78   
dbj|BAA13541.1|  CPRD12 protein                                         250   9e-78   Vigna unguiculata
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    250   1e-77   
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    250   1e-77   
emb|CAN78993.1|  hypothetical protein VITISV_001799                     254   1e-77   Vitis vinifera
ref|XP_011094269.1|  PREDICTED: secoisolariciresinol dehydrogenas...    249   3e-77   
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         249   3e-77   
ref|XP_009388139.1|  PREDICTED: momilactone A synthase-like             248   6e-77   
dbj|BAE72097.1|  Lactuca sativa short-chain dehydrogenase/reducta...    248   9e-77   Lactuca sativa [cultivated lettuce]
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       248   1e-76   
gb|KDP34955.1|  hypothetical protein JCGZ_09243                         248   1e-76   
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       248   1e-76   
ref|XP_009605454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    247   1e-76   
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 247   2e-76   
dbj|BAC53872.1|  alcohol dehydroge                                      247   3e-76   Phaseolus lunatus
ref|XP_002523206.1|  short chain alcohol dehydrogenase, putative        246   3e-76   Ricinus communis
ref|XP_009605455.1|  PREDICTED: secoisolariciresinol dehydrogenas...    245   5e-76   
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             247   7e-76   
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             246   7e-76   
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       246   9e-76   
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    246   9e-76   
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            246   9e-76   
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             245   1e-75   
ref|XP_010059374.1|  PREDICTED: secoisolariciresinol dehydrogenas...    247   1e-75   
ref|XP_006651946.1|  PREDICTED: zerumbone synthase-like                 246   1e-75   
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   245   1e-75   
ref|XP_010104811.1|  Momilactone A synthase                             245   1e-75   
ref|XP_010104809.1|  Momilactone A synthase                             245   2e-75   
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      244   2e-75   Cucumis sativus [cucumbers]
ref|XP_004169912.1|  PREDICTED: short-chain dehydrogenase reducta...    244   2e-75   
ref|XP_009605456.1|  PREDICTED: secoisolariciresinol dehydrogenas...    244   2e-75   
ref|XP_007132473.1|  hypothetical protein PHAVU_011G097000g             244   3e-75   
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   8e-75   
ref|XP_007043248.1|  Short chain alcohol dehydrogenase                  243   9e-75   
ref|XP_010104810.1|  Momilactone A synthase                             243   9e-75   
ref|XP_010050120.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   1e-74   
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    243   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_008442883.1|  PREDICTED: secoisolariciresinol dehydrogenas...    243   1e-74   
ref|XP_009773000.1|  PREDICTED: secoisolariciresinol dehydrogenas...    242   1e-74   
gb|AAK83035.1|AF286650_1  CTA                                           243   1e-74   Cucumis sativus [cucumbers]
gb|KCW58914.1|  hypothetical protein EUGRSUZ_H01537                     241   1e-74   
ref|XP_003539841.1|  PREDICTED: secoisolariciresinol dehydrogenase      242   2e-74   
ref|XP_002308448.2|  alcohol dehydroge family protein                   242   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_002466226.1|  hypothetical protein SORBIDRAFT_01g003880          241   6e-74   Sorghum bicolor [broomcorn]
ref|XP_004139590.1|  PREDICTED: short-chain dehydrogenase reducta...    241   7e-74   
ref|XP_004981321.1|  PREDICTED: zerumbone synthase-like                 241   8e-74   
gb|ACU18308.1|  unknown                                                 240   8e-74   Glycine max [soybeans]
gb|KCW83009.1|  hypothetical protein EUGRSUZ_C04391                     241   1e-73   
ref|XP_010051779.1|  PREDICTED: secoisolariciresinol dehydrogenas...    241   1e-73   
gb|EMT02624.1|  Xanthoxin dehydrogenase                                 240   1e-73   
ref|XP_010917564.1|  PREDICTED: momilactone A synthase-like             239   2e-73   
gb|KCW83006.1|  hypothetical protein EUGRSUZ_C04389                     239   3e-73   
ref|XP_009399160.1|  PREDICTED: momilactone A synthase-like             238   4e-73   
emb|CAN68176.1|  hypothetical protein VITISV_014635                     238   4e-73   Vitis vinifera
sp|F1SWA0.1|ZERSY_ZINZE  RecName: Full=Zerumbone synthase               238   6e-73   
ref|XP_008243484.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   6e-73   
ref|XP_011094266.1|  PREDICTED: secoisolariciresinol dehydrogenas...    239   6e-73   
gb|ADK56099.1|  alcohol dehydrogenase                                   238   6e-73   
ref|XP_004136700.1|  PREDICTED: momilactone A synthase-like             238   8e-73   
ref|XP_009350131.1|  PREDICTED: secoisolariciresinol dehydrogenas...    238   1e-72   
ref|XP_010227919.1|  PREDICTED: zerumbone synthase isoform X1           238   1e-72   
ref|XP_006362152.1|  PREDICTED: secoisolariciresinol dehydrogenas...    237   1e-72   
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    238   1e-72   
ref|XP_004981317.1|  PREDICTED: zerumbone synthase-like                 239   2e-72   
ref|XP_003563948.1|  PREDICTED: zerumbone synthase isoform X2           237   2e-72   
ref|XP_004244887.1|  PREDICTED: secoisolariciresinol dehydrogenas...    237   2e-72   
gb|KCW90500.1|  hypothetical protein EUGRSUZ_A02619                     237   2e-72   
ref|XP_008643649.1|  PREDICTED: short chain alcohol dehydrogenase...    237   2e-72   
gb|KGN59171.1|  hypothetical protein Csa_3G778270                       237   3e-72   
ref|XP_004237829.1|  PREDICTED: xanthoxin dehydrogenase-like            237   3e-72   
ref|XP_007043243.1|  Short chain alcohol dehydrogenase                  236   4e-72   
gb|EMS67256.1|  Xanthoxin dehydrogenase                                 237   5e-72   
emb|CBI18081.3|  unnamed protein product                                236   5e-72   
ref|XP_010246261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    236   7e-72   
ref|XP_009631422.1|  PREDICTED: xanthoxin dehydrogenase-like            236   7e-72   
ref|XP_006367118.1|  PREDICTED: secoisolariciresinol dehydrogenas...    235   8e-72   
ref|XP_010324818.1|  PREDICTED: secoisolariciresinol dehydrogenas...    234   9e-72   
ref|XP_006367119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    234   1e-71   
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    235   1e-71   Forsythia x intermedia [cultivated forsythia]
ref|XP_010246256.1|  PREDICTED: secoisolariciresinol dehydrogenas...    235   2e-71   
ref|XP_009590019.1|  PREDICTED: secoisolariciresinol dehydrogenas...    234   2e-71   
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    234   2e-71   
ref|NP_001148513.1|  short chain alcohol dehydrogenase1                 233   3e-71   Zea mays [maize]
ref|XP_007152489.1|  hypothetical protein PHAVU_004G135000g             233   4e-71   
ref|XP_008392031.1|  PREDICTED: secoisolariciresinol dehydrogenas...    233   4e-71   
gb|KGN59172.1|  hypothetical protein Csa_3G778280                       233   4e-71   
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          233   5e-71   
ref|XP_007152499.1|  hypothetical protein PHAVU_004G135300g             233   5e-71   
gb|AFV30207.1|  borneol dehydrogenase                                   233   6e-71   
ref|XP_010931582.1|  PREDICTED: LOW QUALITY PROTEIN: zerumbone sy...    233   7e-71   
ref|XP_006468252.1|  PREDICTED: short-chain dehydrogenase reducta...    234   9e-71   
gb|KDP36096.1|  hypothetical protein JCGZ_08740                         232   1e-70   
ref|XP_010024677.1|  PREDICTED: secoisolariciresinol dehydrogenas...    232   2e-70   
gb|ACG37730.1|  sex determination protein tasselseed-2                  232   2e-70   Zea mays [maize]
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    232   2e-70   
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    233   2e-70   
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    232   2e-70   
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    233   2e-70   
ref|XP_007027908.1|  Short chain alcohol dehydrogenase, putative        231   2e-70   
ref|XP_008808776.1|  PREDICTED: zerumbone synthase                      232   2e-70   
ref|XP_010312220.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   3e-70   
ref|XP_010922188.1|  PREDICTED: zerumbone synthase-like                 231   3e-70   
ref|XP_010312221.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   4e-70   
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    231   4e-70   
ref|XP_010094675.1|  Sex determination protein tasselseed-2             234   4e-70   
ref|XP_006339150.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   4e-70   
ref|XP_010104812.1|  Momilactone A synthase                             231   4e-70   
ref|XP_011041828.1|  PREDICTED: short-chain dehydrogenase reducta...    232   4e-70   
ref|XP_007202842.1|  hypothetical protein PRUPE_ppa014608mg             230   5e-70   
ref|XP_006339148.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   6e-70   
ref|NP_001275184.1|  short-chain dehydrogenase/reductase                231   6e-70   
gb|KDP34951.1|  hypothetical protein JCGZ_09239                         229   6e-70   
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    231   6e-70   
ref|XP_011094267.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   7e-70   
ref|XP_010654128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    231   7e-70   
ref|XP_008360614.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   8e-70   
ref|XP_002281290.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   9e-70   Vitis vinifera
ref|XP_011046903.1|  PREDICTED: secoisolariciresinol dehydrogenas...    230   9e-70   
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        231   1e-69   Ricinus communis
gb|KDO36906.1|  hypothetical protein CISIN_1g040531mg                   230   1e-69   
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    231   1e-69   Vitis vinifera
ref|XP_011046907.1|  PREDICTED: secoisolariciresinol dehydrogenas...    229   2e-69   
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             229   2e-69   
ref|XP_004305640.1|  PREDICTED: momilactone A synthase-like             229   2e-69   
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         229   2e-69   
ref|XP_009618318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    229   3e-69   
ref|XP_011046902.1|  PREDICTED: secoisolariciresinol dehydrogenas...    229   3e-69   
ref|XP_002275723.3|  PREDICTED: secoisolariciresinol dehydrogenas...    229   4e-69   Vitis vinifera
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    229   4e-69   Vitis vinifera
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    229   6e-69   
gb|KDP36166.1|  hypothetical protein JCGZ_08810                         228   6e-69   
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    228   6e-69   
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    229   7e-69   Populus trichocarpa [western balsam poplar]
gb|ABK23507.1|  unknown                                                 229   7e-69   Picea sitchensis
ref|XP_009395947.1|  PREDICTED: zerumbone synthase                      228   7e-69   
ref|XP_006431968.1|  hypothetical protein CICLE_v10003833mg             228   9e-69   
ref|XP_006428245.1|  hypothetical protein CICLE_v10012415mg             228   1e-68   
ref|XP_009605329.1|  PREDICTED: secoisolariciresinol dehydrogenas...    228   1e-68   
emb|CAA11153.1|  short chain alcohol dehydrogenase                      228   1e-68   Nicotiana tabacum [American tobacco]
ref|XP_011094268.1|  PREDICTED: secoisolariciresinol dehydrogenas...    227   1e-68   
ref|XP_002513092.1|  short chain alcohol dehydrogenase, putative        227   2e-68   Ricinus communis
ref|XP_002309405.1|  alcohol dehydroge family protein                   226   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    227   3e-68   
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    226   3e-68   
gb|KCW90498.1|  hypothetical protein EUGRSUZ_A02616                     226   3e-68   
gb|ABK24336.1|  unknown                                                 227   3e-68   Picea sitchensis
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      226   3e-68   
gb|EAY92297.1|  hypothetical protein OsI_14018                          226   3e-68   Oryza sativa Indica Group [Indian rice]
ref|NP_001051666.1|  Os03g0810800                                       226   4e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    227   4e-68   
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    227   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    226   5e-68   
ref|XP_009802753.1|  PREDICTED: secoisolariciresinol dehydrogenas...    226   5e-68   
ref|XP_006360738.1|  PREDICTED: secoisolariciresinol dehydrogenas...    226   6e-68   
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      226   6e-68   
ref|XP_004237828.1|  PREDICTED: xanthoxin dehydrogenase-like            225   6e-68   
ref|XP_003552289.1|  PREDICTED: short-chain dehydrogenase reducta...    226   7e-68   
ref|XP_002325666.2|  hypothetical protein POPTR_0019s14650g             225   7e-68   Populus trichocarpa [western balsam poplar]
gb|KHN40676.1|  Sex determination protein tasselseed-2                  226   9e-68   
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      226   1e-67   
gb|KDP36152.1|  hypothetical protein JCGZ_08796                         225   1e-67   
gb|KHG10215.1|  hypothetical protein F383_13541                         224   1e-67   
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             224   1e-67   
ref|XP_006361612.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   1e-67   
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    225   2e-67   
ref|XP_010314459.1|  PREDICTED: uncharacterized protein LOC100750...    224   2e-67   
ref|XP_009776711.1|  PREDICTED: secoisolariciresinol dehydrogenas...    224   2e-67   
ref|NP_001275796.1|  short chain alcohol dehydrogenase                  224   2e-67   
ref|XP_006424146.1|  hypothetical protein CICLE_v10030340mg             224   2e-67   
gb|KHG08861.1|  Xanthoxin dehydrogenase -like protein                   224   3e-67   
gb|KDP36168.1|  hypothetical protein JCGZ_08812                         224   3e-67   
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             224   3e-67   
ref|XP_011046906.1|  PREDICTED: secoisolariciresinol dehydrogenas...    223   4e-67   
ref|XP_006338927.1|  PREDICTED: secoisolariciresinol dehydrogenas...    223   5e-67   
ref|XP_002323404.1|  alcohol dehydroge family protein                   223   5e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010671866.1|  PREDICTED: xanthoxin dehydrogenase-like            223   5e-67   
ref|XP_007026535.1|  NAD(P)-binding Rossmann-fold superfamily pro...    224   5e-67   
ref|XP_010922187.1|  PREDICTED: zerumbone synthase-like                 223   6e-67   
ref|XP_009789920.1|  PREDICTED: xanthoxin dehydrogenase-like            223   7e-67   
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             223   7e-67   
ref|XP_002297758.1|  GLUCOSE INSENSITIVE 1 family protein               223   7e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002281352.1|  PREDICTED: secoisolariciresinol dehydrogenas...    223   7e-67   Vitis vinifera
ref|XP_009417972.1|  PREDICTED: sex determination protein tassels...    223   7e-67   
gb|AFL56690.1|  ADH1                                                    223   8e-67   
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         223   9e-67   
ref|XP_010654129.1|  PREDICTED: secoisolariciresinol dehydrogenas...    223   9e-67   
ref|XP_006577090.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   1e-66   
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    222   1e-66   
gb|EYU42960.1|  hypothetical protein MIMGU_mgv1a011480mg                222   1e-66   
gb|ABK26187.1|  unknown                                                 222   1e-66   Picea sitchensis
gb|ABK21151.1|  unknown                                                 222   2e-66   Picea sitchensis
ref|XP_007008811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    222   2e-66   
ref|XP_011091814.1|  PREDICTED: xanthoxin dehydrogenase                 222   2e-66   
ref|XP_003554452.1|  PREDICTED: secoisolariciresinol dehydrogenase      221   2e-66   
ref|XP_002527336.1|  short chain alcohol dehydrogenase, putative        221   2e-66   Ricinus communis
gb|ABS87381.1|  short-chain dehydrogenase/reductase protein             221   2e-66   Lactuca sativa [cultivated lettuce]
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          221   3e-66   
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    222   3e-66   
ref|XP_002309404.1|  alcohol dehydroge family protein                   221   3e-66   
ref|XP_007027905.1|  Short chain alcohol dehydrogenase, putative        221   3e-66   
gb|ABK25445.1|  unknown                                                 221   3e-66   
ref|XP_011094346.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   3e-66   
ref|XP_009420509.1|  PREDICTED: momilactone A synthase-like             221   3e-66   
ref|XP_004499827.1|  PREDICTED: xanthoxin dehydrogenase-like            221   4e-66   
ref|XP_004252563.1|  PREDICTED: secoisolariciresinol dehydrogenas...    221   4e-66   
gb|KHN33174.1|  Momilactone A synthase                                  222   4e-66   
ref|XP_010040330.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   6e-66   
ref|XP_004228706.1|  PREDICTED: secoisolariciresinol dehydrogenas...    220   6e-66   
gb|KDP42340.1|  hypothetical protein JCGZ_02813                         220   7e-66   
ref|XP_002309402.2|  hypothetical protein POPTR_0006s22270g             220   8e-66   
gb|ABK24197.1|  unknown                                                 220   8e-66   
gb|ABK22004.1|  unknown                                                 220   8e-66   
ref|XP_007140172.1|  hypothetical protein PHAVU_008G089900g             221   9e-66   
ref|XP_010654127.1|  PREDICTED: secoisolariciresinol dehydrogenas...    220   9e-66   
ref|XP_009618506.1|  PREDICTED: secoisolariciresinol dehydrogenas...    220   9e-66   
ref|XP_011046905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-65   
gb|KHN13691.1|  Xanthoxin dehydrogenase                                 220   1e-65   
ref|XP_006591160.1|  PREDICTED: xanthoxin dehydrogenase-like            220   1e-65   
ref|XP_003534665.1|  PREDICTED: short-chain dehydrogenase reducta...    220   1e-65   
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-65   
ref|XP_002323403.1|  alcohol dehydroge family protein                   219   1e-65   
ref|XP_006354216.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-65   
ref|XP_009618308.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-65   
ref|XP_009782884.1|  PREDICTED: short-chain dehydrogenase reducta...    220   2e-65   
ref|XP_009631424.1|  PREDICTED: xanthoxin dehydrogenase-like            219   2e-65   
emb|CDO98188.1|  unnamed protein product                                219   3e-65   
ref|XP_002526911.1|  short chain alcohol dehydrogenase, putative        219   3e-65   
gb|KDP36159.1|  hypothetical protein JCGZ_08803                         219   3e-65   
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    219   3e-65   
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        218   3e-65   
gb|KHG07244.1|  Sex determination tasselseed-2                          219   3e-65   
gb|EYU18091.1|  hypothetical protein MIMGU_mgv1a011664mg                218   4e-65   
gb|KHN33244.1|  Sex determination protein tasselseed-2                  219   4e-65   
gb|ACN40590.1|  unknown                                                 219   4e-65   
ref|XP_009768564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    218   4e-65   
ref|XP_007134614.1|  hypothetical protein PHAVU_010G061700g             219   5e-65   
emb|CDY29039.1|  BnaC07g32450D                                          218   5e-65   
gb|KHN29548.1|  Sex determination protein tasselseed-2                  220   5e-65   
ref|XP_003623493.1|  Sex determination protein tasselseed-2             219   6e-65   
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       218   6e-65   
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             219   7e-65   
ref|XP_006361611.1|  PREDICTED: secoisolariciresinol dehydrogenas...    218   8e-65   
emb|CDP20435.1|  unnamed protein product                                218   8e-65   
ref|XP_008782768.1|  PREDICTED: sex determination protein tassels...    217   9e-65   
gb|KDP36160.1|  hypothetical protein JCGZ_08804                         217   9e-65   
ref|XP_009776783.1|  PREDICTED: short-chain dehydrogenase reducta...    218   9e-65   
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    218   9e-65   
ref|XP_006828171.1|  hypothetical protein AMTR_s00023p00118310          218   1e-64   
ref|XP_004143392.1|  PREDICTED: zerumbone synthase-like                 217   1e-64   
ref|XP_010246244.1|  PREDICTED: secoisolariciresinol dehydrogenas...    217   1e-64   
ref|XP_002530171.1|  short chain alcohol dehydrogenase, putative        217   1e-64   
gb|KCW47495.1|  hypothetical protein EUGRSUZ_K01263                     217   1e-64   
ref|XP_004170965.1|  PREDICTED: zerumbone synthase-like                 217   1e-64   
ref|XP_008367851.1|  PREDICTED: xanthoxin dehydrogenase-like            217   1e-64   
ref|XP_010059357.1|  PREDICTED: secoisolariciresinol dehydrogenas...    217   1e-64   
ref|XP_003554453.1|  PREDICTED: secoisolariciresinol dehydrogenas...    217   1e-64   
ref|XP_010683578.1|  PREDICTED: short-chain dehydrogenase reducta...    218   1e-64   
gb|AER92598.1|  putative short-chain alcohol dehydrogenase              218   2e-64   
gb|KDP36156.1|  hypothetical protein JCGZ_08800                         217   2e-64   
ref|XP_009615997.1|  PREDICTED: short-chain dehydrogenase reducta...    218   2e-64   
ref|XP_011043647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    216   2e-64   
ref|XP_003538228.1|  PREDICTED: xanthoxin dehydrogenase-like            216   2e-64   
ref|XP_010067756.1|  PREDICTED: xanthoxin dehydrogenase                 216   2e-64   
ref|XP_004492523.1|  PREDICTED: short-chain dehydrogenase reducta...    217   2e-64   
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             216   2e-64   
gb|ACU23500.1|  unknown                                                 216   2e-64   
ref|XP_010035975.1|  PREDICTED: short-chain dehydrogenase reducta...    217   2e-64   
ref|XP_010102621.1|  Sex determination protein tasselseed-2             217   3e-64   
ref|XP_010529113.1|  PREDICTED: short-chain dehydrogenase reducta...    217   3e-64   
gb|KDP36167.1|  hypothetical protein JCGZ_08811                         216   3e-64   
ref|XP_007148993.1|  hypothetical protein PHAVU_005G031500g             216   4e-64   
ref|XP_006855389.1|  hypothetical protein AMTR_s00057p00137740          216   4e-64   
ref|XP_010921066.1|  PREDICTED: LOW QUALITY PROTEIN: sex determin...    216   4e-64   
ref|XP_010671863.1|  PREDICTED: zerumbone synthase-like                 216   4e-64   
ref|XP_010551306.1|  PREDICTED: xanthoxin dehydrogenase                 216   5e-64   
ref|XP_004249651.1|  PREDICTED: short-chain dehydrogenase reducta...    216   5e-64   
gb|ABK26305.1|  unknown                                                 216   5e-64   
ref|XP_002530176.1|  short chain alcohol dehydrogenase, putative        217   6e-64   
ref|XP_006361625.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   6e-64   
emb|CDP02837.1|  unnamed protein product                                217   7e-64   
gb|ACU19262.1|  unknown                                                 215   8e-64   
ref|XP_010917566.1|  PREDICTED: momilactone A synthase-like isofo...    213   8e-64   
ref|XP_006338966.1|  PREDICTED: short-chain dehydrogenase reducta...    216   9e-64   
gb|KDO58269.1|  hypothetical protein CISIN_1g044485mg                   214   1e-63   
ref|XP_004166485.1|  PREDICTED: LOW QUALITY PROTEIN: xanthoxin de...    214   1e-63   
gb|KDP36155.1|  hypothetical protein JCGZ_08799                         214   1e-63   
gb|KDP36097.1|  hypothetical protein JCGZ_08741                         214   1e-63   
ref|XP_004143748.1|  PREDICTED: xanthoxin dehydrogenase-like            214   2e-63   
gb|KDP37624.1|  hypothetical protein JCGZ_06967                         214   2e-63   
ref|XP_010312311.1|  PREDICTED: short-chain dehydrogenase reducta...    215   2e-63   
ref|XP_010937967.1|  PREDICTED: sex determination protein tassels...    214   3e-63   
ref|XP_010106398.1|  Xanthoxin dehydrogenase                            213   3e-63   
gb|KDP40503.1|  hypothetical protein JCGZ_24502                         213   3e-63   
gb|KEH24173.1|  short-chain dehydrogenase/reductase                     213   3e-63   
ref|XP_004959906.1|  PREDICTED: sex determination protein tassels...    214   4e-63   
ref|XP_004249781.1|  PREDICTED: secoisolariciresinol dehydrogenas...    213   4e-63   
ref|XP_002275746.2|  PREDICTED: secoisolariciresinol dehydrogenas...    213   4e-63   
ref|XP_002530170.1|  short chain alcohol dehydrogenase, putative        213   4e-63   
ref|XP_009611083.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   4e-63   
ref|XP_008370219.1|  PREDICTED: short-chain dehydrogenase reducta...    214   5e-63   
gb|KDP32981.1|  hypothetical protein JCGZ_13012                         212   5e-63   
ref|XP_011077500.1|  PREDICTED: short-chain dehydrogenase reducta...    213   5e-63   
gb|ABK26167.1|  unknown                                                 213   5e-63   
ref|XP_006843399.1|  hypothetical protein AMTR_s00053p00124300          213   5e-63   
ref|XP_008388874.1|  PREDICTED: short-chain dehydrogenase reducta...    214   6e-63   
ref|XP_009136629.1|  PREDICTED: short-chain dehydrogenase reducta...    213   8e-63   
ref|XP_006854739.1|  hypothetical protein AMTR_s00030p00244330          212   1e-62   
emb|CDX90636.1|  BnaA03g41450D                                          212   1e-62   
ref|XP_007204705.1|  hypothetical protein PRUPE_ppa009636mg             212   1e-62   
ref|XP_008809990.1|  PREDICTED: sex determination protein tassels...    213   1e-62   
ref|XP_010503863.1|  PREDICTED: short-chain dehydrogenase reducta...    213   1e-62   
gb|KHN02192.1|  Momilactone A synthase                                  224   1e-62   
ref|XP_008243483.1|  PREDICTED: secoisolariciresinol dehydrogenas...    212   1e-62   
gb|KDP32262.1|  hypothetical protein JCGZ_14783                         211   1e-62   
ref|XP_009592996.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   2e-62   
ref|XP_003554454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    212   2e-62   
ref|XP_008229683.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   2e-62   
ref|XP_004303064.1|  PREDICTED: xanthoxin dehydrogenase-like            211   2e-62   
gb|KCW45306.1|  hypothetical protein EUGRSUZ_L01036                     209   2e-62   
ref|XP_009787721.1|  PREDICTED: xanthoxin dehydrogenase-like            211   2e-62   
ref|XP_002894375.1|  hypothetical protein ARALYDRAFT_474354             211   3e-62   
ref|XP_010104808.1|  Momilactone A synthase                             212   3e-62   
ref|XP_006292209.1|  hypothetical protein CARUB_v10018415mg             211   4e-62   
emb|CDP16984.1|  unnamed protein product                                211   4e-62   
gb|EPS72418.1|  short chain alcohol dehydrogenase                       210   4e-62   
gb|KFK34412.1|  hypothetical protein AALP_AA5G141400                    211   5e-62   
ref|XP_010277608.1|  PREDICTED: xanthoxin dehydrogenase                 210   6e-62   
ref|XP_002513344.1|  short chain alcohol dehydrogenase, putative        210   7e-62   
gb|ACU16756.1|  unknown                                                 208   1e-61   
ref|XP_002877816.1|  short-chain dehydrogenase/reductase family p...    210   1e-61   
ref|XP_008465699.1|  PREDICTED: xanthoxin dehydrogenase                 209   1e-61   
gb|EEC82732.1|  hypothetical protein OsI_27430                          210   1e-61   
gb|KDP25017.1|  hypothetical protein JCGZ_24000                         209   2e-61   
ref|XP_009373111.1|  PREDICTED: short-chain dehydrogenase reducta...    209   2e-61   
ref|XP_002513332.1|  short chain alcohol dehydrogenase, putative        209   2e-61   
gb|KDO58270.1|  hypothetical protein CISIN_1g044923mg                   206   2e-61   
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             208   3e-61   
emb|CDP06416.1|  unnamed protein product                                209   3e-61   
gb|ABR18410.1|  unknown                                                 208   3e-61   
ref|XP_006303255.1|  hypothetical protein CARUB_v10009938mg             208   4e-61   
ref|XP_008808791.1|  PREDICTED: zerumbone synthase-like                 208   4e-61   
ref|XP_009147691.1|  PREDICTED: xanthoxin dehydrogenase                 208   5e-61   
ref|XP_006403893.1|  hypothetical protein EUTSA_v10010941mg             206   5e-61   
ref|NP_001060718.1|  Os07g0691600                                       209   5e-61   
ref|XP_010229744.1|  PREDICTED: short-chain dehydrogenase reducta...    209   5e-61   
ref|XP_006339318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   6e-61   
ref|XP_002275768.1|  PREDICTED: tropinone reductase-like 1              207   6e-61   
gb|AFK45740.1|  unknown                                                 207   8e-61   
emb|CDY52974.1|  BnaA06g01590D                                          207   1e-60   
gb|KDP36165.1|  hypothetical protein JCGZ_08809                         209   1e-60   
ref|NP_190736.1|  short-chain dehydrogenase reductase 2a                207   2e-60   
ref|XP_007218800.1|  hypothetical protein PRUPE_ppa009814mg             206   2e-60   
gb|EYU18090.1|  hypothetical protein MIMGU_mgv1a010990mg                207   2e-60   
ref|XP_002526345.1|  short chain alcohol dehydrogenase, putative        206   2e-60   
gb|ADD70246.1|  secoisolariciresinol dehydrogenase                      206   2e-60   
ref|XP_006392929.1|  hypothetical protein EUTSA_v10011636mg             207   2e-60   
emb|CDY61086.1|  BnaC06g41140D                                          206   2e-60   
ref|XP_003598766.1|  Short-chain dehydrogenase/reductase                206   2e-60   
gb|ABK22745.1|  unknown                                                 206   3e-60   
gb|ABN14311.1|  secoisolariciresinol dehydrogenase                      205   4e-60   
ref|XP_009354435.1|  PREDICTED: xanthoxin dehydrogenase                 205   4e-60   
gb|AHL21380.1|  secoisolariciresinol reductase                          205   5e-60   
ref|XP_003579668.1|  PREDICTED: momilactone A synthase-like             205   5e-60   
sp|Q94KL8.1|SILD_PODPE  RecName: Full=Secoisolariciresinol dehydr...    205   5e-60   
gb|ACB87357.1|  secoisolariciresinol dehydrogenase                      205   6e-60   
ref|XP_010246807.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   6e-60   
dbj|BAE72096.1|  Lactuca sativa short-chain dehydrogenase/reducta...    204   8e-60   
ref|XP_010479742.1|  PREDICTED: xanthoxin dehydrogenase                 204   9e-60   
emb|CDX78027.1|  BnaA09g32220D                                          205   1e-59   
ref|XP_008245281.1|  PREDICTED: xanthoxin dehydrogenase                 204   1e-59   
gb|ABD65462.1|  short chain alcohol dehydrogenase                       204   1e-59   
ref|XP_004984897.1|  PREDICTED: sex determination protein tassels...    205   1e-59   
ref|NP_001052173.1|  Os04g0179100                                       204   1e-59   
ref|XP_010905491.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   1e-59   
gb|EPS74091.1|  hypothetical protein M569_00663                         204   2e-59   
ref|XP_009372539.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   2e-59   
gb|AAC35340.1|  short-chain alcohol dehydrogenase                       203   3e-59   
gb|KDP36151.1|  hypothetical protein JCGZ_08795                         203   3e-59   
ref|NP_001049848.1|  Os03g0299200                                       204   3e-59   
ref|XP_010500833.1|  PREDICTED: xanthoxin dehydrogenase-like            203   3e-59   
ref|XP_004152436.1|  PREDICTED: zerumbone synthase-like                 202   4e-59   
gb|EYU41979.1|  hypothetical protein MIMGU_mgv1a011548mg                202   6e-59   
ref|XP_007015732.1|  Short chain alcohol dehydrogenase, putative        201   7e-59   
ref|XP_002265724.1|  PREDICTED: xanthoxin dehydrogenase                 202   7e-59   
ref|XP_004975524.1|  PREDICTED: momilactone A synthase-like             202   7e-59   
ref|XP_004305639.1|  PREDICTED: momilactone A synthase-like             202   8e-59   
ref|XP_008437356.1|  PREDICTED: zerumbone synthase-like                 202   8e-59   
ref|XP_009115857.1|  PREDICTED: short-chain dehydrogenase reducta...    202   9e-59   
ref|XP_010244664.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   9e-59   
ref|XP_007027880.1|  Short chain alcohol dehydrogenase                  201   1e-58   
ref|XP_010244662.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   1e-58   
emb|CDX73704.1|  BnaC08g22990D                                          202   1e-58   
ref|XP_010244665.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   1e-58   
ref|NP_001238797.1|  uncharacterized protein LOC100750250               199   1e-58   
emb|CAH66124.1|  OSIGBa0109M01.2                                        201   1e-58   
ref|XP_010671865.1|  PREDICTED: zerumbone synthase-like                 201   2e-58   
ref|XP_008660233.1|  PREDICTED: sex determination protein tassels...    202   2e-58   
ref|XP_002446247.1|  hypothetical protein SORBIDRAFT_06g009610          201   2e-58   
ref|XP_010104807.1|  Momilactone A synthase                             200   3e-58   
ref|XP_010244663.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   3e-58   
ref|XP_009626741.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   3e-58   
ref|XP_009763487.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   3e-58   
gb|ABD39551.1|  tasselseed2-like short-chain dehydrogenase/reductase    199   3e-58   
ref|XP_010244661.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   4e-58   
emb|CDP20942.1|  unnamed protein product                                200   5e-58   
ref|XP_008351500.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   6e-58   
ref|XP_010101928.1|  Momilactone A synthase                             200   6e-58   
ref|XP_006361624.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   6e-58   
gb|AAC35342.1|  short-chain alcohol dehydrogenase                       199   7e-58   
gb|ABD39539.1|  tasselseed2-like short-chain dehydrogenase/reductase    198   7e-58   
ref|XP_007148995.1|  hypothetical protein PHAVU_005G031600g             199   8e-58   
ref|XP_002275647.1|  PREDICTED: secoisolariciresinol dehydrogenase      200   8e-58   
gb|ABD39544.1|  tasselseed2-like short-chain dehydrogenase/reductase    198   9e-58   
ref|XP_002533854.1|  short chain alcohol dehydrogenase, putative        199   9e-58   
ref|XP_009404353.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   1e-57   
emb|CAN62844.1|  hypothetical protein VITISV_021186                     200   2e-57   
ref|XP_006354115.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   2e-57   
ref|XP_002468013.1|  hypothetical protein SORBIDRAFT_01g038050          200   2e-57   



>ref|XP_002272549.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 166/270 (61%), Positives = 207/270 (77%), Gaps = 13/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDE--------  276
            MVSSSLLS  A+RLEGKVA+ITGG GGIGS TAK+F QHGAKVLIAD +D++        
Sbjct  1    MVSSSLLSAVARRLEGKVALITGGAGGIGSCTAKLFSQHGAKVLIADIQDEKGHLICRDL  60

Query  277  --SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S + F+HCDVT E DV +A+++AV+ HG+LDIM NNAGILG K+ +ILD DA +F N 
Sbjct  61   GPSSASFIHCDVTKELDVSNAIDEAVAKHGKLDIMFNNAGILGPKIINILDNDAAEFENT  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN LGAFLGTKHAARVM P  RG +IN+ASV   +GG   H+Y  SKHAI+GLT+NTA
Sbjct  121  MRVNVLGAFLGTKHAARVMVPAGRGCVINSASVCSVVGGICTHSYVSSKHAILGLTRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDIAEAVLYLA  804
            ++LG++GIRVNCVSPY VPT M+R +    +DD   DVYS+LKGV LM +D+AEAVLYL 
Sbjct  181  VELGKFGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYSNLKGVALMPQDVAEAVLYLG  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SD+SKYVSG+NLV+D G +++    N+F+Q
Sbjct  241  SDDSKYVSGNNLVIDGGVTVAT-PFNIFDQ  269



>ref|XP_011088939.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=270

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 203/270 (75%), Gaps = 12/270 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ------  282
            M ++SLL   AKRLEGKVA+ITGG G +GS TAK+F +HGAKVLIAD +DD+        
Sbjct  1    MATTSLLFAVAKRLEGKVALITGGAGSLGSVTAKLFHEHGAKVLIADVQDDKGHLVCQNL  60

Query  283  ----SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                + F+HCDVT+ESD++ AV  AVS HG+LDIM NNAGI+   + D+L+ + TDF  V
Sbjct  61   SPESASFIHCDVTNESDIRKAVETAVSIHGKLDIMFNNAGIVDPVIPDMLNYNQTDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAA  MK  +RGSIINTASV   +GG   H YT SKHAIVGLTKNTA
Sbjct  121  LRVNAVGAFLGTKHAACFMKQAKRGSIINTASVCSVIGGVATHGYTSSKHAIVGLTKNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDIAEAVLYLA  804
            ++LGRYGIRVNCVSPYA P+ M+R +F   EDD   D+ S+L+GV L  ED+AEAV+YLA
Sbjct  181  VELGRYGIRVNCVSPYAFPSAMSRGFFERDEDDPIDDIGSNLEGVSLKPEDVAEAVVYLA  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SDES+YVSGHNL+VD GF++ N AL +FN+
Sbjct  241  SDESRYVSGHNLIVDGGFTVMNSALTMFNK  270



>emb|CBI28276.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 218/301 (72%), Gaps = 20/301 (7%)
 Frame = +1

Query  88   VISSQEIDSRK-------MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAK  246
            + SS  ++ R+       MVSSSLLS  A+RLEGKVA+ITGG GGIGS TAK+F QHGAK
Sbjct  18   IFSSATLNPRRFYPEGEAMVSSSLLSAVARRLEGKVALITGGAGGIGSCTAKLFSQHGAK  77

Query  247  VLIADTRDDE----------SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGIL  396
            VLIAD +D++          S + F+HCDVT E DV +A+++AV+ HG+LDIM NNAGIL
Sbjct  78   VLIADIQDEKGHLICRDLGPSSASFIHCDVTKELDVSNAIDEAVAKHGKLDIMFNNAGIL  137

Query  397  GAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-P  573
            G K+ +ILD DA +F N   VN LGAFLGTKHAARVM P  RG +IN+ASV   +GG   
Sbjct  138  GPKIINILDNDAAEFENTMRVNVLGAFLGTKHAARVMVPAGRGCVINSASVCSVVGGICT  197

Query  574  HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSL  750
            H+Y  SKHAI+GLT+NTA++LG++GIRVNCVSPY VPT M+R +    +DD   DVYS+L
Sbjct  198  HSYVSSKHAILGLTRNTAVELGKFGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYSNL  257

Query  751  KGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSIS-NLALNLFNQ*IILYIFHMHY  927
            KGV LM +D+AEAVLYL SD+SKYVSG+NLV+D G + S +LAL      II Y+    Y
Sbjct  258  KGVALMPQDVAEAVLYLGSDDSKYVSGNNLVIDGGVTRSFSLALKKGKIKIIFYLILSLY  317

Query  928  I  930
            I
Sbjct  318  I  318



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 199/268 (74%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SL+S A +RLEGKVA+ITGG  GIG ATA++F +HGA+V+IAD +DD   S     
Sbjct  1    MASISLVSAALRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDDLGHSVCKDL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                FVHC+VT E +V++AVN AVS HG+LDIM NNAGI G   + IL+   ++F  VF 
Sbjct  61   ESASFVHCNVTKEDEVETAVNMAVSKHGKLDIMFNNAGISGNNNTSILNNTKSEFEQVFS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALD  633
            VN  GAFLGTKHAARVM P +RGSIINTAS +G + GG PH YT SKHA+VGL +NTA++
Sbjct  121  VNVSGAFLGTKHAARVMIPARRGSIINTASTSGVIGGGAPHPYTSSKHAVVGLMRNTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFD-VYSSLKGVDLMAEDIAEAVLYLASD  810
            L  YG+RVNCVSPY VPT M +++F L E+D+    YS+LKG DL+ ED+AEAVLYL SD
Sbjct  181  LEAYGVRVNCVSPYFVPTPMVKNFFKLGEEDEVPKFYSNLKGADLVPEDVAEAVLYLGSD  240

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLVVD GF++ N    +F Q
Sbjct  241  ESKYVSGHNLVVDGGFTVLNNGFCVFGQ  268



>gb|EYU26737.1| hypothetical protein MIMGU_mgv1a011831mg [Erythranthe guttata]
Length=269

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/268 (59%), Positives = 204/268 (76%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M ++SLLS  AKRLEGKVA+ITGG G +GSATAK+F +HGAK+LIAD +DD  +      
Sbjct  1    MANTSLLSAVAKRLEGKVALITGGAGRLGSATAKLFHEHGAKILIADVQDDLGRRICKTL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  ++HCD+T+ES V++AV +A+S HG+LDIM NNAG++G   +D+L    +DF  V
Sbjct  61   SPQTASYIHCDITNESHVENAVEEAISKHGKLDIMFNNAGVMGPTNTDMLVETKSDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAARVMKP  RG+IINTASV+  +GG   HAYT SKHA++GLT+NTA
Sbjct  121  LNVNITGTFLGTKHAARVMKPAHRGTIINTASVSSVIGGACTHAYTSSKHAVLGLTRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDIAEAVLYLA  804
            ++LGRYGIRVNCVSPYA  + M+R   G  +DD   D+YS+L G +L AED+A+AVLYLA
Sbjct  181  VELGRYGIRVNCVSPYAFASPMSRGALGRDKDDPMVDIYSNLDGSNLTAEDVAQAVLYLA  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            SDES+YVSG NLVVD GFS++N +L++F
Sbjct  241  SDESRYVSGSNLVVDGGFSVTNSSLSMF  268



>gb|AFK37606.1| unknown [Medicago truncatula]
 gb|KEH29818.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 197/269 (73%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S  L+S A +RLEGKVA+ITGG  GIG ATA++F  HGA+V+IAD +DD         
Sbjct  1    MTSVPLVSAALRRLEGKVALITGGASGIGEATARLFSNHGAQVVIADIQDDIGHSICQEL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             +S + +VHCDVT E D+++AVN  VS HG+LDIM NNAGI G   ++IL+   ++F  V
Sbjct  61   HKSSATYVHCDVTKEKDIENAVNTTVSKHGKLDIMFNNAGITGINKTNILENKLSEFQEV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLGTKHAARVM PV+RGSIINTASV G +GG   HAYT SKHA+VGL KNTA
Sbjct  121  IDINLTGVFLGTKHAARVMTPVRRGSIINTASVCGCIGGVASHAYTSSKHAVVGLMKNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG YGIRVNCVSPY V T +A+++F L +D   DVYS+LKG +L+ +D+AEA LYL S
Sbjct  181  IELGPYGIRVNCVSPYVVGTPLAKNFFKLDDDGVLDVYSNLKGANLLPKDVAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNLVVD G ++ N    +F Q
Sbjct  241  DESKYVSGHNLVVDGGLTVGNNGFCIFKQ  269



>ref|XP_011089208.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=278

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 203/278 (73%), Gaps = 20/278 (7%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDES-------  279
            M SSS+LS AAKRLEGKVA+ITGG GG+GS TAK+F +HGAKVLIAD RDD         
Sbjct  1    MPSSSVLSAAAKRLEGKVALITGGAGGLGSVTAKLFHEHGAKVLIADARDDRGHLICQNL  60

Query  280  ---QSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
               ++ F+HCDVTSESD+Q+AV  AVST+G+LDIM NNAGIL   + ++L+    DF +V
Sbjct  61   SPERASFIHCDVTSESDIQNAVETAVSTYGKLDIMFNNAGILDPVIPNVLNYSQADFEHV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-----FPHA----YTCSKHAI  603
              VN +GAFLGTKHAA  MK  +RGSIINT SV   +GG      P +    Y  SKHA+
Sbjct  121  LRVNVVGAFLGTKHAASFMKQAKRGSIINTGSVCSVIGGDDNKRDPRSRSDHYASSKHAV  180

Query  604  VGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDI  780
            +GLT+NTA++LGRYGIRVNCVSPY  P+ M+R   G  EDD   D+ S+L+GV L  ED+
Sbjct  181  LGLTRNTAVELGRYGIRVNCVSPYVFPSSMSRGLLGRDEDDPVDDIGSNLEGVSLKPEDV  240

Query  781  AEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            AEAV+YLASDES+Y+SGHNLVVD GF + N AL +FN+
Sbjct  241  AEAVVYLASDESRYMSGHNLVVDGGFGVMNSALTMFNK  278



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 198/267 (74%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SL+S A +RLEGKVA+ITGG  GIG +TA++F +HGAKV+IAD +D+   S     
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKEL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  F+HCDVT E DV++AVN AVS +G+LDIM NNAGI G   ++IL+ D  +F  +
Sbjct  61   EPEPASFIHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGIGGTPKTNILENDKAEFEKI  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAARVM P +RGSII TASV   +GG   HAYT SKH ++GLT+NTA
Sbjct  121  ICVNLVGAFLGTKHAARVMIPARRGSIITTASVCAIIGGGLSHAYTSSKHGVLGLTRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG YGIRVNCVSPYAVPT + +++F +++D+   +YS+LKG  L AEDIAEA LYL S
Sbjct  181  VELGHYGIRVNCVSPYAVPTPLFKNFFKMNDDELKCIYSNLKGAVLQAEDIAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKYVSGHNLVVD GF+I N    +F
Sbjct  241  DESKYVSGHNLVVDGGFTIVNRGFCIF  267



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 191/250 (76%), Gaps = 12/250 (5%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHC  300
            A+RLEGKVA+ITGG GGIGS TAK+FCQHGAKVLIAD + ++  S           FVHC
Sbjct  11   ARRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHC  70

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E DV +A++KA+S +G+LDIM NNAGILG    +ILD DA +F N   VN LG FL
Sbjct  71   DVTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFL  130

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            GTKHAARVM P  RGSIINTASV   +GG   H+YT SKHAI+GLT+NTA++LG++GIRV
Sbjct  131  GTKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRV  190

Query  658  NCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGH  834
            NCVSPY VPT ++R +  L EDD F  VYS+LKGV L  ED+AEAVLY+ SD+SKYVSGH
Sbjct  191  NCVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSDDSKYVSGH  250

Query  835  NLVVDAGFSI  864
            NLV+D G +I
Sbjct  251  NLVLDGGVTI  260



>ref|XP_003540812.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=269

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 160/268 (60%), Positives = 197/268 (74%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S SL+S   +RLEGKVAIITGG  GIG ATA++F +HGA V+IAD +DD         
Sbjct  1    MASVSLVSATGRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSICKHL  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCDVT+E+DV++ VN  VS HG+LDIM NNAGI G   + ILD   ++F  V 
Sbjct  61   ESASY-VHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEVI  119

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P +RGSI+NTASV G +GG   HAYT SKHA+VGLTKNTA+
Sbjct  120  NVNLVGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTAV  179

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG +G+RVNCVSPY V T +A+++F L +D    +YS+LKG DL+  D+AEA LYLASD
Sbjct  180  ELGAFGVRVNCVSPYVVATPLAKNFFKLDDDGVQGIYSNLKGTDLVPNDVAEAALYLASD  239

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLVVD GF++ N    +  Q
Sbjct  240  ESKYVSGHNLVVDGGFTVVNSGFCVLGQ  267



>ref|XP_006481514.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=276

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 196/274 (72%), Gaps = 16/274 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+S++S AA+RL+GKVA+ITGG G IG  TA++F +HGAKVLIAD +DD  +S     
Sbjct  1    MGSASIVSAAARRLQGKVALITGGAGSIGECTARLFSKHGAKVLIADIKDDLGESVCEDI  60

Query  289  -----------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDAT  435
                       +VHCDVT E D+++AVN AVS +G+LDIM NNAGI+     +ILD D  
Sbjct  61   SSSSSSANGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQA  120

Query  436  DFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGL  612
            +F  +  VN +GAFLGTKHAARVMKP  RGSII+TASV G +GG   HAYT SKH +VGL
Sbjct  121  EFERILSVNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVGL  180

Query  613  TKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAV  792
             KNTA++LGR+GIRVNCVSPYAV + MA+ +  L +D    +YS+L G  L  ED+AEA 
Sbjct  181  MKNTAVELGRFGIRVNCVSPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEAA  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            LYL SDESK VSGHNLVVD GF+I N  L +F +
Sbjct  241  LYLGSDESKCVSGHNLVVDGGFTIVNEGLCMFGK  274



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 197/271 (73%), Gaps = 11/271 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SL+S A +RLEGKVA+ITGG  GIG + A++F +HGAKV+IAD +D+   S     
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEEL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E DV++AVN AVS HG+LDIM NNAG++G+   +ILD D  +F  V
Sbjct  61   KNESASFVHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGVVGSPKPNILDNDKAEFEKV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAARVM P +RGSII+TASV G +GG   HAYT SKH ++GL +NTA
Sbjct  121  ISVNIVGAFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++GIRVNCVSPY V T +A+ +F L ++    VYS+LK   L AED+AEA L+L S
Sbjct  181  VELGQHGIRVNCVSPYLVSTPLAKDFFKLDDNKVNRVYSNLKEAVLKAEDVAEAALFLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ*I  900
            DESKYVSGHNL+VD GF+I N    +F Q I
Sbjct  241  DESKYVSGHNLIVDGGFTIVNPGFCMFPQSI  271



>ref|XP_004506207.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 195/269 (72%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +  L+ST+ KRLEGKVA+ITGG  GIG AT ++F +HGA+V+IAD +D+   S     
Sbjct  1    MATVPLISTSLKRLEGKVALITGGASGIGEATVRLFSKHGAQVVIADIQDEMGHSICKDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCD T E+DV++AVN  VS +G+LDIM NNAGI G   ++IL+   ++F  V
Sbjct  61   NNSSASFVHCDTTKETDVENAVNTTVSKYGKLDIMFNNAGISGVNKTNILENKLSEFEEV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHA+RVM P +RGSIINTASV G +GG  PHAYT SKHA++GL +NTA
Sbjct  121  IKVNLIGVFLGTKHASRVMIPARRGSIINTASVGGSIGGAAPHAYTSSKHAVLGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG YGIRVNCVSPY V T +A+ +  + ++    VYS+LKGV+L+ ED+AEA LYL S
Sbjct  181  VELGPYGIRVNCVSPYLVATPLAKKFLKIDDEGILAVYSNLKGVNLVPEDVAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNL+VD GF+  N    +F Q
Sbjct  241  DESKYVSGHNLIVDGGFTAGNSGFCIFGQ  269



>ref|XP_010262932.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=268

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 192/267 (72%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M SSS+LS   KRLEGKVA+ITGG  GIG +T ++FC+HGAKV+IAD +DD   S     
Sbjct  2    MGSSSVLSAVVKRLEGKVALITGGASGIGESTVRLFCRHGAKVVIADVQDDLGHSVCNDI  61

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT+ES ++ AV+  V+ +G+LDIM NNAGI+G    +ILD D  +F  V
Sbjct  62   GSKAASFVHCDVTNESHIRKAVDTTVAKYGKLDIMFNNAGIVGTPNPNILDNDKGEFEQV  121

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAARVM P +RGSII+TASV   +GG   HAYTCSKHA+VGLTKN A
Sbjct  122  LAVNITGPFLGTKHAARVMIPARRGSIISTASVCSLVGGVASHAYTCSKHAVVGLTKNAA  181

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++G+RVNCVSPY V T + + +F L E+    +YS+LKG  L  ED+AEAVLYL S
Sbjct  182  VELGKFGVRVNCVSPYLVVTPLTKKFFNLDENGSPGIYSNLKGRMLWPEDVAEAVLYLGS  241

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            D+S YVSGHNLVVD GF+I N A  + 
Sbjct  242  DDSLYVSGHNLVVDGGFTIVNPAFGII  268



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 200/261 (77%), Gaps = 11/261 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SLLST A+RLEGKVA+ITGG  GIG +TA+ F +HGAKV+IADT+D+ + S     
Sbjct  1    MGSVSLLSTVARRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  F+HCD+T E+DV++AVN A+S HG+LD+M NNAGI+G   ++++D   ++F  V
Sbjct  61   NSESASFIHCDITKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHAARVMKP ++GSII T+SV G +GGF  HAYT SKH ++GL +NTA
Sbjct  121  IRVNLVGPFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++GIRVNCVSPY V T+M+R++  +++D+    YS+LKG  L  ED+AEA LYLAS
Sbjct  181  VELGQFGIRVNCVSPYTVATEMSRNFLKMTDDEIRSGYSNLKGAILTPEDVAEAALYLAS  240

Query  808  DESKYVSGHNLVVDAGFSISN  870
            D+S+YVSGHNLVVD G++I N
Sbjct  241  DDSRYVSGHNLVVDGGYTIVN  261



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 195/268 (73%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S   +S AA+RL+GKVA+ITGG  GIG +TA++F +HGAKV+IAD +D+  QS     
Sbjct  1    MASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKEL  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   FVHCDVTSE DV++A+N AV+ +G+LDIM NNAGI+G    +ILD D T+F  
Sbjct  61   SSPTSASFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEK  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            +  VN +GAFLGTKHAARVM P   GSII TASV   +GG   HAYT SKHA+VGL +N 
Sbjct  121  ILNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNA  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A++LG+YGIRVNCVSPY V T +A+ +F L +D    VYS+LKG  L  ED+AEA LYLA
Sbjct  181  AVELGKYGIRVNCVSPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNPEDVAEAALYLA  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            S+ESKYVSGHNL++D GF+I N A  +F
Sbjct  241  SEESKYVSGHNLLIDGGFTIVNPAFGIF  268



>gb|KHN21175.1| Momilactone A synthase [Glycine soja]
Length=304

 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 189/261 (72%), Gaps = 15/261 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S SL+S   +RLEGKVAIITGG          +F +HGA V+IAD +DD         
Sbjct  1    MASVSLVSATGRRLEGKVAIITGGAEATAR----LFSKHGAHVVIADIQDDLGLSICKHL  56

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCDVT+E+DV++ VN  VS HG+LDIM NNAGI G   + ILD   ++F  V 
Sbjct  57   ESASY-VHCDVTNETDVENCVNTTVSKHGKLDIMFNNAGITGVNKTSILDNTKSEFEEVI  115

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P +RGSI+NTASV G +GG   HAYT SKHA+VGLTKNTA+
Sbjct  116  NVNLVGVFLGTKHAARVMIPARRGSIVNTASVCGSIGGVASHAYTSSKHAVVGLTKNTAV  175

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG +G+RVNCVSPY V T +A+++F L +D    +YS+LKG DL+  D+AEA LYLASD
Sbjct  176  ELGAFGVRVNCVSPYVVATPLAKNFFKLDDDGVQGIYSNLKGTDLVPNDVAEAALYLASD  235

Query  811  ESKYVSGHNLVVDAGFSISNL  873
            ESKYVSGHNLVVD GF++ N+
Sbjct  236  ESKYVSGHNLVVDGGFTVVNM  256



>ref|XP_008230130.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 192/265 (72%), Gaps = 11/265 (4%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF--------  288
            SLL+ AA+RLEGKVA+ITGG  GIG +TA++F +HGAKV+IAD +DD ++S         
Sbjct  7    SLLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDFAESVCRDLSPSS  66

Query  289  --FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVN  462
              FVHCDVT E DV++AV  A + +G LDIM NNAGI+G    +ILD D  +F  V  VN
Sbjct  67   TSFVHCDVTKEEDVENAVQTATNKYGELDIMFNNAGIIGTNKPNILDNDRVEFEQVIRVN  126

Query  463  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLG  639
             +GAFLG KHAARVM P  +GSIINTASV   +GG   HAYT SKH +VGL +NTA++LG
Sbjct  127  LVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAVELG  186

Query  640  RYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESK  819
            ++GIRVNCVSPY VPT +A+ +F L +D     YS+LKG  L AEDIAEA LYL SDESK
Sbjct  187  QHGIRVNCVSPYVVPTPLAKEFFKLDDDGVHGAYSNLKGGVLRAEDIAEAALYLGSDESK  246

Query  820  YVSGHNLVVDAGFSISNLALNLFNQ  894
            YVSGHNL+VD G++I N    +F Q
Sbjct  247  YVSGHNLLVDGGYTIVNAGFCMFEQ  271



>ref|XP_006424148.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37388.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=276

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 194/274 (71%), Gaps = 16/274 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+S++S AA+RL+GKVA+ITGG G IG   A++F +HGAKVLIAD +DD  +S     
Sbjct  1    MGSASIVSAAARRLQGKVALITGGAGSIGECAARLFSKHGAKVLIADIKDDLGESVCEDI  60

Query  289  -----------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDAT  435
                       +VHCDVT E D+++AVN AVS +G+LDIM NNAGI+     +ILD D  
Sbjct  61   SSSSSSANGCSYVHCDVTKEKDIENAVNTAVSQYGKLDIMFNNAGIVDEAKPNILDNDQA  120

Query  436  DFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGL  612
            +F  +  VN +GAFLGTKHAARVMKP  RGSII+TASV G +GG   HAYT SKH +VGL
Sbjct  121  EFERILSVNLVGAFLGTKHAARVMKPAGRGSIISTASVCGVIGGVTSHAYTSSKHGVVGL  180

Query  613  TKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAV  792
             KNTA++LGR+GIRVN VSPYAV + MA+ +  L +D    +YS+L G  L  ED+AEA 
Sbjct  181  MKNTAVELGRFGIRVNSVSPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEAA  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            LYL SDESK VSGHNLVVD GF+I N  L +F +
Sbjct  241  LYLGSDESKCVSGHNLVVDGGFTIVNEGLCMFGK  274



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 199/261 (76%), Gaps = 11/261 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SLLST A+RLEGKVA+ITGG  GIG +TA+ F +HGAKV+IADT+D+ + S     
Sbjct  1    MGSVSLLSTVARRLEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  F+HCDVT E+DV++AVN A+S HG+LD+M NNAGI+G   ++++D   ++F  V
Sbjct  61   NSESASFIHCDVTKETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAARVMKP ++GSII T+SV G +GGF  HAYT SKH ++GL +N A
Sbjct  121  IRVNLVGAFLGTKHAARVMKPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++GIRVNCVSPY V T+M+R++  +++D+    YS+LKG  L  ED+AEA LYLAS
Sbjct  181  VELGQFGIRVNCVSPYTVATEMSRNFLKMTDDEIRSGYSNLKGAILTPEDVAEAALYLAS  240

Query  808  DESKYVSGHNLVVDAGFSISN  870
            ++S+YVSGHNLVVD G +I N
Sbjct  241  EDSRYVSGHNLVVDGGHTIVN  261



>ref|XP_008229671.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 191/265 (72%), Gaps = 11/265 (4%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF--------  288
            SLL+ AA+RLEGKVA+ITGG  GIG + A++F +HGAKV+IAD +DD ++S         
Sbjct  7    SLLAAAARRLEGKVAVITGGASGIGESAARLFSKHGAKVVIADVQDDLAESVCRDLSPSS  66

Query  289  --FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVN  462
              FVHCDVT E DV++AV  A + +G+LDIM NNAG++G    +ILD D  +F  V  VN
Sbjct  67   TSFVHCDVTKEEDVENAVKTATNKYGKLDIMFNNAGVVGMTKPNILDNDKVEFEQVIRVN  126

Query  463  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLG  639
             +GAFLG KHAARVM P  +GSIINTASV   +GG  PHAYT SKH +VGL +NTA++LG
Sbjct  127  LVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCAPHAYTSSKHGLVGLVRNTAVELG  186

Query  640  RYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESK  819
            ++GIRVNCVSPY V T +A+ +F L +D     YS+LKG  L AEDI EA LYL SDESK
Sbjct  187  QHGIRVNCVSPYIVSTPLAKEFFKLDDDKLHGAYSNLKGGVLKAEDIVEAALYLGSDESK  246

Query  820  YVSGHNLVVDAGFSISNLALNLFNQ  894
            YVSGHNL+VD GF+I N    +F Q
Sbjct  247  YVSGHNLLVDGGFTIVNAGFCMFEQ  271



>ref|XP_009374964.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=270

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 191/269 (71%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + SL++ AA+RLEGKVA+ITGG  GIG +TA+VF +HGAKV+IAD +DD  +S     
Sbjct  1    MGTFSLVTAAARRLEGKVALITGGASGIGESTARVFSKHGAKVVIADVQDDLGESVCRDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E D+++AV  A S +G+LDIM NNAGI+G    +ILD    +F  V
Sbjct  61   NSSSASFVHCDVTKEEDIENAVKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLG KHAARVM P  +GSIINTASV   MGG   HAYT SKH +VGL KN A
Sbjct  121  IRVNLVGAFLGIKHAARVMIPAGQGSIINTASVCSTMGGIASHAYTSSKHGVVGLMKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG+YGIRVNCVSPY V T +A+ +F L +D    VYS+LKG  L  ED+AEA LYL S
Sbjct  181  VELGQYGIRVNCVSPYLVATPLAKHFFNLEDDGVHGVYSNLKGKVLRPEDVAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNL+VD GFSI N    +F +
Sbjct  241  DESKYVSGHNLLVDGGFSIVNPRFCMFEK  269



>ref|XP_007206815.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
 gb|EMJ08014.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
Length=272

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 191/265 (72%), Gaps = 11/265 (4%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQ  282
            SLL+ AA+RLEGKVA+ITGG  GIG +TA++F +HGAKV+IAD +DD           S 
Sbjct  7    SLLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDDLAESVCRDLSPSP  66

Query  283  SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVN  462
            + FVHCDVT E DV++AV    + +G LDIM NNAGI+G    +ILD D  +F  V  VN
Sbjct  67   TLFVHCDVTKEEDVENAVQTTTNKYGELDIMFNNAGIIGTNKPNILDNDKVEFEQVIRVN  126

Query  463  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLG  639
             +GAFLG KHAARVM P  +GSIINTASV   +GG   HAYT SKH +VGL +NTA++LG
Sbjct  127  LVGAFLGIKHAARVMIPAGKGSIINTASVCSTIGGCASHAYTSSKHGLVGLVRNTAVELG  186

Query  640  RYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESK  819
            ++GIRVNCVSPYAV T++A+ +F + +D     YS+LKG  L AEDIAEA LYL SDESK
Sbjct  187  QHGIRVNCVSPYAVATKLAKEFFKIDDDGVHGAYSNLKGRVLKAEDIAEAALYLGSDESK  246

Query  820  YVSGHNLVVDAGFSISNLALNLFNQ  894
            YVSGHNL+VD G++I N    +F Q
Sbjct  247  YVSGHNLLVDGGYTIMNAGFCMFEQ  271



>ref|XP_003538100.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN08820.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 194/267 (73%), Gaps = 9/267 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S S +S   +RLEGKVA+I+GG  GIG ATA++F +HGA V+IAD +DD   S     
Sbjct  1    MASISTVSVLDRRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT+E+DVQ+AVN A+S +G LDIM NNAGI+    + ILD    DF  V  
Sbjct  61   ESASYVHCDVTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERVIS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM P +RGSIINTASVAG F GG  HAYT SKHA++GL KNTA++
Sbjct  121  VNLVGPFLGTKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG++GIRVNC+SPY V T + +  F L ED   ++YS+LKGV L+  D+AEA LYLA DE
Sbjct  181  LGQFGIRVNCLSPYVVATPLTKKCFNLDEDRNGEIYSNLKGVHLVPNDVAEAALYLAGDE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SKYVSGHNLV+D GF+  N+  ++F Q
Sbjct  241  SKYVSGHNLVLDGGFTNLNVGFSVFGQ  267



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 196/269 (73%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SL+S A +RLEGKVA+ITGG  GIG +TA++F +HGAKV+IAD +D+   S     
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKEL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  F+HCDVT E DV++AVN AVS +G+LDIM NNAG  G   ++I++ D  +F  +
Sbjct  61   EPEPASFIHCDVTQEKDVENAVNTAVSKYGKLDIMFNNAGTGGTPKTNIIENDKAEFEKI  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  627
               N +GAFLGTKHAARVM P +RGSII TASV   +GG   HAYT SKH ++GL +NTA
Sbjct  121  ICANLVGAFLGTKHAARVMIPARRGSIITTASVCAIIGGGSSHAYTSSKHGVLGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG+YGIRVNCVSPYAVPT + +++F +++D+   +YS+LK   L AEDIAEA LYL S
Sbjct  181  VELGQYGIRVNCVSPYAVPTPLFKNFFKMNDDEVSCIYSNLKEAVLEAEDIAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNLVVD GF+I N    +F +
Sbjct  241  DESKYVSGHNLVVDGGFTIVNPGFCMFPR  269



>ref|XP_004506206.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 197/269 (73%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +  L+S + +RLEGKVA+ITGG  GIG ATA++F +HGA+V+IAD +D+         
Sbjct  1    MTTVPLVSASLRRLEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDEMGHSICKDL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             +S + +VHCD T E D+++AVN  VS +G+LDIM NNAGI+G   ++IL+   ++F  V
Sbjct  61   NKSTASYVHCDTTKEKDIENAVNTTVSKYGKLDIMFNNAGIVGVNKTNILENKLSEFEEV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHA+RVM P +RGSIINTASV G +GG   HA T SKHA++GL KNTA
Sbjct  121  IKVNLIGVFLGTKHASRVMIPARRGSIINTASVCGSIGGGASHACTSSKHAVLGLMKNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG YGIRVNCVSPY V T +A+ +F L ++    VYS+LKGV+L+ ED+AEA LYL S
Sbjct  181  VELGPYGIRVNCVSPYVVATPLAKKFFKLDDEGIQGVYSNLKGVNLVPEDVAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNLVVD GF++ N    +F Q
Sbjct  241  DESKYVSGHNLVVDGGFTVGNSGFCIFEQ  269



>ref|XP_010651861.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=267

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 193/267 (72%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S   +S AA+RL+GKVA+ITGG  GIG +TA++F +HGAKV+IAD +D+         
Sbjct  1    MASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGLSVCKDL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              + + FVHCDVT+E +V++AVN AV+THG+LDIM NNAGI G     ILD D T+F  V
Sbjct  61   SPTSASFVHCDVTNEKEVENAVNLAVATHGKLDIMFNNAGIAGEAKPHILDNDKTEFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAARVM P   GSII TASV   +GG   HAYT SKHA+VGL +N A
Sbjct  121  LNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGGASHAYTSSKHAVVGLARNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG+YGIRVNCVSPY V T +A+  F L +D    VYS+LKG  L AED+AEA LYLA 
Sbjct  181  VELGKYGIRVNCVSPYLVATPLAKDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAG  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKYVSGHNL+VD GF++ N +  +F
Sbjct  241  DESKYVSGHNLLVDGGFTVVNPSFGIF  267



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 171/237 (72%), Gaps = 11/237 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD +D+   S           FVHCDVT E DV++AVN AVS HG+LDI
Sbjct  69   LFAKHGAKVVIADVQDELGHSVCEELKTESASFVHCDVTQEKDVENAVNTAVSKHGKLDI  128

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI+G    +ILD D  +F  V  VN +GAFLGTKHAARVM PV+RGSII+TASV 
Sbjct  129  MFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGTKHAARVMIPVRRGSIISTASVC  188

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
            G +GG   HAYT SKH ++GL +NTA++LG++GIRVNCVSPY V T + + +F L +D+ 
Sbjct  189  GTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNCVSPYVVLTPLVKDFFKLDDDEV  248

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ*I  900
              +YS+LK   L AEDIAEA L+L SDESKYVSGHNL+VD GF+I N    +F Q I
Sbjct  249  NRLYSNLKEAVLKAEDIAEAALFLGSDESKYVSGHNLIVDGGFTIVNPGFCMFPQSI  305



>ref|XP_006481516.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 153/274 (56%), Positives = 195/274 (71%), Gaps = 16/274 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+S++S AA+RL+GKVA+ITGG  GIG  TA++F +HGAKVLIAD +DD  +S     
Sbjct  1    MGSASVVSAAARRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDI  60

Query  289  -----------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDAT  435
                       +VHCDVT E D+++AVN AV+ +G+LDIM NNAG +     +ILD D  
Sbjct  61   GSSSSSASGCSYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQA  120

Query  436  DFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGL  612
            +F  +  +N +GAFLGTKHAARVMKP  RGSII+TASV G +GG   HAY  SKH ++GL
Sbjct  121  EFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGL  180

Query  613  TKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAV  792
             KNTA++LGR+GIRVNCVSPY V T +A+ +  L++D    +YS+LKG  L  EDIAEA 
Sbjct  181  MKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAA  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            LYL SDESK VSGHNLVVD GF+I N   ++F +
Sbjct  241  LYLGSDESKCVSGHNLVVDGGFAIVNAGFSVFGK  274



>ref|XP_006481515.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=273

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 168/240 (70%), Gaps = 16/240 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------------FVHCDVTSESDVQSAVNKAVSTH  357
            +F +HGAKVLIAD +DD  +S                +VHCDVT E D+++AVN AVS +
Sbjct  32   LFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVSQY  91

Query  358  GRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIIN  537
            G+LDIM NNAGI+     +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSII+
Sbjct  92   GKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSIIS  151

Query  538  TASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGL  714
            TASV G +GG   HAYT SKH +VGL KNTA++LGR+GIRVNCVSPYAV + MA+ +  L
Sbjct  152  TASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNCVSPYAVSSPMAKGFLKL  211

Query  715  SEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             +D    +YS+L G  L  ED+AEA LYL SDESK VSGHNLVVD GF+I N  L +F +
Sbjct  212  DDDGMSGIYSNLSGAVLKPEDVAEAALYLGSDESKCVSGHNLVVDGGFTIVNEGLCMFGK  271



>ref|XP_008229660.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=270

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 192/269 (71%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + SLL+ AA+RLEGKVA+ITGG  GIG +TA++F +HGA+V+IAD +DD ++S     
Sbjct  1    MGNFSLLAAAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDDLAESVCRDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E DV++AV  A   +G+LDIM NNAG  G    +ILD D  +F  V
Sbjct  61   SSSSTSFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGIAKPNILDNDKAEFEQV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLG KHAARVM P  +GSIINTASV   +GG   HAYT SKH IVGL +NTA
Sbjct  121  IRVNLVGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLVRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++GIRVNCVSPY V T +A+++F L +D     YS+LKG  L AEDIA+A LYL S
Sbjct  181  VELGQHGIRVNCVSPYIVATPLAKNFFKLDDDGVHGAYSNLKGAVLKAEDIAQAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNLVVD GF+I N    +F Q
Sbjct  241  DESKYVSGHNLVVDGGFTIVNPRFCMFEQ  269



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 193/269 (72%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + SLL+ AA+RLEGKVA+ITGG  GIG +TA++F +HGAKV+IAD +D+ ++S     
Sbjct  1    MGNFSLLAAAARRLEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDNLAESICRDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E DV++AV  A S +G+LDIM NNAGI G   ++ILD D  +F  V
Sbjct  61   SSSSTSFVHCDVTKEEDVENAVKTATSKYGKLDIMFNNAGIAGIAKTNILDNDKAEFEQV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +G FLG KHAARVM P  +GSIINTAS    +GG   HAYT SKH ++GL +NTA
Sbjct  121  IGVNLVGVFLGIKHAARVMIPAGQGSIINTASACSTIGGCASHAYTSSKHGVLGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++GIRVNCVSPY V T +A+ +F L +D    VYS+LKG  L AEDIAEA LYL S
Sbjct  181  IELGQHGIRVNCVSPYIVATPLAKDFFKLDDDGVHGVYSNLKGGVLKAEDIAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNL+VD GF+I N    +F Q
Sbjct  241  DESKYVSGHNLLVDGGFTIVNARFCIFEQ  269



>ref|XP_002523859.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38585.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=272

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 191/272 (70%), Gaps = 12/272 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + SLLS A +RLEGKVA+ITG   GIG   A++F +HGA ++IAD +D+   S     
Sbjct  1    MSTLSLLSGALRRLEGKVALITGAASGIGECAARLFSKHGANLVIADVQDELGHSVCREL  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   ++HC+VT E DV++AVN AVS +G+LDIM NNAG++G    +ILD D  +F  
Sbjct  61   DSPSSVSYIHCNVTREEDVENAVNTAVSKYGKLDIMFNNAGVVGIAKPNILDNDKAEFEK  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            +  VN +GAFLGTKHAARVM P ++GSIINTASV   +GG   HAYT SKH +VGLT+NT
Sbjct  121  IISVNLVGAFLGTKHAARVMIPNRKGSIINTASVCSIIGGVASHAYTSSKHGVVGLTRNT  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A++LGR+GIRVNCVSPY V T +A+ +F L +D  + VYS LK   L  ED+AEA LYL 
Sbjct  181  AVELGRHGIRVNCVSPYLVATPLAKDFFKLDDDGVYRVYSVLKEAVLGPEDVAEAALYLG  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLFNQ*I  900
            SDESKYVSGHNLVVD GF+  N    +F Q I
Sbjct  241  SDESKYVSGHNLVVDGGFTKVNPGFCMFPQSI  272



>ref|XP_010049792.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 188/267 (70%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + +LLS AA+RLEGKVA+ITGG GGIG +TA++F +HGA+V+IAD RDD  +S     
Sbjct  1    MATGALLSQAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGKSVCKDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+SESD+++A+  AV  HG+LDIMVNNA I     + ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDIKNAIATAVDKHGKLDIMVNNAAIGDPSKASILDNDKADFEKV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAAR M P QRGSIIN  SV   +GG   HAYT SKHA++GLT+N A
Sbjct  121  VSVNLTGVFLGTKHAARAMIPSQRGSIINLGSVCSSVGGVASHAYTSSKHAVLGLTRNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGRYG+R+NC+SPY + T + ++ F + ED    VYS++ GV L  ED+AEA LYL S
Sbjct  181  AELGRYGVRINCLSPYFILTPLTKAIFQIDEDAGVRVYSNMDGVTLRQEDVAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKYVSGHNL VD GF+  N A  LF
Sbjct  241  DESKYVSGHNLAVDGGFTTINPAFGLF  267



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 194/272 (71%), Gaps = 13/272 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S SL+S A +RLEGKVA+ITGG  GIG + A++F +HGAKV+IAD +D+         
Sbjct  1    MGSVSLVSAALRRLEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHFVCEEL  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
              ES SF VHCDVT E DV++AVN AVS HG+LDIM NNAG       +ILD D  +F  
Sbjct  61   KNESASF-VHCDVTQEKDVENAVNTAVSKHGKLDIMFNNAGAADTPKPNILDNDKAEFEK  119

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  VN +GAFLGTKHAARVM P +RGSII+TASV G +GG   HAYT SKH ++GL +NT
Sbjct  120  VLSVNIVGAFLGTKHAARVMIPARRGSIISTASVCGTIGGVASHAYTSSKHGVIGLMRNT  179

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A++LG++GIRVNCVSPY V T + + +F L +++    YS+L+   L AEDIAEA L+L 
Sbjct  180  AVELGQHGIRVNCVSPYVVLTPLVKDFFKLDDNEVNRFYSNLREAVLKAEDIAEAALFLG  239

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLFNQ*I  900
            SDESKYVSGHNL+VD GF+I N    +F Q I
Sbjct  240  SDESKYVSGHNLIVDGGFTIVNPGFCMFPQSI  271



>ref|XP_006481517.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 192/274 (70%), Gaps = 16/274 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+S++S AA+RL GKVA+ITGG  G G  TA++F +HGAKVLIAD +DD  +S     
Sbjct  1    MGSASIVSAAARRLLGKVALITGGASGFGECTARLFSRHGAKVLIADIKDDLGESVCKDI  60

Query  289  -----------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDAT  435
                       +VHCDVT E ++++AVN AVS +G+LDIM NNAGI+     +ILD D  
Sbjct  61   GSSSSSANGCSYVHCDVTKEKEIENAVNTAVSQYGKLDIMFNNAGIVDEAKHNILDNDQA  120

Query  436  DFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGL  612
            +F  V  VN +G FLGTKHAARVMKP  RGSII+TASV G +GG   HAYT SKH +VGL
Sbjct  121  EFELVLSVNLVGVFLGTKHAARVMKPAGRGSIISTASVCGVIGGVASHAYTSSKHGVVGL  180

Query  613  TKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAV  792
             KN A++LGR+GIRVNCVSPY V T +A+ ++ L +D    +YS+L G  L  ED+AEA 
Sbjct  181  MKNAAVELGRFGIRVNCVSPYVVATPLAKDFYKLDDDGLSAIYSNLSGAVLKPEDVAEAA  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            LYL SDESK VSGHNLVVD GF+I N  L +F +
Sbjct  241  LYLGSDESKCVSGHNLVVDGGFTIVNEGLCMFGK  274



>ref|XP_009411944.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 196/272 (72%), Gaps = 15/272 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + S L   AK+LEGKVA+ITGG  GIG  TAK+FC+HGAKV++AD +D+   +     
Sbjct  1    MATCSDLPADAKKLEGKVALITGGASGIGECTAKLFCRHGAKVVVADVQDELGTAVCSGL  60

Query  289  -----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
                 F+HCDVTSE DV +AV+ AV+  GRLDIM NNAGI GA   +IL C+ +DF  V 
Sbjct  61   GPAASFIHCDVTSEDDVSAAVDHAVAKFGRLDIMFNNAGITGAACHNILQCEKSDFERVV  120

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P ++GSII T+S+AG +G    HAYTCSKHA+VGLTKN A 
Sbjct  121  GVNLVGPFLGTKHAARVMIPARKGSIITTSSLAGVIGAAAAHAYTCSKHAVVGLTKNAAA  180

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDV----YSSLKGVDLMAEDIAEAVLY  798
            +LG++G+RVNCVSP A  T +A  Y GL E + FD+     ++LKGV L  ED+A+AVLY
Sbjct  181  ELGQFGVRVNCVSPAAAATPLAMRYVGL-EGEAFDMAMTAVANLKGVSLGTEDVADAVLY  239

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            LASD+SKYVSGHNLV+D G S++  + NLF +
Sbjct  240  LASDDSKYVSGHNLVLDGGCSVAYPSFNLFKR  271



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 196/267 (73%), Gaps = 9/267 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + S +S   +RLEGKVAIITGG  GIG ATA++F +HGA V+IAD +DD   S     
Sbjct  1    MATVSAVSAPIRRLEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E DV++ VN AVS +G+LDIM+NNAGI     + ILD + +DF +V  
Sbjct  61   ESASYVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVIS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM   +RGSIINTASVAG +GG   HAYT SKHA++GL K+TA++
Sbjct  121  VNLVGPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG++GIRVNCVSPY VPT + + +  + E+   ++YS+LKGV L+  D+AEA LYLA DE
Sbjct  181  LGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGDE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SKYVSGHNLV+D G++  N+  ++F+Q
Sbjct  241  SKYVSGHNLVLDGGYTDVNIGFSVFDQ  267



>ref|XP_010246229.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=274

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 192/269 (71%), Gaps = 13/269 (5%)
 Frame = +1

Query  127  SSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------E  276
            SSS+LS  A+RLE KVA++T G  G+G + AK+F QHGAKV+IAD +D+           
Sbjct  4    SSSILSAVARRLEAKVALVTDGASGLGRSCAKLFSQHGAKVVIADIQDELGHSVCKELGP  63

Query  277  SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
            S + F+HCDVT+ESDV++AVN AV+ HG+LDIM+ NAGI+G+   +IL  D  DF  V  
Sbjct  64   SSASFIHCDVTNESDVENAVNGAVARHGKLDIMLINAGIIGSPTVNILANDRGDFQQVLN  123

Query  457  VNTLGAFLGTKHAARVMKPVQ-RGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  630
            VN +G FLGTKHAARVM      GSIIN AS+   +GG  PHAYT SKHA++GLT+NTA+
Sbjct  124  VNVIGPFLGTKHAARVMILANGGGSIINMASICSIIGGATPHAYTSSKHAVLGLTRNTAV  183

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDIAEAVLYLAS  807
            +LGR+GIRVNC+SPYAV T  +R +  L ED    D YS+LKGV L  ED+AEA LYL S
Sbjct  184  ELGRFGIRVNCISPYAVATPQSRKFLKLEEDAAIVDAYSNLKGVALKPEDVAEAALYLGS  243

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ++S YVSGHNLV+D  F++ N    +F+Q
Sbjct  244  EDSSYVSGHNLVLDGAFTVLNQGFCMFDQ  272



>ref|XP_009340877.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=263

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 164/235 (70%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSFF----------VHCDVTSESDVQSAVNKAVSTHGRLDI  372
            VF +HGAKV+IAD +DD  +S F          VHCDVT E D+++AV  A S +G+LDI
Sbjct  28   VFSKHGAKVVIADVQDDLGESVFRDLNSSSASFVHCDVTKEEDIENAVKTATSKYGKLDI  87

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G    +ILD D  +F  V  VN +G+FLG KHAARVM P  +GSIINTASV 
Sbjct  88   MFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGIKHAARVMIPAGQGSIINTASVC  147

Query  553  GFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG  PHAYT SKH +VGL KN A++LG+YGIRVNCVSPY V T +A+ +F L +D  
Sbjct  148  STIGGGAPHAYTSSKHGVVGLMKNAAVELGQYGIRVNCVSPYLVATPLAKDFFNLDDDGV  207

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
              VYS+LKG  L  ED+AEA LYL SDESKYVSGHNL+VD GFSI N    +F +
Sbjct  208  HGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLLVDGGFSIVNPRFCMFEK  262



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 195/267 (73%), Gaps = 9/267 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + S +S   +RLEGKVAIITGG  GIG ATA++F +HGA ++IAD +DD   S     
Sbjct  1    MATVSAVSAPIRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E DV++ VN AVS +G+LDIM+NNAGI     + ILD + +DF +V  
Sbjct  61   ESASYVHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVIS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM   +RGSIINTASVAG +GG   HAYT SKHA++GL K+TA++
Sbjct  121  VNLVGPFLGTKHAARVMIAAKRGSIINTASVAGILGGVATHAYTSSKHALIGLMKSTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG++GIRVNCVSPY VPT + + +  + E+   ++YS+LKGV L+  D+AEA LYLA DE
Sbjct  181  LGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGDE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SKYVSGHNLV+D G++  N+  ++F Q
Sbjct  241  SKYVSGHNLVLDGGYTDVNIGFSVFGQ  267



>ref|XP_006424147.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37387.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=273

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 167/240 (70%), Gaps = 16/240 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------------FVHCDVTSESDVQSAVNKAVSTH  357
            +F +HGAKVLIAD +DD  +S                +VHCDVT E D+++AVN AVS +
Sbjct  32   LFSKHGAKVLIADIKDDLGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVSQY  91

Query  358  GRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIIN  537
            G+LDIM NNAGI+     +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSII+
Sbjct  92   GKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSIIS  151

Query  538  TASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGL  714
            TASV G +GG   HAYT SKH +VGL KNTA++LGR+GIRVN VSPYAV + MA+ +  L
Sbjct  152  TASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNSVSPYAVSSPMAKGFLKL  211

Query  715  SEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             +D    +YS+L G  L  ED+AEA LYL SDESK VSGHNLVVD GF+I N  L +F +
Sbjct  212  DDDGMSGIYSNLSGAVLKPEDVAEAALYLGSDESKCVSGHNLVVDGGFTIVNEGLCMFGK  271



>gb|KDP26161.1| hypothetical protein JCGZ_22863 [Jatropha curcas]
Length=270

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 189/260 (73%), Gaps = 13/260 (5%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF------------FVH  297
            +RLEGKVA+ITG   GIG  TA++F +HGA+V+IAD +D+   S             FVH
Sbjct  9    RRLEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSVRKEIDRDGKYCSFVH  68

Query  298  CDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAF  477
            CDVT E DV++AVN AVS +G LDIM NNAGI+GA   +ILD +  +F  +  VN +GAF
Sbjct  69   CDVTKEEDVENAVNSAVSKYGELDIMFNNAGIVGAVKPNILDNEKAEFEKIISVNLVGAF  128

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIR  654
            LGTKHAARVM P ++GSI+ TASVA  +GG  PHAYT SKH +VGL +NTA++LG++GIR
Sbjct  129  LGTKHAARVMIPNRKGSIMTTASVASTIGGLAPHAYTSSKHGVVGLMRNTAVELGQHGIR  188

Query  655  VNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGH  834
            VNC+SPY V T +AR +F L +   +DVYS+LK   L  ED+A+A LYL SD+SKY+SGH
Sbjct  189  VNCISPYVVNTPLARDFFKLDDHGVYDVYSNLKEAVLEPEDVAQAALYLGSDDSKYISGH  248

Query  835  NLVVDAGFSISNLALNLFNQ  894
            N+++D GF+I N A ++F Q
Sbjct  249  NMIIDGGFTIVNPAFSIFPQ  268



>ref|XP_003546632.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=269

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 196/268 (73%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S +S   +RLEGKVAIITGG  G+G+ATA++F +HGA V+IAD +DD         
Sbjct  1    MASVSSVSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCD T+E+DV++ VN AVS +G+LDIM NNAGI+    + I+D   +DF  V 
Sbjct  61   ESASY-VHCDATNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVI  119

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P ++G IINTASVAG +GG   HAYT SKHA++GLTKNTA+
Sbjct  120  GVNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAV  179

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG++GIRVNC+SPY V T +++ YF + ED   ++YS+LKG  L+  D+AEA LYLA D
Sbjct  180  ELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGD  239

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLV+D G++  N    +F Q
Sbjct  240  ESKYVSGHNLVIDGGYTDVNAGFTVFGQ  267



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 199/268 (74%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S+S +S   +RLEGKVAIITGG  GIG ATA++F +HGA ++IAD +DD         
Sbjct  70   MASASAVSAHVRRLEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHL  129

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCDVT E DV++ VN AVS +G+LDIM+NNAGI     + ILD + +DF +V 
Sbjct  130  ESASY-VHCDVTKEEDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVI  188

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM   +RGSIINTASVAG +GG   HAYT SKHA++GL K+TA+
Sbjct  189  SVNLVGPFLGTKHAARVMIAAKRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAV  248

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG++GIRVNCVSPY VPT + + +  + E+   ++YS+LKGV L+  D+AEA LYLA D
Sbjct  249  ELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  308

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLV+D G++  N+  ++F+Q
Sbjct  309  ESKYVSGHNLVLDGGYTDVNIGFSVFDQ  336



>gb|KHN11533.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 197/268 (74%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S +S   +RL+GKVAIITGG  G+G+ATA++F +HGA V+IAD +DD         
Sbjct  1    MASVSSVSAPFRRLDGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCDVT+E+DV++ VN AVS +G+LDIM NNAGI+    + I+D   +DF  V 
Sbjct  61   ESASY-VHCDVTNENDVENCVNTAVSKYGKLDIMFNNAGIIDEIKTSIVDNSKSDFERVI  119

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P ++G IINTASVAG +GG   HAYT SKHA++GLTKNTA+
Sbjct  120  GVNLVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAV  179

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG++GIRVNC+SPY V T +++ YF + ED   ++YS+LKG  L+  D+AEA LYLA D
Sbjct  180  ELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGD  239

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLV+D G++  N    +F Q
Sbjct  240  ESKYVSGHNLVIDGGYTDVNAGFTVFGQ  267



>emb|CBI28275.3| unnamed protein product [Vitis vinifera]
Length=861

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 189/248 (76%), Gaps = 12/248 (5%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHC  300
            A+RLEGKVA+ITGG GGIGS TAK+FCQHGAKVLIAD + ++  S           FVHC
Sbjct  11   ARRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHC  70

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E DV +A++KA+S +G+LDIM NNAGILG    +ILD DA +F N   VN LG FL
Sbjct  71   DVTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFL  130

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            GTKHAARVM P  RGSIINTASV   +GG   H+YT SKHAI+GLT+NTA++LG++GIRV
Sbjct  131  GTKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRV  190

Query  658  NCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGH  834
            NCVSPY VPT ++R +  L EDD F  VYS+LKGV L  ED+AEAVLY+ SD+SKYVSGH
Sbjct  191  NCVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSDDSKYVSGH  250

Query  835  NLVVDAGF  858
            NLV+D  F
Sbjct  251  NLVLDGSF  258


 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 195/268 (73%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S   +S AA+RL+GKVA+ITGG  GIG +TA++F +HGAKV+IAD +D+  QS     
Sbjct  594  MASIPQISAAARRLQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKEL  653

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   FVHCDVTSE DV++A+N AV+ +G+LDIM NNAGI+G    +ILD D T+F  
Sbjct  654  SSPTSASFVHCDVTSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEK  713

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            +  VN +GAFLGTKHAARVM P   GSII TASV   +GG   HAYT SKHA+VGL +N 
Sbjct  714  ILNVNVVGAFLGTKHAARVMIPAGNGSIITTASVCSTVGGVASHAYTSSKHAVVGLARNA  773

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A++LG+YGIRVNCVSPY V T +A+ +F L +D    VYS+LKG  L  ED+AEA LYLA
Sbjct  774  AVELGKYGIRVNCVSPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNPEDVAEAALYLA  833

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            S+ESKYVSGHNL++D GF+I N A  +F
Sbjct  834  SEESKYVSGHNLLIDGGFTIVNPAFGIF  861


 Score =   260 bits (664),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 164/227 (72%), Gaps = 11/227 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD +D+           + + FVHCDVT+E +V++AVN AV+THG+LDI
Sbjct  306  LFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKLDI  365

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TASV 
Sbjct  366  MFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTASVC  425

Query  553  GFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYT SKHA+VGL +N A++LG+YGIRVNCVSPY V T +A+  F L +D  
Sbjct  426  STVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCVSPYLVATPLAKDLFKLDDDGV  485

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISN  870
              VYS+LKG  L AED+AEA LYLA DESKYVSGHNL+VD GF++ N
Sbjct  486  SGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLLVDGGFTVVN  532



>ref|XP_009340879.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=273

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 164/235 (70%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            VF +HGAKV+IAD +DD  +S           FVHCDVT E D+++AV  A S +G+LDI
Sbjct  38   VFSKHGAKVVIADVQDDLGESVCTDLNSSSVSFVHCDVTKEEDIENAVKTATSKYGKLDI  97

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G    +ILD D  +F  V  VN +G+FLGTKHAARVM P  +GSIINTASV 
Sbjct  98   MFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGTKHAARVMIPAGQGSIINTASVC  157

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYT SKH +VGL KN A++LG+YGIRVNCVSPY V T +A+ +F L +D  
Sbjct  158  STIGGGSSHAYTSSKHGVVGLMKNAAVELGQYGIRVNCVSPYLVATPLAKDFFNLDDDGV  217

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
              VYS+LKG  L  ED+AEA LYL SDESKYVSGHNL+VD GFSI N    +F +
Sbjct  218  HGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLLVDGGFSIVNPMFCMFEK  272



>ref|XP_007132471.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
 gb|ESW04465.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
Length=269

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 191/268 (71%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +  L+S A KRLEGKVA+ITGG  GIG ATA++F +HGA V+IAD +D          
Sbjct  1    MATLPLISAAGKRLEGKVAMITGGASGIGEATARLFSKHGAHVVIADIQDHLGLSLSKEL  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ +HCDVT+E  V++AVN  VS HG+LD M NNAGI GA  + ILD   ++F  V 
Sbjct  61   ESASY-IHCDVTNEDHVENAVNTVVSKHGKLDTMFNNAGITGANKTSILDNTKSEFEAVI  119

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P  RGSI+NTASV G +GG   HAYT SKH +VGLT+NTA+
Sbjct  120  NVNLVGVFLGTKHAARVMIPAGRGSIVNTASVCGSIGGVASHAYTSSKHGVVGLTRNTAV  179

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG +G+RVNCVSPY V T +A+++F L +     VY++LKG  L  +D+AEA LYLASD
Sbjct  180  ELGAFGVRVNCVSPYVVATPLAKNFFKLDDKGVHGVYTNLKGAVLEPKDVAEAALYLASD  239

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLVVD  F++ N    +F Q
Sbjct  240  ESKYVSGHNLVVDGAFTVVNNGFCVFGQ  267



>gb|KEH29817.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 192/258 (74%), Gaps = 11/258 (4%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDE----------SQSFFVHCD  303
            +RLEGKVA+ITGG  GIG ATA++F +HGA+V+IAD +DD+          S + +VHCD
Sbjct  12   RRLEGKVALITGGASGIGEATARLFTEHGAQVIIADIQDDKGYSVCKDLHKSSASYVHCD  71

Query  304  VTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLG  483
            VT E D+++AVN  +S +G+LDIM NNAGI+GA  ++IL+   ++F  V  VN +G FLG
Sbjct  72   VTKEKDIENAVNTTISMYGKLDIMFNNAGIVGANKTNILEYKLSEFEEVINVNLVGVFLG  131

Query  484  TKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVN  660
            TKHA+RVM P +RGSIINTASV G +GG   HAYT SKHA++GL +NTA++LG + IRVN
Sbjct  132  TKHASRVMIPARRGSIINTASVCGSIGGMASHAYTSSKHAVLGLMRNTAIELGPFSIRVN  191

Query  661  CVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNL  840
            CVSPY V T MA+++  L ++    +YS+LKG +L+ +D+AEA LYL SDESKYVSGHNL
Sbjct  192  CVSPYIVATPMAKNFLKLDDEGLLGLYSNLKGTNLVPKDVAEASLYLGSDESKYVSGHNL  251

Query  841  VVDAGFSISNLALNLFNQ  894
            VVD   S+SN   ++F Q
Sbjct  252  VVDGAVSVSNNGFSVFGQ  269



>emb|CDP06868.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 192/272 (71%), Gaps = 21/272 (8%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M + ++ S   KRL+GKVA+ITG   GIG + A++F +HGAKV+IAD +DD         
Sbjct  1    MANMAIASNIMKRLQGKVALITGAASGIGESAARLFVKHGAKVVIADIQDDLAKKVCQDL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S +  VHCD T ESD+++AVN  VS +G+LDIM NNAGI G+  S+ILD   +DF  V
Sbjct  61   DPSSASHVHCDTTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHAARVM P + GSIINTAS    + GG PHAY  SKHA+VGLT+NTA
Sbjct  121  ISVNLVGVFLGTKHAARVMIPNRCGSIINTASSCSTLGGGAPHAYVSSKHAVVGLTRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMA-----RSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAV  792
            +DLGRYGIRVNC+SPY VPT +A     R Y G+S+     VY  L G +L AED+A+A 
Sbjct  181  IDLGRYGIRVNCLSPYYVPTPLAADVVERIYGGVSK-----VYKFLDGAELKAEDVADAA  235

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LYLASD+SKYVSGHNLVVD G+SI N A+ +F
Sbjct  236  LYLASDDSKYVSGHNLVVDGGYSIVNSAVCMF  267



>ref|XP_010651860.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=288

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 167/233 (72%), Gaps = 11/233 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD +D+           + + FVHCDVT+E +V++AVN AV+THG+LDI
Sbjct  56   LFSRHGAKVVIADIQDNLGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKLDI  115

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TASV 
Sbjct  116  MFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTASVC  175

Query  553  GFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYT SKHA+VGL +N A++LG+YGIRVNCVSPY V T +A+  F L +D  
Sbjct  176  STVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCVSPYLVATPLAKDLFKLDDDGV  235

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
              VYS+LKG  L AED+AEA LYLA DESKYVSGHNL+VD GF++ N +  +F
Sbjct  236  SGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLLVDGGFTVVNPSFGIF  288



>ref|XP_007207105.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
 gb|EMJ08304.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
Length=270

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/269 (57%), Positives = 190/269 (71%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S SLL+ AA+RLEGKVA+ITGG  GIG +TA++F +HGA+V+IAD +D  ++S     
Sbjct  1    MGSFSLLAAAARRLEGKVALITGGASGIGESTARLFSKHGARVVIADVQDGLAESVCRDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E DV++AV  A   +G+LDIM NNAG  G    +ILD D  +F  V
Sbjct  61   SSSSISFVHCDVTKEEDVENAVKTATRKYGKLDIMFNNAGTGGVAKPNILDNDKAEFEQV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLG KHAARVM P  +GSIINTASV   +GG   HAYT SKH IVGL +NTA
Sbjct  121  IRVNLIGAFLGIKHAARVMIPAGQGSIINTASVCSTIGGGSSHAYTSSKHGIVGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++LG++GIRVNCVSPY V T +A+++F L ++     YS+LKG  L  EDIAEA LYL S
Sbjct  181  VELGQHGIRVNCVSPYIVATPLAKNFFKLDDNGVHGAYSNLKGGVLKVEDIAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNL+VD GF+I N    +F Q
Sbjct  241  DESKYVSGHNLLVDGGFTIVNPRFCMFEQ  269



>gb|ACU18273.1| unknown [Glycine max]
Length=269

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 192/268 (72%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S +S   +RLEGKVA+I+GG  GIG ATA++F +HGA V+IAD +DD         
Sbjct  1    MASISTVSVLDRRLEGKVALISGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHL  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCDVT+E+DVQ+AVN A+S +G LDIM NNAGI+    + ILD    DF  V 
Sbjct  61   ESASY-VHCDVTNENDVQNAVNTAISKYGNLDIMFNNAGIIDEIKTSILDNSKFDFERVI  119

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNTAL  630
             VN +G FLGTKHAARVM P +RGSIINTASVAG F GG  HAYT SKHA++GL KNTA+
Sbjct  120  SVNLVGPFLGTKHAARVMIPAKRGSIINTASVAGTFSGGASHAYTSSKHALIGLMKNTAV  179

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG++GIRVNC+SPY V T + +  F L ED   ++YS+LK V L+  D+AEA LYLA D
Sbjct  180  ELGQFGIRVNCLSPYVVATPLTKKCFNLDEDRNGEIYSNLKSVHLVPNDVAEAALYLAGD  239

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSG N V+D GF+  N+   +F Q
Sbjct  240  ESKYVSGPNFVLDGGFTNLNVGFFVFGQ  267



>ref|XP_007132475.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
 gb|ESW04469.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
Length=268

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 185/264 (70%), Gaps = 9/264 (3%)
 Frame = +1

Query  130  SSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRD--------DESQS  285
            S + S  A+RLEGKVA+ITGG  GIG  TA++F +HGAKV+IAD +D        D   S
Sbjct  5    SGVSSAVARRLEGKVALITGGASGIGECTARLFAKHGAKVVIADIQDELGHSVCKDIDSS  64

Query  286  FFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNT  465
            F+VHCDVT E  V+ AVN AVS  G+LDIM NNAGI+G    +I+    +DF  V   N 
Sbjct  65   FYVHCDVTKEEHVERAVNTAVSRFGKLDIMHNNAGIIGVWNPNIIHNKKSDFEEVIRTNL  124

Query  466  LGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGR  642
            +G FLG KHAARVM P +RGSII TAS  G +GG   HAYTCSKH IVGL +N A++LG 
Sbjct  125  VGVFLGMKHAARVMAPSRRGSIIATASTCGRIGGMASHAYTCSKHGIVGLVRNAAVELGP  184

Query  643  YGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKY  822
             GIRVNCVSPYAVPT M++S+    ++    +YS+LKGV L  +D+AEAV+YL SDESKY
Sbjct  185  LGIRVNCVSPYAVPTPMSKSFLNTDDEGIAALYSNLKGVTLKPQDVAEAVVYLGSDESKY  244

Query  823  VSGHNLVVDAGFSISNLALNLFNQ  894
            VSGH+LVVD GF++ N  +  F Q
Sbjct  245  VSGHDLVVDGGFTVVNAGMCSFGQ  268



>emb|CDP06870.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 192/268 (72%), Gaps = 21/268 (8%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQ  282
            ++ S   KRL+GKVA+ITG   GIG +TA++F ++GAKV+IAD +DD           S 
Sbjct  2    AIASNIMKRLQGKVALITGAASGIGESTARLFVKYGAKVVIADIQDDLAKKVCQDLDPSS  61

Query  283  SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVN  462
            +  VHCD T ESD+++AVN  VS +G+LDIM NNAGI G+  S+ILD   +DF  V  VN
Sbjct  62   ASHVHCDTTQESDIENAVNTTVSKYGKLDIMFNNAGIAGSGTSNILDDKKSDFERVISVN  121

Query  463  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDLG  639
             +G FLGTKHAARVM P + GSIINTASV   + GG PHAY  SKHA+VGLT+NTA+DLG
Sbjct  122  LVGVFLGTKHAARVMIPNRCGSIINTASVCSTLGGGAPHAYVSSKHAVVGLTRNTAIDLG  181

Query  640  RYGIRVNCVSPYAVPTQMA-----RSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            RYGIRVNC+SPY VPT +A     R Y G+S+     VY  L G +L AED+A+A LYLA
Sbjct  182  RYGIRVNCLSPYFVPTPLAADVVERIYGGVSK-----VYKFLDGAELKAEDVADAALYLA  236

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            SD+SKYVSGHNLVVD G+SI N A+ +F
Sbjct  237  SDDSKYVSGHNLVVDGGYSIVNSAMCMF  264



>ref|XP_009340878.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=274

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 181/258 (70%), Gaps = 11/258 (4%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHCD  303
            +RLEGKVA+ITGG  GIG +TA+VF + GAKV+IAD +DD  +S           FVHCD
Sbjct  16   RRLEGKVALITGGASGIGESTARVFSKLGAKVVIADVQDDLGESVCRDLNSSSASFVHCD  75

Query  304  VTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLG  483
            VT E D++ AV  A S +G+LDIM NNAGI+G    +ILD    +F  V  VN +GAFLG
Sbjct  76   VTKEEDIEHAVKTATSKYGKLDIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLG  135

Query  484  TKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVN  660
             KHAARVM P  +GSIINTASV   MGG   HAYT SKH +VGL KN A++LG+YGIRVN
Sbjct  136  IKHAARVMIPAGQGSIINTASVCSTMGGIASHAYTSSKHGVVGLMKNAAVELGQYGIRVN  195

Query  661  CVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNL  840
            CVSPY V T +A+ +F L +D    VYS+LKG  L  ED+AEA LYL SDESKYVSGHNL
Sbjct  196  CVSPYLVATPLAKHFFNLEDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNL  255

Query  841  VVDAGFSISNLALNLFNQ  894
            +VD GFSI N    +F +
Sbjct  256  LVDGGFSIVNPRFCMFEK  273



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 188/260 (72%), Gaps = 13/260 (5%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF------------FVH  297
            +RLEGKVA+ITG   GIG  TA++F +HGA+V+IAD +D+   S             FVH
Sbjct  9    RRLEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSLCKEIDRDGKYCSFVH  68

Query  298  CDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAF  477
            CDVT E DV++A+N AVS +G+LDIM NNAGI+G    +ILD +  +F  +  VN +GAF
Sbjct  69   CDVTKEEDVENALNSAVSKYGKLDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLVGAF  128

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIR  654
            LGTKHAARVM P ++GSII TAS+   +GG   HAYT SKH +VGL +NTA++LG++GIR
Sbjct  129  LGTKHAARVMIPNRKGSIITTASICSTIGGVASHAYTSSKHGVVGLMRNTAVELGQHGIR  188

Query  655  VNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGH  834
            VNCVSPY V T +AR +F L ++  +DVYS+LK   L  ED+A+A LYL SD+SKY+SGH
Sbjct  189  VNCVSPYVVNTPLARDFFKLDDNGIYDVYSNLKEAVLQPEDVAQAALYLGSDDSKYISGH  248

Query  835  NLVVDAGFSISNLALNLFNQ  894
            N+++D GF+I N A ++F Q
Sbjct  249  NMIIDGGFTIVNPAFSIFPQ  268



>ref|XP_010040326.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW45304.1| hypothetical protein EUGRSUZ_L01033 [Eucalyptus grandis]
Length=270

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 190/267 (71%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + +LLS AA+RLEGKVA+ITGG GGIG +TA++F +HGA+V+IAD RDD  +S     
Sbjct  1    MATGALLSRAARRLEGKVAVITGGAGGIGESTARLFSKHGARVIIADIRDDLGESVCKDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+SESDV+ A+N AV  HG+LDIMVNNA       ++ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDVEKAINTAVDKHGKLDIMVNNAATGEPVKANILDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAAR M P +RGSIIN  SV+  +GG  PHAYT SKH +VGLT+N A
Sbjct  121  VSVNLTGVFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVVGLTRNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGRYGIRVNC+SPY + + ++R +F +  + +  VYS+L GV L  ED+AEA L+L S
Sbjct  181  AELGRYGIRVNCLSPYFILSPLSREFFNVVRNGRVGVYSNLDGVSLQKEDVAEASLFLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKY+SGHNL VD GF+  N A  LF
Sbjct  241  DESKYISGHNLAVDGGFTTINPAFGLF  267



>emb|CDP06869.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 193/272 (71%), Gaps = 21/272 (8%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + ++ S   KRL+GKVA+ITG   GIG + A++F +HGAKV++AD +DD +Q      
Sbjct  1    MANMAVASNVMKRLQGKVALITGAASGIGESAARLFVKHGAKVVVADIQDDLAQKVCQDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                   VHCDVT ESD+++AVN AVS +G+LDIM NNAGI G++ S+ILD   +DF  V
Sbjct  61   DPSSASHVHCDVTQESDIENAVNTAVSKYGKLDIMFNNAGIGGSRTSNILDDKKSDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  627
              VN +G FLG KHAARVM P + GSIINTASV   + GG PHAY  SKHA+VGLT+NTA
Sbjct  121  ISVNLVGIFLGAKHAARVMIPNRCGSIINTASVCSTLGGGAPHAYVSSKHAVVGLTRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMA-----RSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAV  792
            +DLGRYGIRVNC+SPY V T  A     R Y G+S+     VY+ L G +L AED+A+A 
Sbjct  181  VDLGRYGIRVNCLSPYFVSTPSAADFVERIYGGVSK-----VYTYLDGAELKAEDVADAA  235

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LYLASD+SKYVSGHNLVVD G SI N A+ ++
Sbjct  236  LYLASDDSKYVSGHNLVVDGGHSIVNSAMCMY  267



>gb|ACU19531.1| unknown [Glycine max]
Length=269

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 195/268 (73%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S +S   +RLEGKVAIITGG  G+G+ATA++F +HGA V+IAD +DD         
Sbjct  1    MASVSSVSAPFRRLEGKVAIITGGASGLGAATARLFSKHGAHVVIADIQDDLGLSVAKEL  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
            ES S+ VHCDVT+E DV++ VN AVS +G+LDI+ NNAGI+    + I+D   +DF  V 
Sbjct  61   ESASY-VHCDVTNEIDVENCVNTAVSKYGKLDIIFNNAGIIDEIKTSIVDNSKSDFERVI  119

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  630
             V  +G FLGTKHAARVM P ++G IINTASVAG +GG   HAYT SKHA++GLTKNTA+
Sbjct  120  GVILVGPFLGTKHAARVMIPAKKGCIINTASVAGCIGGGATHAYTSSKHALIGLTKNTAV  179

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASD  810
            +LG++GIRVNC+SPY V T +++ YF + ED   ++YS+LKG  L+  D+AEA LYLA D
Sbjct  180  ELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGD  239

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ESKYVSGHNLV+D G++  N    +F Q
Sbjct  240  ESKYVSGHNLVIDGGYTDVNAGFTVFGQ  267



>gb|AFK35915.1| unknown [Medicago truncatula]
Length=272

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 196/270 (73%), Gaps = 12/270 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDE--------  276
            M +  L+S A +RLEGKVA+ITGG  GIG ATA++F +HGA+V+IAD +DD+        
Sbjct  1    MSTVPLVSNALRRLEGKVALITGGASGIGEATARLFSEHGAQVVIADIQDDKGHSICKEL  60

Query  277  --SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S +V CDVT E D+++AVN  V  +G+LDIM NNAGI G   + IL+   ++F +V
Sbjct  61   QKSSSSYVRCDVTKEEDIENAVNTTVFKYGKLDIMFNNAGISGVNKTKILENKLSEFEDV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHA+RVM P +RGSIINTASV G +GG  PHAYT +KHA+VGL +NTA
Sbjct  121  IKVNLTGVFLGTKHASRVMIPARRGSIINTASVCGSIGGVAPHAYTSAKHAVVGLMRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYF-GLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            ++LGR+GIRVNCVSPY V T + + YF    +DD  DVYS+LKG +L+ +D+AEA LYL 
Sbjct  181  IELGRFGIRVNCVSPYIVATPLVKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLG  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SDESKYVSGHNLV+D GF++ N    +F +
Sbjct  241  SDESKYVSGHNLVIDGGFTVVNNGFCVFGE  270



>ref|NP_001239862.1| uncharacterized protein LOC100794412 [Glycine max]
 gb|ACU19399.1| unknown [Glycine max]
 gb|KHN44551.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 168/234 (72%), Gaps = 11/234 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD---------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGA V+IAD +DD         ES S+ VHCDVT E DV++ VN  VS +G+LDIM
Sbjct  35   LFSKHGAYVVIADIQDDLGLSVAKELESASY-VHCDVTKEEDVENCVNTTVSKYGKLDIM  93

Query  376  VNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG  555
             NNAG+     + ILD + +DF  V  VN +G FLGTKHAARVM P ++G IINTASVAG
Sbjct  94   FNNAGVSDEIKTSILDNNKSDFERVISVNLVGPFLGTKHAARVMIPAKKGCIINTASVAG  153

Query  556  FMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF  732
             +GG   HAYT SKHA++GLTKNTA++LG++GIRVNC+SPY V T +++ YF + ED   
Sbjct  154  CIGGGATHAYTSSKHALIGLTKNTAVELGQHGIRVNCLSPYLVVTPLSKKYFNIDEDKIR  213

Query  733  DVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            ++YS+LKG  L+  D+AEA LYLA DESKYVSGHNLV+D G++  N    +F Q
Sbjct  214  EIYSNLKGAHLVPNDVAEAALYLAGDESKYVSGHNLVIDGGYTDVNAGFTVFGQ  267



>ref|XP_010059365.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90499.1| hypothetical protein EUGRSUZ_A02618 [Eucalyptus grandis]
Length=277

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 186/271 (69%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS +S AAKRLEGKVA+ITGG  GIG  TA+VF  HGAKV+IAD  D    S     
Sbjct  1    MAGSSFISAAAKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSIRDSL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT ES V++AV +AVST+G+LDIM NNAGI G   S I+D D  DF  V
Sbjct  61   SRDNASFVHCDVTDESQVKAAVAEAVSTYGKLDIMFNNAGITGPNKSRIVDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M PV+RG IINTAS+ +G  G   HAYTC+KHA++GLT+N A
Sbjct  121  LAVNVTGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGITSHAYTCAKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SP A  T +A  +FG+     +   D  ++LKGV L  ED+A A L+
Sbjct  181  VELGQFGIRVNCLSPNACATPLATKFFGMGPAELEAAIDAVTNLKGVTLKVEDVANAALF  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            LA DE++YVSGHNL +D GFS+ N +  LF+
Sbjct  241  LAGDEARYVSGHNLFIDGGFSVVNSSFRLFH  271



>ref|XP_007132474.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
 gb|ESW04468.1| hypothetical protein PHAVU_011G097100g [Phaseolus vulgaris]
Length=268

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 186/264 (70%), Gaps = 9/264 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M   S++S A KRLEGKVAIITGG  GIG ATA++F +HGA V+IAD +DD   S     
Sbjct  1    MAHVSVVSAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNEL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E DV+  VN AVS +G+LDI++NNAG        I++    DF  V  
Sbjct  61   ESAVYVHCDVTKEEDVEKCVNVAVSKYGKLDIVLNNAGTCDEFKRSIVENSKCDFERVIN  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM P +RG IINT+SVAG +GG  PHAYT SKH +VGLTKNTA++
Sbjct  121  VNLVGPFLGTKHAARVMIPAKRGCIINTSSVAGCIGGGAPHAYTISKHGLVGLTKNTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG++GIRVNCVSPY V T +   YF L E+   + YS+LKG  L+  D+AEA LYLA DE
Sbjct  181  LGQFGIRVNCVSPYVVATPLLNKYFNLDEEGVREAYSNLKGSYLVPNDVAEAALYLAGDE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNL  885
            SK+VSGHNLV+D GF+ +N   ++
Sbjct  241  SKFVSGHNLVIDGGFTTTNAGFSV  264



>ref|XP_010061228.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW68145.1| hypothetical protein EUGRSUZ_F01817 [Eucalyptus grandis]
Length=277

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 186/271 (69%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS +S A KRLEGKVA+ITGG  GIG  TA+VF  HGAKV+IAD  D    S     
Sbjct  1    MAGSSFISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT ES +++AV +AVST+G+LDIM NNAGI G   + I+D D  DF  V
Sbjct  61   SRDTASFVHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M PV+RG IINTAS+ +G  G   HAYTC+KHA++GLT+N A
Sbjct  121  LAVNVTGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SP A  T +A  +FG+S    +   D  ++LKGV L  ED+A A L+
Sbjct  181  VELGQFGIRVNCLSPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALF  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            LA DE++YVSGHNL +D GFS+ N +  LF+
Sbjct  241  LAGDEARYVSGHNLSIDGGFSVVNSSFRLFH  271



>gb|KEH29814.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=265

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 167/235 (71%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDE----------SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGA+V+IAD +DD+          S S +V CDVT E D+++AVN  V  +G+LDI
Sbjct  29   LFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKLDI  88

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G   + IL+   ++F +V  VN  G FLGTKHAARVM P +RGSIINTASV 
Sbjct  89   MFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHAARVMIPARRGSIINTASVG  148

Query  553  GFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
            G +GG  PHAYT SKHA+VGL +NTA++LG +GIRVNCVSPY + T M  ++F L +   
Sbjct  149  GSIGGCAPHAYTSSKHAVVGLMRNTAIELGPFGIRVNCVSPYFLATPMVTNFFKLDDGGA  208

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             D++S+LKG +L+ +D+AEA LYL SDESKYVSG NLV+D G S++N    +F Q
Sbjct  209  LDIFSNLKGTNLVPKDVAEAALYLGSDESKYVSGLNLVIDGGVSVANNGFCVFEQ  263



>ref|XP_010049793.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW82605.1| hypothetical protein EUGRSUZ_C03995 [Eucalyptus grandis]
Length=270

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 187/267 (70%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + +LLS AA+RLEGKVA+ITGG G IG +TA++F +HGA+V+IAD RDD  +S     
Sbjct  1    MATGALLSRAARRLEGKVAMITGGAGDIGESTARLFSKHGARVIIADIRDDLGESVCKDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+SESDV+ A+N AV  HG+LDIMVNNA       ++ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSESDVEKAINTAVEKHGKLDIMVNNAATGEPVKANILDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAAR M P +RGSIIN  SV+  +GG  PHAYT SKH ++GLT+N A
Sbjct  121  VSVNLTGVFLGTKHAARAMIPSRRGSIINVGSVSSSVGGVAPHAYTSSKHGVLGLTRNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGRYGIRVNC+SPY + + + R +F +  +    VYS+L GV L  ED+AEA ++L S
Sbjct  181  AELGRYGIRVNCLSPYFILSPLTREFFNVVRNGGVGVYSNLDGVSLQKEDVAEAAVFLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKY+SGHNL VD GF+  N A  LF
Sbjct  241  DESKYISGHNLAVDGGFTTINPAFGLF  267



>gb|KDP34949.1| hypothetical protein JCGZ_09237 [Jatropha curcas]
Length=270

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 184/269 (68%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+ LL   A+RLEGKVA+ITGG   IG++  + FC+HGAKV+I D +DD  QS     
Sbjct  1    MASNFLLPFNARRLEGKVALITGGATSIGASIVRTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT ESD+++AV+ A+    +LDIMVNNA I   +   I+D D  DF  V
Sbjct  61   GTDKAIFVHCDVTIESDIENAVDTAIFIFKKLDIMVNNAAIGDPRKPSIVDNDIADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHAARVM P ++GSII   SV   +GG   HAYT +KH +VGL KN A
Sbjct  121  VKVNLIGVFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGVVGLAKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGR+GIRVNC+SPY + T ++ ++F + ED K  VYS+L+GV L  ED+A+A +YL S
Sbjct  181  AELGRFGIRVNCLSPYFIETPLSMNFFKMKEDGKSGVYSNLEGVKLTEEDVAQAAIYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNL +D GF+  N A  LF++
Sbjct  241  DESKYVSGHNLALDGGFTTINPAFGLFSR  269



>ref|XP_010061227.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Eucalyptus grandis]
Length=307

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 186/271 (69%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS +S A KRLEGKVA+ITGG  GIG  TA+VF  HGAKV+IAD  D    S     
Sbjct  31   MAGSSFISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVRDSL  90

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT ES +++AV +AVST+G+LDIM NNAGI G   + I+D D  DF  V
Sbjct  91   SRDTASFVHCDVTDESQIKAAVAEAVSTYGKLDIMFNNAGITGPNETRIIDNDKADFERV  150

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASV-AGFMGGFPHAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M PV+RG IINTAS+ +G  G   HAYTC+KHA++GLT+N A
Sbjct  151  LAVNVTGVFLGMKHAAQAMIPVRRGCIINTASISSGLAGMTSHAYTCAKHAVLGLTRNAA  210

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SP A  T +A  +FG+S    +   D  ++LKGV L  ED+A A L+
Sbjct  211  VELGQFGIRVNCLSPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALF  270

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            LA DE++YVSGHNL +D GFS+ N +  LF+
Sbjct  271  LAGDEARYVSGHNLSIDGGFSVVNSSFRLFH  301



>ref|XP_008246119.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Prunus 
mume]
Length=257

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 163/235 (69%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD +DD ++S           FVHCDVT E DV++AV  A S +G+LDI
Sbjct  22   LFSKHGAKVVIADVQDDLAESICRDLSSSSTSFVHCDVTKEEDVENAVKTATSKYGKLDI  81

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G   ++ILD D  +F  V  VN +G FLG KHAARVM    +GSIINTAS  
Sbjct  82   MFNNAGIAGTAKTNILDNDKAEFEQVIGVNLVGVFLGIKHAARVMISAGQGSIINTASAC  141

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYT SKH ++GL +NTA++LG++GIRVNCVSPY V T +A+ +F L +D  
Sbjct  142  STIGGCASHAYTSSKHGVLGLVRNTAIELGQHGIRVNCVSPYIVATPLAKDFFKLDDDGV  201

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
              VYS+LKG  L AEDIAEA LYL SDESKYVSGHNL+VD GF+  N    +F Q
Sbjct  202  HGVYSNLKGEVLKAEDIAEAALYLGSDESKYVSGHNLLVDGGFTNVNARFCIFEQ  256



>ref|XP_006430117.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43357.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=275

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 194/270 (72%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M SS +LS   +RLEGKVA ITGG  GIG+ TAKVF Q GAKV+IAD ++          
Sbjct  1    MASSGVLSAITRRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEQLGHSVVESI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S +VHCDVT+ES +++A+++ V+THG+LDIM NNAGI GA  + I+D +  DF  V
Sbjct  61   GTSNSSYVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGANKTRIIDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM P + GSI++TASV+  +G    HAY C+KHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK---FDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +A S+ G++++D     +  ++LKGV L  EDIA A LY
Sbjct  181  VELGQFGIRVNCLSPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE+KYVSGHNL +D GF+I N +L +F
Sbjct  241  LASDEAKYVSGHNLFIDGGFTIVNPSLGMF  270



>ref|XP_010262933.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262934.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262935.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=277

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 188/266 (71%), Gaps = 17/266 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M    LLS   +RLEGKVA+ITGG  GIG +TA++F  HGAKV+IAD  D+   S     
Sbjct  1    MEGGPLLSNITRRLEGKVALITGGASGIGRSTARLFANHGAKVVIADVEDELGHSICEEV  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   F+HCDVT ++DV++AV+  V  HG+LDIM +NAGI G+    ILD D  +F  
Sbjct  61   GSEGTICFIHCDVTKDADVRNAVDSTVDKHGKLDIMFSNAGITGSPTKKILDSDNENFRK  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  624
            V  VNT GAFLG KHA RVM P+++G+II T+SVA  + G  P+AY  SKHA+VGLTKN 
Sbjct  121  VLEVNTFGAFLGAKHATRVMIPLKKGTIIFTSSVASVIAGDTPYAYAASKHAVVGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY----SSLKGVDLMAEDIAEAV  792
            +++LG+YGIRVNC+SPY + T M R+  GL E++K + Y    ++LKGV L AED+AEA 
Sbjct  181  SVELGQYGIRVNCISPYGLATPMLRTATGL-EEEKIEAYLSGGANLKGVVLKAEDVAEAA  239

Query  793  LYLASDESKYVSGHNLVVDAGFSISN  870
            LYLASDES+YVSG NLVVD GFSI+N
Sbjct  240  LYLASDESRYVSGLNLVVDGGFSITN  265



>ref|XP_010070261.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 185/267 (69%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + +LLS AA+RLEGKVA+ITGG  GIG +TA++F +HGAKV+IAD  DD  +S     
Sbjct  1    MAARTLLSLAARRLEGKVAVITGGACGIGESTARLFSKHGAKVIIADINDDLGKSVCKNL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+SE DV++AV  AV  HG+LDIMVNNA I      +ILD D  DF  V
Sbjct  61   GPETASFVHCDVSSEPDVENAVATAVDKHGKLDIMVNNAAIGDPTKLNILDNDKADFEKV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAAR M P QRGSIIN  SV+  +GG   HAY  SKHAIVGL++N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSQRGSIINVGSVSSSVGGVASHAYASSKHAIVGLSRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGRYGIRVNC+SPY + T +    F L E+ +F VYS+L GV L  ED+AEA L+L S
Sbjct  181  AELGRYGIRVNCLSPYFIRTPLTEEMFKLDENPEFRVYSNLDGVTLQEEDVAEAALFLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKY+SGHNL VD GF+  N A  +F
Sbjct  241  DESKYISGHNLAVDGGFTTINPAFGVF  267



>gb|KDP36171.1| hypothetical protein JCGZ_08815 [Jatropha curcas]
Length=276

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 193/269 (72%), Gaps = 14/269 (5%)
 Frame = +1

Query  124  VSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------  273
            +++S +S  A+RLEGKVA+ITGG  GIG  TAKVF  HGAK++IAD +D+          
Sbjct  1    MAASFISAVARRLEGKVALITGGASGIGECTAKVFAHHGAKIVIADVQDELGQAVSQALG  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
             S S +VHC+VT+E+ +++AV+KAV+T+G+LDIM NNAGI+      I+D +  DF  V 
Sbjct  61   PSNSTYVHCNVTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVL  120

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  630
             VN  G FLG KHAARVM P ++GSII TAS++  +G    HAYTCSKHA++GLT+N A+
Sbjct  121  SVNVTGVFLGIKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAI  180

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLYL  801
            +LG++G+RVNC+SPYA+ T +A  + GL +   ++  D  +SLKGV L AED+A A LYL
Sbjct  181  ELGQFGVRVNCLSPYALATPLATKFVGLDDEGLENLMDSLASLKGVTLKAEDVANAALYL  240

Query  802  ASDESKYVSGHNLVVDAGFSISNLALNLF  888
            ASDE +Y++GHNL +D GFSI N +  LF
Sbjct  241  ASDEGRYINGHNLAIDGGFSIHNPSFQLF  269



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 193/272 (71%), Gaps = 15/272 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +++ +ST A+RL+GKVA+ITGG  GIG  TAKVF  HGAKV+IAD +D+         
Sbjct  1    MSTTAFISTIARRLQGKVALITGGASGIGECTAKVFSHHGAKVVIADIQDELGHSVVEAL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S +V CDVT E+ +++AV+KA+ST+G+LDIM+NNAGI     + I+D +  DF  V
Sbjct  61   GPSNSTYVRCDVTEEAQIKNAVDKAISTYGKLDIMLNNAGIADDSKARIIDNEMADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLG KHAARVM P + G+II+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LKINVTGVFLGIKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDV----YSSLKGVDLMAEDIAEAVL  795
             +LG++GIRVNC+SPYA+ T +AR + G+ +D+  ++    +++LKGV L  ED+A A L
Sbjct  181  AELGQFGIRVNCLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAAL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            YLASDE++Y+SGHNL +D GFS+ N    +F 
Sbjct  241  YLASDEARYISGHNLFIDGGFSVQNPTFQMFQ  272



>ref|XP_006481701.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=275

 Score =   253 bits (647),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 194/270 (72%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M SS +LS   +RLEGKVA ITGG  GIG+ TAKVF Q GAKV+IAD +++         
Sbjct  1    MASSGVLSAITRRLEGKVAFITGGASGIGACTAKVFAQQGAKVVIADIQEELGHSVVESI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S +VHCDVT+ES +++A+++ V+THG+LDIM NNAGI G   + I+D +  DF  V
Sbjct  61   GTSNSSYVHCDVTNESHIKNAIDQTVATHGKLDIMFNNAGIGGPNKTRIIDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM P + GSI++TASV+  +G    HAY C+KHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPARSGSILSTASVSSRVGAAASHAYCCAKHAVLGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK---FDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +A S+ G++++D     +  ++LKGV L  EDIA A LY
Sbjct  181  VELGQFGIRVNCLSPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE+KYVSGHNL +D GF+I N +L +F
Sbjct  241  LASDEAKYVSGHNLFIDGGFTIVNPSLGMF  270



>gb|KEH29815.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 170/236 (72%), Gaps = 12/236 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDE----------SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGA+V+IAD +DD+          S S +V CDVT E D+++AVN  V  +G+LDI
Sbjct  29   LFSEHGAQVVIADIQDDKGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKLDI  88

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G   + IL+   ++F +V  VN  G FLGTKHA+RVM P +RGSIINTASV 
Sbjct  89   MFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHASRVMIPARRGSIINTASVC  148

Query  553  GFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYF-GLSEDD  726
            G +GG  PHAYT +KHA+VGL +NTA++LGR+GIRVNCVSPY V T + + YF    +DD
Sbjct  149  GSIGGVAPHAYTSAKHAVVGLMRNTAIELGRFGIRVNCVSPYIVATPLVKKYFKLDDDDD  208

Query  727  KFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
              DVYS+LKG +L+ +D+AEA LYL SDESKYVSGHNLV+D GF++ N    +F +
Sbjct  209  VLDVYSNLKGANLVPKDVAEAALYLGSDESKYVSGHNLVIDGGFTVVNNGFCVFGE  264



>ref|XP_003632648.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=275

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 192/270 (71%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +SS LS   +RLEGKVA+ITGG  GIG  TA+ F QHGAKV+IAD +D+         
Sbjct  1    MAASSFLSAITRRLEGKVALITGGASGIGKCTAETFTQHGAKVVIADIQDELGHSVIEAL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             ++ + +VHCDVT ES +++AV+K  +THG+LDIM NNAGI+      I+D +  DF  V
Sbjct  61   GQTNASYVHCDVTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LSINVTGVFLGMKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +A ++  L+ ++     +  ++LKGV L A+D+A A LY
Sbjct  181  IELGQFGIRVNCLSPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDVANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDES+YVSGHNL +D GF+++N + +LF
Sbjct  241  LASDESRYVSGHNLFIDGGFTVANPSFHLF  270



>gb|AEC10992.1| alcohol dehydrogenase [Camellia sinensis]
Length=277

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 188/269 (70%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S+LS AA+RLEGKVA+ITGG  GIG  TA++F +HGAKV+IAD +DD         
Sbjct  1    MASFSILSAAARRLEGKVALITGGASGIGECTARLFSKHGAKVMIADIQDDLGLSVCKDL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             E    FVHCDVT+E+ V +AV+ AV+  G+LDIM NNAGI+G    +ILD D  +F  +
Sbjct  61   DEKSVSFVHCDVTNETHVMNAVDAAVAQFGKLDIMYNNAGIVGLAKPNILDNDKDEFEKI  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTK AARVM   +RG+II TASV   +GG   HAYT SKH + GLTKN A
Sbjct  121  IRVNLVGAFLGTKQAARVMILNRRGTIITTASVCSPIGGVASHAYTSSKHGVAGLTKNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            ++ G++GIRVNCVSPY V T +A+ ++ L ++  + VYS+LKG  L  ED+A+A LYL S
Sbjct  181  VEFGQHGIRVNCVSPYLVGTPLAKDFYKLDDEGVYGVYSNLKGAVLRPEDVAQAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            D+S YVSGHN +VD GF+I N    +F Q
Sbjct  241  DDSMYVSGHNFIVDGGFTIVNPGFCMFEQ  269



>ref|XP_002281462.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=275

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 192/270 (71%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +SS LS   +RLEGKVA+ITGG  GIG  TA+ F QHGAKV+IAD +D+         
Sbjct  1    MAASSFLSVFTRRLEGKVALITGGASGIGKCTAETFTQHGAKVVIADIQDELGHSVIEAL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             ++ + +VHCDVT ES +++AV+K  +THG+LDIM NNAGI+      I+D +  DF  V
Sbjct  61   GQTNASYVHCDVTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LSINVTGVFLGMKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +A ++  L+ ++     +  ++LKGV L A+D+A A LY
Sbjct  181  IELGQFGIRVNCLSPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDVANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDES+YVSGHNL +D GF+++N + +LF
Sbjct  241  LASDESRYVSGHNLFIDGGFTVANPSFHLF  270



>emb|CDP06872.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 186/264 (70%), Gaps = 11/264 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M + ++ S   KRL+GKVA+ITGG  GIG +TA++F +HGAKV+IAD +DD         
Sbjct  1    MANMAIASNIMKRLQGKVALITGGASGIGESTARLFVKHGAKVVIADIQDDLAKKVCQDL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S +  VHCD T ESD+++AVN AVS +G+LDIM NNAGI G+  S+ILD   + F  V
Sbjct  61   DPSSASHVHCDTTQESDIENAVNTAVSKYGKLDIMFNNAGIAGSGTSNILDDKKSGFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNTA  627
              VN +G FLG KHAARVM P + GSIINTASV    +G  PHAY  SKHA+VGLT+NTA
Sbjct  121  ISVNLVGVFLGAKHAARVMIPNRCGSIINTASVCSTIVGAAPHAYVSSKHAVVGLTRNTA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            +DLGRYGIRVNC+SPY VPT MA  +          VY+ L G  L A+D+A+A LYLAS
Sbjct  181  VDLGRYGIRVNCLSPYFVPTPMAVDFIERINGGVSKVYTYLDGAVLKADDVADAALYLAS  240

Query  808  DESKYVSGHNLVVDAGFSISNLAL  879
            D+SKYVSGHNLVVD G+SI N A+
Sbjct  241  DDSKYVSGHNLVVDGGYSIVNSAM  264



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S S L+ AA+RLEGKVA+ITGG  GIG  TA++F +HGAKV+IAD +DD  QS     
Sbjct  1    MASISALTAAARRLEGKVALITGGASGIGEYTAELFTKHGAKVMIADIQDDLGQSVCKNL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVS-DILDCDATDFVN  447
                  ++HCDVT+E+ VQ+AV+  V+ + +LDIM NNAGI G+    +ILD   ++F  
Sbjct  61   GPSVASYIHCDVTNEAHVQNAVDSTVAKYEKLDIMFNNAGIAGSYPKLNILDITQSEFEE  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  624
            +  VN +G FLGTKHAARVM P ++GSII TAS    +GG  PHAYT SKH IVGLT+NT
Sbjct  121  IIKVNLIGPFLGTKHAARVMIPAKQGSIITTASTCSVIGGGAPHAYTSSKHGIVGLTRNT  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A++LG+YGIRVNCVSP+ + T + +++  L ++     YS+LKG     ED+A A L+LA
Sbjct  181  AVELGKYGIRVNCVSPHVISTPLVKNFLKLDDEGVSKFYSNLKGASCKVEDVANAALFLA  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            SD+SK++SGHNLVVD GF+I N    +F
Sbjct  241  SDDSKFISGHNLVVDGGFTIMNPGFCMF  268



>dbj|BAA13541.1| CPRD12 protein [Vigna unguiculata]
Length=267

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 182/265 (69%), Gaps = 9/265 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + S+LS   KRLEGKVAIITGG  GIG ATA++F QHGA V++AD +DD   S     
Sbjct  1    MANGSVLSPVVKRLEGKVAIITGGASGIGEATARLFSQHGAHVVVADIQDDVGLSLCNEL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E D++  V+ AVS  G+LDIM NNAG        ILD   +DF  V  
Sbjct  61   KSAIYVHCDVTKEEDIEKCVDTAVSKFGKLDIMFNNAGTGDEFKKSILDNTKSDFERVIS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM P +RG IINTASVAG +GG   HAYT SKHA+VGLTKNTA++
Sbjct  121  VNLVGPFLGTKHAARVMIPARRGCIINTASVAGCIGGGATHAYTSSKHALVGLTKNTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG++GIRVNCVSP+A+ T +   YF L E+     Y +LKG   +  D+AEA LYLASDE
Sbjct  181  LGQFGIRVNCVSPFAIVTPLLNKYFNLDEEGVRKTYMNLKGWYPVPNDVAEAALYLASDE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNLF  888
            SK+VS HNLV+D G   SN+   +F
Sbjct  241  SKFVSSHNLVIDGGLINSNVGFPMF  265



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 188/263 (71%), Gaps = 12/263 (5%)
 Frame = +1

Query  136  LLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-------FV  294
            + S   KRLEGKVA+ITGG  GIG  TA++F QHGAKV++AD +D+  +S        FV
Sbjct  1    MTSALVKRLEGKVAVITGGASGIGECTARLFSQHGAKVVVADIQDERGRSVCDTIGATFV  60

Query  295  HCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGA  474
            HCDVT ESDVQ A++ AV+ HG+LDIM NNAGI+ A    I D   +DF  V  V   GA
Sbjct  61   HCDVTKESDVQKAIDTAVTGHGKLDIMFNNAGIIDAG-KPITDTALSDFHKVIDVIVTGA  119

Query  475  FLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGI  651
            FLGTKHAARVM P  RGSII+TASVA  +GG   HAYT +KHA+ GLT++ A++LGR+G+
Sbjct  120  FLGTKHAARVMVPAGRGSIISTASVASVIGGVGTHAYTAAKHAVAGLTRSAAVELGRFGV  179

Query  652  RVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKY  822
            RVNCVSPYAV T++A  +  + E   ++    +++L+G  L  ED+A AVLYLASDESKY
Sbjct  180  RVNCVSPYAVATRLAVEFARIDEKVFEEAMSKFATLQGTLLKPEDVAMAVLYLASDESKY  239

Query  823  VSGHNLVVDAGFSISNLALNLFN  891
            VSGHNL+VD G+SI N AL  F+
Sbjct  240  VSGHNLMVDGGYSIVNRALLSFD  262



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 191/272 (70%), Gaps = 15/272 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +++ +S+ AKRL+GKVA+ITGG  GIG  TAKVF  HGAKV+IAD +D+         
Sbjct  1    MSTTAFISSIAKRLQGKVALITGGASGIGECTAKVFSHHGAKVIIADIQDELGHSVVEAL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S +V CDVT E+ +++ V+ A+ST+G+LDIM+NNAGI     S I+D +  DF  V
Sbjct  61   GPSNSTYVRCDVTEEAQIKNVVDTAISTYGKLDIMLNNAGIADDNKSRIIDNEMADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLG KHAARVM P + G+II+TASV+  +G    HAY CSKHA++GLT+N A
Sbjct  121  LKINVTGVFLGIKHAARVMIPARSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDV----YSSLKGVDLMAEDIAEAVL  795
             +LG++GIRVNC+SPYA+ T +AR + G+ +D+  ++    +++LKGV L  ED+A A L
Sbjct  181  AELGQFGIRVNCLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAAL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            YLASDE++Y+SGHNL +D GFS+ N    +F 
Sbjct  241  YLASDEARYISGHNLFIDGGFSVQNPTFQMFQ  272



>emb|CAN78993.1| hypothetical protein VITISV_001799 [Vitis vinifera]
Length=388

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 195/276 (71%), Gaps = 14/276 (5%)
 Frame = +1

Query  103  EIDSRKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---  273
            E  S+ M +SS LS   +RLEGKVA+ITGG  GIG  TA+ F QHGAKV+IAD +D+   
Sbjct  108  EDGSKAMAASSFLSVFTRRLEGKVALITGGASGIGKXTAETFTQHGAKVVIADIQDELGH  167

Query  274  -------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDA  432
                   ++ + +VHCDVT ES +++AV+K  +THG+LDIM NNAGI+      I+D + 
Sbjct  168  SVIEALGQTNASYVHCDVTDESQIKAAVDKTAATHGKLDIMFNNAGIVNNYKPRIMDNEK  227

Query  433  TDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVG  609
             DF  V  +N  G FLG KHAARVM P + GSII+TASV+  +G    HAY CSKHA++G
Sbjct  228  ADFERVLSINVTGVFLGMKHAARVMVPAKSGSIISTASVSSNVGAAATHAYCCSKHAVLG  287

Query  610  LTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDI  780
            LT+N A++LG++GIRVNC+SPYA+ T +A ++  L+ ++     +  ++LKGV L A+D+
Sbjct  288  LTRNAAIELGQFGIRVNCLSPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDV  347

Query  781  AEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            A A LYLASDES+YVSGHNL +D GF+++N + +LF
Sbjct  348  ANAALYLASDESRYVSGHNLFIDGGFTVANPSFHLF  383



>ref|XP_011094269.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=276

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 191/271 (70%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S+SL+S   +RLEGKVA++TGG  GIG  TAK+F +HGAKV IAD +D+         
Sbjct  1    MASASLVSALTRRLEGKVALVTGGASGIGECTAKLFSKHGAKVAIADIQDELAHSVVNSI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S ++HCDVT+E  V++AV+K VST+G+LDIM NNAGI       I+D + +DF  V
Sbjct  61   GHSNSTYIHCDVTNEDHVKNAVDKTVSTYGKLDIMFNNAGIADRPKPRIIDNEKSDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLG KHAARVM P + G+II+TAS+   +GG   HAYTCSKHA+VGLT+N A
Sbjct  121  MSINVTGVFLGMKHAARVMVPARSGTIISTASLGSGIGGAATHAYTCSKHAVVGLTRNLA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +A+ +  L +   ++     ++LKGV L AED+A A L+
Sbjct  181  VELGQFGIRVNCLSPYALATPLAKKFLELDDEGVENAMSYMANLKGVTLKAEDVANAALF  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            LASDE++YVSG NL +D GF I N A+ LFN
Sbjct  241  LASDEARYVSGQNLFIDGGFGIVNSAIKLFN  271



>gb|KDP36172.1| hypothetical protein JCGZ_08816 [Jatropha curcas]
Length=277

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 192/269 (71%), Gaps = 14/269 (5%)
 Frame = +1

Query  124  VSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------  273
            +++S +S  A+RLEGKVA+ITGG  GIG  TAKVF  HGAK++IAD +D+          
Sbjct  1    MAASFISAVARRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADVQDELGQAVSQALG  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
             S S +VHC+VT+E+ +++AV+KAV+T+G+LDIM NNAGI+      I+D +  DF  V 
Sbjct  61   PSNSTYVHCNVTNEAHIKNAVDKAVATYGKLDIMFNNAGIVDPNKPRIIDNEKEDFERVL  120

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTAL  630
             VN  G FLG KHAARVM P ++GSII TAS++  +G    HAYTCSKHA++GLT+N A+
Sbjct  121  SVNVTGVFLGIKHAARVMIPARKGSIICTASISSLVGAAASHAYTCSKHAVLGLTRNAAI  180

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLYL  801
            +LG++G+RVNC+SPYA+ T +A  + GL +   ++  D  +SLKGV L AED+A A LYL
Sbjct  181  ELGQFGVRVNCLSPYALATPLATKFVGLDDEGLENLMDSLASLKGVTLKAEDVANAALYL  240

Query  802  ASDESKYVSGHNLVVDAGFSISNLALNLF  888
            ASDE +Y++GHNL +D G SI N +  +F
Sbjct  241  ASDEGRYINGHNLAIDGGISIHNPSFQMF  269



>ref|XP_009388139.1| PREDICTED: momilactone A synthase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 183/246 (74%), Gaps = 15/246 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M SS LL +AAKRLEGKVA+ITG   GIG ATAK+F +HGA+++IAD +DD+  +     
Sbjct  1    MQSSPLLFSAAKRLEGKVALITGAASGIGEATAKLFARHGARIVIADVQDDKGHALCSAL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  +VHCDVT+ESDVQ AV+  VS HG+LD+M NNAGI+G     +L+ + +DF +V
Sbjct  61   GPSVASYVHCDVTNESDVQQAVDATVSHHGKLDVMFNNAGIIGEPCLRLLESEKSDFEHV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
               N +G++LGTKHAAR M P +RGSI+ TASVA  +    P AYTCSKHA++GL K+ A
Sbjct  121  VATNLVGSYLGTKHAARAMLPARRGSIVITASVASVIASITPVAYTCSKHAVLGLMKSAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            L+LG++GIRVNCVSPYA+PT +A   FG+ E++    +++LKGV L AED+AEAV+YLAS
Sbjct  181  LELGQFGIRVNCVSPYALPTPLAMKAFGMGEEE----HATLKGVRLKAEDVAEAVVYLAS  236

Query  808  DESKYV  825
            DES+YV
Sbjct  237  DESRYV  242



>dbj|BAE72097.1| Lactuca sativa short-chain dehydrogenase/reductase 2
Length=271

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 185/264 (70%), Gaps = 14/264 (5%)
 Frame = +1

Query  139  LSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQSF  288
            ++T  +RLEGKVA+ITG   GIG   AK+F +HGAK++IAD +D            S S 
Sbjct  1    MATTTRRLEGKVALITGAASGIGECAAKLFAEHGAKIVIADIQDQLGQAVCEAIGSSNSI  60

Query  289  FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTL  468
            ++HCDVT+E DV+ AV+ A++T+G+LDIM  NAGI+      I+D + +DF  V  VN  
Sbjct  61   YIHCDVTNEEDVRKAVDIAIATYGKLDIMFCNAGIIDPNKDHIIDNEKSDFERVLSVNVT  120

Query  469  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRY  645
            G FL  KHAARVM P + GSII+TASV   +GG  PHAYTCSKHA+ GLTKN A++LG++
Sbjct  121  GVFLSMKHAARVMVPTRAGSIISTASVVSNIGGLCPHAYTCSKHAVAGLTKNLAVELGQF  180

Query  646  GIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDIAEAVLYLASDES  816
            GIRVNC+SPYA+ T  A  + GL  +D   K +  ++LKGV L  +D+A+A ++LASDE+
Sbjct  181  GIRVNCLSPYAIDTPQATGFTGLKGEDFKNKVNSVANLKGVTLTTDDVAKAAVFLASDEA  240

Query  817  KYVSGHNLVVDAGFSISNLALNLF  888
            KY+SGHNL +D GFSI N + N+F
Sbjct  241  KYISGHNLFIDGGFSIVNPSFNMF  264



>gb|AHH81851.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=275

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 191/273 (70%), Gaps = 16/273 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S LS   +RLEGKVA+ITGG  GIG   AK+F +HGAKV+IAD +D          
Sbjct  1    MASFSTLSVVTRRLEGKVALITGGANGIGECAAKLFSKHGAKVVIADIQDQLGEAVVRQI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                S +VHCDVT E+DV++AV+KAVST+G+LDIM NNA  +      I+D +  DF  V
Sbjct  61   GPENSTYVHCDVTDENDVRNAVDKAVSTYGKLDIMYNNAATIDFGAHPIVDNEKKDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM PV+RG II+TAS+AG +GG   HAYTCSKHA++GL+KN A
Sbjct  121  MAVNVTGVFLGMKHAARVMIPVRRGVIISTASIAGHLGGTATHAYTCSKHAVIGLSKNLA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYS----SLKGVDLMAEDIAEAVL  795
            ++LG+YGIRVNCVSPYA+ T++++ Y  L + + F+  S    +L+G  L  +DIA A L
Sbjct  181  IELGQYGIRVNCVSPYALATKLSKKYLKL-DHELFEKMSHDKGNLQGATLKPDDIANAAL  239

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            +LASD++KYVSG NL +D GF++ N A+ +F +
Sbjct  240  FLASDDAKYVSGQNLFIDGGFTVFNSAMQVFKE  272



>gb|KDP34955.1| hypothetical protein JCGZ_09243 [Jatropha curcas]
Length=270

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 184/269 (68%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +S LL   A+RLEGKVA+ITGG  GIG++ A  FC+HGAKV+I D +DD  QS     
Sbjct  1    MATSFLLPINARRLEGKVALITGGATGIGASIATTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT ESD+++AV+ A+S   +LDIMVNNA I   +   I+D D +DF  V
Sbjct  61   GTDKAIFVHCDVTIESDIKNAVDIAISIFRKLDIMVNNAAIADPRKLSIVDNDISDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHAARVM P ++GSII   SV   +GG   HAYT +KH +VGL KN A
Sbjct  121  VKVNLIGVFLGTKHAARVMIPARQGSIITLGSVCSSVGGVAFHAYTSTKHGVVGLAKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGR+GIRVNC+S Y + T +  ++F + ED K  VYS+L+GV L  ED+A+A +YL S
Sbjct  181  AELGRFGIRVNCLSCYFIETPLTMNFFKMEEDGKSGVYSNLEGVKLKEEDVAQAAIYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESKYVSGHNL +D G +  N A  +F++
Sbjct  241  DESKYVSGHNLALDGGSTTINPAFGVFSR  269



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 192/271 (71%), Gaps = 16/271 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M   S LS+  +RLEGKVA+ITGG  GIG +TAK+F +HGAKV I D  D+         
Sbjct  1    MAYFSTLSSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S ++HCDVT+E DV++AV+K VST+G+LDIM NNAGI       I+D +  DF  V
Sbjct  61   GPSNSTYIHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM P + G+II+TAS+A  MGG   HAYTCSKHA+VGLT+N+A
Sbjct  121  LAVNVTGVFLGMKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY----SSLKGVDLMAEDIAEAVL  795
            ++LG+YGIRVNC+SPYA+ + ++R Y G+ ED++ +      ++LKG  L A+DIA A L
Sbjct  181  IELGQYGIRVNCMSPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAAL  239

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            +LASD++KYVSG NL +D GF+I N A+ +F
Sbjct  240  FLASDDAKYVSGQNLFIDGGFTIFNSAMQVF  270



>ref|XP_009605454.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nicotiana tomentosiformis]
Length=263

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 180/262 (69%), Gaps = 11/262 (4%)
 Frame = +1

Query  136  LLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRD----------DESQS  285
            + S  A+RL+GKVAIITG   GIG A A++F  HGAKV+IAD +D          D + +
Sbjct  1    MASNVARRLKGKVAIITGAASGIGEAAARLFSIHGAKVVIADIQDELAQKVCKDLDPTST  60

Query  286  FFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNT  465
             FVHCD+T E D+++A N AV  +G+LDIM NNAGI+G   S+IL+ +  +F  V  VN 
Sbjct  61   TFVHCDITKEEDLENAANTAVDKYGKLDIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNL  120

Query  466  LGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGR  642
            +G FLGTK AARVM P  RGSII TAS+   +GG   HAYTCSKH ++GLT+N A+DLGR
Sbjct  121  VGTFLGTKQAARVMIPNGRGSIITTASITATIGGSGSHAYTCSKHGVLGLTRNAAVDLGR  180

Query  643  YGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKY  822
            +GIRVNCVSPY V T +A  Y  ++     DVYS+L G  L  +D+AE  L+LASDESKY
Sbjct  181  FGIRVNCVSPYLVLTPLALDYLKMNGKKASDVYSTLNGATLTPKDVAETALFLASDESKY  240

Query  823  VSGHNLVVDAGFSISNLALNLF  888
            VSG N +VD GF+  N  L++F
Sbjct  241  VSGQNFIVDGGFTAENPGLSIF  262



>ref|XP_004139501.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004159104.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN64962.1| TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 186/269 (69%), Gaps = 14/269 (5%)
 Frame = +1

Query  124  VSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRD----------D  273
            +S  LL   A+RLEGKVA+ITGG  GIG  TAK+F +HGAKV+IAD +D           
Sbjct  1    MSIQLLPAIARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLG  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVS-DILDCDATDFVNV  450
            +S S FVHCDVT E DV++AV+ AVS +G+LDIM+NNAG+     + DIL  D   F  V
Sbjct  61   QSSSVFVHCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDILKDDPLTFQRV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAARVMKP  RGSI+ TAS+   +GG   HAYT SKH ++GL +N A
Sbjct  121  VNVNLVGAFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLM-AEDIAEAVLYL  801
            +DLGRYGIRVNCVSP  VPT+M R  F + +  +F   Y SLK  D++  ED+ EAV+YL
Sbjct  181  VDLGRYGIRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYL  240

Query  802  ASDESKYVSGHNLVVDAGFSISNLALNLF  888
             SDESK VSG NL+VD GF++ N AL  F
Sbjct  241  GSDESKCVSGLNLIVDGGFTVVNQALCSF  269



>dbj|BAC53872.1| alcohol dehydroge [Phaseolus lunatus]
Length=274

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 182/259 (70%), Gaps = 9/259 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M   S +S A KRLEGKVAIITGG  GIG+ATA++F +HGA V+IAD +DD   S     
Sbjct  1    MAHVSAVSAAVKRLEGKVAIITGGASGIGAATARLFSEHGAHVVIADIQDDLGLSVCNEL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E DV+  VN  VS +G+LDIM+NNAG        I+D   ++F  V  
Sbjct  61   KSAVYVHCDVTKEEDVEKCVNVTVSKYGKLDIMLNNAGTCHELKDSIVDNITSEFERVIS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM P +RG IINT+S+AG  G G PHAY  SKH + GLTKNTA++
Sbjct  121  VNVVGPFLGTKHAARVMIPAKRGCIINTSSIAGCRGTGSPHAYVVSKHGLEGLTKNTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG++GIRVNCVSPY V T M + YF L E+   + YS+LKG  L+  D+AEA L+LA DE
Sbjct  181  LGQFGIRVNCVSPYLVATPMLKKYFNLDEEGVREAYSNLKGSYLVPNDVAEAALFLAGDE  240

Query  814  SKYVSGHNLVVDAGFSISN  870
            S YVSGH+L++D G++I+N
Sbjct  241  SNYVSGHSLLLDGGYTITN  259



>ref|XP_002523206.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF39237.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=270

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 180/269 (67%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQS-----  285
            M ++ LL  AA+RLEGKVA+ITG    IG   A+ FC+HGAKV+IAD +DD  QS     
Sbjct  1    MATNLLLPPAARRLEGKVALITGAATSIGECIARSFCKHGAKVVIADIQDDLGQSVAKDH  60

Query  286  -----FFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+ ESDV++AV+ AVS  G+LDIMVNNA     +   I+D D  D    
Sbjct  61   GQDVAMFVHCDVSVESDVKNAVDTAVSIFGKLDIMVNNAATGEPRKPSIVDNDLADVERA  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +G FLGTKHAARVM P ++GSII   SV   +GG   H+YT +KH IVGL +N A
Sbjct  121  LRVNLIGPFLGTKHAARVMIPARQGSIITLGSVCSSVGGVASHSYTIAKHGIVGLARNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGR+GIRVN +SPY + T ++   F   ED +  VYS+L+GV L  ED+AEA +YLAS
Sbjct  181  AELGRFGIRVNYLSPYFIETPLSMKLFEEEEDGRSGVYSNLEGVKLKQEDVAEAAIYLAS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            DESK+VSGHNL +D GF+  N A  LF++
Sbjct  241  DESKFVSGHNLALDGGFTTINPAFGLFSR  269



>ref|XP_009605455.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nicotiana tomentosiformis]
Length=250

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 159/233 (68%), Gaps = 11/233 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRD----------DESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F  HGAKV+IAD +D          D + + FVHCD+T E D+++A N AV  +G+LDI
Sbjct  17   LFSIHGAKVVIADIQDELAQKVCKDLDPTSTTFVHCDITKEEDLENAANTAVDKYGKLDI  76

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI+G   S+IL+ +  +F  V  VN +G FLGTK AARVM P  RGSII TAS+ 
Sbjct  77   MYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVMIPNGRGSIITTASIT  136

Query  553  GFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYTCSKH ++GLT+N A+DLGR+GIRVNCVSPY V T +A  Y  ++    
Sbjct  137  ATIGGSGSHAYTCSKHGVLGLTRNAAVDLGRFGIRVNCVSPYLVLTPLALDYLKMNGKKA  196

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             DVYS+L G  L  +D+AE  L+LASDESKYVSG N +VD GF+  N  L++F
Sbjct  197  SDVYSTLNGATLTPKDVAETALFLASDESKYVSGQNFIVDGGFTAENPGLSIF  249



>ref|XP_006430116.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43356.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=312

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 169/236 (72%), Gaps = 14/236 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            VF Q GAKV+IAD ++            S S +VHCDVT+ES +++A+++ V+THG+LDI
Sbjct  72   VFAQQGAKVVIADIQEQLGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKLDI  131

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI GA  + I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TASV+
Sbjct  132  MFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTASVS  191

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +G    HAY C+KHA++GLTKN A++LG++GIRVNC+SPYA+ T +A S+ G++++D 
Sbjct  192  SRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCLSPYALATPLATSFVGITDEDL  251

Query  730  ---FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
                +  ++LKGV L  EDIA A LYLASDE+KYVSGHNL +D GF+I N +L +F
Sbjct  252  EGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSGHNLFIDGGFTIVNPSLGMF  307



>ref|XP_004136701.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004164972.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=278

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 186/273 (68%), Gaps = 17/273 (6%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------  273
            M S+ ++ST    +RLEGKVA+ITGG  GIG  TAK+F  HGAKV+IAD +DD       
Sbjct  1    MASNEIISTTTWQRRLEGKVALITGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCA  60

Query  274  ----ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDF  441
                 + S +VHCDVT ES VQ AV  AV T G+LDIM+NNAGI       I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTEESQVQEAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDF  120

Query  442  VNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  618
              V  +N  G FLG KHAA+ M P + GSI++TASVA + GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLSINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYTGGSASHAYTCSKHAVVGLTK  180

Query  619  NTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEA  789
            N A++LG++GIRVNC+SP+A+ T +A  + GL   +   +  S   LKGV L AED+A A
Sbjct  181  NAAVELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANA  240

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             L+LASDES+YVSGHNL +D GFSI N  +++F
Sbjct  241  ALFLASDESRYVSGHNLFIDGGFSIVNPNIDIF  273



>gb|AHH81853.1| short-chain alcohol dehydrogenase [Perilla frutescens]
Length=277

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 191/271 (70%), Gaps = 16/271 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M   S LS+  +RLEGKVA+ITGG  GIG +TAK+F +HGAKV I D  D+         
Sbjct  1    MAYFSTLSSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
              S S ++HCDVT+E DV++AV+K VST+G+LDIM NNAGI       I+D +  DF  V
Sbjct  61   GPSNSTYIHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G F G KHAARVM P + G+II+TAS+A  MGG   HAYTCSKHA+VGLT+N+A
Sbjct  121  LAVNVTGVFQGMKHAARVMIPARGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY----SSLKGVDLMAEDIAEAVL  795
            ++LG+YGIRVNC+SPYA+ + ++R Y G+ ED++ +      ++LKG  L A+DIA A L
Sbjct  181  IELGQYGIRVNCMSPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAAL  239

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            +LASD++KYVSG NL +D GF+I N A+ +F
Sbjct  240  FLASDDAKYVSGQNLFIDGGFTIFNSAMQVF  270



>ref|XP_007027886.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY08388.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=276

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 192/270 (71%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            MV+SSL+S   +RLEGKVA+ITGG  GIG  TAKVF  HGAKV+IAD +D+   S     
Sbjct  1    MVASSLISAVTRRLEGKVALITGGASGIGKCTAKVFAHHGAKVVIADIQDELGHSVCEAV  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  +VHC+VT E  +++AV+KAV+THG+LDIM NNAGI     + I+D + +DF  V
Sbjct  61   GPSNCSYVHCNVTDEDQIKNAVDKAVATHGKLDIMFNNAGITDPIKARIIDNEKSDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM P + GSII+TASV+  +G    HAY  SKHA++GLT+N A
Sbjct  121  LSVNVTGVFLGIKHAARVMVPARSGSIISTASVSSTVGAAATHAYCASKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SP+A+ T +A    G+++++      + ++LKGV L AEDIA A LY
Sbjct  181  VELGQFGIRVNCLSPFALATPLATEVLGINDEELEKGMGLVANLKGVTLKAEDIANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LAS+E +YVSGHNL VD GF+I N +L++F
Sbjct  241  LASEEGRYVSGHNLFVDGGFTIFNPSLSMF  270



>ref|XP_006359043.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 170/243 (70%), Gaps = 21/243 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRD-----------DESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV I D +D           DE  + F+HCDVTSE+DV +AV+ AV   G LD
Sbjct  37   LFHKHGAKVCIVDIQDELGQRVCESLGDEESACFIHCDVTSETDVSNAVDFAVEKFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG+ GA  S+ILD D + F NV  VN  G FLG KHAAR+M P +RGSI++ +SV
Sbjct  97   IMVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMIPRKRGSIVSLSSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE--  720
            AG +GG  PHAYT SK A++GLT+N A ++G++GIRVNCVSPYAV T++  S+    +  
Sbjct  157  AGSIGGLGPHAYTASKFAVLGLTQNVAAEMGKHGIRVNCVSPYAVATELGLSHLPPEQRN  216

Query  721  DDK-------FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            DD        F  +++LKGVDLMA+D+A AVL+LASDE++Y+SGHNL VD GFS  N +L
Sbjct  217  DDAIADFNSYFGKFANLKGVDLMAQDVANAVLFLASDEARYISGHNLKVDGGFSSVNHSL  276

Query  880  NLF  888
             +F
Sbjct  277  KVF  279



>ref|XP_009387285.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/265 (53%), Positives = 188/265 (71%), Gaps = 15/265 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+S+LS+  +RLEGKVA+ITGG  GIG  TAK+F QHGA+V++ D +DD+  S     
Sbjct  1    MGSTSILSSIVRRLEGKVALITGGASGIGECTAKLFAQHGARVVVVDIQDDKGHSLCADL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  +VHCDVT E+DV+ AV+ AVS HG+LDIM NNAG++    S  L+C+ + F  V
Sbjct  61   GPAVASYVHCDVTIEADVKHAVDTAVSLHGKLDIMFNNAGVVDDLSSGFLNCEKSAFEMV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFPH-AYTCSKHAIVGLTKNTA  627
              VN LGA+LGTKHAARVM P + GSI+ TAS A  MGG    AYTCSKHA+VGL +  A
Sbjct  121  VAVNVLGAYLGTKHAARVMAPARAGSIVTTASAASVMGGLASPAYTCSKHAVVGLMRCAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF----DVYSSLKGVDLMAEDIAEAVL  795
             +LG + +R NCVSP+AV T MA++  G ++D++     +  ++LKG  L A+D+AEAVL
Sbjct  181  AELGPFRVRANCVSPHAVATPMAKTALGFTDDEELERLVEATANLKGTMLKAQDLAEAVL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISN  870
            YL SD+S+YV+GHNL+VD GF+++ 
Sbjct  241  YLGSDKSRYVNGHNLLVDGGFTVTK  265



>ref|XP_010059374.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=321

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 182/271 (67%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS +S A KRLEGKVA+ITGG  GIG  TA+VF  HGAKV+IAD  D    S     
Sbjct  45   MAGSSFISAATKRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDSL  104

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHC+VT ES  ++AV +AVST G+LDIM NNAGI G   + I+D D  DF  V
Sbjct  105  GRDTASFVHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERV  164

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M P +RG IINTAS++  +GG   HAYTC+KHA++GLT+N A
Sbjct  165  LAVNVTGVFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAA  224

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA  T +A  + G+     +      ++LKGV L AED+A A L+
Sbjct  225  VELGQFGIRVNCLSPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAALF  284

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            LA DE++YVSGHNL +D GFS+ N +  +F 
Sbjct  285  LAGDEARYVSGHNLFIDGGFSVVNPSFRMFQ  315



>ref|XP_006651946.1| PREDICTED: zerumbone synthase-like [Oryza brachyantha]
Length=297

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 184/270 (68%), Gaps = 25/270 (9%)
 Frame = +1

Query  148  AAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ-----------SFFV  294
            AAKRLEGKVA++TGG  GIG A  ++F +HGAKV IAD +D+  Q           + F+
Sbjct  28   AAKRLEGKVALVTGGASGIGEAIVRLFREHGAKVCIADIKDEAGQKLWDSLGGDQHALFL  87

Query  295  HCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGA  474
            HCDVT E +V  AV+      G LDI+VNNAGI G K++DI + D  +F  V  +N +G 
Sbjct  88   HCDVTVEEEVSRAVDATAEKFGTLDIIVNNAGITGNKITDIRNVDFAEFRKVIDINLVGV  147

Query  475  FLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGI  651
            F G KHAARVM P +RGSII+ ASVA  MGG  PHAYT SKHA+VGLTKN A +LG++GI
Sbjct  148  FHGMKHAARVMIPNKRGSIISLASVASVMGGLGPHAYTASKHAVVGLTKNVAAELGKHGI  207

Query  652  RVNCVSPYAVPTQMARSYFGLSEDDKFD-----------VYSSLKGVDLMAEDIAEAVLY  798
            RVNCVSPYAVPT ++  Y  L ED++ D             ++LKGVDL+ +D+AEAVLY
Sbjct  208  RVNCVSPYAVPTALSMPY--LPEDERKDDALKGFLAFVGGEANLKGVDLLPKDVAEAVLY  265

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE++YVS  NL+VD GF+  NL L  F
Sbjct  266  LASDEARYVSALNLMVDGGFTSVNLNLRAF  295



>gb|KDO35956.1| hypothetical protein CISIN_1g046809mg, partial [Citrus sinensis]
Length=269

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 169/236 (72%), Gaps = 14/236 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            VF Q GAKV+IAD +++           S S +VHCDVT+ES +++A+++ V+THG+LDI
Sbjct  29   VFAQQGAKVVIADIQEELGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKLDI  88

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI G   + I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TASV+
Sbjct  89   MFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTASVS  148

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +G    HAY C+KHA++GLTKN A++LG++GIRVNC+SPYA+ T +A S+ G++++D 
Sbjct  149  SRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCLSPYALATPLATSFVGITDEDL  208

Query  730  ---FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
                +  ++LKGV L  EDIA A LYLASDE+KYVSGHNL +D GF+I N +L +F
Sbjct  209  EGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSGHNLFIDGGFTIVNPSLGMF  264



>ref|XP_010104811.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01952.1| Momilactone A synthase [Morus notabilis]
Length=272

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 187/270 (69%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRD----------  270
            M ++SLLS  ++RLEGKVA+ITGG  GIG  TAKVF  HGAK++IAD +D          
Sbjct  1    MATTSLLSAVSRRLEGKVAVITGGASGIGECTAKVFAHHGAKLIIADIQDALGHSLCQSI  60

Query  271  DESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
            DE+   +VHCDVT E+ V++AV+KAV  +G+LDI+ NNAG        IL     DF  V
Sbjct  61   DETNCKYVHCDVTDETHVKNAVDKAVKAYGKLDIIFNNAGTSDKSYLRILKDQKNDFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHA+RVM P + GSII+TASV  ++GG   HAYT SKHA++GLTK+ A
Sbjct  121  MSVNATGVFLGIKHASRVMIPARSGSIISTASVCSYIGGAASHAYTASKHAVLGLTKSAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVLY  798
            ++LG+YGIRVNC+SPY V T +   + G  + D  +++SS   LK V L AED+A A LY
Sbjct  181  VELGQYGIRVNCLSPYGVATPLVEKFLGRKKGDIENLFSSAANLKNVTLEAEDVANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE++Y+SGHNL VD G+SI+N + N+F
Sbjct  241  LASDEARYISGHNLFVDGGYSIANPSFNMF  270



>ref|XP_010104809.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01950.1| Momilactone A synthase [Morus notabilis]
Length=277

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 187/271 (69%), Gaps = 15/271 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +   LS   +RLEGKVA+ITGG  GIG  TAKVF  HGAK++IAD +DD         
Sbjct  1    MATIPSLSAVPRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGYSVVESI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             ++   +VHCDVT ES V++AV++AV T+G+LDIM+NNAGI     + I+D +  DF  V
Sbjct  61   GQTSCKYVHCDVTDESHVKNAVDEAVKTYGKLDIMLNNAGIADENKARIIDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM P +RGSII TAS+   + GG  HAYT SKHA++GL +N A
Sbjct  121  MSVNVTGVFLGIKHAARVMIPARRGSIITTASMCSHIGGGSSHAYTASKHAVLGLARNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE----DDKFDVYSSLKGVDLMAEDIAEAVL  795
            ++LG++GIRVNC+SP+ + T M   YFG +     ++ F  + +LK V L AED+A A L
Sbjct  181  VELGQFGIRVNCLSPFPLLTPMTSKYFGSTNQEVLENTFKSWGNLKHVTLKAEDVANAAL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            YLASDE+ Y+SGH+L++D GFSI N +LNLF
Sbjct  241  YLASDEANYISGHSLLIDGGFSIVNPSLNLF  271



>gb|AAK83036.1|AF286651_1 TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 185/269 (69%), Gaps = 14/269 (5%)
 Frame = +1

Query  124  VSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRD----------D  273
            +S  LL   A+RLEGKVA+ITGG  GIG  TAK+F +HGAKV+IAD +D           
Sbjct  1    MSIQLLPAIARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLG  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVS-DILDCDATDFVNV  450
            +S S FVHCDVT E DV++AV+ AVS +G+LDIM+NNAG+     + D L  D   F  V
Sbjct  61   QSSSVFVHCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDFLKDDPLTFQRV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN +GAFLGTKHAARVMKP  RGSI+ TAS+   +GG   HAYT SKH ++GL +N A
Sbjct  121  VNVNLVGAFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLM-AEDIAEAVLYL  801
            +DLGRYGIRVNCVSP  VPT+M R  F + +  +F   Y SLK  D++  ED+ EAV+YL
Sbjct  181  VDLGRYGIRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYL  240

Query  802  ASDESKYVSGHNLVVDAGFSISNLALNLF  888
             SDESK VSG NL+VD GF++ N AL  F
Sbjct  241  GSDESKCVSGLNLIVDGGFTVVNQALCSF  269



>ref|XP_004169912.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
Length=274

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 188/268 (70%), Gaps = 14/268 (5%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQ  282
             LL  AA+RLEGKVAIITGG  GIG + AK F  HGAKV+IAD  DD           S 
Sbjct  4    PLLPAAARRLEGKVAIITGGARGIGESIAKHFFNHGAKVVIADILDDLGNSLSNHLSSSS  63

Query  283  SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVN  462
            + FVHC+VT E+DV++ VN AVS +G+LDIM NNAGI GA   +IL+ + +DF NV  VN
Sbjct  64   TSFVHCNVTKETDVENVVNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVN  123

Query  463  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLG  639
             +GAFLGTKHAA+ M P  +GSII TASV   +GG  P+AYT SKH ++GL +N  +DLG
Sbjct  124  LVGAFLGTKHAAKAMIPAGQGSIIITASVCSSIGGIGPYAYTSSKHGLLGLMRNATIDLG  183

Query  640  RYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYS-SLKGVDLM-AEDIAEAVLYLASD  810
            RYGI+VNCVSP+ VPTQM R +F L + D+F DVYS + K  D++  ED+AE  LYLASD
Sbjct  184  RYGIKVNCVSPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLYLASD  243

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             S++VSGHN V+D GF+  N  L  + Q
Sbjct  244  ASRFVSGHNFVLDGGFTAGNQGLCSYQQ  271



>ref|XP_009605456.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=263

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 179/257 (70%), Gaps = 11/257 (4%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ----------SFFVHC  300
            A+RLEG+VAIITG   GIG A A++F +H AKV+IAD +DD SQ          + FVHC
Sbjct  6    ARRLEGRVAIITGAASGIGEAAARLFSKHRAKVVIADIQDDLSQKVCKELDPSSTTFVHC  65

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E ++++AVN AVS +G+LDIM NNAGI+GA  S+ILD + ++F  V  +N +G FL
Sbjct  66   DVTKEEELENAVNIAVSKYGKLDIMYNNAGIMGAVKSNILDNEKSEFEKVISINLVGTFL  125

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G K AARVM P ++GSII T SV   +GG  PHAYT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKQAARVMIPRRQGSIIVTGSVCSSIGGVCPHAYTSSKHGVLGLTRNAAVDLGRYGIRV  185

Query  658  NCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
            NCVSPY V TQMA         +  DVYS+L G  L   D+AE  ++LASDESK VSG +
Sbjct  186  NCVSPYVVLTQMAFDSLKKMGKEGSDVYSTLNGAILTPNDVAETAVFLASDESKCVSGQD  245

Query  838  LVVDAGFSISNLALNLF  888
             V+D GF+I N   +LF
Sbjct  246  FVIDGGFTIENSGFSLF  262



>ref|XP_007132473.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
 gb|ESW04467.1| hypothetical protein PHAVU_011G097000g [Phaseolus vulgaris]
Length=269

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 184/267 (69%), Gaps = 9/267 (3%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M   S++S A KRLEGKVAIITGG  GIG ATA++F +HGA V+IAD +DD   S     
Sbjct  1    MAHVSVVSAAVKRLEGKVAIITGGASGIGEATARLFSEHGAHVVIADIQDDLGLSLCNEL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E DV++ VN AVS +G+LDIM NNAG        ILD   +DF  V  
Sbjct  61   ESAVYVHCDVTEEEDVENCVNIAVSKYGKLDIMFNNAGSSDLFKRSILDNTKSDFERVLS  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALD  633
            VN +G FLGTKHAARVM P +RG IINTAS+AG +GG   HAYT +KH ++GL KNTA++
Sbjct  121  VNLVGPFLGTKHAARVMIPAKRGCIINTASIAGCIGGGATHAYTSAKHGLLGLMKNTAVE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDE  813
            LG +GIRVNCVSP+ V T +   YF L+E+     Y++LKG   +A D+AEA LYLASDE
Sbjct  181  LGEFGIRVNCVSPHLVVTPLLNKYFNLNEEGARKSYTNLKGWHPVANDVAEAALYLASDE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNLFNQ  894
            SKYVS  N+V+D G + SN+   +F +
Sbjct  241  SKYVSSLNIVLDGGLTNSNVGFPMFGK  267



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   243 bits (620),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 185/268 (69%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S S  + AA+RLEGKVA+ITGG  GIG+ TAK+F +HGAKV+IA+ +DD         
Sbjct  1    MASISAFTAAARRLEGKVALITGGASGIGACTAKLFTKHGAKVMIAEIQDDLGLSVCKSL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKV-SDILDCDATDFVN  447
              S + ++HCDVT+E  VQ+AV+  V+ + +LDIM NNAGI G+    +ILD   +DF  
Sbjct  61   DPSVASYIHCDVTNEDHVQNAVDSTVAKYKKLDIMFNNAGIAGSHPKPNILDITQSDFEE  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNT  624
                N +G FLGTKHAARVM P ++GSII TASV   +GG  PHAYT SKH ++GLT++T
Sbjct  121  TVKTNLIGPFLGTKHAARVMIPARQGSIITTASVCSIIGGVAPHAYTSSKHGVLGLTRST  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
             ++ G+YGIRVNCVSP+AVPT +   +  L ++    +YS+LKG     ED+A A L+LA
Sbjct  181  TVEFGQYGIRVNCVSPHAVPTPLFNKFLQLDDEGISKIYSNLKGTWCKVEDVANAALFLA  240

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            SD+SKYVSGHNL VD GF+I N    +F
Sbjct  241  SDDSKYVSGHNLTVDGGFTIMNSGFCMF  268



>ref|XP_007043248.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99079.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 187/267 (70%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  +S L  AA+RLEGKVA+ITGG  GIG   A++FC+HGAKV+IAD +D+  QS     
Sbjct  1    MACASRLPPAARRLEGKVALITGGASGIGECIARLFCEHGAKVIIADIQDELGQSVCKDI  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCD+  ESDV+ AVN A+S HG+LDIMVNNA ++      I++ +  DF  V
Sbjct  61   GLAVASFVHCDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAARVM P ++GSII+  SV+  +GG   HAYT SKHAI+GLTKN A
Sbjct  121  ISVNLTGVFLGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHAILGLTKNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGR+GIRVNC+S Y + T+ A ++F L  D++  VYS+LKGV L  ED+A+A LYL S
Sbjct  181  AELGRFGIRVNCLSSYFIATRSAMNFFKLDGDERPRVYSNLKGVVLQQEDVADAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKYVSGHNL VD GF+  N A  LF
Sbjct  241  DESKYVSGHNLAVDGGFTTINPAFGLF  267



>ref|XP_010104810.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01951.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 190/270 (70%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M ++SLLS  ++RL+GKV +ITGG  GIG + AK+F  HGAKV+IAD +D+         
Sbjct  1    MATTSLLSAVSRRLDGKVVLITGGASGIGESAAKLFAHHGAKVVIADIQDNLGHSVCESI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             ++ S +VHCDVT ES V++AV++A+ T+G+LDIM NNAGI+      I + +   F +V
Sbjct  61   GQTNSKYVHCDVTDESQVKNAVDEAIKTYGKLDIMFNNAGIIDKSSPRITENEKAVFEHV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAARVM P + G II+TAS++  +GG   HAYTC+KHA++GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAARVMIPARSGCIISTASLSSCIGGTASHAYTCAKHAVLGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNCVSP+ V T MA  Y G S +D        ++LK V L AED+A A L+
Sbjct  181  VELGQFGIRVNCVSPFGVATPMAIKYAGSSAEDLENGMSFLANLKNVTLKAEDVANAALF  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            ++SDE +Y+SGHNL++D GF+I+N + N+F
Sbjct  241  ISSDEGRYISGHNLLIDGGFAIANPSFNMF  270



>ref|XP_010050120.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 185/268 (69%), Gaps = 13/268 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +++LL   A+RLEGKVA+ITGG GGIG +TA++F +HGAKV+IAD RDD         
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDL  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
              E+ SF VHCDV+ ESDV++A+  AV   G+LDIMVNNA I     ++ILD D  DF  
Sbjct  61   GAETASF-VHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFER  119

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHA+VGLT+N 
Sbjct  120  VISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNV  179

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A +LGRYGIRVNCVSPY + T + + +F + E     VYS+L GV L  ED+A+A +YL 
Sbjct  180  AAELGRYGIRVNCVSPYFILTPLTKEFFKVDESSGVRVYSNLDGVSLQEEDVAKAAVYLG  239

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLF  888
            SDESKYVSG NL VD GF+  N A  LF
Sbjct  240  SDESKYVSGQNLAVDGGFTTINPAFGLF  267



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 165/238 (69%), Gaps = 16/238 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            VF  HGAKV++AD +D+           S S +VHCDVT E+ V++AVN AV+T+G+LDI
Sbjct  31   VFAHHGAKVVVADIQDESGRSLAKALGPSNSTYVHCDVTDEAQVKNAVNAAVTTYGKLDI  90

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI     + I+D +  DF  V   N  G FLG KHAARVM P + G+II+TASV+
Sbjct  91   MFNNAGIADESKARIIDNEKVDFERVLQTNVTGVFLGIKHAARVMIPGRNGTIISTASVS  150

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +G    HAY CSKHA++GLTKN A++LG++GIRVNC+SPYA+ T +A+   GL +D++
Sbjct  151  SKVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIRVNCLSPYALATPLAKQVIGL-DDEQ  209

Query  730  FD----VYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
             +     + +LKGV L AED+A A LYLASDE++YVSGHNL +D GF+I N +  +F 
Sbjct  210  LENLMHAFGTLKGVTLQAEDVANAALYLASDEARYVSGHNLFIDGGFTIQNPSFRMFQ  267



>ref|XP_008442883.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Cucumis melo]
Length=275

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 193/273 (71%), Gaps = 17/273 (6%)
 Frame = +1

Query  121  MVSSSL--LSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------  273
            M SS +  L+T  +RLEGKVA+ITGG  GIG  TAK+F  HGAKV+IAD +DD       
Sbjct  1    MTSSEVISLTTGQRRLEGKVALITGGASGIGECTAKIFVHHGAKVVIADIQDDLGHALCA  60

Query  274  ----ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDF  441
                 + S +VHCDVT ES VQ+AV  AV T G+LD+M+NNAGI+      I+D D +DF
Sbjct  61   NVLGSTNSLYVHCDVTDESQVQAAVAAAVETFGKLDVMMNNAGIVDPSKPRIIDNDRSDF  120

Query  442  VNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  618
              V  +N  G FLG KHAA+ M P + GSI++TASVA ++GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLNINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTK  180

Query  619  NTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEA  789
            N A++LG++GIRVNC+SPYA+ T +A  + GL+  +  +V  S   LKGV L AED+A A
Sbjct  181  NAAVELGQFGIRVNCLSPYALVTPLATKFVGLNGAEFEEVMGSKANLKGVTLKAEDVANA  240

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             L+LASDES+YVSGHNL++D GFSI N  +N+F
Sbjct  241  ALFLASDESRYVSGHNLLIDGGFSIVNPNINIF  273



>ref|XP_009773000.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=263

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 179/257 (70%), Gaps = 11/257 (4%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ----------SFFVHC  300
            A+RLEGKVA+ITG   GIG A A++F +HGAKV+IAD +DD +Q          + FVHC
Sbjct  6    ARRLEGKVAVITGAASGIGEAAARLFSRHGAKVVIADIQDDLAQKVCKELDTSSTTFVHC  65

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            +VT E D+++AVN AVS +G+LDIM NNAGI+GA  S+ILD + ++F  V  VN +G FL
Sbjct  66   NVTKEEDLENAVNIAVSKYGKLDIMYNNAGIMGAIKSNILDNEKSEFEKVISVNLVGTFL  125

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G K AARVM P ++GSII T SV   +GG   HAYT SKH ++GL +N  +DLGRYGIRV
Sbjct  126  GIKQAARVMIPRRQGSIIVTGSVCSSIGGVCSHAYTSSKHGVLGLARNATVDLGRYGIRV  185

Query  658  NCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
            NCVSPYAV TQMA         + +DVYS+L G  L  +D+AE  ++LASDESK  SG +
Sbjct  186  NCVSPYAVLTQMAFDSLKKMGKEGWDVYSTLNGATLTPKDVAETAVFLASDESKCFSGQD  245

Query  838  LVVDAGFSISNLALNLF  888
             ++D GF+I N   +LF
Sbjct  246  FIIDGGFTIENSGFSLF  262



>gb|AAK83035.1|AF286650_1 CTA [Cucumis sativus]
Length=271

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 185/269 (69%), Gaps = 14/269 (5%)
 Frame = +1

Query  124  VSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRD----------D  273
            +S  LL   A+RLEGKVA+ITGG  GIG  TAK+F +HGAKV+IAD +D           
Sbjct  1    MSIQLLPAIARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDHLGQTLCKDLG  60

Query  274  ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVS-DILDCDATDFVNV  450
            +S S FVHCDVT E DV++AV+ AVS +G+LDIM+NNAG+     + DIL  D   F  V
Sbjct  61   QSSSVFVHCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDILKDDPLTFQRV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
              VN +GA LGT+HAARVMKP  RGSI+ TAS+   +GG   HAYT SKH ++GL +N A
Sbjct  121  VNVNLVGASLGTRHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDLM-AEDIAEAVLYL  801
            +DLGRYGIRVNCVSP  VPT+M R  F + +  +F   Y SLK  D++  ED+ EAV+YL
Sbjct  181  VDLGRYGIRVNCVSPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYL  240

Query  802  ASDESKYVSGHNLVVDAGFSISNLALNLF  888
             SDESK VSG NL+VD GF++ N AL  F
Sbjct  241  GSDESKCVSGLNLIVDGGFTVVNQALCSF  269



>gb|KCW58914.1| hypothetical protein EUGRSUZ_H01537, partial [Eucalyptus grandis]
Length=235

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 155/230 (67%), Gaps = 11/230 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD  DD  +S           FVHCDV+SE DV++AV  AV  HG+LDI
Sbjct  5    LFSKHGAKVIIADINDDLGKSVCKNLGPETASFVHCDVSSEPDVENAVATAVDKHGKLDI  64

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            MVNNA I      +ILD D  DF  V  VN  G FLGTKHAAR M P QRGSIIN  SV+
Sbjct  65   MVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVFLGTKHAARAMIPSQRGSIINVGSVS  124

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAY  SKHAIVGL++N A +LGRYGIRVNC+SPY + T +    F L E+ +
Sbjct  125  SSVGGVASHAYASSKHAIVGLSRNAAAELGRYGIRVNCLSPYFIRTPLTEEMFKLDENPE  184

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            F VYS+L GV L  ED+AEA L+L SDESKY+SGHNL VD GF+  N A 
Sbjct  185  FRVYSNLDGVTLQEEDVAEAALFLGSDESKYISGHNLAVDGGFTTINPAF  234



>ref|XP_003539841.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN21178.1| Momilactone A synthase [Glycine soja]
Length=273

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 161/235 (69%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRD----------DESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD +D          D S + ++HCDVT E +++ AVN  VS +G+LDI
Sbjct  37   LFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTKEENIEHAVNTTVSKYGKLDI  96

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M ++AGI+GA    IL    + F  V  VN +G FLG KHAARVM P  RGSI+  AS+ 
Sbjct  97   MHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKHAARVMIPSGRGSIVAMASIC  156

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
            G +GG   HAYT SKH IVGL +NTA++LG  GIRVN VSPYAVPT M++++    ++  
Sbjct  157  GRIGGVASHAYTSSKHGIVGLVRNTAVELGTLGIRVNSVSPYAVPTPMSKTFLNTDDEGI  216

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
              +YS+LKG  L  +D+AEAVLYL SDESKYVSGH+LVVD GF++ N  L +F Q
Sbjct  217  AALYSNLKGTVLKPQDVAEAVLYLGSDESKYVSGHDLVVDGGFTVVNPGLCVFGQ  271



>ref|XP_002308448.2| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE91971.2| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 187/273 (68%), Gaps = 18/273 (7%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SSLL+  +KRLEGKVA+ITGG  GIG ++ ++F +HGAKV+IAD +DD   S     
Sbjct  1    MKGSSLLAPVSKRLEGKVALITGGASGIGESSTRLFVRHGAKVVIADIQDDLGHSVCEEI  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   +VHCDVT ESDV+ AVN AVS +G+LDI  +NAGILG         D  +F  
Sbjct  61   GSDESLSYVHCDVTRESDVEKAVNTAVSKYGKLDIFFSNAGILGKGDPQASAIDYDNFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG-FMGGFPHAYTCSKHAIVGLTKNT  624
            VF  N  GAFLG KHA+RVM P ++GSII T+SV    +G  PHAYT SKHAIVGLTKN 
Sbjct  121  VFDTNVYGAFLGAKHASRVMIPEKKGSIIYTSSVVSVIVGNVPHAYTASKHAIVGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYF-GLSEDDKFDVYSS---LKGVDLMAEDIAEAV  792
              +LG++GIRVNC+SP AVPT + R+ F G++ +   ++ S+   LKGV L  ED+AEA 
Sbjct  181  CAELGQFGIRVNCISPAAVPTPLMRNAFGGINRNAALEIASATAHLKGVMLEEEDVAEAA  240

Query  793  LYLASDESKYVSGHNLVVDAGFSI--SNLALNL  885
            LYLASD+SKYVSG NLVVD G S   +NLA NL
Sbjct  241  LYLASDDSKYVSGLNLVVDGGISATNTNLAGNL  273



>ref|XP_002466226.1| hypothetical protein SORBIDRAFT_01g003880 [Sorghum bicolor]
 gb|EER93224.1| hypothetical protein SORBIDRAFT_01g003880 [Sorghum bicolor]
Length=282

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 179/268 (67%), Gaps = 22/268 (8%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF------------FVH  297
            KRLEGKVA++TGG  GIG A  ++F +HGAKV IAD +D+  Q              FVH
Sbjct  14   KRLEGKVALVTGGATGIGEAIVRLFTEHGAKVCIADIQDEAGQQLRDALGGDAQGVMFVH  73

Query  298  CDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAF  477
            CDVTSE DV  AV+ A    G LD+MVNNAG+ GAKV+DI   D  +   V  +N  G F
Sbjct  74   CDVTSEEDVSRAVDAAAERFGALDVMVNNAGVTGAKVTDIRAVDFAEVRRVLDINVHGVF  133

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIR  654
            LG KHAARVM P +RGSI++ ASVA  +GG  PHAYT SKHA+VGLTK+ A +LGR+G+R
Sbjct  134  LGMKHAARVMIPQKRGSIVSLASVASAIGGLGPHAYTASKHAVVGLTKSVAAELGRHGVR  193

Query  655  VNCVSPYAVPTQMARSYF--GLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLAS  807
            VNCVSPYAVPT ++  +   G   DD    +       ++LKGVD M +D+A+AVLYLAS
Sbjct  194  VNCVSPYAVPTALSMPHLPQGARADDALTDFLAFVGGEANLKGVDAMPKDVAQAVLYLAS  253

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFN  891
            DE++YVS  NL+VD GF+  N  L  F+
Sbjct  254  DEARYVSALNLMVDGGFTAVNHNLRPFD  281



>ref|XP_004139590.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN64963.1| hypothetical protein Csa_1G168890 [Cucumis sativus]
Length=274

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 186/268 (69%), Gaps = 14/268 (5%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQ  282
             LL  AA+RLEGK AIITGG  GIG + AK F   GAKV+IAD  DD           S 
Sbjct  4    PLLPAAARRLEGKAAIITGGARGIGESIAKHFFNPGAKVVIADILDDLGNSLSNHLSSSS  63

Query  283  SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVN  462
            + FVHC+VT E+DV++ VN AVS +G+LDIM NNAGI GA   +IL+ + +DF NV  VN
Sbjct  64   TSFVHCNVTKETDVENVVNTAVSKYGKLDIMFNNAGIPGALKFNILENEYSDFQNVLNVN  123

Query  463  TLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLG  639
             +GAFLGTKHAA+ M P  +GSI+ TASV   +GG  P+AYT SKH ++GL +N  +DLG
Sbjct  124  LVGAFLGTKHAAKAMIPAGQGSIVITASVCSSIGGIGPYAYTSSKHGLLGLMRNATIDLG  183

Query  640  RYGIRVNCVSPYAVPTQMARSYFGLSEDDKF-DVYS-SLKGVDLM-AEDIAEAVLYLASD  810
            RYGI+VNCVSP+ VPTQM R +F L + D+F DVYS + K  D++  ED+AE  LYLASD
Sbjct  184  RYGIKVNCVSPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLYLASD  243

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             S++VSGHN V+D GF+  N  L  + Q
Sbjct  244  ASRFVSGHNFVLDGGFTAGNQGLCSYQQ  271



>ref|XP_004981321.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=282

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 177/267 (66%), Gaps = 21/267 (8%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-----------FVHC  300
            KRLEGKVA++TGG  GIG    ++F  HGAKV IAD +D+  Q             FVHC
Sbjct  15   KRLEGKVALVTGGASGIGETIVRLFKNHGAKVCIADIQDEAGQKLRDALGGGDDVMFVHC  74

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E DV +AV+      G LD+MVNNAGI G+KV+DI + D  +   VF +N  G F+
Sbjct  75   DVTVEEDVSAAVDAVAQRFGALDVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFM  134

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G KHAARVM P +RGSI++ ASVA  +GG  PHAYT SKHA+ GLTK+ A +LGR+G+RV
Sbjct  135  GMKHAARVMIPRKRGSIVSLASVASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRV  194

Query  658  NCVSPYAVPTQMARSYF--GLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLASD  810
            NCVSPYAVPT ++  +   G   DD    +       ++LKGVDLM ED+AEAVLYLASD
Sbjct  195  NCVSPYAVPTALSMPHLPKGARADDAVKDFLAFAGGAANLKGVDLMPEDVAEAVLYLASD  254

Query  811  ESKYVSGHNLVVDAGFSISNLALNLFN  891
            E+KYVS  NLVVD GF+  N  +  F 
Sbjct  255  EAKYVSALNLVVDGGFTSVNHDMKQFE  281



>gb|ACU18308.1| unknown [Glycine max]
Length=273

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 160/235 (68%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRD----------DESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD +D          D S + ++HCDVT E +++ AVN  VS +G+LDI
Sbjct  37   LFSKHGAKVVIADIQDELGHSICKDLDSSSATYIHCDVTKEENIEHAVNTTVSKYGKLDI  96

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M ++AGI+GA    IL    + F  V  VN +G FLG KHAARVM P  RGSI+  AS+ 
Sbjct  97   MHSSAGIVGAWNPSILHNKKSHFEQVISVNLVGTFLGIKHAARVMIPSGRGSIVAMASIC  156

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
            G +GG   HAYT SKH IVGL +NTA++LG  GIRVN VSPYAVPT M++++    ++  
Sbjct  157  GRIGGVASHAYTSSKHGIVGLVRNTAVELGTLGIRVNSVSPYAVPTPMSKTFLNTDDEGI  216

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
              +YS+LKG  L  +D+AEAVLYL SDESKYVSGH+LVVD GF+  N  L +F Q
Sbjct  217  AALYSNLKGTVLKPQDVAEAVLYLGSDESKYVSGHDLVVDGGFTAVNPGLCVFGQ  271



>gb|KCW83009.1| hypothetical protein EUGRSUZ_C04391, partial [Eucalyptus grandis]
Length=287

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 186/265 (70%), Gaps = 11/265 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +++LL   A+RLEGKVA+ITGG GGIG +TA++F +HGAKV+IAD RDD  +S     
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+ ESDV++A+  AV   G+LDIMVNNA I     ++ILD D  DF  V
Sbjct  61   GAETASFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHAIVGLT+N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGRYGIRVNC+SPY + T + + +F + E+    VYS+L GV L  ED+A+A +YL S
Sbjct  181  SELGRYGIRVNCLSPYFILTPLTKEFFKIDENAGVRVYSNLDGVSLQEEDVAKAAVYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALN  882
            DESKYVSG NL VDAGF+  N+ ++
Sbjct  241  DESKYVSGQNLAVDAGFTTINIIID  265



>ref|XP_010051779.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=318

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 186/265 (70%), Gaps = 11/265 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +++LL   A+RLEGKVA+ITGG GGIG +TA++F +HGAKV+IAD RDD  +S     
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFSKHGAKVIIADIRDDLGKSVCVDL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDV+ ESDV++A+  AV   G+LDIMVNNA I     ++ILD D  DF  V
Sbjct  61   GAETASFVHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPLKANILDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHAIVGLT+N A
Sbjct  121  ISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAIVGLTRNVA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGRYGIRVNC+SPY + T + + +F + E+    VYS+L GV L  ED+A+A +YL S
Sbjct  181  SELGRYGIRVNCLSPYFILTPLTKEFFKIDENAGVRVYSNLDGVSLQEEDVAKAAVYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALN  882
            DESKYVSG NL VDAGF+  N+ ++
Sbjct  241  DESKYVSGQNLAVDAGFTTINIIID  265



>gb|EMT02624.1| Xanthoxin dehydrogenase [Aegilops tauschii]
Length=285

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 158/244 (65%), Gaps = 21/244 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F QHGAKV IAD +D+  Q             FVHCDVT E D+  AV+      G LD
Sbjct  41   LFRQHGAKVCIADVQDEAGQQLRDSLGGDPDVLFVHCDVTVEEDISRAVDATAEKFGTLD  100

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAGI G KV+DI + D  D   VF +N  G  LG KHAARVM P ++GSI++ ASV
Sbjct  101  IMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGMLLGMKHAARVMIPSKKGSIVSLASV  160

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PHAYT SKHA+VGLTK+ AL+LGR+GIRVNCVSPYAVPT ++  +    E  
Sbjct  161  ASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIRVNCVSPYAVPTALSMPHLPQGEQK  220

Query  727  KFDVY---------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
               V          ++LKGVDL+ +D+AEAVLYLASDE++Y+S  NLVVD GF+  N  L
Sbjct  221  GDAVRDFLAFVGSEANLKGVDLLPKDVAEAVLYLASDEARYISALNLVVDGGFTSVNGNL  280

Query  880  NLFN  891
              F 
Sbjct  281  KAFE  284



>ref|XP_010917564.1| PREDICTED: momilactone A synthase-like [Elaeis guineensis]
Length=270

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 194/266 (73%), Gaps = 14/266 (5%)
 Frame = +1

Query  136  LLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF---------  288
            +L++AA+RLEGKVA+ITGG  GIG ATAK+F +HGA+V+IAD +DD+ ++          
Sbjct  1    MLTSAARRLEGKVALITGGASGIGEATAKLFTRHGARVMIADVQDDKGRALCESLGSSVA  60

Query  289  -FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNT  465
             +VHCD+T ES V+ AV+ AVS HG+LDIM NNAGI+G+    IL  +  DF  V  +N 
Sbjct  61   SYVHCDMTDESHVRDAVDAAVSRHGKLDIMFNNAGIIGSPCMQILKSEKADFERVVGINL  120

Query  466  LGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGR  642
            +G++LGTKHAARVM P +RGSI+ TASVA       P AYTCSKHA++GL ++ A++LG+
Sbjct  121  VGSYLGTKHAARVMIPARRGSIVMTASVASVDPAMTPVAYTCSKHAVLGLMRSAAVELGQ  180

Query  643  YGIRVNCVSPYAVPTQMARSYFGLSEDDKFDV---YSSLKGVDLMAEDIAEAVLYLASDE  813
            +G+RVNCVSPYA+ T +A + FG+  ++  D    ++ LKGV L AEDIAEAVL+L S+E
Sbjct  181  FGVRVNCVSPYALATPLAATAFGMGGEELEDFMHEHAILKGVRLKAEDIAEAVLFLGSEE  240

Query  814  SKYVSGHNLVVDAGFSISNLALNLFN  891
            +KYVSG NL+VD GF+ +N +  LF 
Sbjct  241  AKYVSGLNLLVDGGFTTANPSHGLFK  266



>gb|KCW83006.1| hypothetical protein EUGRSUZ_C04389, partial [Eucalyptus grandis]
Length=265

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 183/265 (69%), Gaps = 13/265 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +++LL   A+RLEGKVA+ITGG GGIG +TA++F +HGAKV+IAD RDD         
Sbjct  1    MATTTLLPQEARRLEGKVAVITGGAGGIGESTARLFLKHGAKVIIADIRDDLGKLVCKDL  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
              E+ SF VHCDV+ ESDV++A+  AV   G+LDIMVNNA I     ++ILD D  DF  
Sbjct  61   GAETASF-VHCDVSIESDVENAIATAVDKFGKLDIMVNNAAISDPPKANILDNDKADFER  119

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  VN  G FLGTKHAAR M P + GSIIN  SV+  +GG   HAYT SKHA+VGLT+N 
Sbjct  120  VISVNLTGVFLGTKHAARAMIPSRSGSIINVGSVSSSVGGVASHAYTSSKHAVVGLTRNV  179

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            A +LGRYGIRVNCVSPY + T + + +F + E     VYS+L GV L  ED+A+A +YL 
Sbjct  180  AAELGRYGIRVNCVSPYFILTPLTKEFFKVDESSGVRVYSNLDGVSLQEEDVAKAAVYLG  239

Query  805  SDESKYVSGHNLVVDAGFSISNLAL  879
            SDESKYVSG NL VD GF+  N A 
Sbjct  240  SDESKYVSGQNLAVDGGFTTINPAF  264



>ref|XP_009399160.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 184/262 (70%), Gaps = 12/262 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S+S+LS+ A+RLEGKVA+ITGG  GIG  TAK+F +HGA+V++AD +DD+ ++     
Sbjct  1    MGSASILSSVARRLEGKVALITGGASGIGECTAKLFARHGARVIVADIQDDKGRALCAAL  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                +VHCDVT E+DV+ AV+ AV+ HG+LD+M NNAG++   V+  L  D   F  V  
Sbjct  61   GPASYVHCDVTDEADVERAVDTAVALHGKLDVMFNNAGVMDPPVNGFLASDRAAFERVMA  120

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFPH-AYTCSKHAIVGLTKNTALD  633
             N LGAFLGTKHAARVM P + GSI++TAS+   +GG    AYTCSKHA+VGL ++ A +
Sbjct  121  TNALGAFLGTKHAARVMVPARAGSIVSTASLVSAVGGVASAAYTCSKHAVVGLMRSAAAE  180

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLYLA  804
            LGR+G+R NCVSPY V T +A +   L+    +   +   +LKGV L A D+AEAVLYLA
Sbjct  181  LGRFGVRANCVSPYGVATPLAMAGMQLTTEEMEAAMEAMGNLKGVRLKAADVAEAVLYLA  240

Query  805  SDESKYVSGHNLVVDAGFSISN  870
            SDES+YVSG NL VD G S++ 
Sbjct  241  SDESRYVSGLNLTVDGGLSVTK  262



>emb|CAN68176.1| hypothetical protein VITISV_014635 [Vitis vinifera]
Length=265

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 174/236 (74%), Gaps = 13/236 (6%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHC  300
            A+RLEGKVA+ITGG GGIGS TAK+FCQHGAKVLIAD +D++  S           FVHC
Sbjct  11   ARRLEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQDEKGHSICKDLGPTSASFVHC  70

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E DV +A++KA+S +G+LDIM NNAGILG    +ILD DA +F N   VN LG FL
Sbjct  71   DVTKELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFL  130

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            GTKHAARVM P  RGSIINTASV   +GG   H+YT SKHAI+GLT+NTA++LG++GIRV
Sbjct  131  GTKHAARVMAPAGRGSIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRV  190

Query  658  NCVSPYAVPTQMARSYFGLSEDDKF-DVYSSLKGVDL-MAEDIAEAVLYLASDESK  819
            NCVSPY VPT ++R +  L EDD F +VYS+LKGV L M    A  +  + S++SK
Sbjct  191  NCVSPYLVPTSLSRKFMNLGEDDPFVNVYSNLKGVSLEMIIKDANPIGIIISNKSK  246



>sp|F1SWA0.1|ZERSY_ZINZE RecName: Full=Zerumbone synthase [Zingiber zerumbet]
 dbj|BAK09296.1| short-chain dehydrogenase/reductase1 [Zingiber zerumbet]
Length=267

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 162/243 (67%), Gaps = 21/243 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAK+ I D +D+  Q             + HCDVT E DV+ AV+     +G +D
Sbjct  24   LFIEHGAKICIVDVQDELGQQVSQRLGGDPHACYFHCDVTVEDDVRRAVDFTAEKYGTID  83

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAGI G KV DI D D  +F  VF +N  G FLG KHAAR+M P  +GSI++ ASV
Sbjct  84   IMVNNAGITGDKVIDIRDADFNEFKKVFDINVNGVFLGMKHAARIMIPKMKGSIVSLASV  143

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE--  720
            +  + G  PH YT +KHA+VGLTK+ A +LGR+GIRVNCVSPYAVPT+++  Y   SE  
Sbjct  144  SSVIAGAGPHGYTGAKHAVVGLTKSVAAELGRHGIRVNCVSPYAVPTRLSMPYLPESEMQ  203

Query  721  DDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            +D    +       ++LKGVDLM  D+AEAVLYLA++ESKYVSG NLV+D GFSI+N  L
Sbjct  204  EDALRGFLTFVRSNANLKGVDLMPNDVAEAVLYLATEESKYVSGLNLVIDGGFSIANHTL  263

Query  880  NLF  888
             +F
Sbjct  264  QVF  266



>ref|XP_008243484.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=276

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 192/270 (71%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS+LS   +RLEGKVA+ITGG  GIG  TAK+F QHGAK++IAD +DD   S     
Sbjct  1    MAFSSVLSAVTRRLEGKVALITGGASGIGECTAKIFAQHGAKIVIADVQDDLGHSVRESI  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E+ +++AV+KAV+T+G+LDIM NNAGI+    + I+D +  DF  V
Sbjct  61   GPTDCTFVHCDVTDEAQIKNAVHKAVATYGKLDIMFNNAGIVDDNKARIIDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M P + GSII+TAS++ ++GG   HAY CSKHA+ GLTKN A
Sbjct  121  LSVNVTGVFLGIKHAAQAMIPARAGSIISTASISSYVGGAASHAYCCSKHAVNGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +AR + GL +++  +  S+   LKGV L A D+A A LY
Sbjct  181  VELGQFGIRVNCLSPYALVTPLARKFVGLEDEEMENAMSALANLKGVTLKAVDVANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE++Y+SGHNL++D  FSI N   N+F
Sbjct  241  LASDEARYISGHNLLIDGAFSIVNPCFNMF  270



>ref|XP_011094266.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Sesamum indicum]
Length=284

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 180/267 (67%), Gaps = 16/267 (6%)
 Frame = +1

Query  127  SSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF------  288
            S  L+S+ AKRLEGKVA+ITGG  GIG  TA++F QHGAKV+IAD +D+  Q+       
Sbjct  8    SKELISSMAKRLEGKVAVITGGASGIGEYTARLFVQHGAKVVIADVQDELGQTACRDIGS  67

Query  289  -----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
                 +VHCDVT+E+DV++ VN AVS +G+LDIM +NAG+ G     IL  D  D   VF
Sbjct  68   SEVISYVHCDVTNETDVENVVNTAVSKYGKLDIMFSNAGVPGNNDPRILATDYEDLRRVF  127

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTAL  630
             VN  G FL  KHAARVM P +RGSI+ T+SVA    G  PHAY  SKHA+VGLTKN  +
Sbjct  128  DVNVFGGFLCAKHAARVMIPAKRGSIVFTSSVASVTHGVVPHAYVASKHAVVGLTKNLCI  187

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAEAVLY  798
            +LG YGIRVNCVSP+ V T M      L E  K +   S    LKG  + A D+AEAV++
Sbjct  188  ELGEYGIRVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAVIF  247

Query  799  LASDESKYVSGHNLVVDAGFSISNLAL  879
            L+SDE KYVSG NLV+D G+S++N+AL
Sbjct  248  LSSDEGKYVSGQNLVIDGGYSLTNIAL  274



>gb|ADK56099.1| alcohol dehydrogenase [Artemisia annua]
Length=265

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 156/235 (66%), Gaps = 13/235 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQ----------SFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV+IAD  DD  +          + FVHCDVT ESD+++ +N  ++ HG+LDI
Sbjct  31   LFVKHGAKVVIADVNDDLGKLLCQDLGSKFACFVHCDVTIESDIENLINTTIAKHGQLDI  90

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            MVNNAG +      ILD + +DF  V  +N  G FLGTKHAARVM P   GSII TAS+ 
Sbjct  91   MVNNAGTVDEPKLSILDNEKSDFDRVVSINLAGVFLGTKHAARVMIPKCSGSIITTASIC  150

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
               GG   HAYT SKH +VGL KN A +LG+Y IRVNCVSPY VPT++A  +  + E   
Sbjct  151  SVTGGVASHAYTSSKHGVVGLAKNAAAELGKYNIRVNCVSPYFVPTKLAFKFLNMDETSS  210

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
            F  YS+L+G  L  +DIA A L+LASDES YVSGHNLVVD G+S+ N A  LF+ 
Sbjct  211  F--YSNLQGKTLGPQDIANATLFLASDESGYVSGHNLVVDGGYSVLNPAFGLFSW  263



>ref|XP_004136700.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004173253.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=277

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 190/275 (69%), Gaps = 19/275 (7%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------  273
            M SS ++ST    +RLEGKVAIITGG  GIG  TAK+F  HGAKV++AD +DD       
Sbjct  1    MTSSEVISTTTGQRRLEGKVAIITGGASGIGECTAKLFVHHGAKVVVADIQDDLGRALCA  60

Query  274  ----ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDF  441
                 + S +VHCDVT ES VQ+AV  AV T G+LDIM+NNAGI       I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTDESQVQAAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKQDF  120

Query  442  VNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  618
              V  VN  G FLG KHAA+ M PV+ GSI++TASVA ++GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLSVNITGVFLGIKHAAQAMIPVKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTK  180

Query  619  NTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAE  786
            N A++LG++GIRVNC+SPY + T +A  +  L +  +F+ Y+S    LKGV L AED+A 
Sbjct  181  NAAVELGQFGIRVNCLSPYVLATPLATEFVDL-DGAEFEKYASSRANLKGVTLKAEDVAN  239

Query  787  AVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            A L+LASDES+YVSGHNL VD GFSI N  + +F 
Sbjct  240  AALFLASDESRYVSGHNLFVDGGFSIVNPNIQIFQ  274



>ref|XP_009350131.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009350149.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=276

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 194/271 (72%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS+LS  ++RLEGKVA+ITGG  GIG  TAK+F QHGAKV+IAD +DD   S     
Sbjct  1    MAFSSVLSAVSRRLEGKVALITGGASGIGECTAKIFVQHGAKVVIADVQDDLGHSVRESI  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT E+ ++ AV+K+V+T+G+LDIM NNAG++    + I+D +  DF  V
Sbjct  61   GPSDCTFVHCDVTDEAQIKDAVHKSVATYGKLDIMFNNAGVVDPNKARIIDNEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLG KHAA+ M P + GSII+TAS++ ++GG   HAY CSKHA+ GLTKN A
Sbjct  121  LSINVTGVFLGIKHAAQAMIPARTGSIISTASISSYVGGAASHAYCCSKHAVNGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPYA+ T +AR++ G+ +++  +V  S   LKGV L A D+A A LY
Sbjct  181  VELGQFGIRVNCLSPYALATPLARNFVGVEDEELENVMGSLANLKGVTLKAVDVANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            LASDE++Y+SGHNL++D GFSI N +  +F 
Sbjct  241  LASDEARYISGHNLLIDGGFSILNPSFEMFQ  271



>ref|XP_010227919.1| PREDICTED: zerumbone synthase isoform X1 [Brachypodium distachyon]
Length=283

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 177/269 (66%), Gaps = 23/269 (9%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQS-------------FFV  294
            +RLEGKVA++TGG  GIG A  ++F QHGAKV IAD +D+  Q               FV
Sbjct  14   RRLEGKVALVTGGASGIGEAIVRLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGTDVLFV  73

Query  295  HCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGA  474
            HCDVT E DV  AV+ A    G LDIMVNNAGI G KV+DI + D  +   VF +N  G 
Sbjct  74   HCDVTVEEDVSRAVDAAAEKFGTLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGM  133

Query  475  FLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGI  651
             LG KHAARVM P ++GSI++ ASVA  MGG  PHAYT SKHA+VGLTK+ AL+LG++GI
Sbjct  134  LLGMKHAARVMIPGKKGSIVSLASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGI  193

Query  652  RVNCVSPYAVPTQMARSYFGLSEDDKFDVY---------SSLKGVDLMAEDIAEAVLYLA  804
            RVNCVSPYAVPT ++  +    E     V          ++LKGVDL+ +D+A+AVLYLA
Sbjct  194  RVNCVSPYAVPTALSMPHLPQGEHKGDAVRDFLAFVGGEANLKGVDLLPKDVAQAVLYLA  253

Query  805  SDESKYVSGHNLVVDAGFSISNLALNLFN  891
            SDE++Y+S  NLVVD GF+  N  L  F 
Sbjct  254  SDEARYISALNLVVDGGFTSVNPNLKAFE  282



>ref|XP_006362152.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 175/257 (68%), Gaps = 11/257 (4%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQSFFVHC  300
            A+RL+GKVAIITG   GIG A AK+F ++GAKV+IAD +DD           S + FVHC
Sbjct  6    ARRLKGKVAIITGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHC  65

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E D+++ VN  V  +G+LDIM NNAGI+GA  S+IL+ + +DF  V   N +G FL
Sbjct  66   DVTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFL  125

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G K AARVM P  +GSII T SV   +GG  PHAYT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKQAARVMIPRGQGSIITTGSVCSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRV  185

Query  658  NCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
            NCVSPY + T  A +       +  DVYSSLKG  L   D+AE  ++LASDESKYV+G +
Sbjct  186  NCVSPYVILTASALNTLKKMGKEDSDVYSSLKGATLTPNDVAETAVFLASDESKYVNGQD  245

Query  838  LVVDAGFSISNLALNLF  888
             ++D GF+I N   ++F
Sbjct  246  FIIDGGFTIENRGFSMF  262



>ref|XP_010039348.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
 gb|KCW88250.1| hypothetical protein EUGRSUZ_A00637 [Eucalyptus grandis]
Length=304

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 190/295 (64%), Gaps = 35/295 (12%)
 Frame = +1

Query  100  QEIDSRKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDES  279
            QEI+   M+ +   +   +RLEGK+AI+TGGV GIG AT ++F +HGAKV+IAD  D   
Sbjct  12   QEIN--LMLGNENTTPGPRRLEGKIAIVTGGVKGIGEATVRLFARHGAKVVIADIEDLLG  69

Query  280  QSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSDILDC  426
             +          +VHCDV+SE DV++ V   VS +GRLD+M NNAG+LG  +K   I+D 
Sbjct  70   TALANSLSPSVTYVHCDVSSEEDVENLVTSTVSRYGRLDVMFNNAGLLGNQSKRKSIMDF  129

Query  427  DATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAI  603
            D  +F +V  +N  G+ LG KHAARVM P + G II+TASVAG MGG  PHAYT SKHAI
Sbjct  130  DVGEFESVMSINVKGSALGIKHAARVMAPRRSGCIISTASVAGVMGGLGPHAYTASKHAI  189

Query  604  VGLTKNTALDLGRYGIRVNCVSPYAVPTQM----ARSYFGLSEDD--KFDVYS-------  744
            VGLTKN A +LGRYGIRVNC+SP+ V T M     RS  G  ED+   F V S       
Sbjct  190  VGLTKNAACELGRYGIRVNCISPFGVATSMLINAWRSSDGEEEDEGMSFGVPSEGEVEKM  249

Query  745  --------SLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
                    +LKG  L A+DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  250  EEFVRGLANLKGATLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTTSRNCVGL  304



>ref|XP_004981317.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=329

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 177/266 (67%), Gaps = 20/266 (8%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHCD  303
            KRLEGKVA++TGG  GIG A  ++F +HGAK+ IAD +D+  Q            FVHCD
Sbjct  63   KRLEGKVALVTGGATGIGEAIVRLFREHGAKICIADIQDEAGQQLRDALGDQDVMFVHCD  122

Query  304  VTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLG  483
            VT E +V +AV+      G LD+MVNNAGI G+KV+DI + D  +   VF +N  G FLG
Sbjct  123  VTVEDEVSAAVDAVAQRFGSLDVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFLG  182

Query  484  TKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVN  660
             KHAARVM P +RGSI++ ASVA  +GG  PHAYT SKHA+ GLTK+ A +LGR+G+RVN
Sbjct  183  MKHAARVMIPQKRGSIVSLASVASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRVN  242

Query  661  CVSPYAVPTQMARSYF--GLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDE  813
            CVSPYAVPT ++  +   G   DD    +       ++LKGVDLM  D+AEAVLYLASDE
Sbjct  243  CVSPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDLMPRDVAEAVLYLASDE  302

Query  814  SKYVSGHNLVVDAGFSISNLALNLFN  891
            ++YVS  NL VD GF+  N  L  F 
Sbjct  303  ARYVSALNLTVDGGFTAVNHNLKPFE  328



>ref|XP_003563948.1| PREDICTED: zerumbone synthase isoform X2 [Brachypodium distachyon]
Length=282

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 159/246 (65%), Gaps = 23/246 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQS-------------FFVHCDVTSESDVQSAVNKAVSTHGR  363
            +F QHGAKV IAD +D+  Q               FVHCDVT E DV  AV+ A    G 
Sbjct  36   LFRQHGAKVCIADVQDEAGQQVRDSLGDDAGTDVLFVHCDVTVEEDVSRAVDAAAEKFGT  95

Query  364  LDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTA  543
            LDIMVNNAGI G KV+DI + D  +   VF +N  G  LG KHAARVM P ++GSI++ A
Sbjct  96   LDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGMLLGMKHAARVMIPGKKGSIVSLA  155

Query  544  SVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE  720
            SVA  MGG  PHAYT SKHA+VGLTK+ AL+LG++GIRVNCVSPYAVPT ++  +    E
Sbjct  156  SVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGIRVNCVSPYAVPTALSMPHLPQGE  215

Query  721  DDKFDVY---------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
                 V          ++LKGVDL+ +D+A+AVLYLASDE++Y+S  NLVVD GF+  N 
Sbjct  216  HKGDAVRDFLAFVGGEANLKGVDLLPKDVAQAVLYLASDEARYISALNLVVDGGFTSVNP  275

Query  874  ALNLFN  891
             L  F 
Sbjct  276  NLKAFE  281



>ref|XP_004244887.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=263

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 177/257 (69%), Gaps = 11/257 (4%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHC  300
            A+RLEGKVAIITG   GIG A+AK+F ++G+KV+IAD +DD +Q+           FVHC
Sbjct  6    ARRLEGKVAIITGAASGIGEASAKLFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHC  65

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E D+++ VN  V  +G+LDIM NNAGI+GA  S+IL+ + +DF  V   N +G FL
Sbjct  66   DVTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFL  125

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G K AARVM P  +GSII T SV   +GG  PH+YT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKQAARVMIPRGQGSIITTGSVCASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRV  185

Query  658  NCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
            NCVSPY + T  A         +  DVYS+L G  L   D+AEA ++LASDESKYV+G +
Sbjct  186  NCVSPYVIRTTSALDTLKKMGKEDSDVYSTLNGPTLTPYDVAEAAVFLASDESKYVNGQD  245

Query  838  LVVDAGFSISNLALNLF  888
             V+D GF+I N  L++F
Sbjct  246  FVIDGGFTIENPGLSMF  262



>gb|KCW90500.1| hypothetical protein EUGRSUZ_A02619 [Eucalyptus grandis]
Length=283

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 180/272 (66%), Gaps = 14/272 (5%)
 Frame = +1

Query  118  KMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF---  288
            K VS S+      RLEGKVA+ITGG  GIG  TA+VF  HGAKV+IAD  D    S    
Sbjct  6    KQVSFSMHFLKFHRLEGKVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGHSVCDS  65

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   FVHC+VT ES  ++AV +AVST G+LDIM NNAGI G   + I+D D  DF  
Sbjct  66   LGRDTASFVHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFER  125

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  VN  G FLG KHAA+ M P +RG IINTAS++  +GG   HAYTC+KHA++GLT+N 
Sbjct  126  VLAVNVTGVFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNA  185

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVL  795
            A++LG++GIRVNC+SPYA  T +A  + G+     +      ++LKGV L AED+A A L
Sbjct  186  AVELGQFGIRVNCLSPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAAL  245

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            +LA DE++YVSGHNL +D GFS+ N +  +F 
Sbjct  246  FLAGDEARYVSGHNLFIDGGFSVVNPSFRMFQ  277



>ref|XP_008643649.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X2 [Zea 
mays]
 gb|AFW67244.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 177/267 (66%), Gaps = 22/267 (8%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ------------SFFVH  297
            KRLEGKVA++TGG  GIG A  ++F +HGAKV IAD +D+  Q            + FVH
Sbjct  15   KRLEGKVALVTGGATGIGEAIVRLFMEHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVH  74

Query  298  CDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAF  477
            CDVTSE DV  AV+ A    G LD+MVNNAG+ G KV+DI + D  +   V  VN  G F
Sbjct  75   CDVTSEEDVSRAVDAAAERFGALDVMVNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVF  134

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIR  654
            LG KHAAR M P +RGSI++ ASVA  +GG  PH YT SKHA+VGLTK+ A +LGR+G+R
Sbjct  135  LGMKHAARAMIPRKRGSIVSLASVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVR  194

Query  655  VNCVSPYAVPTQMARSYF--GLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLAS  807
            VNCVSPYAVPT ++  +   G   DD    +       ++LKGVD M ED+A+AVLYLAS
Sbjct  195  VNCVSPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLAS  254

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DE++YVS  NL+VD GF+  N  L  F
Sbjct  255  DEARYVSAVNLMVDGGFTAVNNNLRAF  281



>gb|KGN59171.1| hypothetical protein Csa_3G778270 [Cucumis sativus]
Length=277

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 190/275 (69%), Gaps = 19/275 (7%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------  273
            M SS ++ST    +RLEGKVAIITGG  GIG  TAK+F  HGAKV++AD +DD       
Sbjct  1    MTSSEVISTTTGQRRLEGKVAIITGGASGIGECTAKLFVHHGAKVVVADIQDDLGRALCA  60

Query  274  ----ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDF  441
                 + S +VHCDVT ES VQ+AV  AV T G+LDIM+NNAGI       I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTDESQVQAAVAAAVETFGKLDIMMNNAGIADPSKPRIIDNDKHDF  120

Query  442  VNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  618
              V  +N  G FLG KHAA+ M PV+ GSI++TASVA ++GG   HAYTCSKHA+VGLTK
Sbjct  121  DRVLSINVTGVFLGIKHAAQAMIPVKTGSILSTASVASYIGGSASHAYTCSKHAVVGLTK  180

Query  619  NTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAE  786
            N A++LG++GIRVNC+SPY + T +A  +  L +  +F+ Y+S    LKGV L AED+A 
Sbjct  181  NAAVELGQFGIRVNCLSPYVLATPLATEFVDL-DGAEFEKYASSRANLKGVTLKAEDVAN  239

Query  787  AVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            A L+LASDES+YVSGHNL VD GFSI N  + +F 
Sbjct  240  AALFLASDESRYVSGHNLFVDGGFSIVNPNIQIFQ  274



>ref|XP_004237829.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 168/243 (69%), Gaps = 21/243 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRD-----------DESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV I D +D           DE  + F+HCDVTSE+DV +AV+ AV   G LD
Sbjct  37   LFHKHGAKVCIVDIQDAFGKRVCESLGDEDSACFIHCDVTSETDVSNAVDFAVERFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            I+VNNAG+ GA  S+ILD D + F NV  VN  G FLG KHAAR+M P +RGSI++  SV
Sbjct  97   IIVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMIPRKRGSIVSLCSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE--  720
            AG +GG  PHAYT SK A++GLT+N A ++G++G+RVNCVSPYAV T++   +    +  
Sbjct  157  AGSIGGLGPHAYTASKFALLGLTQNVAAEMGKHGVRVNCVSPYAVATELGLLHLPPEQRT  216

Query  721  DD-------KFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            DD        F  +++LKGVDLMA+D+A+AVL+LASDE+ Y+SGH+L VD GFS  N +L
Sbjct  217  DDAIADFNSHFGKFANLKGVDLMAQDVAKAVLFLASDEASYISGHDLKVDGGFSSVNHSL  276

Query  880  NLF  888
             +F
Sbjct  277  KVF  279



>ref|XP_007043243.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99074.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 183/267 (69%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  +SLL  AA+RLEGKVA+ITGG  G+G   A++FC+HGAKV+I D +D+  QS     
Sbjct  1    MACASLLPPAARRLEGKVALITGGASGLGECIARLFCEHGAKVIITDIQDELGQSVCKDI  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FV CD+  ESDV+ AVN A+S HG+LDIMVNNA ++      I++ +  DF  V
Sbjct  61   GLAVASFVLCDIVKESDVEIAVNTAISLHGKLDIMVNNAAVIDDAKPSIVENNVADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              +N  G FLGTKHAARVM P ++GSII+  SV+  +GG   HAYT SKH ++GLTKN A
Sbjct  121  ISINLTGVFLGTKHAARVMIPARKGSIISLGSVSSSVGGVASHAYTSSKHGVIGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LGR+GIRVNC+S Y + T +  ++F L  ++   VYS+LKGV L  ED+AEA LYL S
Sbjct  181  AELGRFGIRVNCLSSYFIATPLTTNFFKLDRNESDRVYSNLKGVFLQKEDVAEAALYLGS  240

Query  808  DESKYVSGHNLVVDAGFSISNLALNLF  888
            DESKYVSGHNL VD GF+  N A  LF
Sbjct  241  DESKYVSGHNLAVDGGFTTINPAFGLF  267



>gb|EMS67256.1| Xanthoxin dehydrogenase [Triticum urartu]
Length=317

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 158/244 (65%), Gaps = 21/244 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F QHGAKV IAD +D+  Q             FVHCDVT E D+  AV+ A    G LD
Sbjct  73   LFRQHGAKVCIADVQDEAGQQLCDSLGGDPDVLFVHCDVTVEEDISRAVDVAAEKFGTLD  132

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAGI G KV+DI + D  D   VF +N  G  LG KHAARVM P ++GSI++ ASV
Sbjct  133  IMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGMLLGMKHAARVMIPSKKGSIVSLASV  192

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PHAYT SKHA+VGLTK+ AL+LGR+GIRVNCVSPYAVPT ++  +    E  
Sbjct  193  ASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIRVNCVSPYAVPTALSMPHLPQGEHK  252

Query  727  KFDVY---------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
               V          ++LKGVDL+ +D+AEAVLYLASDE +Y+S  NLVVD GF+  N  L
Sbjct  253  GDAVRDFLAFVGSEANLKGVDLLPKDVAEAVLYLASDEGRYISALNLVVDGGFTSVNGNL  312

Query  880  NLFN  891
              F 
Sbjct  313  KAFE  316



>emb|CBI18081.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 157/237 (66%), Gaps = 22/237 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D    +          FVHCDV+ E D+++ +N  VS +GRLDI+
Sbjct  51   LFARHGAKVVIADVEDTLGAALASSLAPSVTFVHCDVSLEEDIENVINSTVSRYGRLDIL  110

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D D  +F  V  VN  G  LG KHAARVM P   G II+TASV
Sbjct  111  FNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGIKHAARVMVPRGMGCIISTASV  170

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M R      E +
Sbjct  171  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLR------EVE  224

Query  727  KFDVYSS----LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            K + + S    LKG  L A+DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  225  KMEEFVSGLANLKGHILRAKDIAEAALYLASDESKYVSGHNLVVDGGITTSRNCVGL  281



>ref|XP_010246261.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nelumbo nucifera]
Length=281

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 187/269 (70%), Gaps = 19/269 (7%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M + S+LST  +RL+GKVA+ITGG  GIG +TA++F +HGAKV++AD +D+         
Sbjct  1    MAAGSVLSTIVRRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDI  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
              E    + HCDV+ ++ V+ AV+ +VS +G+LDIM NNA I G    +IL  D  DF  
Sbjct  61   GSEETICYAHCDVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  624
            V  VN  GAFLG KHAARVM P++RGSI+ T+SVA  + G  PHAY+ +KHA+VGLTKN 
Sbjct  121  VVDVNLYGAFLGAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMAR---SYFGLSEDDKFDVYSS----LKGVDLMAEDIA  783
             ++LGRYGIRVNC+SPY V T M R   +  G +E++K +   S    LKGV + AED+A
Sbjct  181  CVELGRYGIRVNCISPYGVVTGMLRKVMAELGFTEEEKVEELVSRSTVLKGVKVTAEDMA  240

Query  784  EAVLYLASDESKYVSGHNLVVDAGFSISN  870
            EA LYLASDE++YV+G NL+VD G+S +N
Sbjct  241  EAALYLASDEARYVNGLNLIVDGGYSTTN  269



>ref|XP_009631422.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 166/244 (68%), Gaps = 24/244 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F +HGAKV IAD +D           + QS F+HCDVT+E+D+  AV+ AV   G LDI
Sbjct  37   LFHKHGAKVCIADIQDKLGQRVCESLGDDQSAFIHCDVTAEADISQAVDFAVQKFGTLDI  96

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            +VNNAG+ G   +DI D + + F NV  VN  G FLG KHAAR+M P+++GSI++ +S A
Sbjct  97   LVNNAGLTGTTYTDIRDYELSVFDNVIDVNVKGVFLGMKHAARIMIPLKKGSIVSLSSAA  156

Query  553  GFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG  PHAYT SKHA+ GLTKN A +LG++GIRVNCVSPYAV T +  S+  L ED +
Sbjct  157  SAIGGLAPHAYTASKHAVSGLTKNVAAELGQHGIRVNCVSPYAVATGLGLSH--LPEDQR  214

Query  730  -----------FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLA  876
                       F  +++L+GVDL+ ED+A AVL+LASDE++Y+SGHNL+VD GFS  N +
Sbjct  215  DDDAIADFHAYFGKFANLQGVDLLVEDVANAVLFLASDEARYISGHNLMVDGGFSCVNHS  274

Query  877  LNLF  888
              +F
Sbjct  275  FKVF  278



>ref|XP_006367118.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 175/257 (68%), Gaps = 11/257 (4%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------ESQSFFVHC  300
            A+RL+GKVAIITG   GIG A AK+F ++GAKV+IAD +DD           S + FVHC
Sbjct  6    ARRLKGKVAIITGAASGIGEAAAKLFSRYGAKVVIADIQDDLAHKVCKDLDPSSTTFVHC  65

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E D+++ VN  V  +G+LDIM NNAGI+GA  S+IL+ + +DF  V   N +G FL
Sbjct  66   DVTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFL  125

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G K AAR M P  +GSII T SV   +GG  PHAYT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKQAARDMIPRGQGSIITTGSVCSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRV  185

Query  658  NCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
            NCVSPY + T  A +       +  DVYS+LKG  L   D+AE  ++LASDESKYV+G +
Sbjct  186  NCVSPYVILTASALNTLKKMGKEDSDVYSTLKGATLTPNDVAETTVFLASDESKYVNGQD  245

Query  838  LVVDAGFSISNLALNLF  888
             ++D GF+I N  L++F
Sbjct  246  FIIDGGFTIENRGLSMF  262



>ref|XP_010324818.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=256

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 157/233 (67%), Gaps = 11/233 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F ++G+KV+IAD +DD +Q+           FVHCDVT E D+++ VN  V  +G+LDI
Sbjct  23   LFSRYGSKVVIADIQDDLAQNVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKLDI  82

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI+GA  S+IL+ + +DF  V   N +G FLG K AARVM P  +GSII T SV 
Sbjct  83   MYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIPRGQGSIITTGSVC  142

Query  553  GFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG  PH+YT SKH ++GLT+N A+DLGRYGIRVNCVSPY + T  A         + 
Sbjct  143  ASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRVNCVSPYVIRTTSALDTLKKMGKED  202

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             DVYS+L G  L   D+AEA ++LASDESKYV+G + V+D GF+I N  L++F
Sbjct  203  SDVYSTLNGPTLTPYDVAEAAVFLASDESKYVNGQDFVIDGGFTIENPGLSMF  255



>ref|XP_006367119.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 176/257 (68%), Gaps = 11/257 (4%)
 Frame = +1

Query  151  AKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHC  300
            A+RLEGKVAIITG   GIG   A++F +HGA V+IAD +DD +Q            +VHC
Sbjct  6    ARRLEGKVAIITGAASGIGEVAARLFTRHGAVVVIADIQDDLAQKVCENLDPSSITYVHC  65

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFL  480
            DVT E D+++ VN AVS +G+LDIM NNAGI+    S+ILD + ++F  V  +N +G F+
Sbjct  66   DVTKEDDLKNVVNTAVSKYGKLDIMYNNAGIVDEIKSNILDNEKSEFEKVININLIGTFV  125

Query  481  GTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRV  657
            G K AARVM P  +GSII+TASV   +GG   HAYT SKH ++GLT+N A+DLGRYGIRV
Sbjct  126  GIKEAARVMIPRGQGSIISTASVCASIGGVCSHAYTSSKHGVLGLTRNAAVDLGRYGIRV  185

Query  658  NCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
            NCVSPY V T M          D  +VYS+LKG  L   D+AEA ++LASDESK VSGH+
Sbjct  186  NCVSPYTVLTTMGLYTLKKIGKDSSNVYSNLKGATLTPNDVAEAAVFLASDESKCVSGHD  245

Query  838  LVVDAGFSISNLALNLF  888
            L+VD GF++ N   ++F
Sbjct  246  LIVDGGFTVENSGSSMF  262



>sp|Q94KL7.1|SILD_FORIN RecName: Full=Secoisolariciresinol dehydrogenase, partial [Forsythia 
x intermedia]
 gb|AAK38665.1| stem secoisolariciresinol dehydrogenase [Forsythia x intermedia]
Length=277

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 185/269 (69%), Gaps = 15/269 (6%)
 Frame = +1

Query  127  SSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD----------E  276
            +S +L+  A+RLEGKVA+ITGG  GIG  TAK+F QHGAKV IAD +D+           
Sbjct  4    TSQVLTAIARRLEGKVALITGGASGIGETTAKLFSQHGAKVAIADVQDELGHSVVEAIGT  63

Query  277  SQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
            S S ++HCDVT+E  V++AV+  VST+G+LDIM +NAGI       I+D +  DF  VF 
Sbjct  64   SNSTYIHCDVTNEDGVKNAVDNTVSTYGKLDIMFSNAGISDPNRPRIIDNEKADFERVFS  123

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALD  633
            VN  G FL  KHAARVM P + G+II+TAS++  M GG  HAY  SKHA++GLT+N A++
Sbjct  124  VNVTGVFLCMKHAARVMIPARSGNIISTASLSSTMGGGSSHAYCGSKHAVLGLTRNLAVE  183

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFD----VYSSLKGVDLMAEDIAEAVLYL  801
            LG++GIRVNC+SP+ +PT + + + G+  +++F+       +LKG     ED+A A LYL
Sbjct  184  LGQFGIRVNCLSPFGLPTALGKKFSGIKNEEEFENVINFAGNLKGPKFNVEDVANAALYL  243

Query  802  ASDESKYVSGHNLVVDAGFSISNLALNLF  888
            ASDE+KYVSGHNL +D GFS+ N  + +F
Sbjct  244  ASDEAKYVSGHNLFIDGGFSVCNSVIKVF  272



>ref|XP_010246256.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nelumbo nucifera]
Length=281

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 187/269 (70%), Gaps = 19/269 (7%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M ++SLL+   KRL+GKVA+ITGG  GIG +TA++F +HGAKV++AD +D+         
Sbjct  1    MKAASLLAPITKRLKGKVALITGGAAGIGESTARLFVRHGAKVVVADVQDELGRAVCNDI  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
              E    + HCDV+ ++ V+ AV+ +VS +G+LDIM NNA I G    +IL  D  DF  
Sbjct  61   GSEETICYAHCDVSRDAHVRDAVDMSVSKYGKLDIMFNNAAIPGKSSKEILSTDNEDFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNT  624
            V  VN  GAFLG KHAARVM P++RGSI+ T+SVA  + G  PHAY+ +KHA+VGLTKN 
Sbjct  121  VVDVNLYGAFLGAKHAARVMVPLKRGSILFTSSVASVVNGETPHAYSATKHAVVGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMAR---SYFGLSEDDKFDVYSS----LKGVDLMAEDIA  783
             ++LGRYGIRVNC+SPY V T M R   +  G +E++K +   S    LKGV + AED+A
Sbjct  181  CVELGRYGIRVNCISPYGVVTGMLRKVMAELGFTEEEKVEELVSRSTVLKGVKVTAEDMA  240

Query  784  EAVLYLASDESKYVSGHNLVVDAGFSISN  870
            EA LYLASDE++YV+G NL+VD G+S +N
Sbjct  241  EAALYLASDEARYVNGLNLIVDGGYSTTN  269



>ref|XP_009590019.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 185/268 (69%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M SSSL S  AK+LEGKVA ITGG  GIG+AT ++F QHGAKV IAD +D+         
Sbjct  1    MASSSLQSPIAKKLEGKVAFITGGASGIGAATTRLFVQHGAKVTIADIQDNLGTSLVHEI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
               ++ F+HC+V  ESDVQ+AV+  +   G+LDIM +NAG+LG  +S IL+ D      V
Sbjct  61   GTEKAIFIHCNVAIESDVQNAVDATIEKFGKLDIMFSNAGVLGKPISSILEVDYDIIKTV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
            F VN +GAF   KHAARVM P ++GSII TASVA  + G  PHAY  SK A++GL+KN  
Sbjct  121  FDVNIIGAFFCAKHAARVMIPFKKGSIIFTASVATVVSGLVPHAYAASKCAVLGLSKNIG  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY----SSLKGVDLMAEDIAEAVL  795
            ++LG+YGI+VNCVSPY V T +A +  G+++ +  D +     +LKG  L  E++A+AVL
Sbjct  181  VELGKYGIKVNCVSPYYVGTPLALNMLGIADREMADKWIAEAGNLKGALLNEEEVAKAVL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLAL  879
            YL SD+SKYVSG NLV+D GFS +N+AL
Sbjct  241  YLVSDDSKYVSGMNLVLDGGFSTTNVAL  268



>ref|XP_010917565.1| PREDICTED: momilactone A synthase-like isoform X1 [Elaeis guineensis]
Length=272

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 188/261 (72%), Gaps = 14/261 (5%)
 Frame = +1

Query  130  SSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-------  288
            +S+L++AA RLEGKVA+ITGG  GIG ATAK+F +HGA+V+IAD +DD+ ++        
Sbjct  4    TSVLTSAAGRLEGKVALITGGASGIGEATAKLFTRHGARVMIADIQDDKGRALCESLGSA  63

Query  289  ---FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLV  459
               +VHCDVT ES V+ AV+ AVS HG+LDIM NNAGI G+    I + +  DF  V  +
Sbjct  64   VASYVHCDVTDESHVRDAVDAAVSRHGKLDIMFNNAGIAGSLCMQIRESEKADFERVMGI  123

Query  460  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDL  636
            N +G++LGTKHAARVM P +RGSI+ T SVA    G    AYTCSK A+VGL ++ A++L
Sbjct  124  NLVGSYLGTKHAARVMIPARRGSIVMTGSVASAAPGIGSAAYTCSKPAVVGLMRSAAVEL  183

Query  637  GRYGIRVNCVSPYAVPTQMARSYFGLS--EDDKF-DVYSSLKGVDLMAEDIAEAVLYLAS  807
            G++G+RVNCVSPY V T +A + FG+   E ++F   ++ LKGV L  ED+AEAVL+L S
Sbjct  184  GQFGVRVNCVSPYGVATPLATTSFGIGVEEVEEFMHKHAILKGVRLKVEDVAEAVLFLGS  243

Query  808  DESKYVSGHNLVVDAGFSISN  870
            +E++YVSG NL+VD GF+ +N
Sbjct  244  EEARYVSGVNLLVDGGFTTTN  264



>ref|NP_001148513.1| short chain alcohol dehydrogenase1 [Zea mays]
 ref|XP_008643650.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X1 [Zea 
mays]
 gb|ACG31792.1| sex determination protein tasselseed-2 [Zea mays]
 gb|ACG45115.1| sex determination protein tasselseed-2 [Zea mays]
 gb|AFW67240.1| sex determination protein tasselseed-2 isoform 1 [Zea mays]
 gb|AFW67241.1| sex determination protein tasselseed-2 isoform 2 [Zea mays]
 gb|AFW67242.1| sex determination protein tasselseed-2 isoform 3 [Zea mays]
 gb|AFW67243.1| sex determination protein tasselseed-2 isoform 4 [Zea mays]
Length=244

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 157/241 (65%), Gaps = 22/241 (9%)
 Frame = +1

Query  232  QHGAKVLIADTRDDESQ------------SFFVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +HGAKV IAD +D+  Q            + FVHCDVTSE DV  AV+ A    G LD+M
Sbjct  2    EHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFGALDVM  61

Query  376  VNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG  555
            VNNAG+ G KV+DI + D  +   V  VN  G FLG KHAAR M P +RGSI++ ASVA 
Sbjct  62   VNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVFLGMKHAARAMIPRKRGSIVSLASVAS  121

Query  556  FMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYF--GLSEDD  726
             +GG  PH YT SKHA+VGLTK+ A +LGR+G+RVNCVSPYAVPT ++  +   G   DD
Sbjct  122  AIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCVSPYAVPTALSMPHLPQGARADD  181

Query  727  KFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
                +       ++LKGVD M ED+A+AVLYLASDE++YVS  NL+VD GF+  N  L  
Sbjct  182  ALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLASDEARYVSAVNLMVDGGFTAVNNNLRA  241

Query  886  F  888
            F
Sbjct  242  F  242



>ref|XP_007152489.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
 gb|ESW24483.1| hypothetical protein PHAVU_004G135000g [Phaseolus vulgaris]
Length=270

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 166/235 (71%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +FC+HGAKV+IAD RD   Q+           +VHCDV+ E+DV++AVN  VS +G+LDI
Sbjct  35   LFCKHGAKVVIADIRDQLGQALQHEIGTECATYVHCDVSKETDVENAVNITVSKYGKLDI  94

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            MVNNA I      +ILD D TDF  V  VN +G FLGTKHAARVM P +RGSII   SV+
Sbjct  95   MVNNAAISDDAKPNILDNDVTDFERVVRVNLVGPFLGTKHAARVMIPAKRGSIIIVGSVS  154

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYT SKHAIVGL KNTA +LG++GIRVN +S Y +  ++A+ +F L ++  
Sbjct  155  SSVGGVASHAYTSSKHAIVGLAKNTAAELGQFGIRVNSLSCYCIHNELAKDFFKLDDEGF  214

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             ++YS+LKGV L  ED+A+A LYLASDESKY+SGHNL VD GF+  N +  LF+Q
Sbjct  215  SNIYSNLKGVTLKEEDVAQAALYLASDESKYISGHNLAVDGGFTTINPSFGLFSQ  269



>ref|XP_008392031.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Malus 
domestica]
Length=268

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 168/237 (71%), Gaps = 14/237 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F QHGAKV+IAD +DD   S           FVHCDVT ES ++ AV+KAV+T+G+LDI
Sbjct  27   IFVQHGAKVVIADVQDDLGHSVRESIGPSDCTFVHCDVTDESQIKDAVHKAVATYGKLDI  86

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI+    + I+D +  DF  V  +N  G FLG KHAA+ M P + GSII+TAS++
Sbjct  87   MFNNAGIVDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIPARTGSIISTASIS  146

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
             ++GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+SPYA+ T +AR++ G+ +++ 
Sbjct  147  SYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCLSPYALATPLARTFVGVDDEEL  206

Query  730  FDVYSS---LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
             +V  S   LKGV L A D+A A LYLASDE++Y+SGHNL++D GFSI N +  +F 
Sbjct  207  ENVMGSLANLKGVTLKAVDVANAALYLASDEARYISGHNLLIDGGFSILNPSFKMFQ  263



>gb|KGN59172.1| hypothetical protein Csa_3G778280 [Cucumis sativus]
Length=272

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 182/273 (67%), Gaps = 23/273 (8%)
 Frame = +1

Query  121  MVSSSLLSTAA--KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------  273
            M S+ ++ST    +RLEGKVA+ITGG  GIG  TAK+F  HGAKV+IAD +DD       
Sbjct  1    MASNEIISTTTWQRRLEGKVALITGGASGIGECTAKLFVHHGAKVVIADIQDDLGHALCA  60

Query  274  ----ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDF  441
                 + S +VHCDVT ES        AV T G+LDIM+NNAGI       I+D D  DF
Sbjct  61   NVLGSTNSLYVHCDVTEESQA------AVETFGKLDIMMNNAGIADPSKPRIIDNDKHDF  114

Query  442  VNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTK  618
              V  +N  G FLG KHAA+ M P + GSI++TASVA + GG   HAYTCSKHA+VGLTK
Sbjct  115  DRVLSINVTGVFLGIKHAAQAMIPAKTGSILSTASVASYTGGSASHAYTCSKHAVVGLTK  174

Query  619  NTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEA  789
            N A++LG++GIRVNC+SP+A+ T +A  + GL   +   +  S   LKGV L AED+A A
Sbjct  175  NAAVELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANA  234

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             L+LASDES+YVSGHNL +D GFSI N  +++F
Sbjct  235  ALFLASDESRYVSGHNLFIDGGFSIVNPNIDIF  267



>ref|XP_006854740.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
 gb|ERN16207.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
Length=276

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 161/237 (68%), Gaps = 14/237 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF--------FVHCDVTSESDVQSAVNKAVST-HGRLDIM  375
            +F QHGA+V+IAD +DD  QS         + HCDVT+E D+  A++ A +   G+LDIM
Sbjct  40   LFSQHGARVIIADIQDDLGQSTASSIPNATYTHCDVTNEEDICQAIDLATTLGDGKLDIM  99

Query  376  VNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG  555
             NNAGI+      IL+   +DF  V  VN +GAFLGTKHAARVM P Q G I+ TASV+ 
Sbjct  100  FNNAGIVDPPKPSILEYSLSDFDRVLGVNLVGAFLGTKHAARVMIPAQSGCILYTASVSS  159

Query  556  FMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF  732
             +GG   HAY C+KHA+ GLTKN A++LG +GIRVNC+SPY + T +A+ + GL +D + 
Sbjct  160  VIGGAATHAYACTKHALAGLTKNAAVELGEFGIRVNCISPYCLATPLAKKFVGLEQDKEL  219

Query  733  D----VYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            +     +++LKGV L +ED+A A LYLAS++ +YVSGHNLVVD GF+I N +    N
Sbjct  220  EEVMGAHANLKGVVLKSEDVARAALYLASEDGRYVSGHNLVVDGGFTIVNTSFQRGN  276



>ref|XP_007152499.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
 gb|ESW24493.1| hypothetical protein PHAVU_004G135300g [Phaseolus vulgaris]
Length=270

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 166/235 (71%), Gaps = 11/235 (5%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +FC+HGAKV+IAD RD   Q+           +VHCDV+ E+DV++AVN  VS +G+LDI
Sbjct  35   LFCKHGAKVVIADIRDQLGQALQHEIGTECATYVHCDVSKETDVENAVNITVSKYGKLDI  94

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            MVNNA I      +ILD D TDF  V  VN +G FLGTKHAARVM P +RGSII   SV+
Sbjct  95   MVNNAAISDDAKPNILDNDVTDFERVVRVNLVGPFLGTKHAARVMIPAKRGSIIIVGSVS  154

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
              +GG   HAYT SKHAIVGL KNTA +LG++GIRVN +S Y +  ++A+ +F L ++  
Sbjct  155  SSVGGVASHAYTSSKHAIVGLAKNTAAELGQFGIRVNSLSCYCIHNELAKDFFKLDDEGF  214

Query  730  FDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFNQ  894
             ++YS+LKGV L  ED+A+A LYLASDESKY+SGHNL VD GF+  N +  LF+Q
Sbjct  215  SNIYSNLKGVTLKEEDVAQAALYLASDESKYISGHNLAVDGGFTTINPSFGLFSQ  269



>gb|AFV30207.1| borneol dehydrogenase [Lavandula x intermedia]
Length=259

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 178/261 (68%), Gaps = 15/261 (6%)
 Frame = +1

Query  136  LLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------ESQSFFV  294
            + ST  +RLEGKVA+ITG   GIG + A++F +HGAKV+IAD +D+       +  S FV
Sbjct  1    MASTVLRRLEGKVALITGAASGIGESAARLFSRHGAKVVIADIQDELALNICKDLGSTFV  60

Query  295  HCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGA  474
            HCDVT E DV++AVN AVST+G+LDIM+NNAGI GA    I +   +DF  V  VN +G 
Sbjct  61   HCDVTKEFDVETAVNTAVSTYGKLDIMLNNAGISGAPKYKISNTQLSDFKRVVDVNLVGV  120

Query  475  FLGTKHAARVMKPVQRG-SIINTASVAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRYGI  651
            FLGTKHAARVM P + G  I   ++      G P+ Y CSKH +VGLT+N A+++G +GI
Sbjct  121  FLGTKHAARVMIPNRSGSIISTASAATAAAAGTPYPYICSKHGVVGLTRNAAVEMGGHGI  180

Query  652  RVNCVSPYAVPTQMARSYFGLSEDDKFD-VYSSLKGVDLMAEDIAEAVLYLASDESKYVS  828
            RVNCVSPY V T M R      +DD     +S+LKG  L AED+AEA LYLASDESKYVS
Sbjct  181  RVNCVSPYYVATPMTR------DDDWIQGCFSNLKGAVLTAEDVAEAALYLASDESKYVS  234

Query  829  GHNLVVDAGFSISNLALNLFN  891
            GHNL+VD G SI N   N+F+
Sbjct  235  GHNLLVDGGVSIMNQGCNMFD  255



>ref|XP_010931582.1| PREDICTED: LOW QUALITY PROTEIN: zerumbone synthase-like [Elaeis 
guineensis]
Length=277

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 182/274 (66%), Gaps = 19/274 (7%)
 Frame = +1

Query  127  SSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF------  288
            S+  +    +RLEGKVA++TGG  GIG +  ++F +HGAK+ + D +D+  Q        
Sbjct  4    SADSVPPLPRRLEGKVALVTGGATGIGESIVRLFRKHGAKICVVDIQDNLGQQLCKSLGG  63

Query  289  -----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
                 F HCDVT E DV+ AV+     +G +DIMVNNAGI G+KV DI D D  +F  VF
Sbjct  64   DPYVCFFHCDVTIEDDVRRAVDFTADKYGTIDIMVNNAGITGSKVKDIRDADFNEFKKVF  123

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTAL  630
             VN  G FLG KHAAR+M P ++GSII+ ASVA   GG  PH YT SKHA++GLTKN A 
Sbjct  124  DVNVNGVFLGMKHAARIMIPQRKGSIISLASVASTTGGLGPHGYTGSKHAVLGLTKNVAA  183

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFG---LSEDDKF----DVYSSLKGVDLMAEDIAEA  789
            +LG+ GIRVNCVSPYA PT ++  +       ED  F      +++LKGVDLM +D+A+A
Sbjct  184  ELGKRGIRVNCVSPYATPTSLSMPHLPEEERQEDAXFLSFVGSHANLKGVDLMVDDVAQA  243

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            VLYLASDE++Y+SG NL+VD GF+  N ++ +F+
Sbjct  244  VLYLASDEARYISGLNLMVDGGFTCVNNSVRVFD  277



>ref|XP_006468252.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Citrus 
sinensis]
Length=302

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 184/286 (64%), Gaps = 31/286 (11%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            +++    S  AKRLEGK+AI+TGG  GIG AT ++F +HGAKV+IAD  D    +     
Sbjct  17   LITKDSCSALAKRLEGKIAIVTGGARGIGEATVRLFVKHGAKVVIADIDDAAGIALADSL  76

Query  289  --------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSDILDCDATD  438
                    ++HCDV+ E D+Q+ +N  +S HGRLDI+ NNAG+LG  +K   I D DA +
Sbjct  77   LSSSPLVTYLHCDVSLEQDIQNLINVTISKHGRLDILFNNAGVLGNQSKHKSITDFDANE  136

Query  439  FVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLT  615
            F N+  +N  GA LG K+AA+VM P + G II+TASVA  MGG  PHAYT SKHAIVGLT
Sbjct  137  FDNIIRINVRGAALGMKYAAKVMVPRRSGCIISTASVASLMGGLGPHAYTVSKHAIVGLT  196

Query  616  KNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSED----------------DKFDVYSS  747
            KNTA +LG+YGIRVNC+SP+ V T M  + +   ED                +     ++
Sbjct  197  KNTACELGKYGIRVNCISPFGVATSMLVNAWKSCEDCMDSGKPCEEEEEKMEELVRGLAN  256

Query  748  LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            LKGV L A DIAEA LYLASDESKY+SGHNLVVD GF+ S   + L
Sbjct  257  LKGVTLKARDIAEAALYLASDESKYISGHNLVVDGGFTTSKNCVGL  302



>gb|KDP36096.1| hypothetical protein JCGZ_08740 [Jatropha curcas]
Length=269

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 180/259 (69%), Gaps = 17/259 (7%)
 Frame = +1

Query  139  LSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------ESQS--  285
            ++T AKRL+GKVA+ITGG  GIG ATA++F + GAKV+I D + D         ES+S  
Sbjct  1    MATLAKRLQGKVALITGGASGIGEATARLFARQGAKVVITDIQSDLGHSVSNQIESESNQ  60

Query  286  --FFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLV  459
               ++HCDV+ ESDVQ+AVN AVS HG LDIM NNAGI G     IL  +  DF  V  +
Sbjct  61   PVSYIHCDVSKESDVQNAVNAAVSMHGHLDIMFNNAGITGNYNPSILSIEREDFKKVMDI  120

Query  460  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDL  636
            N  G  LG KHAARVM P ++G+I+ T+SVA    GG PHAYT SKHAIVGLTKN A++L
Sbjct  121  NVYGGLLGAKHAARVMIPEKKGAILFTSSVAAVTYGGVPHAYTTSKHAIVGLTKNLAVEL  180

Query  637  GRYGIRVNCVSPYAVPTQMARSYFGLSED--DKFDV-YSSLKGVDLMAEDIAEAVLYLAS  807
            G+YGIRVNC+SP AV T       G+ E   ++F++  ++LKGV + A D+AEA LYLAS
Sbjct  181  GKYGIRVNCISPAAVATPSVVKALGMDEKQIEEFNLAIANLKGVKVDANDMAEAALYLAS  240

Query  808  DESKYVSGHNLVVDAGFSI  864
             ESK+VSG NLVVD GFS+
Sbjct  241  GESKFVSGLNLVVDGGFSL  259



>ref|XP_010024677.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=277

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 181/270 (67%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SS +S   +RLEG+VA+ITGG  GIG  TA+VF  HGAKV+IAD  D   QS     
Sbjct  1    MGGSSFISAFTRRLEGRVALITGGASGIGEITARVFAHHGAKVVIADVNDSLGQSVRDSL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  +VHCDVT+ES +++AV +AVS +G+LDIM NNAGI     + I+D D  DF  V
Sbjct  61   GQDTASYVHCDVTNESQIKAAVAEAVSAYGKLDIMFNNAGITDPNKARIVDNDKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M   +RG IINTAS++  +GG   HAYTC+KHA++GLT+N A
Sbjct  121  LAVNVTGVFLGVKHAAQAMIAARRGCIINTASISSNIGGSASHAYTCAKHAVLGLTRNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GI VNC+SP+   T +A  + GL     +      ++LKGV L AED+A A L+
Sbjct  181  VELGQFGIWVNCLSPFGCGTPLATKFVGLGPVEMEALIGATANLKGVTLKAEDVANAALF  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE++YVSGHNL +D G ++ N + ++F
Sbjct  241  LASDEARYVSGHNLFIDGGVTVVNPSFHMF  270



>gb|ACG37730.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 175/268 (65%), Gaps = 22/268 (8%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ------------SFFVH  297
            KRLEGKVA++TGG  GIG A  ++F +HGAKV IAD +D+  Q            + FVH
Sbjct  15   KRLEGKVALVTGGATGIGEAIVRLFMEHGAKVCIADIQDEAGQQLRDALGGDAQGAMFVH  74

Query  298  CDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAF  477
            CDVTSE DV  AV+ A    G LD+MVNNAG+ G KV+DI   D  +   V  VN  G F
Sbjct  75   CDVTSEEDVSRAVDAAAERFGALDVMVNNAGVTGTKVTDIRTVDFAEARRVLDVNVHGVF  134

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIR  654
            L  KHAAR M P +RGSI++ ASVA  +GG  PH YT SKHA+VGLTK+ A +LGR+G+R
Sbjct  135  LVMKHAARAMIPRKRGSIVSLASVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVR  194

Query  655  VNCVSPYAVPTQMARSYF--GLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLAS  807
            VNCVSPYAVPT ++  +   G   DD    +       ++LKGVD M ED+A+AVLYLAS
Sbjct  195  VNCVSPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLAS  254

Query  808  DESKYVSGHNLVVDAGFSISNLALNLFN  891
            DE++YVS  NL+VD GF+  N  L  F 
Sbjct  255  DEARYVSAVNLMVDGGFTAVNNNLRAFE  282



>ref|XP_010264499.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X3 [Nelumbo nucifera]
Length=280

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 160/245 (65%), Gaps = 30/245 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D+   +          ++HCDV+ E DV++ +N  VS HGRLDI+
Sbjct  30   LFARHGAKVVIADVEDEIGIALSNSLAPCVTYIHCDVSLEEDVENLINSTVSWHGRLDIL  89

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D DA +F  V  VN  G  LG K+AARVM P   G II+TASV
Sbjct  90   FNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTASV  149

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSED-  723
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M  + +   +D 
Sbjct  150  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCDDE  209

Query  724  -------------DKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDA  852
                         +K + +    ++LKG  L A+DIAEA LYLASDESKYVSGHNLVVD 
Sbjct  210  EDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALYLASDESKYVSGHNLVVDG  269

Query  853  GFSIS  867
            G + S
Sbjct  270  GVTTS  274



>ref|XP_010264496.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Nelumbo nucifera]
Length=301

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 180/271 (66%), Gaps = 30/271 (11%)
 Frame = +1

Query  145  TAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF---------FVH  297
            +  +RLEGKVAI+TGG  GIG AT ++F +HGAKV+IAD  D+   +          ++H
Sbjct  25   SPPRRLEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDEIGIALSNSLAPCVTYIH  84

Query  298  CDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSDILDCDATDFVNVFLVNTLG  471
            CDV+ E DV++ +N  VS HGRLDI+ NNAG+LG  +K   I+D DA +F  V  VN  G
Sbjct  85   CDVSLEEDVENLINSTVSWHGRLDILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRG  144

Query  472  AFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYG  648
              LG K+AARVM P   G II+TASVAG MGG  PHAYT SKHAIVGLTKNTA +LGRYG
Sbjct  145  VALGMKYAARVMVPRGSGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYG  204

Query  649  IRVNCVSPYAVPTQMARSYFGLSED--------------DKFDVY----SSLKGVDLMAE  774
            IRVNC+SP+ V T M  + +   +D              +K + +    ++LKG  L A+
Sbjct  205  IRVNCISPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAK  264

Query  775  DIAEAVLYLASDESKYVSGHNLVVDAGFSIS  867
            DIAEA LYLASDESKYVSGHNLVVD G + S
Sbjct  265  DIAEAALYLASDESKYVSGHNLVVDGGVTTS  295



>ref|XP_010264500.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X4 [Nelumbo nucifera]
Length=273

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 160/245 (65%), Gaps = 30/245 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D+   +          ++HCDV+ E DV++ +N  VS HGRLDI+
Sbjct  23   LFARHGAKVVIADVEDEIGIALSNSLAPCVTYIHCDVSLEEDVENLINSTVSWHGRLDIL  82

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D DA +F  V  VN  G  LG K+AARVM P   G II+TASV
Sbjct  83   FNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTASV  142

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSED-  723
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M  + +   +D 
Sbjct  143  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCDDE  202

Query  724  -------------DKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDA  852
                         +K + +    ++LKG  L A+DIAEA LYLASDESKYVSGHNLVVD 
Sbjct  203  EDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALYLASDESKYVSGHNLVVDG  262

Query  853  GFSIS  867
            G + S
Sbjct  263  GVTTS  267



>ref|XP_007026536.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY07038.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=304

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 181/281 (64%), Gaps = 33/281 (12%)
 Frame = +1

Query  142  STAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF---------FV  294
            S   KRLEGK+AI+TGG  GIG AT ++F +HGAKV+IAD  D    +          FV
Sbjct  24   SPHPKRLEGKIAIVTGGARGIGEATVRLFARHGAKVVIADLEDTLGAALANSLSPSVTFV  83

Query  295  HCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSDILDCDATDFVNVFLVNTL  468
            HCDV  E D+++ +N  +S +GRLDI+ NNAG+LG   K   I+D D  +F NV  VN  
Sbjct  84   HCDVRLEEDIENLINSTISRYGRLDILFNNAGVLGNQKKHKSIVDFDVDEFDNVMRVNVR  143

Query  469  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRY  645
            G  LG KHAAR M P   G II+TASVAG MGG  PHAYT SKHAIVGLTKNTA +LGRY
Sbjct  144  GMALGIKHAARAMIPRGGGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRY  203

Query  646  GIRVNCVSPYAVPTQM----ARSY----------FGLS---EDDKFDVY----SSLKGVD  762
            GIRVNC+SP+ V T M     RS+          FG+    E +K + +    ++LKG  
Sbjct  204  GIRVNCISPFGVATSMLVNAWRSHDDDEEEDSINFGIPCQQETEKMEEFVRGLANLKGPT  263

Query  763  LMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            L A+DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  264  LRAKDIAEAALYLASDESKYVSGHNLVVDGGVTTSRNCVGL  304



>ref|XP_007027908.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08410.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=274

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 177/258 (69%), Gaps = 15/258 (6%)
 Frame = +1

Query  142  STAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------F  291
            S+  KRLEGKVA+ITGG  G+G +TA++F QHGAKVLIAD +D+   S           +
Sbjct  5    SSVTKRLEGKVALITGGASGLGESTARLFVQHGAKVLIADIQDELGHSLCQELGTETISY  64

Query  292  VHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLG  471
            VHCDVT ESDVQ+AV  AVS + +LDIM+NNAGI+G     + D D  +F  VF +N LG
Sbjct  65   VHCDVTCESDVQNAVELAVSKYRKLDIMLNNAGIMGHHEVRVTDADTENFKTVFDINVLG  124

Query  472  AFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRYG  648
             FLG KHAARVM P ++G I+ TAS+A  +  G PHAY  SKHA+VGLTK+ +++LG YG
Sbjct  125  GFLGAKHAARVMVPAKKGCILFTASLASKISMGTPHAYKASKHAVVGLTKSLSVELGEYG  184

Query  649  IRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAEAVLYLASDES  816
            IRVNC+SP+AV T + +   G+ +  K +   S    LKG  L  ED A A LYLASDE+
Sbjct  185  IRVNCISPHAVATPLFQKTLGVFDKKKGEEAVSASAVLKGAVLEPEDFANAALYLASDEA  244

Query  817  KYVSGHNLVVDAGFSISN  870
            KY+SG NL +D G+S+SN
Sbjct  245  KYLSGVNLTIDGGYSLSN  262



>ref|XP_008808776.1| PREDICTED: zerumbone synthase [Phoenix dactylifera]
Length=280

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 185/278 (67%), Gaps = 25/278 (9%)
 Frame = +1

Query  127  SSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF------  288
            + S+   + +RLEGKVA++TGG  GIG +  ++F +HGAK+ + D +D+  Q        
Sbjct  5    AGSVPPLSPRRLEGKVALVTGGAMGIGESIVRLFREHGAKICVVDIQDNLGQQLCKSLGG  64

Query  289  -----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVF  453
                 F HCDVT E DV  AV+  V  +G +DI+VNNAGI G+KV DI + D  +F  VF
Sbjct  65   DPYVVFFHCDVTIEDDVHRAVDFTVRKYGTIDILVNNAGITGSKVVDIRNVDLKEFKKVF  124

Query  454  LVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTAL  630
             VN  G FLG KHA+RVM P  +GSII+ ASVA  +GG  PH YT SKHA++GLT+N A 
Sbjct  125  DVNVNGVFLGMKHASRVMIPKSKGSIISLASVASVIGGMGPHGYTGSKHAVLGLTRNVAA  184

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDV-----------YSSLKGVDLMAED  777
            +LGR+GIRVNCVSPYA PT ++  +  L E+++ +            +++LKG +LM +D
Sbjct  185  ELGRHGIRVNCVSPYATPTSLSMPH--LPENERREAALKGFLSFAGSHANLKGAELMVDD  242

Query  778  IAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            +A+AVLYLASDE+KY+SG NL+VD GF+  N +L  F+
Sbjct  243  VAQAVLYLASDEAKYISGLNLMVDGGFTCVNHSLQPFD  280



>ref|XP_010312220.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=283

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 183/271 (68%), Gaps = 15/271 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S+S LST  KRLEGKVAI+TGG  GIG A AK+F +HGAKV+IAD +D+         
Sbjct  8    MASASFLSTIGKRLEGKVAIVTGGASGIGEAIAKLFFEHGAKVVIADVQDELGNSVINAL  67

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
               S S ++HCDVT+E  VQ AV++ ++T G+LDIM+ NAGI       I+D    DF  
Sbjct  68   GGSSNSIYIHCDVTNEDYVQEAVDRTIATFGKLDIMICNAGICDETKPRIIDNTKADFER  127

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  128  VLSINITGVFLSMKHAARVMVPTRSGCIISTASVSSKVGAAASHAYCSSKHAVLGLTKNL  187

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVL  795
            A++LG++GIRVNC+SPYA+ T MA    GL  ++  +  S+   LKG  L  +D+A+A L
Sbjct  188  AVELGQFGIRVNCLSPYAMVTPMATKIIGLENEELENAMSTIGNLKGATLKVDDVAKAAL  247

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            +LASD+++Y+SGHNL +D GF++SN  L +F
Sbjct  248  FLASDDAQYISGHNLFIDGGFTVSNPGLGMF  278



>ref|XP_010922188.1| PREDICTED: zerumbone synthase-like [Elaeis guineensis]
Length=280

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 184/275 (67%), Gaps = 21/275 (8%)
 Frame = +1

Query  130  SSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-------  288
             S+L  + +RLEGKVA++TGG  GIG    ++F +HGAK+ + D +D+  Q         
Sbjct  6    ESVLPLSPQRLEGKVALVTGGATGIGEGIVRLFRKHGAKICVVDIQDNLGQQLCESLGGD  65

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                F HC+VT E DV  A++  V  +G +DIMVNNAGI G+KV DI D D  +F  VF 
Sbjct  66   PYVCFFHCNVTIEDDVHHAIDFTVRKYGTIDIMVNNAGITGSKVVDIRDVDFNEFKKVFD  125

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALD  633
            VN  G FLG KHAARVM P ++GSII+ ASVA  +GG  PH YT +KHA++GLT+N A +
Sbjct  126  VNVNGVFLGMKHAARVMIPKKKGSIISLASVASVIGGMGPHGYTGTKHAVLGLTRNVAAE  185

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSE--DDKFD-------VYSSLKGVDLMAEDIAE  786
            LG++GIRVNCVSPYA PT+++  +   +E  +D  +        +++LKGVDL  +D+A+
Sbjct  186  LGKHGIRVNCVSPYATPTRLSMPHLPENERQEDALNGFLSFVGTHANLKGVDLAVDDVAQ  245

Query  787  AVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
            AVLYLASDE+KYVSG NL+VD  F+  N +L  F+
Sbjct  246  AVLYLASDEAKYVSGLNLMVDGAFTCVNHSLRPFD  280



>ref|XP_010312221.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=276

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 183/271 (68%), Gaps = 15/271 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S+S LST  KRLEGKVAI+TGG  GIG A AK+F +HGAKV+IAD +D+         
Sbjct  1    MASASFLSTIGKRLEGKVAIVTGGASGIGEAIAKLFFEHGAKVVIADVQDELGNSVINAL  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
               S S ++HCDVT+E  VQ AV++ ++T G+LDIM+ NAGI       I+D    DF  
Sbjct  61   GGSSNSIYIHCDVTNEDYVQEAVDRTIATFGKLDIMICNAGICDETKPRIIDNTKADFER  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  121  VLSINITGVFLSMKHAARVMVPTRSGCIISTASVSSKVGAAASHAYCSSKHAVLGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVL  795
            A++LG++GIRVNC+SPYA+ T MA    GL  ++  +  S+   LKG  L  +D+A+A L
Sbjct  181  AVELGQFGIRVNCLSPYAMVTPMATKIIGLENEELENAMSTIGNLKGATLKVDDVAKAAL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            +LASD+++Y+SGHNL +D GF++SN  L +F
Sbjct  241  FLASDDAQYISGHNLFIDGGFTVSNPGLGMF  271



>ref|XP_010264497.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Nelumbo nucifera]
Length=291

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 160/245 (65%), Gaps = 30/245 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D+   +          ++HCDV+ E DV++ +N  VS HGRLDI+
Sbjct  41   LFARHGAKVVIADVEDEIGIALSNSLAPCVTYIHCDVSLEEDVENLINSTVSWHGRLDIL  100

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D DA +F  V  VN  G  LG K+AARVM P   G II+TASV
Sbjct  101  FNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIISTASV  160

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSED-  723
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M  + +   +D 
Sbjct  161  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLLNAWRRCDDE  220

Query  724  -------------DKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDA  852
                         +K + +    ++LKG  L A+DIAEA LYLASDESKYVSGHNLVVD 
Sbjct  221  EDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAALYLASDESKYVSGHNLVVDG  280

Query  853  GFSIS  867
            G + S
Sbjct  281  GVTTS  285



>ref|XP_010094675.1| Sex determination protein tasselseed-2 [Morus notabilis]
 gb|EXB56617.1| Sex determination protein tasselseed-2 [Morus notabilis]
Length=362

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 179/269 (67%), Gaps = 37/269 (14%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD------ESQS---FFVHCDV  306
            KRLEGKVAI+TGG  GIG AT ++F +HGAKV+IAD  D       ES S    +VHCDV
Sbjct  27   KRLEGKVAIVTGGARGIGEATVRLFAKHGAKVVIADIDDANGTILAESLSPLAVYVHCDV  86

Query  307  TSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSD---ILDCDATDFVNVFLVNTLGAF  477
            TSE D+Q+ +N  +S HGRLDI+ NNAG+LG ++     ILD DA +   +  +N  G  
Sbjct  87   TSEDDIQNLINSTISHHGRLDILFNNAGVLGNQIKSTRSILDLDADELDRIMRLNVRGTA  146

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIR  654
            LG KHAARVM P + G II+TASVAG MGG  PHAYT SKHA+VGLTKN A +LGRYGIR
Sbjct  147  LGMKHAARVMVPRRSGCIISTASVAGVMGGLGPHAYTASKHAVVGLTKNAACELGRYGIR  206

Query  655  VNCVSPYAVPTQM----ARSY----------FGLSED------DKFDVY----SSLKGVD  762
            VNC+SP+ V T M     RSY           G+  D      +K + +    ++LKG  
Sbjct  207  VNCISPFGVATSMLINAWRSYDNDDFDRDVDLGIPSDKEENKVEKMEEFVRGLANLKGAT  266

Query  763  LMAEDIAEAVLYLASDESKYVSGHNLVVD  849
            L A+DIAEA LYLASDESKYVSGHNLVVD
Sbjct  267  LKAQDIAEAALYLASDESKYVSGHNLVVD  295



>ref|XP_006339150.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X3 
[Solanum tuberosum]
 ref|XP_006339151.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X4 
[Solanum tuberosum]
 ref|XP_006339152.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X5 
[Solanum tuberosum]
Length=276

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 183/271 (68%), Gaps = 15/271 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S+S LST  KRLEGKVAI+TGG  GIG A AK+F +HGAKV+IAD +D+         
Sbjct  1    MASASFLSTIGKRLEGKVAIVTGGASGIGEAIAKLFSEHGAKVVIADVQDELGNSVINAL  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
               S S ++HCDVT+E  VQ AV++ ++T G+LDIM+ NAGI     S I+D    DF  
Sbjct  61   GGSSNSIYIHCDVTNEDHVQEAVDRTIATFGKLDIMICNAGICDETKSRIIDNTKADFER  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  121  VLSINVTGVFLSMKHAARVMVPTRSGCIISTASVSSTVGAAASHAYCSSKHAVLGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVL  795
            A++LG++GIRVNC+SPYA+ T +A    GL  ++  +  S+   LKG  L  +D+A+A L
Sbjct  181  AVELGQFGIRVNCLSPYAMVTPLATKVIGLENEELENAMSAVGNLKGATLKVDDVAKAAL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            +LASD+++Y+SGHNL +D GF++ N  L +F
Sbjct  241  FLASDDAQYISGHNLFIDGGFTVCNPGLGMF  271



>ref|XP_010104812.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01953.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 192/270 (71%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M  SSLLS  ++RLEGKVA+ITGG  GIG  TAKVF  HGAK++IAD +DD         
Sbjct  1    MAISSLLSAVSRRLEGKVALITGGASGIGECTAKVFAHHGAKLVIADIQDDLGHSVCESL  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
             ++ S +VHC+VT ES V++AV++AV T+GRLDIM NNAGI     + I+D +  DF  V
Sbjct  61   GQTNSKYVHCNVTDESHVENAVDEAVKTYGRLDIMFNNAGIADENKARIIDSEKADFERV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G FLG KHAA+ M P + GSII+TAS++ ++GG   HAY CSKHA++GLTKN A
Sbjct  121  MSVNVTGVFLGIKHAAQAMIPSRSGSIISTASISSYVGGAASHAYCCSKHAVIGLTKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVLY  798
            ++LG++GIRVN +SPYA+ T +A  + GL ++   ++ +S   LK V L AED+A A LY
Sbjct  181  VELGQFGIRVNSLSPYALATPLATKFVGLDDEGLENLMNSLGNLKHVTLKAEDVANAALY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
            LASDE +Y+SGHNL++D GFSI N + N+F
Sbjct  241  LASDEGRYISGHNLLIDGGFSIVNPSFNMF  270



>ref|XP_011041828.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=309

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 148/283 (52%), Positives = 181/283 (64%), Gaps = 35/283 (12%)
 Frame = +1

Query  142  STAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDES---------QSFFV  294
            S + KRLEGKVAIITGG  GIG AT K+F +HGAKV+IAD  D             + +V
Sbjct  27   SLSYKRLEGKVAIITGGARGIGEATVKLFVRHGAKVVIADIEDANGIALAESLSPSAVYV  86

Query  295  HCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSDILDCDATDFVNVFLVNTL  468
             CDV  E +++S +N  +S +GRLDI+ NNAG+LG  +K   I++ DA +F N+  +N  
Sbjct  87   RCDVCLEEEIESLINLTISQYGRLDILFNNAGVLGNQSKHKSIINFDADEFDNIMRINVR  146

Query  469  GAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRY  645
            GA LG KHAARVM P + G +I+TASVAG +GG  PHAYT SKHAIVGLTKNTA +LGRY
Sbjct  147  GAALGMKHAARVMVPRRSGCVISTASVAGIIGGLGPHAYTASKHAIVGLTKNTACELGRY  206

Query  646  GIRVNCVSPYAVPTQM-ARSYFGLSEDDKFDV----------------------YSSLKG  756
            GIRVNC+SP+ V T M   ++ G  ED   D                         +LKG
Sbjct  207  GIRVNCISPFGVATSMLVNAWRGCEEDGDDDEKCMDFGAPSEEEMEKIEELVRGLGNLKG  266

Query  757  VDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
              L A+DIAEA LYLASDESKYVSGHNLVVD GF+  N  + L
Sbjct  267  TTLKAKDIAEAALYLASDESKYVSGHNLVVDGGFTTFNNGVGL  309



>ref|XP_007202842.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
 gb|EMJ04041.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
Length=263

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 168/236 (71%), Gaps = 14/236 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F QHGAK++IAD +DD   S           FVHCDVT E+ +++AV+KAV+T+G+LDI
Sbjct  22   IFAQHGAKIVIADVQDDLGHSVRESMGPTDCTFVHCDVTDEAQIKNAVHKAVATYGKLDI  81

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI+    + I+D +  DF  +  VN  G FLG KHAA+VM P + GSII+TAS++
Sbjct  82   MFNNAGIVDDNKARIIDNEKADFERILSVNVTGVFLGIKHAAQVMIPARAGSIISTASIS  141

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
             ++GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+SPYA+ T +AR + GL +++ 
Sbjct  142  SYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCLSPYALVTPLARKFVGLEDEEM  201

Query  730  FDVYSS---LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             +  S+   LKGV L A D+A A LYLASDE++Y+SGHNL++D  FSI N   ++F
Sbjct  202  ENTMSALANLKGVTLKAVDVANAALYLASDEARYISGHNLLIDGAFSIVNPGFHMF  257



>ref|XP_006339148.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum tuberosum]
 ref|XP_006339149.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum tuberosum]
Length=304

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 184/273 (67%), Gaps = 15/273 (5%)
 Frame = +1

Query  115  RKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD-------  273
            + M S+S LST  KRLEGKVAI+TGG  GIG A AK+F +HGAKV+IAD +D+       
Sbjct  27   KVMASASFLSTIGKRLEGKVAIVTGGASGIGEAIAKLFSEHGAKVVIADVQDELGNSVIN  86

Query  274  ----ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDF  441
                 S S ++HCDVT+E  VQ AV++ ++T G+LDIM+ NAGI     S I+D    DF
Sbjct  87   ALGGSSNSIYIHCDVTNEDHVQEAVDRTIATFGKLDIMICNAGICDETKSRIIDNTKADF  146

Query  442  VNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTK  618
              V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTK
Sbjct  147  ERVLSINVTGVFLSMKHAARVMVPTRSGCIISTASVSSTVGAAASHAYCSSKHAVLGLTK  206

Query  619  NTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEA  789
            N A++LG++GIRVNC+SPYA+ T +A    GL  ++  +  S+   LKG  L  +D+A+A
Sbjct  207  NLAVELGQFGIRVNCLSPYAMVTPLATKVIGLENEELENAMSAVGNLKGATLKVDDVAKA  266

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
             L+LASD+++Y+SGHNL +D GF++ N  L +F
Sbjct  267  ALFLASDDAQYISGHNLFIDGGFTVCNPGLGMF  299



>ref|NP_001275184.1| short-chain dehydrogenase/reductase [Solanum tuberosum]
 gb|AAT75153.1| short-chain dehydrogenase/reductase [Solanum tuberosum]
Length=275

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 166/245 (68%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV IAD RD+  Q             F+HCDVT E+DV +AV+  V   G LD
Sbjct  32   LFHKHGAKVCIADIRDEVGQHVCETLGNDQNVCFIHCDVTVEADVSNAVDFTVQKFGTLD  91

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG+ G  + DI D + + F NV  VN  GAFLG KHAAR+M P+++G+I++  SV
Sbjct  92   IMVNNAGLSGPPIRDIRDYELSVFENVLDVNLKGAFLGMKHAARIMIPLKKGAIVSLCSV  151

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PH Y  SK+A++GLT+N A ++G++G+RVNCVSPYAV T +A ++  L ED+
Sbjct  152  ASAIGGIGPHGYAASKYAVLGLTQNVAAEMGKHGVRVNCVSPYAVATGLALAH--LPEDE  209

Query  727  KFD-----------VYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            K D             ++L+GV+LMA D+A AVL+LASDES+Y+SGHNL+VD GFS  N 
Sbjct  210  KTDDAMEGFRDFVARNANLQGVELMANDVANAVLFLASDESRYISGHNLMVDGGFSCVNH  269

Query  874  ALNLF  888
            +L +F
Sbjct  270  SLRVF  274



>gb|KDP34951.1| hypothetical protein JCGZ_09239 [Jatropha curcas]
Length=246

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 168/246 (68%), Gaps = 11/246 (4%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M ++ LL   A+RLEGKVA+ITGG   IG++ A+ FC+HGAKV+I D +DD  QS     
Sbjct  1    MATNFLLPINARRLEGKVALITGGATSIGASIARTFCKHGAKVIIVDIQDDLGQSLSKEL  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHCDVT ESD+++AV+ A+S  G+LDI+VNNA I   +   I+D D  DF  V
Sbjct  61   GTDKAVFVHCDVTIESDIENAVDTAISIFGKLDIIVNNAAIGDPRKPSIVDNDVVDFKRV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN +G FLG KHAARVM P ++GSII   SV   +GG   HAYT +KH IVGL KN A
Sbjct  121  VKVNLIGVFLGPKHAARVMIPARQGSIITLGSVCSSVGGVASHAYTSTKHGIVGLAKNAA  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
             +LG++GIRVNC+S Y + T +  ++F + ED K  VYS+LKGV L  ED+AEA +YL S
Sbjct  181  AELGQFGIRVNCLSSYFIETPLTMNFFKMKEDGKSGVYSNLKGVKLKEEDVAEAAIYLGS  240

Query  808  DESKYV  825
            DESKYV
Sbjct  241  DESKYV  246



>ref|XP_010685947.1| PREDICTED: sex determination protein tasselseed-2-like [Beta 
vulgaris subsp. vulgaris]
Length=306

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 178/274 (65%), Gaps = 30/274 (11%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF---------FVHCDV  306
            +RLEGK+AI+TGG  GIG AT ++F +HGAKV+IAD  D    +          F+HCDV
Sbjct  33   RRLEGKIAIVTGGARGIGEATVRLFIRHGAKVVIADVEDTLGNALANALSPSATFIHCDV  92

Query  307  TSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSD---ILDCDATDFVNVFLVNTLGAF  477
            + E DV + V+ AV+ HGRLDI+VNNAG+LG++      IL+ D  +F  +  +N  G  
Sbjct  93   SVEDDVCTVVDTAVALHGRLDILVNNAGVLGSQTKSRKSILNFDPNEFDQIMSINVKGMA  152

Query  478  LGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIR  654
            LG KHAARVM P   G II+ +SVAG MGG  PHAYT SKHAIVGLTKNTA +LGR+GIR
Sbjct  153  LGIKHAARVMMPKGSGCIISISSVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRFGIR  212

Query  655  VNCVSPYAVPTQMARSYFGLSEDDKFDV-----------------YSSLKGVDLMAEDIA  783
            VNCVSP+ V T M  + +   E+D  ++                  ++LKG  L  +DIA
Sbjct  213  VNCVSPFGVATSMLINAWRSGEEDDMELGLPNGEEVEKMEEFVRGLATLKGATLKPKDIA  272

Query  784  EAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            EA LYLASDES+YVSGHNLVVD GF+ S   + L
Sbjct  273  EASLYLASDESRYVSGHNLVVDGGFTTSKNCVGL  306



>ref|XP_011094267.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Sesamum indicum]
Length=280

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 155/235 (66%), Gaps = 16/235 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F QHGAKV+IAD +D+  Q+            +VHCDVT+E+DV++ VN AVS +G+LD
Sbjct  36   LFVQHGAKVVIADVQDELGQTACRDIGSSEVISYVHCDVTNETDVENVVNTAVSKYGKLD  95

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IM +NAG+ G     IL  D  D   VF VN  G FL  KHAARVM P +RGSI+ T+SV
Sbjct  96   IMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFLCAKHAARVMIPAKRGSIVFTSSV  155

Query  550  AGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A    G  PHAY  SKHA+VGLTKN  ++LG YGIRVNCVSP+ V T M      L E  
Sbjct  156  ASVTHGVVPHAYVASKHAVVGLTKNLCIELGEYGIRVNCVSPFGVATPMLMRTVELDEKA  215

Query  727  KFDVYSS----LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            K +   S    LKG  + A D+AEAV++L+SDE KYVSG NLV+D G+S++N+AL
Sbjct  216  KVEELVSGIANLKGEKMEAVDVAEAVIFLSSDEGKYVSGQNLVIDGGYSLTNIAL  270



>ref|XP_010654128.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=282

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 157/237 (66%), Gaps = 16/237 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD-----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV++ D +D            E   F+ HCDVT +SDVQ+AV+ A+S +G+LD
Sbjct  32   LFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQNAVDTAISKYGKLD  91

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IM +NAGI G   S+IL  D T+F  VF VN  GAFL  KHAARVM P + G II T+SV
Sbjct  92   IMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMIPAKTGCIIFTSSV  151

Query  550  AGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  + G   HAY  SKHA+VGL  N  ++LG+YG+RVNCVSP+ VPT M +   G+ E  
Sbjct  152  ASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRVNCVSPFGVPTPMLQKGVGIMEKR  211

Query  727  KFDVYSS----LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            K +   S    LKG  L AEDIAEA LYL SD+SKYVSG NLVVD G+SI+N +L +
Sbjct  212  KVEELVSSAANLKGAALEAEDIAEAALYLGSDDSKYVSGINLVVDGGYSITNPSLGM  268



>ref|XP_008360614.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
Length=280

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 166/237 (70%), Gaps = 14/237 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            +F QHGAKV+IAD +DD   S           FVHCDVT E  ++ AV+KAV+T+G+LDI
Sbjct  39   IFVQHGAKVVIADVQDDLGHSVRESIGPSDCTFVHCDVTDEXQIKDAVHKAVATYGKLDI  98

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI     + I+D +  DF  V  +N  G FLG KHAA+ M P + GSII+TAS++
Sbjct  99   MFNNAGIXDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIPARTGSIISTASIS  158

Query  553  GFMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDK  729
             ++GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+SPYA+ T +AR++ G+ +++ 
Sbjct  159  SYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCLSPYALATPLARTFVGVXDEEL  218

Query  730  FDVYSS---LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLFN  891
             +V  S   LKGV L A D+A A LYLASDE++Y+SGHNL++D GFSI N +  +F 
Sbjct  219  ENVMGSLANLKGVTLKAVDVANAALYLASDEARYISGHNLLIDGGFSILNPSFKMFQ  275



>ref|XP_002281290.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=282

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 157/237 (66%), Gaps = 16/237 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD-----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV++ D +D            E   F+ HCDVT +SDVQ+AV+ A+S +G+LD
Sbjct  32   LFVKHGAKVIVTDVQDQLGRSVCKEIGPEETVFYDHCDVTCDSDVQNAVDTAISKYGKLD  91

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IM +NAGI G   S+IL  D T+F  VF VN  GAFL  KHAARVM P + G II T+SV
Sbjct  92   IMFSNAGISGEVDSEILLSDNTNFKRVFDVNAYGAFLAAKHAARVMIPAKTGCIIFTSSV  151

Query  550  AGFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  + G   HAY  SKHA+VGL  N  ++LG+YG+RVNCVSP+ VPT M +   G+ E  
Sbjct  152  ASVVSGEISHAYVASKHAVVGLANNLCVELGQYGLRVNCVSPFGVPTPMLQKGVGIMEKR  211

Query  727  KFDVYSS----LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            K +   S    LKG  L AEDIAEA LYL SD+SKYVSG NLVVD G+SI+N +L +
Sbjct  212  KVEELVSSAANLKGAALEAEDIAEAALYLGSDDSKYVSGINLVVDGGYSITNPSLGM  268



>ref|XP_011046903.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
 ref|XP_011046904.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=277

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 184/269 (68%), Gaps = 16/269 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M  SSLL+  +KRLEGKVA+ITGG  GIG ++A++F +HGAKV+IAD +DD   S     
Sbjct  1    MKGSSLLAPVSKRLEGKVALITGGASGIGESSARLFVRHGAKVVIADIQDDPGHSVCEEI  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   +V CDVT ESDV+ AVN AVS +G+LDI  +NAGI G         D  +F  
Sbjct  61   CSNESLSYVRCDVTRESDVEKAVNTAVSKYGKLDIFFSNAGIFGKGDPQASAIDYDNFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTAS-VAGFMGGFPHAYTCSKHAIVGLTKNT  624
            VF  N  GAFLG KHA+RVM P ++GSII ++S V+  +G  PHAYT SKHAIVGLTKN 
Sbjct  121  VFDTNVYGAFLGAKHASRVMIPEKKGSIIYSSSLVSVIVGNVPHAYTASKHAIVGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYF-GLSEDDKFDVYSS---LKGVDLMAEDIAEAV  792
              +LG++GIRVNC+SP AVPT + R+ F G+S +   ++ S+   LKGV L  ED+A+A 
Sbjct  181  CAELGQFGIRVNCISPAAVPTPLMRNAFGGISRNAALEIASAAAHLKGVMLEEEDVAQAA  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLAL  879
            LYLASD+SKYVSG NLVVD G S +N  L
Sbjct  241  LYLASDDSKYVSGLNLVVDGGISATNTNL  269



>ref|XP_002533789.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28591.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=303

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 186/299 (62%), Gaps = 33/299 (11%)
 Frame = +1

Query  88   VISSQEIDSRKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTR  267
            V+  Q +    +++      + +RLEGKVAI+TGG  GIG AT ++F +HGAKV+IAD  
Sbjct  5    VMPEQTLHGIHVLARENNPPSPRRLEGKVAIVTGGARGIGEATVRLFAKHGAKVVIADVE  64

Query  268  DDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSD  414
            D               FVHCDV+ E D+++ +N  VS +GRLDI+ NNAG+LG   K   
Sbjct  65   DTPGTILANSLSPFVTFVHCDVSQEEDIENLINSTVSHYGRLDILFNNAGLLGNQPKNKS  124

Query  415  ILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCS  591
            IL+ D  +F  V  VN  G  LG KHAARVM P   G II+TASVAG MGG  PHAYT S
Sbjct  125  ILEFDVDEFDRVMRVNVKGVALGIKHAARVMIPRGVGCIISTASVAGVMGGLGPHAYTAS  184

Query  592  KHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----ARSY----------FGLS---E  720
            KHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M     RS           FGL    E
Sbjct  185  KHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRSSDDQEDDECMNFGLPCEQE  244

Query  721  DDKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
             +K + +    ++LKG  L  +DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  245  VEKMEEFVRGLANLKGTTLRGKDIAEAALYLASDESKYVSGHNLVVDGGITTSRNCIGL  303



>gb|KDO36906.1| hypothetical protein CISIN_1g040531mg [Citrus sinensis]
Length=285

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 158/246 (64%), Gaps = 31/246 (13%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF------------FVHCDVTSESDVQSAVNKAVSTHGRL  366
            +F +HGAKV+IAD  D    +             ++HCDV+ E D+Q+ +N  +S HGRL
Sbjct  34   LFVKHGAKVVIADIDDAAGIALADSLLSSSPLVTYLHCDVSLEQDIQNLINVTISKHGRL  93

Query  367  DIMVNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINT  540
            DI+ NNAG+LG  +K   I D DA +F N+  +N  GA LG K+AA+VM P + G II+T
Sbjct  94   DILFNNAGVLGNQSKHKSITDFDANEFDNIIRINVRGAALGMKYAAKVMVPRRSGCIIST  153

Query  541  ASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLS  717
            ASVA  MGG  PHAYT SKHAIVGLTKNTA +LG+YGIRVNC+SP+ V T M  + +   
Sbjct  154  ASVASLMGGLGPHAYTVSKHAIVGLTKNTACELGKYGIRVNCISPFGVATSMLVNAWKSC  213

Query  718  ED----------------DKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVD  849
            ED                +     ++LKGV L A DIAEA LYLASDESKY+SGHNLVVD
Sbjct  214  EDCMDSGKPCEEEEEKMEELVRGLANLKGVTLKARDIAEAALYLASDESKYISGHNLVVD  273

Query  850  AGFSIS  867
             GF+ S
Sbjct  274  GGFTTS  279



>ref|XP_002265892.1| PREDICTED: short-chain dehydrogenase reductase 2a [Vitis vinifera]
Length=303

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 160/253 (63%), Gaps = 32/253 (13%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D    +          FVHCDV+ E D+++ +N  VS +GRLDI+
Sbjct  51   LFARHGAKVVIADVEDTLGAALASSLAPSVTFVHCDVSLEEDIENVINSTVSRYGRLDIL  110

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D D  +F  V  VN  G  LG KHAARVM P   G II+TASV
Sbjct  111  FNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGIKHAARVMVPRGMGCIISTASV  170

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M  + +  S+++
Sbjct  171  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRSSDEE  230

Query  727  KFDVY--------------------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVV  846
            + D                      ++LKG  L A+DIAEA LYLASDESKYVSGHNLVV
Sbjct  231  EEDCMNFGIPCEREVEKMEEFVSGLANLKGHILRAKDIAEAALYLASDESKYVSGHNLVV  290

Query  847  DAGFSISNLALNL  885
            D G + S   + L
Sbjct  291  DGGITTSRNCVGL  303



>ref|XP_011046907.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Populus euphratica]
Length=277

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 185/272 (68%), Gaps = 19/272 (7%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M SSS L++ AKRL GKVAIITGG  GIG +T+++F +HGAKV+IAD +D   QS     
Sbjct  1    MNSSSSLASFAKRLAGKVAIITGGASGIGESTSRLFVEHGAKVIIADVQDQVGQSLCKEL  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   +VHCDVTS++DV++ V+ A+S +G+LDIM NNAGI G     IL  D  DF  
Sbjct  61   LTEDNVCYVHCDVTSDTDVKNVVDVAISKYGKLDIMHNNAGITGNIDPTILGTDNEDFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNT  624
            VF VN  G FLG KHAARVM PV++G I+ T+SVA    G  PHAYT SKHA+VGL KN 
Sbjct  121  VFEVNVYGGFLGAKHAARVMIPVKKGVILFTSSVASVACGESPHAYTMSKHAVVGLMKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY-----SSLKGVDLMAEDIAEA  789
             ++LG+YGIRVNC+SP A+ T + R+  G   D  F  +     ++LKGV    +D+AEA
Sbjct  181  CVELGQYGIRVNCISPCALATPLLRNAMG--ADKSFVEHVVCESANLKGVVPSPKDVAEA  238

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
             LYL SDESKYVSG NL+VD G+S +N + N+
Sbjct  239  ALYLGSDESKYVSGLNLMVDGGYSTTNQSFNM  270



>ref|XP_009387234.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 186/268 (69%), Gaps = 16/268 (6%)
 Frame = +1

Query  115  RKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF--  288
            + M S S+ S+ A+RLEGKVA+ITGG  GIG  T K+F +HGA+V++AD +D++ +S   
Sbjct  12   QAMASVSVGSSIARRLEGKVAVITGGASGIGECTVKLFVRHGARVVVADIKDEKGRSLCA  71

Query  289  --------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCD--ATD  438
                    +VHCDVTSE+DV++AV+ AVS HG+LDIM NNAG+   +    L+ +  A+ 
Sbjct  72   ALGLDVASYVHCDVTSEADVKNAVDTAVSLHGKLDIMFNNAGVALGRDHGFLNGEHSASL  131

Query  439  FVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLT  615
            F  +  VN LG +LGTKHAARVM P + G I+ TAS    +GG  P  YTCSK+A+VGL 
Sbjct  132  FERMMAVNVLGVYLGTKHAARVMAPARSGCIVTTASSVSALGGMAPAFYTCSKYAVVGLM  191

Query  616  KNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD---KFDVYSSLKGVDLMAEDIAE  786
            ++ A +LG++G+R NCVSP+ + T M  +  G+++++     D  ++LKGV    EDIAE
Sbjct  192  RSAAAELGKFGVRANCVSPHLLATPMTSAALGMTDEEVERLLDAGANLKGVTAKPEDIAE  251

Query  787  AVLYLASDESKYVSGHNLVVDAGFSISN  870
            AVLYLASDES+YVSGHNL VD GF+++ 
Sbjct  252  AVLYLASDESRYVSGHNLFVDGGFTVTK  279



>ref|XP_004305640.1| PREDICTED: momilactone A synthase-like [Fragaria vesca subsp. 
vesca]
Length=278

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 162/236 (69%), Gaps = 15/236 (6%)
 Frame = +1

Query  226  FCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            F  HGAKV+IAD +D+ + S           FVHCDV  E+ +++AV +AV+T+G+LDIM
Sbjct  35   FVNHGAKVVIADVQDELAHSVVESIGSENCTFVHCDVRDEAQIKNAVEQAVATYGKLDIM  94

Query  376  VNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG  555
             NNAGI     + I+D    DF  V  VN  G FLG KHA++ M   + G II+TAS++ 
Sbjct  95   FNNAGIADENKARIIDNTKDDFERVLGVNVTGVFLGIKHASQPMIRARTGCIISTASISS  154

Query  556  FMGGFP-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKF  732
            ++GG   HAY CSKHAI GLTKN A++LG++GIRVNCVSPYA+ T +A  + GL ++   
Sbjct  155  YIGGAASHAYACSKHAINGLTKNAAVELGQFGIRVNCVSPYALATPLATQFVGLDDEGLE  214

Query  733  DVYSS---LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL-NLF  888
            +V +S   LKGV L A+D+A A LYLASDE+KYVSGHNL++D GFSI N +  N+F
Sbjct  215  NVMNSLANLKGVTLKAQDVANAALYLASDEAKYVSGHNLLIDGGFSIVNPSFSNMF  270



>gb|KDP36095.1| hypothetical protein JCGZ_08739 [Jatropha curcas]
Length=275

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 155/231 (67%), Gaps = 17/231 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-------------FVHCDVTSESDVQSAVNKAVSTHGR  363
            +F +HGAKVLIAD ++   QS              ++ CDVT E+DV++AVN AVS HG+
Sbjct  35   LFARHGAKVLIADVQNKLGQSLSEEIRSETGQPVSYIQCDVTQETDVENAVNTAVSMHGK  94

Query  364  LDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTA  543
            LDIM NNAGI+G    +IL  +  DF +V  +N  GAFLG KHAARVM P ++G+I+ TA
Sbjct  95   LDIMYNNAGIIGKFDPNILSLEREDFKSVMDINLYGAFLGAKHAARVMVPEKKGNILFTA  154

Query  544  SVAGFM-GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE  720
            SVA    GG P  Y  SKHA+VGLTKN A++LG+YGIRVNC+SP  +PT MA    G   
Sbjct  155  SVAAVTYGGTPLPYAASKHAVVGLTKNLAVELGKYGIRVNCISPAGIPTPMAAKIMGADI  214

Query  721  DDKFDV---YSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSI  864
                +V    ++LKGV + A+D+AEA LYL S+ESK+VSG NLVVD G S+
Sbjct  215  KTVQEVSMAVANLKGVKIEADDVAEAALYLGSEESKFVSGLNLVVDGGHSL  265



>ref|XP_009618318.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 187/272 (69%), Gaps = 17/272 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S+S LST  KRLEGKVAI+TGG  GIG ATAK+F +HGAKV+IAD +D+         
Sbjct  15   MASASFLSTIGKRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDELGNSVSNAL  74

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
               S S ++HCDVT+E  VQ+AV++ +ST G+LDIM+ NAGI       I+D    DF  
Sbjct  75   GSPSHSIYIHCDVTNEDHVQNAVDRTISTFGKLDIMICNAGISDETKPRIIDNMKEDFER  134

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  135  VLSINVTGVFLSMKHAARVMVPTRSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNL  194

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAEAV  792
            A++LG++GIRVNC+SPYA+ T +A    GL E++ F+   S    L+GV L  +D+A+A 
Sbjct  195  AVELGQFGIRVNCLSPYAMVTPLAVKVVGL-ENEAFEKALSSAGNLQGVTLKVDDVAKAA  253

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            L+LASD++KY+SGHNL +D GF++ N +L +F
Sbjct  254  LFLASDDAKYISGHNLFIDGGFTVYNPSLGMF  285



>ref|XP_011046902.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 187/270 (69%), Gaps = 15/270 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M S +  +   KRLEGKVA+ITGG  GIG+ TA++F QHGAKVLIAD +DD   SF    
Sbjct  1    MSSITSATPVTKRLEGKVALITGGASGIGACTARLFVQHGAKVLIADIQDDLGHSFCQEF  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   +VHC+VT +SDVQ+AV+ AVS +G+LDIM NNAGI G + S IL CD  +F  
Sbjct  61   GPQETISYVHCNVTCDSDVQNAVDTAVSKYGKLDIMFNNAGIPGDRKSGILTCDNENFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNT  624
            V  VN  G FLG KHAARVM P ++G I+ T+SVA  + G   HAYT SK+AIVGL KN 
Sbjct  121  VLDVNVYGGFLGAKHAARVMIPAKKGCILFTSSVASVLYGELAHAYTASKNAIVGLAKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS---LKGVDLMAEDIAEAVL  795
            +++LG+YGIRVN +SPYAV T +      ++++   ++ +S   LK V L  ED+++A L
Sbjct  181  SVELGQYGIRVNSISPYAVATPLLTDGLSMTKEAAEELVASAATLKDVVLEPEDVSQAAL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLALNL  885
            YLAS+ESKYVSG NLV+D G++++N + ++
Sbjct  241  YLASEESKYVSGVNLVIDGGYNLTNPSFSM  270



>ref|XP_002275723.3| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=277

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 158/233 (68%), Gaps = 17/233 (7%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQS-----------FFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV++AD +D   +S           F+VHCDVT ++D+Q+AV+ A+S +G+LD
Sbjct  33   LFVKHGAKVIVADVQDQLGRSLCQEIGSEETIFYVHCDVTCDADIQNAVDTAISKYGKLD  92

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IM +NAGI G   S I+  D T+F  VF VN  GAFL  KHAARVM P + G II TASV
Sbjct  93   IMFSNAGISGEMESRIILSDNTNFKRVFDVNAYGAFLAGKHAARVMIPAKTGCIIFTASV  152

Query  550  AGFM--GGFPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSED  723
               +  G  P+AY  SKHA+VGL  N  ++LG+YGIRVNC+SP+ V T M R   G+ E 
Sbjct  153  VSVVAEGAIPYAYVASKHAVVGLANNLCVELGQYGIRVNCISPFGVATPMLRQGAGMIEK  212

Query  724  DKF-DVYSS---LKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISN  870
             K  D+ SS   LKG+ L AED+A+A LYL SD+SKYVSG NLVVD G+SI+N
Sbjct  213  SKVEDLVSSSANLKGIVLEAEDVAKAALYLGSDDSKYVSGMNLVVDGGYSITN  265



>ref|XP_002277487.2| PREDICTED: short-chain dehydrogenase reductase 2a-like [Vitis 
vinifera]
Length=294

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 143/287 (50%), Positives = 185/287 (64%), Gaps = 35/287 (12%)
 Frame = +1

Query  112  SRKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD------  273
            + K +    +S++ KRLEGKVA++TGG  GIG A  ++F +HGAKV+IAD  D       
Sbjct  2    TEKTLQGENISSSPKRLEGKVALVTGGARGIGEAIVRLFVRHGAKVIIADIDDATGLPLA  61

Query  274  ---ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSD---ILDCDAT  435
                  + + HCDVT E D+++++N AVS +G+LDI+ NNAG+LG +  +   I + DA 
Sbjct  62   NLLHPSTVYAHCDVTVEGDIENSINLAVSQYGKLDILFNNAGVLGNQSKNKICIANFDAD  121

Query  436  DFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGL  612
            +F ++  VN  G  LG KHAARVM P + G II+TASVAG MGG  PHAYT SKHAIVGL
Sbjct  122  EFDHIMRVNVRGVALGMKHAARVMVPKRSGCIISTASVAGLMGGLGPHAYTASKHAIVGL  181

Query  613  TKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD-------KFDV-----------  738
            TKNTA +LGRYGIRVNC+SP+ V T M  + +  SE++        F             
Sbjct  182  TKNTACELGRYGIRVNCISPFGVATSMLVNAWRKSEEEDDGEECLHFQAPCEKEVEEMEE  241

Query  739  ----YSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSIS  867
                 ++LKGV L AE IAEA +YLASDES+YVSGHNLVVD G + S
Sbjct  242  FVGGIANLKGVKLRAECIAEAAVYLASDESEYVSGHNLVVDGGVTTS  288



>ref|XP_010256990.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Nelumbo 
nucifera]
Length=304

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 179/284 (63%), Gaps = 32/284 (11%)
 Frame = +1

Query  130  SSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------ESQ  282
            +S LS+  +RLEGKVAI+TGG  GIG AT ++F + GAKV+IAD  D+            
Sbjct  21   NSSLSSTPRRLEGKVAIVTGGARGIGEATVRLFARQGAKVVIADVEDELGIVLARSLAPS  80

Query  283  SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AKVSDILDCDATDFVNVFL  456
              +VHCDV+ E DV+  +N  VS HGRLDI+ NNAG+LG  +K   I++ DA +F  V  
Sbjct  81   VTYVHCDVSLEEDVEKLINSTVSRHGRLDILFNNAGVLGNQSKHKSIINFDADEFDRVMR  140

Query  457  VNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALD  633
            VN  G  LG KHAARVM P   G II+TASVAG +GG  PHAYT SKHAIVGLTKNTA +
Sbjct  141  VNVRGVALGMKHAARVMVPRGSGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNTACE  200

Query  634  LGRYGIRVNCVSPYAVPTQMARSYFGLSED--DKFDV------------------YSSLK  753
            LGRYGIRVNC+SP+ V T M  + +    D  D  D+                   ++LK
Sbjct  201  LGRYGIRVNCISPFGVATSMLVNAWRRCNDVQDCMDIVGIPCEEEVGKMEEFVRSLANLK  260

Query  754  GVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
               L  +DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  261  SATLTVKDIAEAALYLASDESKYVSGHNLVVDGGITTSRNCVGL  304



>gb|KDP36166.1| hypothetical protein JCGZ_08810 [Jatropha curcas]
Length=281

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 181/266 (68%), Gaps = 19/266 (7%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-----------FVHC  300
            KRLEGKV +ITGG  GIG  TA++F +HGAKVLIAD +DD  QS            +VHC
Sbjct  12   KRLEGKVVLITGGASGIGECTARLFVKHGAKVLIADIQDDLGQSLCQEFSSPETISYVHC  71

Query  301  DVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAK---VSDILDCDATDFVNVFLVNTLG  471
            +V+S+SDV++AV+ AVS +G+LDIM NNAGILG      + IL  +  DF  V  VN  G
Sbjct  72   NVSSDSDVKNAVDLAVSRYGKLDIMFNNAGILGNPDFSNTRILPTENQDFKKVIDVNVFG  131

Query  472  AFLGTKHAARVMKPVQRGSIINTASVAGFMG-GFPHAYTCSKHAIVGLTKNTALDLGRYG  648
            AFLGTKHAAR+M P ++G I+ TAS+        PHAY  SKHA+VGL KN  ++LG+YG
Sbjct  132  AFLGTKHAARIMIPNKKGCILFTASLVSVCCLDSPHAYAASKHAVVGLAKNLCVELGQYG  191

Query  649  IRVNCVSPYAVPTQMARSYFGLSE----DDKFDVYSSLKGVDLMAEDIAEAVLYLASDES  816
            IRVN +SP+A  T M R+ FG+ E    ++     ++LKGV L  EDIA A L+LASDES
Sbjct  192  IRVNSISPFAAATPMLRNAFGMMEKKEAEEVISSIATLKGVVLETEDIANAALFLASDES  251

Query  817  KYVSGHNLVVDAGFSISNLALNLFNQ  894
            KYVSG NLVVD GFS++N +L +  Q
Sbjct  252  KYVSGINLVVDGGFSLTNPSLAIAMQ  277



>ref|XP_006354114.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=277

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 179/263 (68%), Gaps = 16/263 (6%)
 Frame = +1

Query  139  LSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------  288
            +S+ AKRLEGKVAIITGG  GIG AT ++F +HGAKVLIAD +DD  QS           
Sbjct  4    ISSIAKRLEGKVAIITGGASGIGEATTRLFTKHGAKVLIADVQDDHGQSIIKEIGENRDV  63

Query  289  -FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNT  465
             +VHCDV  E DV++ V+ A+S +G+LDIM +NAG+ G   + IL  D  +F NVF VN 
Sbjct  64   SYVHCDVKVEKDVKNVVDMAISKYGKLDIMFSNAGVPGQPDTTILKLDYENFKNVFDVNV  123

Query  466  LGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNTALDLGR  642
             GA +  KHA RVM P ++GSII T+S+A    G   H Y  SKHAIVGL KN  ++LG+
Sbjct  124  FGALMCAKHATRVMIPPKKGSIIFTSSIASVTYGDVAHTYLASKHAIVGLAKNLGVELGQ  183

Query  643  YGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY----SSLKGVDLMAEDIAEAVLYLASD  810
            +GIRVNCVSP+ V T M  +  G+ + ++ + +    S+LKG  L  ED+A+A LYLASD
Sbjct  184  HGIRVNCVSPFGVATPMLMNGLGIHDKEEVEEFVSQISNLKGTILEGEDVAQAALYLASD  243

Query  811  ESKYVSGHNLVVDAGFSISNLAL  879
            ESKY+SG N+++D G+S +N+AL
Sbjct  244  ESKYISGMNILIDGGYSTTNVAL  266



>ref|XP_002308240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE91763.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 158/252 (63%), Gaps = 31/252 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F + GAKV+IAD  D    S          FVHCDV+ E D+++ +N  +S +G+LDI+
Sbjct  54   LFARQGAKVVIADVEDALGTSLVNSLAPSVSFVHCDVSLEKDIENLINSTISQYGKLDIL  113

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D D  +F  V  VN  G  LG KHAARVM P   G II+TASV
Sbjct  114  FNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMALGIKHAARVMIPRGGGCIISTASV  173

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----ARSY---  705
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M     RS    
Sbjct  174  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRSSGEE  233

Query  706  -----FGLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVD  849
                 FGL  + + +         ++LKG  L A DIAEA LYLASDESKYVSGHNLVVD
Sbjct  234  EDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVD  293

Query  850  AGFSISNLALNL  885
             G + S   + L
Sbjct  294  GGITTSTNCVGL  305



>gb|ABK23507.1| unknown [Picea sitchensis]
 gb|ABK26813.1| unknown [Picea sitchensis]
Length=304

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 163/247 (66%), Gaps = 23/247 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV++AD  D+  ++          +VHCDV+ E DV++AV+ A+  HG+LDIM
Sbjct  46   LFTKHGAKVILADIADEAGRNLAGSLSPPATYVHCDVSKEQDVRAAVDLAMEKHGQLDIM  105

Query  376  VNNAGILG-AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
             NNAG +    V  + + +   F  V  VN  GA LG KHAARVM P ++G II+TASVA
Sbjct  106  YNNAGTIEFVAVESVAEYEMLQFDRVMSVNVRGAMLGIKHAARVMIPRKKGCIISTASVA  165

Query  553  GFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFG------  711
            G +GG  P+AYT SKHAI+GLTKN A +LG+YGIRVN VSP  V T +  +Y        
Sbjct  166  GILGGLTPYAYTASKHAILGLTKNGAAELGKYGIRVNTVSPSGVATALLVNYNKQGNGSV  225

Query  712  LSEDDKFDVYS------SLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            +SEDDK  V +      +L+G  L AEDIAEA LYLASDE+KYVSGHNLVVD GFS+ N 
Sbjct  226  VSEDDKAAVEAYCTSIGNLEGATLRAEDIAEAGLYLASDEAKYVSGHNLVVDGGFSVVNH  285

Query  874  ALNLFNQ  894
            +  L+ +
Sbjct  286  SWKLYRK  292



>ref|XP_009395947.1| PREDICTED: zerumbone synthase [Musa acuminata subsp. malaccensis]
Length=283

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 156/244 (64%), Gaps = 22/244 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAK+ + D +D   Q             F HCDVT E DV+ AV+ A   +G +D
Sbjct  39   LFRKHGAKICVVDVQDAVGQQLCEFLGGDPYACFFHCDVTVEDDVRRAVDFAAERYGTID  98

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAGI G KV DI + +  +F  VF +N  G FLG KHAARVM P  +GSII+  SV
Sbjct  99   IMVNNAGITGEKVVDIRNVNFDEFKRVFDINVNGVFLGMKHAARVMIPQGKGSIISLGSV  158

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A   GG  PH YT SKHA+VGLTKN A +LG++GIRVNCVSPYAVPT+++  +   SE  
Sbjct  159  ASVNGGMGPHGYTGSKHAVVGLTKNVAGELGKHGIRVNCVSPYAVPTKLSMPHLPESERQ  218

Query  727  KFDVY----------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLA  876
            + D            ++LKGVDL+  D+AEAVLYLASDE+KYVSG NLVVD GF+     
Sbjct  219  EEDAVEGFLTFVRSCANLKGVDLLRNDVAEAVLYLASDEAKYVSGLNLVVDGGFTCVTHI  278

Query  877  LNLF  888
            L  F
Sbjct  279  LKPF  282



>ref|XP_006431968.1| hypothetical protein CICLE_v10003833mg, partial [Citrus clementina]
 gb|ESR45208.1| hypothetical protein CICLE_v10003833mg, partial [Citrus clementina]
Length=273

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 161/253 (64%), Gaps = 33/253 (13%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF------------FVHCDVTSESDVQSAVNKAVSTHGRL  366
            +F +HGAKV+IAD  D    +             + HCDV+ E D+Q+ +N  +S HGRL
Sbjct  22   LFVKHGAKVVIADIDDAAGIALADSLLSSSPLVTYRHCDVSLEQDIQNLINFTISKHGRL  81

Query  367  DIMVNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINT  540
            DI+ NNAG+LG  +K   I D DA +F N+  +N  GA LG K+AA+VM P + G II+T
Sbjct  82   DILFNNAGVLGNQSKHKSITDFDANEFDNIIRINVRGAALGMKYAAKVMVPRRSGCIIST  141

Query  541  ASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLS  717
            ASVAG MGG  PHAYT SKHAIVGLTKNTA +LG+YGIRVNC+SP+ V T M  + +  S
Sbjct  142  ASVAGIMGGLGPHAYTASKHAIVGLTKNTACELGKYGIRVNCISPFGVATSMLVNAWK-S  200

Query  718  EDDKFDV-----------------YSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVV  846
             +D  D+                  ++L+ V L A DIAEA LYLASDESKY+SGHNLVV
Sbjct  201  CEDCMDIGTPCVEEEEKMEEFVRGLANLQAVTLKARDIAEAALYLASDESKYISGHNLVV  260

Query  847  DAGFSISNLALNL  885
            D GF+ S   + L
Sbjct  261  DGGFTTSKNCVGL  273



>ref|XP_006428245.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428246.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428251.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428253.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428254.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428256.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006480290.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Citrus sinensis]
 ref|XP_006480291.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Citrus sinensis]
 ref|XP_006480292.1| PREDICTED: xanthoxin dehydrogenase isoform X3 [Citrus sinensis]
 ref|XP_006480293.1| PREDICTED: xanthoxin dehydrogenase isoform X4 [Citrus sinensis]
 gb|ESR41485.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41486.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41491.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41493.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41494.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41496.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|KDO45361.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45362.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45363.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45364.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
Length=280

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 162/245 (66%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD-----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV IAD +D+           E  +FF HCDVT E DV SAV+  V   G LD
Sbjct  37   LFHKHGAKVCIADVQDNLGQQVCQSLGGEPDTFFCHCDVTKEEDVCSAVDLTVEKFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAGI GA   DI + D ++F  VF +N  G F G KHAAR+M P  +G+II+  SV
Sbjct  97   IMVNNAGISGAPCPDIREADLSEFEKVFDINVKGVFHGMKHAARIMIPQTKGTIISICSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            AG +GG  PHAYT SKHA++GL KN A +LG+YGIRVNCVSPYAV T +A ++  L E++
Sbjct  157  AGAIGGLGPHAYTGSKHAVLGLNKNVAAELGKYGIRVNCVSPYAVATGLALAH--LPEEE  214

Query  727  KFD-----------VYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            + +             ++++G +L A D+A AVL+LASDE++Y+SG NL+VD GF+  N 
Sbjct  215  RTEDAMVGFRNFVARNANMQGTELTANDVANAVLFLASDEARYISGTNLMVDGGFTSVNH  274

Query  874  ALNLF  888
            +L +F
Sbjct  275  SLRVF  279



>ref|XP_009605329.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=284

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 182/268 (68%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S SL S  AKRLEGKVA+ITGG  GIG+ATA++F QHGAKV IAD +D+         
Sbjct  1    MASYSLPSPIAKRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                + FVHC+V  ESDVQ+ V+  ++  G+LDIM +NAGI G  +S ILD D      V
Sbjct  61   GNEHTIFVHCNVAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
            F VN +GAF   KHAARVM P ++GSII TAS A  + G  PHAY+ SK A++G +KN  
Sbjct  121  FDVNIVGAFFCAKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIG  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE----DDKFDVYSSLKGVDLMAEDIAEAVL  795
            ++LG+YGI+VNCVSP+ + T +  +  G++E    +  F    +LKG  L  E++A+AVL
Sbjct  181  VELGKYGIKVNCVSPHYISTPLVLNALGIAEREMAEKWFAAGGNLKGALLDEEEVAKAVL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLAL  879
            YLASD+SKYVSG NLV+D GFS +N+AL
Sbjct  241  YLASDDSKYVSGMNLVIDGGFSTTNVAL  268



>emb|CAA11153.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
 emb|CAA11154.1| short chain alcohol dehydrogenase [Nicotiana tabacum]
Length=284

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 182/268 (68%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M S SL S  AKRLEGKVA+ITGG  GIG+ATA++F QHGAKV IAD +D+         
Sbjct  1    MASYSLPSPIAKRLEGKVALITGGASGIGAATARLFVQHGAKVTIADIQDNLGTSLVQEI  60

Query  274  -ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                + FVHC+V  ESDVQ+ V+  ++  G+LDIM +NAGI G  +S ILD D      V
Sbjct  61   GNEHTIFVHCNVAVESDVQNVVDATIAKFGKLDIMFSNAGIGGKSISSILDVDYDIIKTV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTA  627
            F VN +GAF   KHAARVM P ++GSII TAS A  + G  PHAY+ SK A++G +KN  
Sbjct  121  FDVNIVGAFFCAKHAARVMIPFKKGSIIFTASAATVVSGIVPHAYSASKGAVLGFSKNIG  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE----DDKFDVYSSLKGVDLMAEDIAEAVL  795
            ++LG+YGI+VNCVSP+ + T +  +  G++E    +  F    +LKG  L  E++A+AVL
Sbjct  181  VELGKYGIKVNCVSPHYISTPLVLNALGIAEREIAEKWFAAGGNLKGALLDEEEVAKAVL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLAL  879
            YLASD+SKYVSG NLV+D GFS +N+AL
Sbjct  241  YLASDDSKYVSGMNLVIDGGFSTTNVAL  268



>ref|XP_011094268.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=275

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 180/261 (69%), Gaps = 15/261 (6%)
 Frame = +1

Query  133  SLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF--------  288
            +LL+ A +RLEGKVAIITGG  G G +TA++F +HGAKV+IAD +DD  QS         
Sbjct  3    TLLNHAPRRLEGKVAIITGGASGFGESTARLFARHGAKVVIADVQDDRGQSLCRDLNLPD  62

Query  289  ---FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLV  459
               +VHCDVTS+SDV++ V+ AVS +G LDIM NNAGI G     I D D  +F  VF V
Sbjct  63   QISYVHCDVTSDSDVRNVVDFAVSKYGNLDIMFNNAGIPGNLDFTIADADNDNFKRVFEV  122

Query  460  NTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTALDL  636
            N  GAFLG KHAARVM P ++G I+ T+SVA  + G  P++Y+ SKHA+VGL KN  ++L
Sbjct  123  NVYGAFLGAKHAARVMIPERKGVILFTSSVASVVSGECPYSYSASKHAVVGLMKNLCVEL  182

Query  637  GRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLYLAS  807
            G+YGIRVN +SP AV T M     GL +   DD     ++LKGV   AED+AEA LYL+S
Sbjct  183  GQYGIRVNSISPCAVATPMLTGAVGLDKAVVDDIIRASANLKGVMPTAEDVAEAALYLSS  242

Query  808  DESKYVSGHNLVVDAGFSISN  870
            DESK+VSG NLVVD G+S +N
Sbjct  243  DESKFVSGLNLVVDGGYSTTN  263



>ref|XP_002513092.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF49595.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=280

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 166/245 (68%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV + D  D+  Q+            + HCDVT E +VQ AV+  V   G LD
Sbjct  37   LFHKHGAKVCLVDLDDNLGQNVCKSLGGEPNICYFHCDVTVEDEVQRAVDFTVDKFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG+ G   SDI   + +DF  VF VNT G F+G KHAARVM P+ RGSII+  SV
Sbjct  97   IMVNNAGLSGPPCSDIRCTELSDFQKVFDVNTKGTFIGMKHAARVMIPLNRGSIISLCSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PHAYT SKHA++GLT+N A +LG++GIRVNCVSPYAVPT +A ++  L ED+
Sbjct  157  ASTIGGLGPHAYTGSKHAVLGLTRNVAAELGKHGIRVNCVSPYAVPTNLALAH--LPEDE  214

Query  727  K-------FDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            +       F  +    ++++G++L A+D+A +VL+LAS+ES+Y+SG NL++D GF+ SN 
Sbjct  215  RTEDAMAGFKAFARKNANMQGIELTADDVANSVLFLASEESRYISGANLMIDGGFTTSNH  274

Query  874  ALNLF  888
            +L +F
Sbjct  275  SLRVF  279



>ref|XP_002309405.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEE92928.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=277

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 185/272 (68%), Gaps = 19/272 (7%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQS-----  285
            M SSS L++ AKRL GKVAIITGG  GIG +T+++F +HGA V+IAD +D   QS     
Sbjct  1    MNSSSSLASFAKRLAGKVAIITGGASGIGESTSRLFVEHGANVIIADVQDQVGQSLCKEL  60

Query  286  ------FFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                  ++VHCDVTS++DV++ V+ A+S +G+LDIM NNAGI G     IL  +  +F  
Sbjct  61   GTENNVYYVHCDVTSDTDVKNVVDFAISKYGKLDIMYNNAGITGNIDPTILGTENENFKR  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFM-GGFPHAYTCSKHAIVGLTKNT  624
            VF VN  G FLG KHAARVM PV++G I+ T+SVA    G  PHAYT SKHA+VGL KN 
Sbjct  121  VFEVNVYGGFLGAKHAARVMIPVKKGVILFTSSVASMACGESPHAYTMSKHAVVGLMKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY-----SSLKGVDLMAEDIAEA  789
             ++LG+YGIRVNC+SP A+ T + R+  G   D  F  +     ++LKGV    +D+AEA
Sbjct  181  CVELGQYGIRVNCISPCALATPLLRNAMG--ADKSFVEHVVCESANLKGVVPSPKDVAEA  238

Query  790  VLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
             LYL SDESKYVSG NL+VD G+S +N + N+
Sbjct  239  ALYLGSDESKYVSGLNLMVDGGYSTTNQSFNM  270



>ref|XP_011019045.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 157/252 (62%), Gaps = 31/252 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F + GAKV+IAD  D    S          FVHCDV  E D+++ +N  +S +G+LDI+
Sbjct  54   LFARQGAKVVIADVEDALGTSLVNSLAPSVSFVHCDVGLEKDIENLINSTISQYGKLDIL  113

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I+D D  +F  V  VN  G  LG KHAARVM P   G II+TASV
Sbjct  114  FNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMALGIKHAARVMIPRGGGCIISTASV  173

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----ARS----  702
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M     RS    
Sbjct  174  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRSCGEE  233

Query  703  ----YFGLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVD  849
                 FGL  + + +         ++LKG  L A DIAEA LYLASDESKYVSGHNLVVD
Sbjct  234  EDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVD  293

Query  850  AGFSISNLALNL  885
             G + S   + L
Sbjct  294  GGITTSTNCVGL  305



>ref|XP_004252598.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=281

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 180/269 (67%), Gaps = 16/269 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +SS  S  AK+LEGKVAIITGG  GIG+ATA++F QHGAKV+IAD +DD  +S     
Sbjct  1    MANSSFQSPIAKKLEGKVAIITGGASGIGAATARLFVQHGAKVIIADIQDDLGKSLVKDI  60

Query  289  -------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                   + HC+V+ ESDVQ+ V+  V+  G+LDIM +NAG+ G  ++ IL+ D     N
Sbjct  61   GTEQTVIYAHCNVSIESDVQNVVDATVAKFGKLDIMCSNAGVSGKPITSILEVDHDIIKN  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINT--ASVAGFMGGFPHAYTCSKHAIVGLTKN  621
            VF VN +GAF   KHAARVM P ++G I+ T  AS   F  G PH Y  SK A++GL+KN
Sbjct  121  VFDVNVVGAFFCAKHAARVMTPNKKGVILFTTSASTVVFGTGVPHTYVSSKCAVLGLSKN  180

Query  622  TALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAV  792
              ++LG+YGIRVNCVSPY V T +    FG+ E   D  F+   +LKG  L  +D+A  V
Sbjct  181  VGVELGKYGIRVNCVSPYCVSTPLVVDGFGIEEQKADKWFEEAGNLKGALLDEQDVANGV  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLAL  879
            LYL SD+SKYVSGHNL++D GFS +N+AL
Sbjct  241  LYLTSDDSKYVSGHNLILDGGFSTTNVAL  269



>gb|KCW90498.1| hypothetical protein EUGRSUZ_A02616, partial [Eucalyptus grandis]
Length=275

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 157/236 (67%), Gaps = 14/236 (6%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF----------FVHCDVTSESDVQSAVNKAVSTHGRLDI  372
            VF  HGAKV+IAD  D   QS           +VHCDVT+ES +++AV +AVS +G+LDI
Sbjct  33   VFAHHGAKVVIADVNDSLGQSVRDSLGQDTASYVHCDVTNESQIKAAVAEAVSAYGKLDI  92

Query  373  MVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
            M NNAGI     + I+D D  DF  V  VN  G FLG KHAA+ M   +RG IINTAS++
Sbjct  93   MFNNAGITDPNKARIVDNDKADFERVLAVNVTGVFLGVKHAAQAMIAARRGCIINTASIS  152

Query  553  GFMGG-FPHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---  720
              +GG   HAYTC+KHA++GLT+N A++LG++GI VNC+SP+   T +A  + GL     
Sbjct  153  SNIGGSASHAYTCAKHAVLGLTRNAAVELGQFGIWVNCLSPFGCGTPLATKFVGLGPVEM  212

Query  721  DDKFDVYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            +      ++LKGV L AED+A A L+LASDE++YVSGHNL +D G ++ N + ++F
Sbjct  213  EALIGATANLKGVTLKAEDVANAALFLASDEARYVSGHNLFIDGGVTVVNPSFHMF  268



>gb|ABK24336.1| unknown [Picea sitchensis]
 gb|ACN40053.1| unknown [Picea sitchensis]
Length=291

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 162/245 (66%), Gaps = 23/245 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV++AD  D+  ++          +VHCDV+ E DV++AV+ A+  HG+LDIM
Sbjct  46   LFTKHGAKVILADIADEAGRNLAGSLSPPATYVHCDVSKEQDVRAAVDLAMEKHGQLDIM  105

Query  376  VNNAGILG-AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVA  552
             NNAG +    V  + + +   F  V  VN  GA LG KHAARVM P ++G II+TASVA
Sbjct  106  YNNAGTIEFVAVESVAEYEMEQFDRVMSVNVRGAMLGIKHAARVMIPRKKGCIISTASVA  165

Query  553  GFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFG------  711
            G +GG  P+AYT SKHAI+GLTKN A +LG+YGIRVN VSP  V T +  +Y        
Sbjct  166  GILGGLTPYAYTASKHAILGLTKNGAAELGKYGIRVNTVSPSGVATALLVNYNKQGNGSV  225

Query  712  LSEDDKFDVYS------SLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            +SE+DK  V +      +L+G  L AEDIAEA LYLASDE+KYVSGHNLVVD GFS+ N 
Sbjct  226  VSEEDKAAVEAYCTSIGNLEGATLRAEDIAEAGLYLASDEAKYVSGHNLVVDGGFSVVNH  285

Query  874  ALNLF  888
            +  L+
Sbjct  286  SWKLY  290



>ref|XP_003553613.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN02191.1| Momilactone A synthase [Glycine soja]
Length=280

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 180/264 (68%), Gaps = 14/264 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQ------  282
            M+ SS +++ AK LEGKVAIITGG  GIG+ATAK+F QHGAKV+IAD +D+  Q      
Sbjct  1    MIKSSSMASIAKMLEGKVAIITGGASGIGAATAKLFVQHGAKVIIADVQDELGQFHCKTL  60

Query  283  ----SFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  +VHCDVTS+SDV++ V  AVS +G+LDIM NNAGI G     I   D   F NV
Sbjct  61   GTTNIHYVHCDVTSDSDVKNVVEFAVSKYGKLDIMYNNAGISGDSNRSITTSDNEGFKNV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGG-FPHAYTCSKHAIVGLTKNTA  627
            F VN  GAFLG KHAARVM P +RG I+ T+SVA  +GG   HAY  SKHA+VGL KN  
Sbjct  121  FGVNVYGAFLGAKHAARVMIPAKRGVILFTSSVASLLGGETTHAYAVSKHAVVGLMKNLC  180

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY---SSLKGVDLMAEDIAEAVLY  798
            ++LG +GIRVNCV P  +PT M  +   +++ +  +V    + LKG  L AEDIA+A +Y
Sbjct  181  VELGEHGIRVNCVCPGGIPTPMLNNALKMNKKETQEVLCKVAVLKGTVLEAEDIAKAAVY  240

Query  799  LASDESKYVSGHNLVVDAGFSISN  870
            L SDE+K+VSG N V+D G+SI+N
Sbjct  241  LCSDEAKFVSGVNFVLDGGYSITN  264



>gb|EAY92297.1| hypothetical protein OsI_14018 [Oryza sativa Indica Group]
Length=278

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 159/243 (65%), Gaps = 21/243 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV IAD +D+  Q             FVHCDV+ E DV  AV+      G LD
Sbjct  34   LFREHGAKVCIADIQDEAGQKLRDSLGGDQDVLFVHCDVSVEEDVARAVDATAEKFGTLD  93

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG  G K++DI + D ++   V  +N +G F G KHAAR+M P ++GSII+  SV
Sbjct  94   IMVNNAGFTGQKITDIRNIDFSEVRKVIDINLVGVFHGMKHAARIMIPNKKGSIISLGSV  153

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYF--GLSE  720
            +  +GG  PH+YT +KHA+VGLTKN A +LG++GIRVNCVSPYAVPT ++  Y   G  +
Sbjct  154  SSVIGGLGPHSYTATKHAVVGLTKNVAGELGKHGIRVNCVSPYAVPTALSMPYLPQGERK  213

Query  721  DDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            DD    +       ++LKGVDL+ +D+A+AVLYLASDE++Y+S  NL+VD GF+  N  L
Sbjct  214  DDALKDFFAFVGGEANLKGVDLLPKDVAQAVLYLASDEARYISALNLMVDGGFTSVNHNL  273

Query  880  NLF  888
              F
Sbjct  274  RAF  276



>ref|NP_001051666.1| Os03g0810800 [Oryza sativa Japonica Group]
 gb|AAP73842.1| putative short chain alcohol dehydrogenase [Oryza sativa Japonica 
Group]
 gb|AAT77908.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 gb|ABF99487.1| Sex determination protein tasselseed 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13580.1| Os03g0810800 [Oryza sativa Japonica Group]
 gb|EAZ29016.1| hypothetical protein OsJ_13064 [Oryza sativa Japonica Group]
 dbj|BAG91826.1| unnamed protein product [Oryza sativa Japonica Group]
Length=281

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 159/243 (65%), Gaps = 21/243 (9%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV IAD +D+  Q             FVHCDV+ E DV  AV+      G LD
Sbjct  37   LFREHGAKVCIADIQDEAGQKLRDSLGGDQDVLFVHCDVSVEEDVARAVDATAEKFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG  G K++DI + D ++   V  +N +G F G KHAAR+M P ++GSII+  SV
Sbjct  97   IMVNNAGFTGQKITDIRNIDFSEVRKVIDINLVGVFHGMKHAARIMIPNKKGSIISLGSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYF--GLSE  720
            +  +GG  PH+YT +KHA+VGLTKN A +LG++GIRVNCVSPYAVPT ++  Y   G  +
Sbjct  157  SSVIGGLGPHSYTATKHAVVGLTKNVAGELGKHGIRVNCVSPYAVPTALSMPYLPQGERK  216

Query  721  DDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  879
            DD    +       ++LKGVDL+ +D+A+AVLYLASDE++Y+S  NL+VD GF+  N  L
Sbjct  217  DDALKDFFAFVGGEANLKGVDLLPKDVAQAVLYLASDEARYISALNLMVDGGFTSVNHNL  276

Query  880  NLF  888
              F
Sbjct  277  RAF  279



>ref|XP_004137687.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 ref|XP_004156632.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN58711.1| hypothetical protein Csa_3G730750 [Cucumis sativus]
Length=308

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 145/278 (52%), Positives = 179/278 (64%), Gaps = 34/278 (12%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHCD  303
            KRLEGKVAI+TGG  GIG AT ++F +HGAKV+IAD  D   Q+           FVHCD
Sbjct  31   KRLEGKVAIVTGGAKGIGEATVRLFAKHGAKVVIADVEDILGQALANTLSPSPVSFVHCD  90

Query  304  VTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSD---ILDCDATDFVNVFLVNTLGA  474
            V+SE DV++ V+  V  HG++DI+ NNAG+LG + +    ILD D  +F  V  VN  G 
Sbjct  91   VSSEDDVENLVSTTVCLHGQVDIIFNNAGVLGNQSNSHKSILDFDPDEFERVMRVNVKGV  150

Query  475  FLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGI  651
             LG KHAARVM P   G II+TASVAG +GG  PHAYT SKHAIVGLTKNTA +LGRYGI
Sbjct  151  ALGIKHAARVMIPRATGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNTACELGRYGI  210

Query  652  RVNCVSPYAVPTQMARSYF----------------GLSEDDKFDVY----SSLKGVDLMA  771
            RVNC+SP+ V T M  + +                  +E DK + +    ++LKG  L  
Sbjct  211  RVNCISPFGVATSMLVNAWRADVEEEEECMNYGVPSAAEVDKMEEFVRGLANLKGPTLKP  270

Query  772  EDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            +DIA+A LYLASDESKY+SGHNLVVD G + S   + L
Sbjct  271  KDIAQAALYLASDESKYISGHNLVVDGGVTTSRNCIGL  308



>ref|XP_002323034.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF04795.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 160/252 (63%), Gaps = 31/252 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF---------FVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D               FVHCDV+ E D+++ +N  VS +G+LD++
Sbjct  54   LFARHGAKVVIADVEDTLGTLLANSLAPSVSFVHCDVSLEEDIENLINSTVSHYGKLDVL  113

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I + DA +F  V  VN  G  LG KHAARVM P   G II+TASV
Sbjct  114  FNNAGVLGNQSKNKSIANFDAEEFDRVMQVNVRGVALGIKHAARVMIPRGVGCIISTASV  173

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----ARS----  702
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M     RS    
Sbjct  174  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRSGDEE  233

Query  703  ----YFGLS---EDDKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVD  849
                 FGL    E +K + +    ++LKG  L A DIAEA LYLASDESKYVSGHNLVVD
Sbjct  234  EDCLNFGLPCEKEVEKMEDFVRGLANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVD  293

Query  850  AGFSISNLALNL  885
             G + S   + L
Sbjct  294  GGITTSRNCVGL  305



>ref|XP_011032578.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 159/252 (63%), Gaps = 31/252 (12%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD---------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D               FVHCDV+ E D+++ +N  VS +G+LD++
Sbjct  54   LFARHGAKVVIADVEDTLGTLVANSLAPSVSFVHCDVSLEGDIENLINSTVSHYGKLDVL  113

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I++ DA +F  V  VN  G  LG KHAARVM P   G II+TASV
Sbjct  114  FNNAGVLGNQSKNKSIVNFDAEEFDRVMHVNVRGVALGIKHAARVMIPRGVGCIISTASV  173

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----ARS----  702
            AG MGG  PHAYT SKHAIVGLTKNTA +LGRYGIRVNC+SP+ V T M     RS    
Sbjct  174  AGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCISPFGVATSMLVNAWRSGGEE  233

Query  703  ----YFGLSEDDKFDVY-------SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVD  849
                 FGL  + + +         ++LKG  L A DIAEA LYLASDESKYVSGHNLVVD
Sbjct  234  EDCLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVD  293

Query  850  AGFSISNLALNL  885
             G + +   + L
Sbjct  294  GGITTTRNCVGL  305



>ref|XP_009802753.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
 ref|XP_009802755.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=276

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 186/272 (68%), Gaps = 17/272 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDES-------  279
            M S+S LST  KRLEGKVAI+TGG  GIG ATAK+F +HGAKV+IAD +D+ S       
Sbjct  1    MASASFLSTIGKRLEGKVAIVTGGASGIGEATAKLFSEHGAKVVIADVQDERSNSVSNAL  60

Query  280  ----QSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
                 S ++HCDVT+E  VQ+AV++ +ST G+LDI++ NAGI       I+D    DF  
Sbjct  61   GSPSHSIYIHCDVTNEDHVQNAVDRTISTFGKLDIIICNAGISDETKPRIIDNTKEDFER  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNT  624
            V  +N  G FL  KHAARVM P + G II+TASV+  +G    HAY  SKHA++GLTKN 
Sbjct  121  VLSINVTGVFLCMKHAARVMVPARSGCIISTASVSSRVGAAASHAYCSSKHAVLGLTKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFD----VYSSLKGVDLMAEDIAEAV  792
            A++LG++GIRVNC+SPYA+ T +A    GL E++ F+    +  +LKG  L  +D+A+A 
Sbjct  181  AVELGQFGIRVNCLSPYAMVTPLATKVVGL-ENEMFETALSMAGNLKGAILRVDDVAKAA  239

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLALNLF  888
            L+LA ++SKY+SGHNL +D GF++ N +L +F
Sbjct  240  LFLAGEDSKYISGHNLFIDGGFTVYNPSLGMF  271



>ref|XP_006360738.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 184/268 (69%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +SSL S  AK+LEGKVAIITGG  GIG+ATA++F QHGAKV IAD ++D   S     
Sbjct  1    MTTSSLQSPIAKKLEGKVAIITGGASGIGAATARLFVQHGAKVTIADIQNDLGNSLVKQI  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  FVHC+VT ESDVQ+AV+  ++  G+LDIM +NAG+LG  +S ILD D     +V
Sbjct  61   GTEHITFVHCNVTIESDVQNAVDATIAKFGKLDIMFSNAGVLGKPISSILDVDYDTIKDV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG--FMGGFPHAYTCSKHAIVGLTKNT  624
            F VN +GAF   KH ARVM P ++G I+ TAS +   +  G  H  T SK+A++GL+KN 
Sbjct  121  FDVNVVGAFFCAKHDARVMIPNKKGVILFTASASTVVYGTGVSHTSTSSKNAVLGLSKNL  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVL  795
             ++LG+YGIRVNCVSPY + T +  + FG+ +   D  F+   +LKG  L  +D+A  VL
Sbjct  181  GVELGKYGIRVNCVSPYCISTPLMLNGFGIDKQKADKWFEEGGNLKGASLDEQDVANGVL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLAL  879
            YLASD+SKY+SGHNL++D GF+ +N+AL
Sbjct  241  YLASDDSKYMSGHNLILDGGFNTTNVAL  268



>ref|XP_010999596.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Populus euphratica]
Length=280

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 167/245 (68%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD-----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +FC+HGAKV IAD +D+           E ++ ++HCDVT E DV+ AV+ AV   G LD
Sbjct  37   LFCRHGAKVCIADLQDNLGRNVCESLGGEPKTCYIHCDVTIEDDVRQAVDFAVDKFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG+ G    DI +   +DF  VF VN  G FLG KHAAR+M P+ +GSI++  SV
Sbjct  97   IMVNNAGLGGPPCPDIREVALSDFEKVFDVNVKGVFLGMKHAARIMIPLNKGSIVSLCSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PHAYT SKHA++GLT++ A +LG++GIRVNCVSPY V T +A ++  L ED+
Sbjct  157  ASAIGGLGPHAYTGSKHAVLGLTRSVAAELGKHGIRVNCVSPYGVATSLAVAH--LPEDE  214

Query  727  K-------FDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            +       F  +    ++L+GV+L  +D+A AVL+LASDE++Y+SG NL++D GF+ +N 
Sbjct  215  RTEDALIGFRSFVGRNANLQGVELTVDDVANAVLFLASDEARYISGDNLMLDGGFTCTNH  274

Query  874  ALNLF  888
            +L +F
Sbjct  275  SLRVF  279



>ref|XP_004237828.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=275

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 165/245 (67%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDESQSF-----------FVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV IAD +D+  Q             F+HCDVT E+D+ +AV+  V   G LD
Sbjct  32   LFHKHGAKVCIADIQDEVGQHVCETLGNDQNVCFIHCDVTVEADISNAVDFTVQKFGTLD  91

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG+ G  + DI + + + F NV  VN  G FLG KHAAR+M P+++G+I++  SV
Sbjct  92   IMVNNAGLSGPPIGDIREYELSVFENVLDVNLKGTFLGMKHAARIMIPLKKGAIVSLCSV  151

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PH YT SK+A++GLT+N A +LG++G+ VNCVSPYAVPT +A ++  L ED+
Sbjct  152  ASAIGGVGPHGYTASKYAVLGLTQNVAAELGKHGVHVNCVSPYAVPTGLALAH--LPEDE  209

Query  727  KFD-----------VYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            K D             ++L+GV+L  +D+A AVL+LASDES+Y+SGHNL+VD GFS  N 
Sbjct  210  KTDDAMEGFRDFAARNANLQGVELTVDDVANAVLFLASDESRYISGHNLMVDGGFSCVNH  269

Query  874  ALNLF  888
            +L +F
Sbjct  270  SLRVF  274



>ref|XP_003552289.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Glycine 
max]
Length=298

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 191/298 (64%), Gaps = 30/298 (10%)
 Frame = +1

Query  82   VLVISSQEIDS-RKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIA  258
            ++V+S + +      ++ +  S+++KRLEGKVAI+TGG  GIG AT +VF +HGAKV+IA
Sbjct  1    MIVMSEKPLQGVPPQITDTTFSSSSKRLEGKVAIVTGGAKGIGEATVRVFVKHGAKVMIA  60

Query  259  DTRDD---------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AK  405
            D  D             + +VHCDV+ E +V+  V+  +S +G LDIM NNAG+LG  +K
Sbjct  61   DVEDAAGAMLAETLSPSATYVHCDVSIEKEVEKLVSSTISRYGHLDIMFNNAGVLGNQSK  120

Query  406  VSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAY  582
               I++ D  +F  V  VN  G  LG KHAARVM P   G II+T+SVAG MGG  PHAY
Sbjct  121  NKSIVNFDPDEFDKVMCVNVKGVALGIKHAARVMIPRGIGCIISTSSVAGVMGGLGPHAY  180

Query  583  TCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----------ARSYFGLS---ED  723
            T SKHAIVG+TKNTA +LGRYGIRVNC+SP+ V T M            + FG+    E 
Sbjct  181  TASKHAIVGITKNTACELGRYGIRVNCISPFGVATSMLVNAWRPCDDEGTNFGVPFPEEV  240

Query  724  DKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            +K + +    ++L+G  L A DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  241  EKIEEFVRGLANLRGPTLRALDIAEAALYLASDESKYVSGHNLVVDGGVTSSRNCIGL  298



>ref|XP_002325666.2| hypothetical protein POPTR_0019s14650g, partial [Populus trichocarpa]
 gb|EEF00048.2| hypothetical protein POPTR_0019s14650g, partial [Populus trichocarpa]
Length=277

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 156/248 (63%), Gaps = 35/248 (14%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDDES---------QSFFVHCDVTSESDVQSAVNKAVSTHGRLDIM  375
            +F +HGAKV+IAD  D             + +V CDV  E +++S +N  +S +GRLDI+
Sbjct  22   LFVRHGAKVVIADIEDANGIALAESLSPSAVYVRCDVCLEEEIESLINLTISQYGRLDIL  81

Query  376  VNNAGILG--AKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
             NNAG+LG  +K   I++ DA +F N+  +N  GA LG KHAARVM P + G +I+TASV
Sbjct  82   FNNAGVLGNQSKHKSIINFDADEFDNIMRINVRGAALGMKHAARVMVPRRSGCVISTASV  141

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM-ARSYFGLSED  723
            AG +GG  PHAYT SKHAIVGLTKNTA +L RYGIRVNC+SP+ V T M   ++ G  ED
Sbjct  142  AGIIGGLGPHAYTASKHAIVGLTKNTACELSRYGIRVNCISPFGVATSMLVNAWRGCEED  201

Query  724  DKFDV----------------------YSSLKGVDLMAEDIAEAVLYLASDESKYVSGHN  837
               D                         +LKG  L A+DIAEA LYLASDESKYVSGHN
Sbjct  202  GDDDEKCMDFGAPSEEEMEKMEELVRGLGNLKGATLKAKDIAEAALYLASDESKYVSGHN  261

Query  838  LVVDAGFS  861
            LVVD GF+
Sbjct  262  LVVDGGFT  269



>gb|KHN40676.1| Sex determination protein tasselseed-2 [Glycine soja]
Length=298

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 190/298 (64%), Gaps = 30/298 (10%)
 Frame = +1

Query  82   VLVISSQEIDS-RKMVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIA  258
            ++V+S + +      ++ +  S ++KRLEGKVAI+TGG  GIG AT +VF +HGAKV+IA
Sbjct  1    MIVMSEKPLQGVPPQITDTTFSPSSKRLEGKVAIVTGGAKGIGEATVRVFVKHGAKVMIA  60

Query  259  DTRDD---------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILG--AK  405
            D  D             + +VHCDV+ E +V+  V+  +S +G LDIM NNAG+LG  +K
Sbjct  61   DVEDAAGAMLAETLSPSATYVHCDVSIEKEVEKLVSSTISRYGHLDIMFNNAGVLGNQSK  120

Query  406  VSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAY  582
               I++ D  +F  V  VN  G  LG KHAARVM P   G II+T+SVAG MGG  PHAY
Sbjct  121  NKSIVNFDPDEFDKVMCVNVKGVALGIKHAARVMIPRGIGCIISTSSVAGVMGGLGPHAY  180

Query  583  TCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQM----------ARSYFGLS---ED  723
            T SKHAIVG+TKNTA +LGRYGIRVNC+SP+ V T M            + FG+    E 
Sbjct  181  TASKHAIVGITKNTACELGRYGIRVNCISPFGVATSMLVNAWRPCDDEGTNFGVPFPEEV  240

Query  724  DKFDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            +K + +    ++L+G  L A DIAEA LYLASDESKYVSGHNLVVD G + S   + L
Sbjct  241  EKIEEFVRGLANLRGPTLRALDIAEAALYLASDESKYVSGHNLVVDGGVTSSRNCIGL  298



>ref|XP_010999595.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Populus euphratica]
Length=302

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 167/245 (68%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD-----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +FC+HGAKV IAD +D+           E ++ ++HCDVT E DV+ AV+ AV   G LD
Sbjct  59   LFCRHGAKVCIADLQDNLGRNVCESLGGEPKTCYIHCDVTIEDDVRQAVDFAVDKFGTLD  118

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAG+ G    DI +   +DF  VF VN  G FLG KHAAR+M P+ +GSI++  SV
Sbjct  119  IMVNNAGLGGPPCPDIREVALSDFEKVFDVNVKGVFLGMKHAARIMIPLNKGSIVSLCSV  178

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            A  +GG  PHAYT SKHA++GLT++ A +LG++GIRVNCVSPY V T +A ++  L ED+
Sbjct  179  ASAIGGLGPHAYTGSKHAVLGLTRSVAAELGKHGIRVNCVSPYGVATSLAVAH--LPEDE  236

Query  727  K-------FDVY----SSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            +       F  +    ++L+GV+L  +D+A AVL+LASDE++Y+SG NL++D GF+ +N 
Sbjct  237  RTEDALIGFRSFVGRNANLQGVELTVDDVANAVLFLASDEARYISGDNLMLDGGFTCTNH  296

Query  874  ALNLF  888
            +L +F
Sbjct  297  SLRVF  301



>gb|KDP36152.1| hypothetical protein JCGZ_08796 [Jatropha curcas]
Length=274

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 179/259 (69%), Gaps = 16/259 (6%)
 Frame = +1

Query  142  STAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-----------  288
            ++  +RLEGKVA+ITGG  GIG  TA++F + GAKVLIAD +DD   S            
Sbjct  4    TSTTRRLEGKVALITGGASGIGECTARLFVEQGAKVLIADVQDDLGHSICQEFNNQEIIS  63

Query  289  FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTL  468
            ++HC+VTS+SDV++AV+ AVS +G+LDIM NNAG+ G+  ++IL  D  +F  VF VN  
Sbjct  64   YIHCNVTSDSDVKNAVDTAVSRYGKLDIMFNNAGVSGSPGANILGSDNEEFKKVFDVNVF  123

Query  469  GAFLGTKHAARVMKPVQRGSIINTAS-VAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRY  645
            G FLG KHAARVM P ++G I+ TAS V+  +G   HAY  SKHA+VGL KN +++LG+Y
Sbjct  124  GPFLGAKHAARVMIPEKKGCILFTASAVSVCLGESSHAYAASKHAVVGLAKNLSVELGKY  183

Query  646  GIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAEAVLYLASDE  813
            GIRVN +SP+ V T M +S  G+S+    + + S    LK V L  EDIA A LYLASDE
Sbjct  184  GIRVNAISPFTVVTPMMKSLLGISDKRAAEEFISSIGNLKTVLLEPEDIANAALYLASDE  243

Query  814  SKYVSGHNLVVDAGFSISN  870
            SKYVSG NLVVD GFS++N
Sbjct  244  SKYVSGLNLVVDGGFSLTN  262



>gb|KHG10215.1| hypothetical protein F383_13541 [Gossypium arboreum]
Length=272

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 178/259 (69%), Gaps = 16/259 (6%)
 Frame = +1

Query  142  STAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF-----------  288
            S+ AKRLEGKVA+ITGG  GIG +T +VF +HGA VL+AD +D+  QS            
Sbjct  6    SSVAKRLEGKVALITGGASGIGESTTRVFVEHGATVLVADIQDELGQSLCKQLGSPETVS  65

Query  289  FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFLVNTL  468
            + HCDV SESDVQ+AV+ AVS +G+LDIM NNAGI G     ++  +  +F  VF VN L
Sbjct  66   YTHCDVKSESDVQNAVDTAVSRYGKLDIMFNNAGIAGEAEPRLIASNLHNFKRVFDVNVL  125

Query  469  GAFLGTKHAARVMKPVQRGSIINTAS-VAGFMGGFPHAYTCSKHAIVGLTKNTALDLGRY  645
            G FLG KHAARVM P ++G I+ TAS V+    G  HAYT SKHA+VGLT+N A++LG Y
Sbjct  126  GGFLGAKHAARVMIPAKKGCILFTASIVSKICMGLSHAYTTSKHAVVGLTENLAVELGEY  185

Query  646  GIRVNCVSPYAVPTQMARSYFGLSEDDKFDVYSS----LKGVDLMAEDIAEAVLYLASDE  813
            GIRVNC+SPYA+ T + +   G+S+ +K +   S    LKG  L   D+A+A L+LASD+
Sbjct  186  GIRVNCISPYAIVTPLFQKTSGVSKKEKVEGILSAAGVLKGAILEPSDVAQAALFLASDD  245

Query  814  SKYVSGHNLVVDAGFSISN  870
            +KY++G NL VD G+S++N
Sbjct  246  AKYLNGVNLPVDGGYSLNN  264



>ref|XP_004494228.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=273

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 186/270 (69%), Gaps = 16/270 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQS-----  285
            M SSS      +RLEGKVA+ITGG  GIG  TA++F + GAKV+IAD +D+   S     
Sbjct  1    MASSS--PAVNRRLEGKVALITGGASGIGKRTAEIFAEQGAKVVIADIQDEVGHSVVESI  58

Query  286  -----FFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                 F+VHCDVT E+ V++AV+K V T+G+LDIM NNAGI G   + I+D D  DF  V
Sbjct  59   GASTCFYVHCDVTDENQVKNAVDKTVETYGKLDIMFNNAGIGGPNNARIIDNDKADFERV  118

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAGFMGGFP-HAYTCSKHAIVGLTKNTA  627
              VN  G F+G KHAA+ M P + GSII+T+SV+ ++GG   HAYTC+KHA+VGLTKN A
Sbjct  119  LSVNVTGVFVGIKHAAQAMIPARTGSIISTSSVSSYVGGAASHAYTCAKHAVVGLTKNAA  178

Query  628  LDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVLY  798
            ++LG++GIRVNC+SPY   T +A  + G  +   ++    +++LKGV    +D+A A L+
Sbjct  179  VELGQFGIRVNCLSPYGCATPLATQFIGCDDHVFENVMSGFANLKGVTFKTDDVANAALF  238

Query  799  LASDESKYVSGHNLVVDAGFSISNLALNLF  888
             ASD+SKY+SGHNL++D GFSI N + N+F
Sbjct  239  FASDDSKYISGHNLLIDGGFSIVNPSFNMF  268



>ref|XP_006361612.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=281

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 183/269 (68%), Gaps = 16/269 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDD---------  273
            M +SS  S  AK+LEGKVAIITGG  GIG+ATA++F QHGAKV+IAD ++D         
Sbjct  1    MANSSFQSPIAKKLEGKVAIITGGASGIGAATARLFVQHGAKVVIADIQNDLGNSLVKQI  60

Query  274  --ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVN  447
              E    +VHC+V+ ESDV++ V+  ++  G+LDIM +NAG+LG  +S ILD D     +
Sbjct  61   GTEQTIIYVHCNVSIESDVKNVVDATIAKFGKLDIMCSNAGVLGKPISSILDVDHDIIKD  120

Query  448  VFLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG--FMGGFPHAYTCSKHAIVGLTKN  621
            VF VN +GAF   KHAARVM P ++G I+ TAS +   F  G PH Y  SK A++GL+ N
Sbjct  121  VFDVNVVGAFFCAKHAARVMIPNKKGVILFTASASTVVFGAGVPHTYASSKTAVLGLSTN  180

Query  622  TALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAV  792
              ++LG+YGIRVNCVSPY + T +  + FG+ E   D  F+   +LKG  L  +D+A A+
Sbjct  181  VGVELGKYGIRVNCVSPYYISTPLVVNGFGVEEQKADKWFEEGGNLKGALLDEQDVANAM  240

Query  793  LYLASDESKYVSGHNLVVDAGFSISNLAL  879
            LYL SD+SKYVSGHNL++D GFS +N+A+
Sbjct  241  LYLTSDDSKYVSGHNLILDGGFSTTNVAI  269



>ref|XP_008442351.1| PREDICTED: short-chain dehydrogenase reductase 2a [Cucumis melo]
Length=307

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/278 (52%), Positives = 177/278 (64%), Gaps = 34/278 (12%)
 Frame = +1

Query  154  KRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----------FVHCD  303
            KRLEGKVAI+TGG  GIG AT ++F +HGAKV+IAD  D   Q+           FVHCD
Sbjct  30   KRLEGKVAIVTGGAKGIGEATVRLFAKHGAKVVIADVEDILGQALADTLSPSPVSFVHCD  89

Query  304  VTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSD---ILDCDATDFVNVFLVNTLGA  474
            V+SE DV+  V+  V  HG +DI+ NNAG+LG++      ILD D  +F  V  VN  G 
Sbjct  90   VSSEDDVERLVSTTVCLHGHVDIIFNNAGVLGSQSKSHKSILDFDPDEFERVMRVNVKGV  149

Query  475  FLGTKHAARVMKPVQRGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGI  651
             LG KHAARVM P   G II+TASVAG +GG  PHAYT SKHAIVGLTKNTA +LGR+GI
Sbjct  150  ALGIKHAARVMIPRATGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNTACELGRHGI  209

Query  652  RVNCVSPYAVPTQMARSYF----------------GLSEDDKFDVY----SSLKGVDLMA  771
            RVNC+SP+ V T M  + +                  +E DK + +    ++LKG  L  
Sbjct  210  RVNCISPFGVATSMLVNAWRADVEEEDQCMNYGVPSAAEVDKMEEFVRGLANLKGPTLRP  269

Query  772  EDIAEAVLYLASDESKYVSGHNLVVDAGFSISNLALNL  885
            +DIA+A LYLASDESKY+SGHNLVVD G + S   + L
Sbjct  270  KDIAQAALYLASDESKYISGHNLVVDGGITTSTNCIGL  307



>ref|XP_010314459.1| PREDICTED: uncharacterized protein LOC100750250 isoform X1 [Solanum 
lycopersicum]
Length=288

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 180/267 (67%), Gaps = 14/267 (5%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M + SL S  AK+LEGK+AIITGG  GIG ATA++F QHGAKV IAD +DD   S     
Sbjct  1    MATPSLQSPIAKKLEGKIAIITGGASGIGLATARLFIQHGAKVTIADIQDDLVNSLVKEN  60

Query  289  ----FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNVFL  456
                FVHCDV  ESDVQ+ V+  V+  G+LDIM +NAG+ G  +S ILD D     NVF 
Sbjct  61   EHLMFVHCDVAIESDVQNVVDATVAKFGKLDIMFSNAGVAGKSISSILDVDTDIIKNVFD  120

Query  457  VNTLGAFLGTKHAARVMKPVQ-RGSIINTASVAGFMGGF-PHAYTCSKHAIVGLTKNTAL  630
            VN +GAFL  KHAARVM     +GSII T S A  + G  PH+Y  SK A++GL KN  +
Sbjct  121  VNVVGAFLCAKHAARVMISSHTKGSIIFTTSAATVVYGIVPHSYAASKSAVLGLCKNIGV  180

Query  631  DLGRYGIRVNCVSPYAVPTQMARSYFGLSEDDKFDVY----SSLKGVDLMAEDIAEAVLY  798
            +LGRYGI+VNCVSP+ + T++A    G+ E +K + +     +LKGV L  +D+A  VLY
Sbjct  181  ELGRYGIKVNCVSPHYISTKLALDALGIDEREKAERWFGEGGNLKGVLLEEQDVANGVLY  240

Query  799  LASDESKYVSGHNLVVDAGFSISNLAL  879
            LASD+SKYVSG NLV+D G+S +N+AL
Sbjct  241  LASDDSKYVSGLNLVIDGGYSTTNVAL  267



>ref|XP_009776711.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=284

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 180/268 (67%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  MVSSSLLSTAAKRLEgkvaiitggvggigsatakVFCQHGAKVLIADTRDDESQSF----  288
            M +S L S  AK+L+GKVA ITGG  GIG+ATA++F QHGAKV+IAD +D  + S     
Sbjct  1    MANSPLQSPIAKKLQGKVAFITGGASGIGAATARLFVQHGAKVIIADIQDSLATSVVQEI  60

Query  289  ------FVHCDVTSESDVQSAVNKAVSTHGRLDIMVNNAGILGAKVSDILDCDATDFVNV  450
                  F+HCDV  ESDVQ+AV+  V+  G+LDIM +NAG+LG  +S IL+ D      V
Sbjct  61   GTENATFIHCDVAIESDVQNAVDATVAKFGKLDIMYSNAGVLGKPISSILEVDYDIIKTV  120

Query  451  FLVNTLGAFLGTKHAARVMKPVQRGSIINTASVAG--FMGGFPHAYTCSKHAIVGLTKNT  624
            F VN +G F   KHAARVM P ++G I+ TAS +   +    PH Y+ SK+A++GL+KN 
Sbjct  121  FDVNIVGKFFCAKHAARVMIPAKKGVILFTASASTEVYGAAVPHTYSASKNALLGLSKNV  180

Query  625  ALDLGRYGIRVNCVSPYAVPTQMARSYFGLSE---DDKFDVYSSLKGVDLMAEDIAEAVL  795
             ++LG YGIRVNCVSPY + T +  + FG+ +   D  F    +LKG  L  ED+A+AVL
Sbjct  181  GVELGEYGIRVNCVSPYYISTPLVLNGFGIDKQMADKWFAAGGNLKGALLGVEDVAKAVL  240

Query  796  YLASDESKYVSGHNLVVDAGFSISNLAL  879
            YLASD+SKY SG NLV+D GFS +N+AL
Sbjct  241  YLASDDSKYASGMNLVLDGGFSTTNVAL  268



>ref|NP_001275796.1| short chain alcohol dehydrogenase [Citrus sinensis]
 gb|ADH82118.1| short chain alcohol dehydrogenase [Citrus sinensis]
Length=280

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 160/245 (65%), Gaps = 25/245 (10%)
 Frame = +1

Query  223  VFCQHGAKVLIADTRDD-----------ESQSFFVHCDVTSESDVQSAVNKAVSTHGRLD  369
            +F +HGAKV IAD +D+           E  +FF HCDVT E DV SAV+  V   G LD
Sbjct  37   LFHKHGAKVCIADVQDNLGQQVCQSLGGEPDTFFCHCDVTKEEDVCSAVDLTVEKFGTLD  96

Query  370  IMVNNAGILGAKVSDILDCDATDFVNVFLVNTLGAFLGTKHAARVMKPVQRGSIINTASV  549
            IMVNNAGI GA   DI + D ++F  VF +N  G F G KHAAR+M P  +G+II+  SV
Sbjct  97   IMVNNAGISGAPCPDIREADLSEFEKVFDINXKGVFHGMKHAARIMIPQTKGTIISICSV  156

Query  550  AGFMGGF-PHAYTCSKHAIVGLTKNTALDLGRYGIRVNCVSPYAVPTQMARSYFGLSEDD  726
            AG +GG  PHAYT SKHA +GL KN A +LG+YGIRVNCVSPYAV T +A ++  L E++
Sbjct  157  AGAIGGLGPHAYTGSKHAXLGLNKNVAAELGKYGIRVNCVSPYAVATGLALAH--LPEEE  214

Query  727  KFD-----------VYSSLKGVDLMAEDIAEAVLYLASDESKYVSGHNLVVDAGFSISNL  873
            + +             ++++G +L A D+A AVL+LASDE++Y+ G NL+VD GF+  N 
Sbjct  215  RTEDAMVGFRNFVARNANMQGTELTANDVANAVLFLASDEARYIXGTNLMVDGGFTSVNH  274

Query  874  ALNLF  888
            +L +F
Sbjct  275  SLRVF  279



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2169515985086