BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25035_g2_i3 len=857 path=[11771:0-71 11574:72-98 3148:99-119
3169:120-160 3209:161-165 3214:166-199 13363:200-206 7355:207-258
3274:259-290 2018:291-308 2036:309-344 13462:345-346 11984:347-369
3384:370-430 13517:431-442 3457:443-455 3470:456-479 3494:480-524
73:525-547 96:548-574 367:575-596 389:597-641 434:642-709
502:710-729 522:730-750 543:751-762 13672:763-774 567:775-790
13703:791-856]

Length=857
                                                                      Score     E

emb|CBI28276.3|  unnamed protein product                                211   3e-72   
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                205   8e-70   
ref|XP_011088939.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   9e-70   
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   2e-69   
gb|AFK46966.1|  unknown                                                 191   2e-69   
gb|AFK37606.1|  unknown                                                 195   2e-68   
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   2e-68   
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   2e-68   
emb|CBI28275.3|  unnamed protein product                                202   3e-68   
ref|XP_011089208.1|  PREDICTED: secoisolariciresinol dehydrogenas...    192   4e-67   
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             195   4e-67   
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             198   5e-67   
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   8e-67   Vitis vinifera
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   1e-66   
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    193   2e-66   
ref|XP_004506206.1|  PREDICTED: momilactone A synthase-like             189   2e-66   
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    192   2e-66   
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   3e-66   
ref|XP_006388114.1|  alcohol dehydroge family protein                   191   3e-66   
ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   6e-66   
emb|CAN68176.1|  hypothetical protein VITISV_014635                     218   1e-65   Vitis vinifera
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    189   1e-65   
ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    190   2e-65   
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             192   5e-65   
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    197   1e-64   
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    186   2e-64   
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             186   2e-64   
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    187   3e-64   
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   3e-64   Vitis vinifera
ref|XP_006481514.1|  PREDICTED: secoisolariciresinol dehydrogenas...    193   3e-64   
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   6e-64   
gb|KCW58914.1|  hypothetical protein EUGRSUZ_H01537                     189   9e-64   
ref|XP_010070261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    188   1e-63   
emb|CDP06870.1|  unnamed protein product                                194   2e-63   
ref|XP_007207105.1|  hypothetical protein PRUPE_ppa020955mg             187   3e-63   
ref|XP_010246229.1|  PREDICTED: secoisolariciresinol dehydrogenas...    192   3e-63   
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    184   3e-63   
ref|XP_006424148.1|  hypothetical protein CICLE_v10029025mg             189   4e-63   
ref|XP_006424147.1|  hypothetical protein CICLE_v10029025mg             189   4e-63   
ref|XP_010040326.1|  PREDICTED: secoisolariciresinol dehydrogenas...    186   4e-63   
emb|CDP06868.1|  unnamed protein product                                194   5e-63   
emb|CDP06869.1|  unnamed protein product                                197   7e-63   
ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    210   1e-62   Vitis vinifera
ref|XP_010049793.1|  PREDICTED: secoisolariciresinol dehydrogenas...    185   2e-62   
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    180   2e-62   
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    183   5e-62   Populus trichocarpa [western balsam poplar]
emb|CDP06872.1|  unnamed protein product                                191   7e-62   
ref|XP_002523859.1|  short chain alcohol dehydrogenase, putative        188   7e-62   Ricinus communis
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             193   9e-62   
ref|NP_001239862.1|  uncharacterized protein LOC100794412               178   5e-61   
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       191   8e-61   
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         179   1e-60   
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    184   2e-60   Populus trichocarpa [western balsam poplar]
gb|KHN11533.1|  Momilactone A synthase                                  176   2e-60   
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       189   4e-60   
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         178   5e-60   
ref|XP_003546632.1|  PREDICTED: secoisolariciresinol dehydrogenas...    175   5e-60   
ref|XP_010051779.1|  PREDICTED: secoisolariciresinol dehydrogenas...    177   1e-59   
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 190   2e-59   
gb|KCW83009.1|  hypothetical protein EUGRSUZ_C04391                     177   2e-59   
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         184   2e-59   
ref|XP_010050120.1|  PREDICTED: secoisolariciresinol dehydrogenas...    178   2e-59   
gb|KCW83006.1|  hypothetical protein EUGRSUZ_C04389                     178   2e-59   
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      188   6e-59   Cucumis sativus [cucumbers]
gb|ACU19531.1|  unknown                                                 171   6e-59   Glycine max [soybeans]
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    178   8e-59   
ref|XP_006384780.1|  alcohol dehydroge family protein                   200   1e-58   
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             199   1e-58   
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         183   2e-58   
ref|XP_009605456.1|  PREDICTED: secoisolariciresinol dehydrogenas...    188   4e-58   
gb|AAK83035.1|AF286650_1  CTA                                           185   4e-58   Cucumis sativus [cucumbers]
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             176   5e-58   
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             176   6e-58   
gb|AEC10992.1|  alcohol dehydrogenase                                   175   7e-58   
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    176   9e-58   
dbj|BAE72097.1|  Lactuca sativa short-chain dehydrogenase/reducta...    176   1e-57   Lactuca sativa [cultivated lettuce]
ref|XP_002523206.1|  short chain alcohol dehydrogenase, putative        170   1e-57   Ricinus communis
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   175   2e-57   
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    179   3e-57   
ref|XP_009388139.1|  PREDICTED: momilactone A synthase-like             187   5e-57   
ref|XP_003632648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   5e-57   
ref|XP_002281462.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   6e-57   Vitis vinifera
ref|XP_004244887.1|  PREDICTED: secoisolariciresinol dehydrogenas...    183   6e-57   
ref|XP_006367119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    177   7e-57   
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       188   7e-57   
ref|XP_007043248.1|  Short chain alcohol dehydrogenase                  167   8e-57   
gb|KEH29817.1|  short-chain dehydrogenase/reductase                     194   1e-56   
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    176   1e-56   
gb|KDO58270.1|  hypothetical protein CISIN_1g044923mg                   192   1e-56   
ref|XP_010324818.1|  PREDICTED: secoisolariciresinol dehydrogenas...    182   2e-56   
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    194   2e-56   
ref|XP_006362152.1|  PREDICTED: secoisolariciresinol dehydrogenas...    181   2e-56   
gb|KCW90500.1|  hypothetical protein EUGRSUZ_A02619                     176   3e-56   
ref|XP_009773000.1|  PREDICTED: secoisolariciresinol dehydrogenas...    182   4e-56   
ref|XP_010061227.1|  PREDICTED: secoisolariciresinol dehydrogenas...    175   5e-56   
ref|XP_006367118.1|  PREDICTED: secoisolariciresinol dehydrogenas...    178   5e-56   
ref|XP_006481515.1|  PREDICTED: secoisolariciresinol dehydrogenas...    192   6e-56   
ref|XP_010061228.1|  PREDICTED: secoisolariciresinol dehydrogenas...    174   7e-56   
gb|KCW45306.1|  hypothetical protein EUGRSUZ_L01036                     191   7e-56   
ref|XP_010059374.1|  PREDICTED: secoisolariciresinol dehydrogenas...    175   8e-56   
emb|CBI18081.3|  unnamed protein product                                174   2e-55   
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    176   2e-55   
ref|XP_010040330.1|  PREDICTED: secoisolariciresinol dehydrogenas...    191   2e-55   
ref|XP_010104811.1|  Momilactone A synthase                             166   4e-55   
ref|XP_006481517.1|  PREDICTED: secoisolariciresinol dehydrogenas...    190   6e-55   
ref|XP_002530171.1|  short chain alcohol dehydrogenase, putative        166   6e-55   Ricinus communis
gb|AFK35915.1|  unknown                                                 190   6e-55   
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          162   6e-55   
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            170   7e-55   
gb|KEH29815.1|  short-chain dehydrogenase/reductase                     190   7e-55   
ref|XP_004169912.1|  PREDICTED: short-chain dehydrogenase reducta...    164   8e-55   
ref|XP_007043243.1|  Short chain alcohol dehydrogenase                  159   1e-54   
gb|KDP36152.1|  hypothetical protein JCGZ_08796                         171   2e-54   
ref|XP_003540812.1|  PREDICTED: secoisolariciresinol dehydrogenase      188   3e-54   
gb|KEH29814.1|  short-chain dehydrogenase/reductase                     188   3e-54   
gb|KHN21175.1|  Momilactone A synthase                                  189   3e-54   
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    175   4e-54   
ref|XP_009605455.1|  PREDICTED: secoisolariciresinol dehydrogenas...    187   4e-54   
ref|XP_009605454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    187   4e-54   
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    173   4e-54   
gb|AFV30207.1|  borneol dehydrogenase                                   159   5e-54   
sp|F1SWA0.1|ZERSY_ZINZE  RecName: Full=Zerumbone synthase               160   5e-54   
ref|XP_006383023.1|  hypothetical protein POPTR_0005s10820g             185   6e-54   
ref|XP_002526911.1|  short chain alcohol dehydrogenase, putative        164   7e-54   Ricinus communis
ref|XP_008243484.1|  PREDICTED: secoisolariciresinol dehydrogenas...    163   7e-54   
ref|XP_009631422.1|  PREDICTED: xanthoxin dehydrogenase-like            167   9e-54   
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    173   1e-53   
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    174   1e-53   Vitis vinifera
ref|XP_004139590.1|  PREDICTED: short-chain dehydrogenase reducta...    160   1e-53   
ref|XP_007202842.1|  hypothetical protein PRUPE_ppa014608mg             164   1e-53   
ref|XP_006651946.1|  PREDICTED: zerumbone synthase-like                 166   1e-53   
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    172   1e-53   
gb|EMS67256.1|  Xanthoxin dehydrogenase                                 171   2e-53   
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    172   2e-53   
ref|XP_008392031.1|  PREDICTED: secoisolariciresinol dehydrogenas...    161   2e-53   
ref|XP_008360614.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   2e-53   
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    165   2e-53   
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    170   3e-53   
ref|XP_007027905.1|  Short chain alcohol dehydrogenase, putative        176   3e-53   
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        171   4e-53   Ricinus communis
ref|XP_009350131.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   4e-53   
ref|XP_006481516.1|  PREDICTED: secoisolariciresinol dehydrogenas...    186   4e-53   
emb|CDP02837.1|  unnamed protein product                                165   4e-53   
ref|XP_006338927.1|  PREDICTED: secoisolariciresinol dehydrogenas...    169   4e-53   
gb|KHG10215.1|  hypothetical protein F383_13541                         179   5e-53   
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             171   5e-53   
gb|KEH24184.1|  short-chain dehydrogenase/reductase                     182   6e-53   
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    170   6e-53   
ref|XP_006354216.1|  PREDICTED: secoisolariciresinol dehydrogenas...    155   7e-53   
ref|XP_004981317.1|  PREDICTED: zerumbone synthase-like                 164   7e-53   
ref|XP_004981321.1|  PREDICTED: zerumbone synthase-like                 161   8e-53   
ref|NP_001275184.1|  short-chain dehydrogenase/reductase                161   8e-53   
ref|XP_011046902.1|  PREDICTED: secoisolariciresinol dehydrogenas...    178   9e-53   
gb|EMT02624.1|  Xanthoxin dehydrogenase                                 168   9e-53   
ref|XP_003538100.1|  PREDICTED: secoisolariciresinol dehydrogenase      184   1e-52   
ref|XP_002466226.1|  hypothetical protein SORBIDRAFT_01g003880          166   1e-52   Sorghum bicolor [broomcorn]
gb|ACU18273.1|  unknown                                                 184   2e-52   Glycine max [soybeans]
ref|XP_008808776.1|  PREDICTED: zerumbone synthase                      164   2e-52   
ref|XP_010227919.1|  PREDICTED: zerumbone synthase isoform X1           168   3e-52   
ref|XP_003563948.1|  PREDICTED: zerumbone synthase isoform X2           168   3e-52   
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    167   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010931582.1|  PREDICTED: LOW QUALITY PROTEIN: zerumbone sy...    162   4e-52   
ref|XP_004237829.1|  PREDICTED: xanthoxin dehydrogenase-like            162   5e-52   
gb|KHN21176.1|  Momilactone A synthase                                  182   5e-52   
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    182   6e-52   
ref|XP_010104812.1|  Momilactone A synthase                             159   6e-52   
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    168   6e-52   
gb|KHN02192.1|  Momilactone A synthase                                  159   7e-52   
gb|KCW90498.1|  hypothetical protein EUGRSUZ_A02616                     166   7e-52   
ref|XP_006431968.1|  hypothetical protein CICLE_v10003833mg             166   7e-52   
gb|ABS87381.1|  short-chain dehydrogenase/reductase protein             171   8e-52   Lactuca sativa [cultivated lettuce]
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             182   9e-52   
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    167   1e-51   
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    166   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008643649.1|  PREDICTED: short chain alcohol dehydrogenase...    161   1e-51   
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    166   1e-51   
ref|XP_010922188.1|  PREDICTED: zerumbone synthase-like                 162   1e-51   
ref|XP_010024677.1|  PREDICTED: secoisolariciresinol dehydrogenas...    165   1e-51   
gb|KHG08861.1|  Xanthoxin dehydrogenase -like protein                   170   1e-51   
gb|KDP34955.1|  hypothetical protein JCGZ_09243                         181   1e-51   
gb|KDP36160.1|  hypothetical protein JCGZ_08804                         166   2e-51   
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         169   2e-51   
ref|XP_011094269.1|  PREDICTED: secoisolariciresinol dehydrogenas...    181   2e-51   
ref|XP_002513092.1|  short chain alcohol dehydrogenase, putative        164   2e-51   Ricinus communis
ref|XP_002323404.1|  alcohol dehydroge family protein                   172   3e-51   Populus trichocarpa [western balsam poplar]
gb|KDP36159.1|  hypothetical protein JCGZ_08803                         164   3e-51   
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    164   4e-51   
ref|XP_002530513.1|  short chain alcohol dehydrogenase, putative        179   5e-51   Ricinus communis
ref|XP_004237828.1|  PREDICTED: xanthoxin dehydrogenase-like            155   5e-51   
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   5e-51   
ref|XP_007027908.1|  Short chain alcohol dehydrogenase, putative        180   6e-51   
ref|XP_009395947.1|  PREDICTED: zerumbone synthase                      157   7e-51   
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             155   9e-51   
gb|KHN21177.1|  Momilactone A synthase                                  181   1e-50   
ref|XP_009776711.1|  PREDICTED: secoisolariciresinol dehydrogenas...    156   1e-50   
ref|XP_011091814.1|  PREDICTED: xanthoxin dehydrogenase                 163   1e-50   
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    179   1e-50   
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    164   1e-50   
gb|KHN33244.1|  Sex determination protein tasselseed-2                  164   1e-50   
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      179   2e-50   
gb|ADK56099.1|  alcohol dehydrogenase                                   178   2e-50   
ref|XP_010917566.1|  PREDICTED: momilactone A synthase-like isofo...    160   2e-50   
ref|XP_002309402.2|  hypothetical protein POPTR_0006s22270g             175   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009789920.1|  PREDICTED: xanthoxin dehydrogenase-like            159   2e-50   
gb|ACG37730.1|  sex determination protein tasselseed-2                  157   2e-50   Zea mays [maize]
gb|KDP36096.1|  hypothetical protein JCGZ_08740                         167   3e-50   
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    152   3e-50   
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    178   3e-50   
gb|KDP36155.1|  hypothetical protein JCGZ_08799                         165   3e-50   
ref|XP_007008811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    165   4e-50   
gb|KDP34951.1|  hypothetical protein JCGZ_09239                         177   4e-50   
ref|XP_006428245.1|  hypothetical protein CICLE_v10012415mg             167   4e-50   
gb|KDP32981.1|  hypothetical protein JCGZ_13012                         160   4e-50   
gb|KCW47495.1|  hypothetical protein EUGRSUZ_K01263                     160   5e-50   
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             177   6e-50   
ref|XP_007134614.1|  hypothetical protein PHAVU_010G061700g             161   6e-50   
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             177   6e-50   
ref|XP_006339148.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   6e-50   
ref|XP_009802753.1|  PREDICTED: secoisolariciresinol dehydrogenas...    163   7e-50   
ref|NP_001148513.1|  short chain alcohol dehydrogenase1                 155   7e-50   Zea mays [maize]
dbj|BAA13541.1|  CPRD12 protein                                         177   8e-50   Vigna unguiculata
ref|XP_006339150.1|  PREDICTED: secoisolariciresinol dehydrogenas...    159   8e-50   
gb|ABK23507.1|  unknown                                                 155   8e-50   Picea sitchensis
ref|XP_010035975.1|  PREDICTED: short-chain dehydrogenase reducta...    160   8e-50   
ref|XP_009611083.1|  PREDICTED: secoisolariciresinol dehydrogenas...    154   8e-50   
gb|EYU42960.1|  hypothetical protein MIMGU_mgv1a011480mg                162   8e-50   
ref|XP_010917564.1|  PREDICTED: momilactone A synthase-like             177   9e-50   
gb|ABK22004.1|  unknown                                                 155   9e-50   Picea sitchensis
ref|XP_003554452.1|  PREDICTED: secoisolariciresinol dehydrogenase      153   1e-49   
ref|XP_009631424.1|  PREDICTED: xanthoxin dehydrogenase-like            157   1e-49   
ref|XP_007132471.1|  hypothetical protein PHAVU_011G096800g             176   1e-49   
gb|ABK24197.1|  unknown                                                 158   1e-49   Picea sitchensis
gb|AER92598.1|  putative short-chain alcohol dehydrogenase              156   2e-49   
gb|KDP34949.1|  hypothetical protein JCGZ_09237                         176   2e-49   
ref|XP_010922187.1|  PREDICTED: zerumbone synthase-like                 153   2e-49   
gb|KDP37624.1|  hypothetical protein JCGZ_06967                         157   2e-49   
ref|XP_002275746.2|  PREDICTED: secoisolariciresinol dehydrogenas...    176   2e-49   Vitis vinifera
ref|XP_009592996.1|  PREDICTED: secoisolariciresinol dehydrogenas...    155   2e-49   
ref|XP_002527336.1|  short chain alcohol dehydrogenase, putative        157   2e-49   Ricinus communis
gb|ABK24336.1|  unknown                                                 155   3e-49   Picea sitchensis
ref|NP_001051666.1|  Os03g0810800                                       154   3e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92297.1|  hypothetical protein OsI_14018                          154   3e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010104810.1|  Momilactone A synthase                             176   3e-49   
ref|XP_002446247.1|  hypothetical protein SORBIDRAFT_06g009610          154   3e-49   Sorghum bicolor [broomcorn]
ref|XP_011094266.1|  PREDICTED: secoisolariciresinol dehydrogenas...    176   3e-49   
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      162   3e-49   
ref|XP_006828171.1|  hypothetical protein AMTR_s00023p00118310          157   3e-49   
ref|XP_011094267.1|  PREDICTED: secoisolariciresinol dehydrogenas...    176   3e-49   
ref|XP_010671866.1|  PREDICTED: xanthoxin dehydrogenase-like            156   4e-49   
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      162   4e-49   
gb|KDP36097.1|  hypothetical protein JCGZ_08741                         167   4e-49   
ref|XP_007132473.1|  hypothetical protein PHAVU_011G097000g             175   4e-49   
ref|XP_010102621.1|  Sex determination protein tasselseed-2             158   5e-49   
gb|KDP36151.1|  hypothetical protein JCGZ_08795                         156   5e-49   
ref|NP_001275796.1|  short chain alcohol dehydrogenase                  166   5e-49   
ref|XP_004499827.1|  PREDICTED: xanthoxin dehydrogenase-like            159   5e-49   
ref|XP_003552289.1|  PREDICTED: short-chain dehydrogenase reducta...    159   5e-49   
ref|XP_010551306.1|  PREDICTED: xanthoxin dehydrogenase                 159   5e-49   
gb|KHN40676.1|  Sex determination protein tasselseed-2                  159   6e-49   
ref|XP_002309405.1|  alcohol dehydroge family protein                   174   7e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002297758.1|  GLUCOSE INSENSITIVE 1 family protein               160   7e-49   Populus trichocarpa [western balsam poplar]
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             159   7e-49   
ref|XP_003623493.1|  Sex determination protein tasselseed-2             157   8e-49   
ref|XP_008437356.1|  PREDICTED: zerumbone synthase-like                 154   9e-49   
ref|XP_010104809.1|  Momilactone A synthase                             174   9e-49   
gb|ABK25445.1|  unknown                                                 158   1e-48   Picea sitchensis
ref|XP_010905491.1|  PREDICTED: secoisolariciresinol dehydrogenas...    159   1e-48   
gb|ABK21151.1|  unknown                                                 162   1e-48   Picea sitchensis
gb|ABK26187.1|  unknown                                                 162   1e-48   Picea sitchensis
ref|XP_002323403.1|  alcohol dehydroge family protein                   169   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011046907.1|  PREDICTED: secoisolariciresinol dehydrogenas...    174   1e-48   
ref|XP_010654128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    174   2e-48   
ref|XP_003538228.1|  PREDICTED: xanthoxin dehydrogenase-like            160   2e-48   
ref|XP_009399160.1|  PREDICTED: momilactone A synthase-like             173   2e-48   
ref|XP_002281290.1|  PREDICTED: secoisolariciresinol dehydrogenas...    174   2e-48   Vitis vinifera
ref|XP_006424145.1|  hypothetical protein CICLE_v10029347mg             171   2e-48   
ref|XP_011046906.1|  PREDICTED: secoisolariciresinol dehydrogenas...    173   2e-48   
ref|XP_007148993.1|  hypothetical protein PHAVU_005G031500g             158   2e-48   
ref|XP_010503863.1|  PREDICTED: short-chain dehydrogenase reducta...    158   2e-48   
ref|XP_010094675.1|  Sex determination protein tasselseed-2             176   2e-48   
gb|AFK45740.1|  unknown                                                 173   3e-48   
ref|XP_009373111.1|  PREDICTED: short-chain dehydrogenase reducta...    154   3e-48   
gb|KHG07244.1|  Sex determination tasselseed-2                          156   3e-48   
ref|XP_006292209.1|  hypothetical protein CARUB_v10018415mg             158   3e-48   
ref|XP_004492523.1|  PREDICTED: short-chain dehydrogenase reducta...    153   3e-48   
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         173   4e-48   
gb|ACU19262.1|  unknown                                                 160   4e-48   
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    173   5e-48   
gb|KDP36165.1|  hypothetical protein JCGZ_08809                         156   5e-48   
ref|XP_011094268.1|  PREDICTED: secoisolariciresinol dehydrogenas...    172   5e-48   
emb|CDO98188.1|  unnamed protein product                                154   6e-48   
ref|XP_006591160.1|  PREDICTED: xanthoxin dehydrogenase-like            155   7e-48   
gb|KHN13691.1|  Xanthoxin dehydrogenase                                 155   8e-48   
ref|XP_010246256.1|  PREDICTED: secoisolariciresinol dehydrogenas...    172   9e-48   
ref|XP_008367851.1|  PREDICTED: xanthoxin dehydrogenase-like            157   9e-48   
gb|EPS74091.1|  hypothetical protein M569_00663                         164   9e-48   
ref|XP_010246261.1|  PREDICTED: secoisolariciresinol dehydrogenas...    172   1e-47   
ref|XP_004152436.1|  PREDICTED: zerumbone synthase-like                 151   1e-47   
gb|KDP36157.1|  hypothetical protein JCGZ_08801                         171   1e-47   
ref|XP_002533854.1|  short chain alcohol dehydrogenase, putative        155   1e-47   
emb|CDY29039.1|  BnaC07g32450D                                          153   1e-47   
ref|XP_002309404.1|  alcohol dehydroge family protein                   171   2e-47   
ref|XP_007132474.1|  hypothetical protein PHAVU_011G097100g             171   2e-47   
ref|XP_004975524.1|  PREDICTED: momilactone A synthase-like             152   2e-47   
ref|XP_002877816.1|  short-chain dehydrogenase/reductase family p...    155   2e-47   
gb|KDP40503.1|  hypothetical protein JCGZ_24502                         160   2e-47   
emb|CAN78993.1|  hypothetical protein VITISV_001799                     174   2e-47   
ref|XP_003579668.1|  PREDICTED: momilactone A synthase-like             155   3e-47   
gb|ABD39551.1|  tasselseed2-like short-chain dehydrogenase/reductase    169   3e-47   
ref|XP_010059357.1|  PREDICTED: secoisolariciresinol dehydrogenas...    171   3e-47   
gb|ACN40590.1|  unknown                                                 157   3e-47   
gb|ABD65462.1|  short chain alcohol dehydrogenase                       159   3e-47   
ref|NP_001052709.1|  Os04g0405300                                       152   3e-47   
ref|XP_009618308.1|  PREDICTED: secoisolariciresinol dehydrogenas...    170   4e-47   
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    170   5e-47   
ref|XP_009136629.1|  PREDICTED: short-chain dehydrogenase reducta...    154   5e-47   
ref|XP_010671863.1|  PREDICTED: zerumbone synthase-like                 154   5e-47   
ref|XP_010671865.1|  PREDICTED: zerumbone synthase-like                 148   6e-47   
ref|NP_001150890.1|  sex determination protein tasselseed-2             152   6e-47   
ref|XP_002894375.1|  hypothetical protein ARALYDRAFT_474354             150   7e-47   
ref|XP_006338966.1|  PREDICTED: short-chain dehydrogenase reducta...    150   7e-47   
ref|XP_010067756.1|  PREDICTED: xanthoxin dehydrogenase                 156   8e-47   
ref|XP_010654129.1|  PREDICTED: secoisolariciresinol dehydrogenas...    169   8e-47   
gb|KDP42340.1|  hypothetical protein JCGZ_02813                         164   8e-47   
gb|ABK26305.1|  unknown                                                 148   9e-47   
ref|XP_002281352.1|  PREDICTED: secoisolariciresinol dehydrogenas...    169   9e-47   
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    170   1e-46   
gb|ABR18410.1|  unknown                                                 152   1e-46   
gb|ACU16756.1|  unknown                                                 150   1e-46   
ref|NP_190736.1|  short-chain dehydrogenase reductase 2a                153   1e-46   
gb|KDP34947.1|  hypothetical protein JCGZ_09235                         167   1e-46   
ref|XP_008669542.1|  PREDICTED: momilactone A synthase-like             150   1e-46   
ref|XP_004303064.1|  PREDICTED: xanthoxin dehydrogenase-like            153   1e-46   
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             169   1e-46   
ref|XP_011043647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    157   1e-46   
emb|CDX90636.1|  BnaA03g41450D                                          153   1e-46   
gb|KDP25017.1|  hypothetical protein JCGZ_24000                         168   2e-46   
gb|ABD39539.1|  tasselseed2-like short-chain dehydrogenase/reductase    167   2e-46   
ref|XP_002275723.3|  PREDICTED: secoisolariciresinol dehydrogenas...    168   2e-46   
ref|XP_006854739.1|  hypothetical protein AMTR_s00030p00244330          154   2e-46   
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    168   2e-46   
ref|XP_009768564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    168   2e-46   
ref|XP_002308448.2|  alcohol dehydroge family protein                   168   3e-46   
ref|XP_004252563.1|  PREDICTED: secoisolariciresinol dehydrogenas...    147   3e-46   
gb|ABD39555.1|  tasselseed2-like short-chain dehydrogenase/reductase    167   3e-46   
ref|XP_004143748.1|  PREDICTED: xanthoxin dehydrogenase-like            151   3e-46   
ref|XP_004136700.1|  PREDICTED: momilactone A synthase-like             167   3e-46   
ref|XP_007152489.1|  hypothetical protein PHAVU_004G135000g             167   3e-46   
ref|XP_002530176.1|  short chain alcohol dehydrogenase, putative        169   4e-46   
ref|XP_006303255.1|  hypothetical protein CARUB_v10009938mg             147   4e-46   
ref|XP_004305639.1|  PREDICTED: momilactone A synthase-like             167   4e-46   
ref|XP_009787721.1|  PREDICTED: xanthoxin dehydrogenase-like            144   4e-46   
ref|XP_003539841.1|  PREDICTED: secoisolariciresinol dehydrogenase      167   4e-46   
ref|XP_004166485.1|  PREDICTED: LOW QUALITY PROTEIN: xanthoxin de...    149   4e-46   
gb|KDP32262.1|  hypothetical protein JCGZ_14783                         167   4e-46   
ref|XP_007152499.1|  hypothetical protein PHAVU_004G135300g             167   4e-46   
gb|ACU18308.1|  unknown                                                 167   4e-46   
ref|XP_009420509.1|  PREDICTED: momilactone A synthase-like             166   6e-46   
ref|XP_011041828.1|  PREDICTED: short-chain dehydrogenase reducta...    168   6e-46   
ref|XP_004305640.1|  PREDICTED: momilactone A synthase-like             167   6e-46   
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    167   6e-46   
gb|KGN59171.1|  hypothetical protein Csa_3G778270                       167   7e-46   
ref|XP_010104807.1|  Momilactone A synthase                             152   7e-46   
ref|XP_010654127.1|  PREDICTED: secoisolariciresinol dehydrogenas...    167   8e-46   
emb|CDX78027.1|  BnaA09g32220D                                          152   8e-46   
gb|KFK34412.1|  hypothetical protein AALP_AA5G141400                    150   8e-46   
ref|XP_011046905.1|  PREDICTED: secoisolariciresinol dehydrogenas...    166   8e-46   
ref|NP_001052173.1|  Os04g0179100                                       149   9e-46   
ref|XP_010106398.1|  Xanthoxin dehydrogenase                            152   9e-46   
dbj|BAC53872.1|  alcohol dehydroge                                      166   1e-45   
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        166   1e-45   
ref|XP_008808791.1|  PREDICTED: zerumbone synthase-like                 143   1e-45   
ref|XP_010229744.1|  PREDICTED: short-chain dehydrogenase reducta...    153   1e-45   
ref|XP_006855389.1|  hypothetical protein AMTR_s00057p00137740          149   1e-45   
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             166   1e-45   
emb|CDP20435.1|  unnamed protein product                                166   2e-45   
ref|XP_008465699.1|  PREDICTED: xanthoxin dehydrogenase                 146   2e-45   
gb|KDO36906.1|  hypothetical protein CISIN_1g040531mg                   166   2e-45   
ref|XP_009115857.1|  PREDICTED: short-chain dehydrogenase reducta...    150   2e-45   
gb|ABK26167.1|  unknown                                                 151   2e-45   
ref|XP_006468252.1|  PREDICTED: short-chain dehydrogenase reducta...    166   2e-45   
ref|XP_006403893.1|  hypothetical protein EUTSA_v10010941mg             147   3e-45   
emb|CDP03557.1|  unnamed protein product                                151   3e-45   
emb|CAH66124.1|  OSIGBa0109M01.2                                        147   3e-45   
ref|XP_010101928.1|  Momilactone A synthase                             149   3e-45   
ref|XP_002325666.2|  hypothetical protein POPTR_0019s14650g             165   3e-45   
ref|XP_006843399.1|  hypothetical protein AMTR_s00053p00124300          166   4e-45   
ref|XP_002447766.1|  hypothetical protein SORBIDRAFT_06g015240          144   4e-45   
ref|XP_008229683.1|  PREDICTED: secoisolariciresinol dehydrogenas...    124   4e-45   
gb|KGN59172.1|  hypothetical protein Csa_3G778280                       164   4e-45   
gb|ABD39547.1|  tasselseed2-like short-chain dehydrogenase/reductase    164   4e-45   
ref|XP_011094346.1|  PREDICTED: secoisolariciresinol dehydrogenas...    164   5e-45   
emb|CBI30357.3|  unnamed protein product                                163   5e-45   
emb|CDX73704.1|  BnaC08g22990D                                          149   6e-45   
ref|XP_010244665.1|  PREDICTED: secoisolariciresinol dehydrogenas...    142   7e-45   
ref|XP_010244663.1|  PREDICTED: secoisolariciresinol dehydrogenas...    142   7e-45   
ref|XP_010244664.1|  PREDICTED: secoisolariciresinol dehydrogenas...    142   7e-45   
ref|XP_010244662.1|  PREDICTED: secoisolariciresinol dehydrogenas...    142   7e-45   
ref|XP_010244661.1|  PREDICTED: secoisolariciresinol dehydrogenas...    142   8e-45   
ref|XP_006444212.1|  hypothetical protein CICLE_v10021400mg             145   9e-45   
emb|CAH66125.1|  OSIGBa0109M01.3                                        152   1e-44   
emb|CBI30355.3|  unnamed protein product                                161   1e-44   
ref|XP_009354435.1|  PREDICTED: xanthoxin dehydrogenase                 146   1e-44   
ref|XP_007218800.1|  hypothetical protein PRUPE_ppa009814mg             148   1e-44   
ref|NP_001052174.1|  Os04g0179200                                       152   1e-44   
ref|XP_007026535.1|  NAD(P)-binding Rossmann-fold superfamily pro...    164   1e-44   
ref|XP_011077500.1|  PREDICTED: short-chain dehydrogenase reducta...    164   2e-44   
gb|AGT01914.1|  putative short chain alcohol dehydrogenase              160   2e-44   
gb|KDP36156.1|  hypothetical protein JCGZ_08800                         163   2e-44   
ref|XP_008442883.1|  PREDICTED: secoisolariciresinol dehydrogenas...    163   2e-44   
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             164   2e-44   
ref|XP_008245281.1|  PREDICTED: xanthoxin dehydrogenase                 148   2e-44   
ref|XP_007027881.1|  Short chain alcohol dehydrogenase                  150   2e-44   
ref|XP_009618318.1|  PREDICTED: secoisolariciresinol dehydrogenas...    163   3e-44   
ref|XP_006354115.1|  PREDICTED: secoisolariciresinol dehydrogenas...    162   3e-44   
ref|XP_010246244.1|  PREDICTED: secoisolariciresinol dehydrogenas...    162   3e-44   
gb|ABD39544.1|  tasselseed2-like short-chain dehydrogenase/reductase    162   3e-44   
gb|ACB87357.1|  secoisolariciresinol dehydrogenase                      162   3e-44   
ref|XP_009147691.1|  PREDICTED: xanthoxin dehydrogenase                 141   3e-44   
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    163   4e-44   
ref|XP_009372539.1|  PREDICTED: secoisolariciresinol dehydrogenas...    162   4e-44   
ref|XP_006479859.1|  PREDICTED: short-chain dehydrogenase reducta...    143   4e-44   
ref|XP_006844487.1|  hypothetical protein AMTR_s00016p00114910          140   4e-44   
ref|XP_010104808.1|  Momilactone A synthase                             163   4e-44   
emb|CDY52974.1|  BnaA06g01590D                                          140   5e-44   
gb|KDP36168.1|  hypothetical protein JCGZ_08812                         162   5e-44   
ref|XP_006368128.1|  PREDICTED: secoisolariciresinol dehydrogenas...    158   7e-44   
emb|CDP20942.1|  unnamed protein product                                144   7e-44   
ref|XP_003598766.1|  Short-chain dehydrogenase/reductase                141   7e-44   
ref|XP_002265724.1|  PREDICTED: xanthoxin dehydrogenase                 145   7e-44   
ref|XP_010479742.1|  PREDICTED: xanthoxin dehydrogenase                 142   7e-44   
gb|EPS72418.1|  short chain alcohol dehydrogenase                       151   7e-44   
emb|CBI30358.3|  unnamed protein product                                159   8e-44   
gb|EYU18090.1|  hypothetical protein MIMGU_mgv1a010990mg                162   8e-44   
ref|XP_006577090.1|  PREDICTED: secoisolariciresinol dehydrogenas...    161   9e-44   
gb|ABD39542.1|  tasselseed2-like short-chain dehydrogenase/reductase    160   9e-44   
emb|CDY61086.1|  BnaC06g41140D                                          139   1e-43   
ref|XP_002513344.1|  short chain alcohol dehydrogenase, putative        161   1e-43   
ref|XP_008368953.1|  PREDICTED: secoisolariciresinol dehydrogenase      144   1e-43   
ref|XP_010500833.1|  PREDICTED: xanthoxin dehydrogenase-like            140   1e-43   
ref|XP_008782768.1|  PREDICTED: sex determination protein tassels...    160   1e-43   
ref|XP_011046903.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   1e-43   
ref|XP_009417972.1|  PREDICTED: sex determination protein tassels...    161   2e-43   
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          160   2e-43   
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             160   2e-43   
gb|ABD39543.1|  tasselseed2-like short-chain dehydrogenase/reductase    159   2e-43   
gb|ACU21443.1|  unknown                                                 159   2e-43   
gb|KDP36166.1|  hypothetical protein JCGZ_08810                         160   2e-43   
gb|KHN33174.1|  Momilactone A synthase                                  161   2e-43   
ref|XP_008243483.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   2e-43   
ref|XP_008811702.1|  PREDICTED: momilactone A synthase-like             142   2e-43   
ref|XP_004228706.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   2e-43   
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       160   3e-43   
gb|KDP21551.1|  hypothetical protein JCGZ_22022                         145   3e-43   
ref|XP_007204705.1|  hypothetical protein PRUPE_ppa009636mg             160   3e-43   
ref|XP_004170965.1|  PREDICTED: zerumbone synthase-like                 160   3e-43   
ref|XP_004249781.1|  PREDICTED: secoisolariciresinol dehydrogenas...    160   3e-43   
emb|CDP19910.1|  unnamed protein product                                142   3e-43   
ref|XP_008234979.1|  PREDICTED: secoisolariciresinol dehydrogenas...    140   4e-43   
ref|XP_002524074.1|  short chain alcohol dehydrogenase, putative        157   4e-43   
gb|ADB82907.1|  secoisolariciresinol dehydrogenase                      145   4e-43   
gb|ABD39526.1|  tasselseed2-like short-chain dehydrogenase/reductase    159   4e-43   
ref|XP_006392929.1|  hypothetical protein EUTSA_v10011636mg             137   4e-43   
ref|XP_004143392.1|  PREDICTED: zerumbone synthase-like                 160   4e-43   
ref|XP_008388874.1|  PREDICTED: short-chain dehydrogenase reducta...    160   4e-43   
ref|XP_009763487.1|  PREDICTED: secoisolariciresinol dehydrogenas...    159   4e-43   
ref|XP_008234980.1|  PREDICTED: secoisolariciresinol dehydrogenas...    139   5e-43   
gb|ABD39527.1|  tasselseed2-like short-chain dehydrogenase/reductase    159   5e-43   
ref|XP_007200395.1|  hypothetical protein PRUPE_ppa008509mg             140   5e-43   
emb|CDP06416.1|  unnamed protein product                                160   6e-43   
gb|ABD39550.1|  tasselseed2-like short-chain dehydrogenase/reductase    158   7e-43   
gb|EAZ29934.1|  hypothetical protein OsJ_13988                          146   8e-43   
ref|XP_009782884.1|  PREDICTED: short-chain dehydrogenase reducta...    159   9e-43   
ref|XP_011033623.1|  PREDICTED: zerumbone synthase isoform X1           139   9e-43   
ref|NP_175644.1|  Xanthoxin dehydrogenase                               139   1e-42   
gb|AHL21380.1|  secoisolariciresinol reductase                          158   1e-42   
ref|XP_009590019.1|  PREDICTED: secoisolariciresinol dehydrogenas...    158   1e-42   
ref|XP_011033624.1|  PREDICTED: zerumbone synthase isoform X2           139   1e-42   
gb|ABD39530.1|  tasselseed2-like short-chain dehydrogenase/reductase    157   1e-42   
ref|XP_003534665.1|  PREDICTED: short-chain dehydrogenase reducta...    159   1e-42   
ref|XP_010921066.1|  PREDICTED: LOW QUALITY PROTEIN: sex determin...    159   1e-42   
gb|ABD39533.1|  tasselseed2-like short-chain dehydrogenase/reductase    157   1e-42   
ref|XP_006361624.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   1e-42   
dbj|BAE72096.1|  Lactuca sativa short-chain dehydrogenase/reducta...    158   1e-42   
gb|AAC35340.1|  short-chain alcohol dehydrogenase                       158   1e-42   
ref|XP_009615997.1|  PREDICTED: short-chain dehydrogenase reducta...    159   1e-42   
ref|XP_010036428.1|  PREDICTED: tropinone reductase-like 1              142   1e-42   
gb|ADD70246.1|  secoisolariciresinol dehydrogenase                      158   2e-42   
ref|XP_002530170.1|  short chain alcohol dehydrogenase, putative        158   2e-42   
gb|EEC82732.1|  hypothetical protein OsI_27430                          159   2e-42   
gb|AAC35342.1|  short-chain alcohol dehydrogenase                       158   2e-42   
ref|XP_006653365.1|  PREDICTED: momilactone A synthase-like             136   2e-42   
ref|XP_010312221.1|  PREDICTED: secoisolariciresinol dehydrogenas...    157   2e-42   
ref|XP_010312220.1|  PREDICTED: secoisolariciresinol dehydrogenas...    158   2e-42   
ref|XP_004252564.1|  PREDICTED: secoisolariciresinol dehydrogenas...    134   2e-42   
gb|KDP36167.1|  hypothetical protein JCGZ_08811                         157   2e-42   
ref|XP_010112720.1|  Sex determination protein tasselseed-2             137   2e-42   
gb|ABD39522.1|  tasselseed2-like short-chain dehydrogenase/reductase    157   2e-42   
ref|XP_009626741.1|  PREDICTED: secoisolariciresinol dehydrogenas...    157   3e-42   
gb|ABD39532.1|  tasselseed2-like short-chain dehydrogenase/reductase    157   3e-42   



>emb|CBI28276.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   211 bits (537),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF QHGAKVLIAD +D+ +   IC+DLGP +A F+HCDVT E DV NA+++AV+ HG+L
Sbjct  69   KLFSQHGAKVLIADIQDE-KGHLICRDLGPSSASFIHCDVTKELDVSNAIDEAVAKHGKL  127

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G K ++ILD D  +F N  RVN LGAFLGTKHAARVM P  RG +IN+AS
Sbjct  128  DIMFNNAGILGPKIINILDNDAAEFENTMRVNVLGAFLGTKHAARVMVPAGRGCVINSAS  187

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG   H+Y  SKHAI+GLT+NTA++LG++GIRVNCV
Sbjct  188  VCSVVGGICTHSYVSSKHAILGLTRNTAVELGKFGIRVNCV  228


 Score = 89.0 bits (219),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY++PT M R +    +DD L DVYSNLKGV LM +DVAEAVLYL SD+SKYVSG+NLV
Sbjct  229  SPYVVPTPMSRKFLNSEDDDPLEDVYSNLKGVALMPQDVAEAVLYLGSDDSKYVSGNNLV  288

Query  819  VDAGFSIS-NLALN  857
            +D G + S +LAL 
Sbjct  289  IDGGVTRSFSLALK  302



>gb|EYU26737.1| hypothetical protein MIMGU_mgv1a011831mg [Erythranthe guttata]
Length=269

 Score =   205 bits (521),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAK+LIAD +DD   + ICK L P  A ++HCD+T+E+ V+NAV +A+S HG+L
Sbjct  34   KLFHEHGAKILIADVQDD-LGRRICKTLSPQTASYIHCDITNESHVENAVEEAISKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG+ G    D+L    +DF  V  VN  G FLGTKHAARVMKP  RG+IINTAS
Sbjct  93   DIMFNNAGVMGPTNTDMLVETKSDFERVLNVNITGTFLGTKHAARVMKPAHRGTIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS V+GG   HAYT SKHA++GLT+NTA++LGRYGIRVNCV
Sbjct  153  VSSVIGGACTHAYTSSKHAVLGLTRNTAVELGRYGIRVNCV  193


 Score = 87.4 bits (215),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY   + M R   G  +DD + D+YSNL G +L AEDVA+AVLYLASDES+YVSG NLV
Sbjct  194  SPYAFASPMSRGALGRDKDDPMVDIYSNLDGSNLTAEDVAQAVLYLASDESRYVSGSNLV  253

Query  819  VDAGFSISNLALN  857
            VD GFS++N +L+
Sbjct  254  VDGGFSVTNSSLS  266



>ref|XP_011088939.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=270

 Score =   201 bits (510),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKVLIAD +DD +   +C++L P +A F+HCDVT+E+D++ AV  AVS HG+L
Sbjct  34   KLFHEHGAKVLIADVQDD-KGHLVCQNLSPESASFIHCDVTNESDIRKAVETAVSIHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI      D+L+ + TDF  V RVN +GAFLGTKHAA  MK  +RGSIINTAS
Sbjct  93   DIMFNNAGIVDPVIPDMLNYNQTDFERVLRVNAVGAFLGTKHAACFMKQAKRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG   H YT SKHAIVGLTKNTA++LGRYGIRVNCV
Sbjct  153  VCSVIGGVATHGYTSSKHAIVGLTKNTAVELGRYGIRVNCV  193


 Score = 91.3 bits (225),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY  P+ M R +F   EDD +D + SNL+GV L  EDVAEAV+YLASDES+YVSGHNL+
Sbjct  194  SPYAFPSAMSRGFFERDEDDPIDDIGSNLEGVSLKPEDVAEAVVYLASDESRYVSGHNLI  253

Query  819  VDAGFSISNLAL  854
            VD GF++ N AL
Sbjct  254  VDGGFTVMNSAL  265



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   198 bits (503),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CK+L P  A F+HCDVT E DV+NAVN AVS +G+L
Sbjct  34   RLFVKHGAKVVIADIQDE-LGHSVCKELEPEPASFIHCDVTQEKDVENAVNTAVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +IL+ D  +F  +  VN +GAFLGTKHAARVM P +RGSII TAS
Sbjct  93   DIMFNNAGIGGTPKTNILENDKAEFEKIICVNLVGAFLGTKHAARVMIPARRGSIITTAS  152

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  ++ GG  HAYT SKH ++GLT+NTA++LG YGIRVNCV
Sbjct  153  VCAIIGGGLSHAYTSSKHGVLGLTRNTAVELGHYGIRVNCV  193


 Score = 92.8 bits (229),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY +PT + + +F + +D+   +YSNLKG  L AED+AEA LYL SDESKYVSGHNLVV
Sbjct  194  SPYAVPTPLFKNFFKMNDDELKCIYSNLKGAVLQAEDIAEAALYLGSDESKYVSGHNLVV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   191 bits (484),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +DD    S+CKDL   +A FVHC+VT E +V+ AVN AVS HG+L
Sbjct  34   RLFSKHGAQVVIADIQDD-LGHSVCKDLE--SASFVHCNVTKEDEVETAVNMAVSKHGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+G     IL+   ++F  VF VN  GAFLGTKHAARVM P +RGSIINTAS
Sbjct  91   DIMFNNAGISGNNNTSILNNTKSEFEQVFSVNVSGAFLGTKHAARVMIPARRGSIINTAS  150

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             SGV+ GG  H YT SKHA+VGL +NTA++L  YG+RVNCV
Sbjct  151  TSGVIGGGAPHPYTSSKHAVVGLMRNTAVELEAYGVRVNCV  191


 Score = 99.8 bits (247),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY +PT M++ +F L E+D++   YSNLKG DL+ EDVAEAVLYL SDESKYVSGHNLV
Sbjct  192  SPYFVPTPMVKNFFKLGEEDEVPKFYSNLKGADLVPEDVAEAVLYLGSDESKYVSGHNLV  251

Query  819  VDAGFSISN  845
            VD GF++ N
Sbjct  252  VDGGFTVLN  260



>gb|AFK37606.1| unknown [Medicago truncatula]
 gb|KEH29818.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   195 bits (495),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF  HGA+V+IAD +DD    SIC++L   +A +VHCDVT E D++NAVN  VS HG+L
Sbjct  34   RLFSNHGAQVVIADIQDDI-GHSICQELHKSSATYVHCDVTKEKDIENAVNTTVSKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +IL+   ++F  V  +N  G FLGTKHAARVM PV+RGSIINTAS
Sbjct  93   DIMFNNAGITGINKTNILENKLSEFQEVIDINLTGVFLGTKHAARVMTPVRRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKHA+VGL KNTA++LG YGIRVNCV
Sbjct  153  VCGCIGGVASHAYTSSKHAVVGLMKNTAIELGPYGIRVNCV  193


 Score = 93.2 bits (230),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D  LDVYSNLKG +L+ +DVAEA LYL SDESKYVSGHNLVV
Sbjct  194  SPYVVGTPLAKNFFKLDDDGVLDVYSNLKGANLLPKDVAEAALYLGSDESKYVSGHNLVV  253

Query  822  DAGFSISN  845
            D G ++ N
Sbjct  254  DGGLTVGN  261



>ref|XP_010651860.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=288

 Score =   203 bits (517),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CKDL P +A FVHCDVT+E +V+NAVN AV+THG+L
Sbjct  55   RLFSRHGAKVVIADIQDN-LGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKL  113

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TAS
Sbjct  114  DIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTAS  173

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S V GG  HAYT SKHA+VGL +N A++LG+YGIRVNCV
Sbjct  174  VCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  214


 Score = 84.3 bits (207),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + +  F L +D    VYSNLKG  L AEDVAEA LYLA DESKYVSGHNL+V
Sbjct  215  SPYLVATPLAKDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLLV  274

Query  822  DAGFSISN  845
            D GF++ N
Sbjct  275  DGGFTVVN  282



>ref|XP_010651861.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=267

 Score =   203 bits (516),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CKDL P +A FVHCDVT+E +V+NAVN AV+THG+L
Sbjct  34   RLFSRHGAKVVIADIQDN-LGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TAS
Sbjct  93   DIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S V GG  HAYT SKHA+VGL +N A++LG+YGIRVNCV
Sbjct  153  VCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  193


 Score = 84.7 bits (208),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + +  F L +D    VYSNLKG  L AEDVAEA LYLA DESKYVSGHNL+V
Sbjct  194  SPYLVATPLAKDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLLV  253

Query  822  DAGFSISN  845
            D GF++ N
Sbjct  254  DGGFTVVN  261



>emb|CBI28275.3| unnamed protein product [Vitis vinifera]
Length=861

 Score =   202 bits (515),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CKDL P +A FVHCDVT+E +V+NAVN AV+THG+L
Sbjct  305  RLFSRHGAKVVIADIQDN-LGLSVCKDLSPTSASFVHCDVTNEKEVENAVNLAVATHGKL  363

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG     ILD D T+F  V  VN +GAFLGTKHAARVM P   GSII TAS
Sbjct  364  DIMFNNAGIAGEAKPHILDNDKTEFERVLNVNVVGAFLGTKHAARVMIPAGNGSIITTAS  423

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S V GG  HAYT SKHA+VGL +N A++LG+YGIRVNCV
Sbjct  424  VCSTVGGGASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  464


 Score = 84.3 bits (207),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + +  F L +D    VYSNLKG  L AEDVAEA LYLA DESKYVSGHNL+V
Sbjct  465  SPYLVATPLAKDLFKLDDDGVSGVYSNLKGKVLNAEDVAEAALYLAGDESKYVSGHNLLV  524

Query  822  DAGFSISN  845
            D GF++ N
Sbjct  525  DGGFTVVN  532


 Score =   196 bits (498),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+IAD +D+   QS+CK+L  P +A FVHCDVTSE DV+NA+N AV+ +G+
Sbjct  627  RLFSRHGAKVVIADIQDN-LGQSVCKELSSPTSASFVHCDVTSEKDVENAINVAVAKYGK  685

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI G    +ILD D T+F  +  VN +GAFLGTKHAARVM P   GSII TA
Sbjct  686  LDIMFNNAGIVGESKPNILDNDKTEFEKILNVNVVGAFLGTKHAARVMIPAGNGSIITTA  745

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV   +GG   HAYT SKHA+VGL +N A++LG+YGIRVNCV
Sbjct  746  SVCSTVGGVASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  787


 Score = 84.7 bits (208),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYSNLKG  L  EDVAEA LYLAS+ESKYVSGHNL++
Sbjct  788  SPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNPEDVAEAALYLASEESKYVSGHNLLI  847

Query  822  DAGFSISNLAL  854
            D GF+I N A 
Sbjct  848  DGGFTIVNPAF  858


 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLFCQHGAKVLIAD + + +  SICKDLGP +A FVHCDVT E DV NA++KA+S +G+L
Sbjct  34   KLFCQHGAKVLIADIQYE-KGHSICKDLGPTSASFVHCDVTKELDVGNAIDKAISKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F N  RVN LG FLGTKHAARVM P  RGSIINTAS
Sbjct  93   DIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAPAGRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG   H+YT SKHAI+GLT+NTA++LG++GIRVNCV
Sbjct  153  VCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVNCV  193


 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDK-LDVYSNLKGVDLMAEDVAEAVLYLASD  785
            LG         SPY++PT + R +  L EDD  + VYSNLKGV L  EDVAEAVLY+ SD
Sbjct  183  LGKFGIRVNCVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSD  242

Query  786  ESKYVSGHNLVVDAGF  833
            +SKYVSGHNLV+D  F
Sbjct  243  DSKYVSGHNLVLDGSF  258



>ref|XP_011089208.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=278

 Score =   192 bits (487),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 121/169 (72%), Gaps = 10/169 (6%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKVLIAD RDD     IC++L P  A F+HCDVTSE+D+QNAV  AVST+G+L
Sbjct  34   KLFHEHGAKVLIADARDD-RGHLICQNLSPERASFIHCDVTSESDIQNAVETAVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI      ++L+    DF +V RVN +GAFLGTKHAA  MK  +RGSIINT S
Sbjct  93   DIMFNNAGILDPVIPNVLNYSQADFEHVLRVNVVGAFLGTKHAASFMKQAKRGSIINTGS  152

Query  523  VSGVMGGFQHA---------YTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG  +          Y  SKHA++GLT+NTA++LGRYGIRVNCV
Sbjct  153  VCSVIGGDDNKRDPRSRSDHYASSKHAVLGLTRNTAVELGRYGIRVNCV  201


 Score = 90.9 bits (224),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY+ P+ M R   G  EDD +D + SNL+GV L  EDVAEAV+YLASDES+Y+SGHNLV
Sbjct  202  SPYVFPSSMSRGLLGRDEDDPVDDIGSNLEGVSLKPEDVAEAVVYLASDESRYMSGHNLV  261

Query  819  VDAGFSISNLAL  854
            VD GF + N AL
Sbjct  262  VDGGFGVMNSAL  273



>ref|XP_004506207.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   195 bits (496),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +D+    SICKDL   +A FVHCD T E DV+NAVN  VS +G+L
Sbjct  34   RLFSKHGAQVVIADIQDE-MGHSICKDLNNSSASFVHCDTTKETDVENAVNTTVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+G    +IL+   ++F  V +VN +G FLGTKHA+RVM P +RGSIINTAS
Sbjct  93   DIMFNNAGISGVNKTNILENKLSEFEEVIKVNLIGVFLGTKHASRVMIPARRGSIINTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKHA++GL +NTA++LG YGIRVNCV
Sbjct  153  VGGSIGGAAPHAYTSSKHAVLGLMRNTAVELGPYGIRVNCV  193


 Score = 87.8 bits (216),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +  + ++  L VYSNLKGV+L+ EDVAEA LYL SDESKYVSGHNL+V
Sbjct  194  SPYLVATPLAKKFLKIDDEGILAVYSNLKGVNLVPEDVAEAALYLGSDESKYVSGHNLIV  253

Query  822  DAGFSISN  845
            D GF+  N
Sbjct  254  DGGFTAGN  261



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   198 bits (504),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+C++L   +A FVHCDVT E DV+NAVN AVS HG+L
Sbjct  68   RLFAKHGAKVVIADVQDE-LGHSVCEELKTESASFVHCDVTQEKDVENAVNTAVSKHGKL  126

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  V  VN +GAFLGTKHAARVM PV+RGSII+TAS
Sbjct  127  DIMFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGTKHAARVMIPVRRGSIISTAS  186

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKH ++GL +NTA++LG++GIRVNCV
Sbjct  187  VCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNCV  227


 Score = 84.3 bits (207),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T +++ +F L +D+   +YSNLK   L AED+AEA L+L SDESKYVSGHNL+V
Sbjct  228  SPYVVLTPLVKDFFKLDDDEVNRLYSNLKEAVLKAEDIAEAALFLGSDESKYVSGHNLIV  287

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  288  DGGFTIVN  295



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   197 bits (500),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+IAD +D+   QS+CK+L  P +A FVHCDVTSE DV+NA+N AV+ +G+
Sbjct  34   RLFSRHGAKVVIADIQDN-LGQSVCKELSSPTSASFVHCDVTSEKDVENAINVAVAKYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI G    +ILD D T+F  +  VN +GAFLGTKHAARVM P   GSII TA
Sbjct  93   LDIMFNNAGIVGESKPNILDNDKTEFEKILNVNVVGAFLGTKHAARVMIPAGNGSIITTA  152

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV   +GG   HAYT SKHA+VGL +N A++LG+YGIRVNCV
Sbjct  153  SVCSTVGGVASHAYTSSKHAVVGLARNAAVELGKYGIRVNCV  194


 Score = 85.1 bits (209),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYSNLKG  L  EDVAEA LYLAS+ESKYVSGHNL++
Sbjct  195  SPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNPEDVAEAALYLASEESKYVSGHNLLI  254

Query  822  DAGFSISNLAL  854
            D GF+I N A 
Sbjct  255  DGGFTIVNPAF  265



>ref|XP_010049792.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   197 bits (500),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD RDD   +S+CKDLGP  A FVHCDV+SE+D++NA+  AV  HG+L
Sbjct  34   RLFSKHGARVIIADIRDD-LGKSVCKDLGPETASFVHCDVSSESDIKNAIATAVDKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I       ILD D  DF  V  VN  G FLGTKHAAR M P QRGSIIN  S
Sbjct  93   DIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTGVFLGTKHAARAMIPSQRGSIINLGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKHA++GLT+N A +LGRYG+R+NC+
Sbjct  153  VCSSVGGVASHAYTSSKHAVLGLTRNVAAELGRYGVRINCL  193


 Score = 84.7 bits (208),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +3

Query  621  RYPSQL-C-SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESK  794
            RY  ++ C SPY I T + +  F + ED  + VYSN+ GV L  EDVAEA LYL SDESK
Sbjct  185  RYGVRINCLSPYFILTPLTKAIFQIDEDAGVRVYSNMDGVTLRQEDVAEAALYLGSDESK  244

Query  795  YVSGHNLVVDAGFSISNLALN  857
            YVSGHNL VD GF+  N A  
Sbjct  245  YVSGHNLAVDGGFTTINPAFG  265



>ref|XP_008230130.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   193 bits (490),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD  ++S+C+DL P +  FVHCDVT E DV+NAV  A + +G L
Sbjct  36   RLFSKHGAKVVIADVQDD-FAESVCRDLSPSSTSFVHCDVTKEEDVENAVQTATNKYGEL  94

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  95   DIMFNNAGIIGTNKPNILDNDRVEFEQVIRVNLVGAFLGIKHAARVMIPAGKGSIINTAS  154

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKH +VGL +NTA++LG++GIRVNCV
Sbjct  155  VCSTIGGCASHAYTSSKHGLVGLVRNTAVELGQHGIRVNCV  195


 Score = 88.2 bits (217),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++PT + + +F L +D     YSNLKG  L AED+AEA LYL SDESKYVSGHNL+V
Sbjct  196  SPYVVPTPLAKEFFKLDDDGVHGAYSNLKGGVLRAEDIAEAALYLGSDESKYVSGHNLLV  255

Query  822  DAGFSISN  845
            D G++I N
Sbjct  256  DGGYTIVN  263



>ref|XP_004506206.1| PREDICTED: momilactone A synthase-like [Cicer arietinum]
Length=271

 Score =   189 bits (479),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +D+    SICKDL    A +VHCD T E D++NAVN  VS +G+L
Sbjct  34   RLFSKHGAQVVIADIQDE-MGHSICKDLNKSTASYVHCDTTKEKDIENAVNTTVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +IL+   ++F  V +VN +G FLGTKHA+RVM P +RGSIINTAS
Sbjct  93   DIMFNNAGIVGVNKTNILENKLSEFEEVIKVNLIGVFLGTKHASRVMIPARRGSIINTAS  152

Query  523  VSG-VMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G + GG  HA T SKHA++GL KNTA++LG YGIRVNCV
Sbjct  153  VCGSIGGGASHACTSSKHAVLGLMKNTAVELGPYGIRVNCV  193


 Score = 92.0 bits (227),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L ++    VYSNLKGV+L+ EDVAEA LYL SDESKYVSGHNLVV
Sbjct  194  SPYVVATPLAKKFFKLDDEGIQGVYSNLKGVNLVPEDVAEAALYLGSDESKYVSGHNLVV  253

Query  822  DAGFSISN  845
            D GF++ N
Sbjct  254  DGGFTVGN  261



>ref|XP_009374964.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=270

 Score =   192 bits (489),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F +HGAKV+IAD +DD   +S+C+DL   +A FVHCDVT E D++NAV  A S +G+L
Sbjct  34   RVFSKHGAKVVIADVQDD-LGESVCRDLNSSSASFVHCDVTKEEDIENAVKTATSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD    +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  93   DIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLGIKHAARVMIPAGQGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   MGG   HAYT SKH +VGL KN A++LG+YGIRVNCV
Sbjct  153  VCSTMGGIASHAYTSSKHGVVGLMKNAAVELGQYGIRVNCV  193


 Score = 87.8 bits (216),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYSNLKG  L  EDVAEA LYL SDESKYVSGHNL+V
Sbjct  194  SPYLVATPLAKHFFNLEDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLLV  253

Query  822  DAGFSISN  845
            D GFSI N
Sbjct  254  DGGFSIVN  261



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   197 bits (502),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+C++L   +A FVHCDVT E DV+NAVN AVS HG+L
Sbjct  34   RLFAKHGAKVVIADVQDE-LGHSVCEELKNESASFVHCDVTQEKDVENAVNTAVSKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG+ G+   +ILD D  +F  V  VN +GAFLGTKHAARVM P +RGSII+TAS
Sbjct  93   DIMFNNAGVVGSPKPNILDNDKAEFEKVISVNIVGAFLGTKHAARVMIPARRGSIISTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKH ++GL +NTA++LG++GIRVNCV
Sbjct  153  VCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNCV  193


 Score = 82.4 bits (202),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY++ T + + +F L +D+K++ VYSNLK   L AEDVAEA L+L SDESKYVSGHNL+
Sbjct  194  SPYLVSTPLAKDFFKL-DDNKVNRVYSNLKEAVLKAEDVAEAALFLGSDESKYVSGHNLI  252

Query  819  VDAGFSISN  845
            VD GF+I N
Sbjct  253  VDGGFTIVN  261



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   191 bits (486),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CK+L P  A F+HCDVT E DV+NAVN AVS +G+L
Sbjct  34   RLFVKHGAKVVIADIQDE-LGHSVCKELEPEPASFIHCDVTQEKDVENAVNTAVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG  G    +I++ D  +F  +   N +GAFLGTKHAARVM P +RGSII TAS
Sbjct  93   DIMFNNAGTGGTPKTNIIENDKAEFEKIICANLVGAFLGTKHAARVMIPARRGSIITTAS  152

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  ++ GG  HAYT SKH ++GL +NTA++LG+YGIRVNCV
Sbjct  153  VCAIIGGGSSHAYTSSKHGVLGLMRNTAVELGQYGIRVNCV  193


 Score = 88.2 bits (217),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY +PT + + +F + +D+   +YSNLK   L AED+AEA LYL SDESKYVSGHNLVV
Sbjct  194  SPYAVPTPLFKNFFKMNDDEVSCIYSNLKEAVLEAEDIAEAALYLGSDESKYVSGHNLVV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>ref|XP_008229671.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=272

 Score =   194 bits (493),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD  ++S+C+DL P +  FVHCDVT E DV+NAV  A + +G+L
Sbjct  36   RLFSKHGAKVVIADVQDD-LAESVCRDLSPSSTSFVHCDVTKEEDVENAVKTATNKYGKL  94

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG+ G    +ILD D  +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  95   DIMFNNAGVVGMTKPNILDNDKVEFEQVIRVNLVGAFLGIKHAARVMIPAGKGSIINTAS  154

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
            V   +GG   HAYT SKH +VGL +NTA++LG++GIRVNCV P I
Sbjct  155  VCSTIGGCAPHAYTSSKHGLVGLVRNTAVELGQHGIRVNCVSPYI  199


 Score = 85.1 bits (209),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPYI+ T + + +F L +DDKL   YSNLKG  L AED+ EA LYL SDESKYVSGHNL+
Sbjct  196  SPYIVSTPLAKEFFKL-DDDKLHGAYSNLKGGVLKAEDIVEAALYLGSDESKYVSGHNLL  254

Query  819  VDAGFSISN  845
            VD GF+I N
Sbjct  255  VDGGFTIVN  263



>emb|CAN68176.1| hypothetical protein VITISV_014635 [Vitis vinifera]
Length=265

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLFCQHGAKVLIAD +D+ +  SICKDLGP +A FVHCDVT E DV NA++KA+S +G+L
Sbjct  34   KLFCQHGAKVLIADIQDE-KGHSICKDLGPTSASFVHCDVTKELDVGNAIDKAISKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F N  RVN LG FLGTKHAARVM P  RGSIINTAS
Sbjct  93   DIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAPAGRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG   H+YT SKHAI+GLT+NTA++LG++GIRVNCV
Sbjct  153  VCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVNCV  193



>ref|XP_008229660.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=270

 Score =   189 bits (481),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +DD  ++S+C+DL   +  FVHCDVT E DV+NAV  A   +G+L
Sbjct  34   RLFSKHGARVVIADVQDD-LAESVCRDLSSSSTSFVHCDVTKEEDVENAVKTATRKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG  G    +ILD D  +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  93   DIMFNNAGTGGIAKPNILDNDKAEFEQVIRVNLVGAFLGIKHAARVMIPAGQGSIINTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
            V S + GG  HAYT SKH IVGL +NTA++LG++GIRVNCV P I
Sbjct  153  VCSTIGGGSSHAYTSSKHGIVGLVRNTAVELGQHGIRVNCVSPYI  197


 Score = 88.6 bits (218),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPYI+ T + + +F L +D     YSNLKG  L AED+A+A LYL SDESKYVSGHNLVV
Sbjct  194  SPYIVATPLAKNFFKLDDDGVHGAYSNLKGAVLKAEDIAQAALYLGSDESKYVSGHNLVV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>ref|XP_009340879.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=273

 Score =   190 bits (483),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F +HGAKV+IAD +DD   +S+C DL   +  FVHCDVT E D++NAV  A S +G+L
Sbjct  37   RVFSKHGAKVVIADVQDD-LGESVCTDLNSSSVSFVHCDVTKEEDIENAVKTATSKYGKL  95

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  V  VN +G+FLGTKHAARVM P  +GSIINTAS
Sbjct  96   DIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGTKHAARVMIPAGQGSIINTAS  155

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S + GG  HAYT SKH +VGL KN A++LG+YGIRVNCV
Sbjct  156  VCSTIGGGSSHAYTSSKHGVVGLMKNAAVELGQYGIRVNCV  196


 Score = 86.7 bits (213),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYSNLKG  L  EDVAEA LYL SDESKYVSGHNL+V
Sbjct  197  SPYLVATPLAKDFFNLDDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLLV  256

Query  822  DAGFSISN  845
            D GFSI N
Sbjct  257  DGGFSIVN  264



>ref|XP_007206815.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
 gb|EMJ08014.1| hypothetical protein PRUPE_ppa025923mg [Prunus persica]
Length=272

 Score =   192 bits (489),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD  ++S+C+DL P    FVHCDVT E DV+NAV    + +G L
Sbjct  36   RLFSKHGAKVVIADVQDD-LAESVCRDLSPSPTLFVHCDVTKEEDVENAVQTTTNKYGEL  94

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  95   DIMFNNAGIIGTNKPNILDNDKVEFEQVIRVNLVGAFLGIKHAARVMIPAGKGSIINTAS  154

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKH +VGL +NTA++LG++GIRVNCV
Sbjct  155  VCSTIGGCASHAYTSSKHGLVGLVRNTAVELGQHGIRVNCV  195


 Score = 83.6 bits (205),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY + T++ + +F + +D     YSNLKG  L AED+AEA LYL SDESKYVSGHNL+V
Sbjct  196  SPYAVATKLAKEFFKIDDDGVHGAYSNLKGRVLKAEDIAEAALYLGSDESKYVSGHNLLV  255

Query  822  DAGFSISN  845
            D G++I N
Sbjct  256  DGGYTIMN  263



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   197 bits (500),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 126/162 (78%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD   QS+CK+LGP  A ++HCDVT+EA VQNAV+  V+ + +L
Sbjct  34   ELFTKHGAKVMIADIQDD-LGQSVCKNLGPSVASYIHCDVTNEAHVQNAVDSTVAKYEKL  92

Query  343  DIMVNNAGIAGA-KGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            DIM NNAGIAG+   L+ILD   ++F  + +VN +G FLGTKHAARVM P ++GSII TA
Sbjct  93   DIMFNNAGIAGSYPKLNILDITQSEFEEIIKVNLIGPFLGTKHAARVMIPAKQGSIITTA  152

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S   V+ GG  HAYT SKH IVGLT+NTA++LG+YGIRVNCV
Sbjct  153  STCSVIGGGAPHAYTSSKHGIVGLTRNTAVELGKYGIRVNCV  194


 Score = 77.8 bits (190),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SP++I T +++ +  L ++     YSNLKG     EDVA A L+LASD+SK++SGHNLVV
Sbjct  195  SPHVISTPLVKNFLKLDDEGVSKFYSNLKGASCKVEDVANAALFLASDDSKFISGHNLVV  254

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  255  DGGFTIMN  262



>ref|XP_009340878.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=274

 Score =   186 bits (473),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F + GAKV+IAD +DD   +S+C+DL   +A FVHCDVT E D+++AV  A S +G+L
Sbjct  38   RVFSKLGAKVVIADVQDD-LGESVCRDLNSSSASFVHCDVTKEEDIEHAVKTATSKYGKL  96

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD    +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  97   DIMFNNAGIIGTPKPNILDNGKAEFEQVIRVNLVGAFLGIKHAARVMIPAGQGSIINTAS  156

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   MGG   HAYT SKH +VGL KN A++LG+YGIRVNCV
Sbjct  157  VCSTMGGIASHAYTSSKHGVVGLMKNAAVELGQYGIRVNCV  197


 Score = 87.8 bits (216),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYSNLKG  L  EDVAEA LYL SDESKYVSGHNL+V
Sbjct  198  SPYLVATPLAKHFFNLEDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLLV  257

Query  822  DAGFSISN  845
            D GFSI N
Sbjct  258  DGGFSIVN  265



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   186 bits (471),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+  ++SIC+DL   +  FVHCDVT E DV+NAV  A S +G+L
Sbjct  34   RLFSKHGAKVVIADVQDN-LAESICRDLSSSSTSFVHCDVTKEEDVENAVKTATSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG    +ILD D  +F  V  VN +G FLG KHAARVM P  +GSIINTAS
Sbjct  93   DIMFNNAGIAGIAKTNILDNDKAEFEQVIGVNLVGVFLGIKHAARVMIPAGQGSIINTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
                +GG   HAYT SKH ++GL +NTA++LG++GIRVNCV P I
Sbjct  153  ACSTIGGCASHAYTSSKHGVLGLMRNTAIELGQHGIRVNCVSPYI  197


 Score = 88.6 bits (218),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPYI+ T + + +F L +D    VYSNLKG  L AED+AEA LYL SDESKYVSGHNL+V
Sbjct  194  SPYIVATPLAKDFFKLDDDGVHGVYSNLKGGVLKAEDIAEAALYLGSDESKYVSGHNLLV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>ref|XP_009340877.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=263

 Score =   187 bits (475),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F +HGAKV+IAD +DD   +S+ +DL   +A FVHCDVT E D++NAV  A S +G+L
Sbjct  27   RVFSKHGAKVVIADVQDD-LGESVFRDLNSSSASFVHCDVTKEEDIENAVKTATSKYGKL  85

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  V  VN +G+FLG KHAARVM P  +GSIINTAS
Sbjct  86   DIMFNNAGIGGTPKPNILDNDKAEFEQVLSVNLVGSFLGIKHAARVMIPAGQGSIINTAS  145

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S + GG  HAYT SKH +VGL KN A++LG+YGIRVNCV
Sbjct  146  VCSTIGGGAPHAYTSSKHGVVGLMKNAAVELGQYGIRVNCV  186


 Score = 86.7 bits (213),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYSNLKG  L  EDVAEA LYL SDESKYVSGHNL+V
Sbjct  187  SPYLVATPLAKDFFNLDDDGVHGVYSNLKGKVLRPEDVAEAALYLGSDESKYVSGHNLLV  246

Query  822  DAGFSISN  845
            D GFSI N
Sbjct  247  DGGFSIVN  254



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLFCQHGAKVLIAD + + +  SICKDLGP +A FVHCDVT E DV NA++KA+S +G+L
Sbjct  34   KLFCQHGAKVLIADIQYE-KGHSICKDLGPTSASFVHCDVTKELDVGNAIDKAISKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F N  RVN LG FLGTKHAARVM P  RGSIINTAS
Sbjct  93   DIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTKHAARVMAPAGRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG   H+YT SKHAI+GLT+NTA++LG++GIRVNCV
Sbjct  153  VCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVNCV  193


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDK-LDVYSNLKGVDLMAEDVAEAVLYLASD  785
            LG         SPY++PT + R +  L EDD  + VYSNLKGV L  EDVAEAVLY+ SD
Sbjct  183  LGKFGIRVNCVSPYLVPTSLSRKFMNLGEDDPFVKVYSNLKGVSLEVEDVAEAVLYMGSD  242

Query  786  ESKYVSGHNLVVDAGFSI  839
            +SKYVSGHNLV+D G +I
Sbjct  243  DSKYVSGHNLVLDGGVTI  260



>ref|XP_006481514.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=276

 Score =   193 bits (490),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-----PGNAFFVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+C+D+           +VHCDVT E D++NAVN AVS
Sbjct  34   RLFSKHGAKVLIADIKDD-LGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVS  92

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  93   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  152

Query  508  INTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV GV+GG   HAYT SKH +VGL KNTA++LGR+GIRVNCV
Sbjct  153  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNCV  198


 Score = 80.1 bits (196),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY + + M + +  L +D    +YSNL G  L  EDVAEA LYL SDESK VSGHNLVV
Sbjct  199  SPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEAALYLGSDESKCVSGHNLVV  258

Query  822  DAGFSISNLAL  854
            D GF+I N  L
Sbjct  259  DGGFTIVNEGL  269



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   191 bits (486),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+     +C++L   +A FVHCDVT E DV+NAVN AVS HG+L
Sbjct  34   RLFAKHGAKVVIADVQDE-LGHFVCEELKNESASFVHCDVTQEKDVENAVNTAVSKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG A     +ILD D  +F  V  VN +GAFLGTKHAARVM P +RGSII+TAS
Sbjct  93   DIMFNNAGAADTPKPNILDNDKAEFEKVLSVNIVGAFLGTKHAARVMIPARRGSIISTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKH ++GL +NTA++LG++GIRVNCV
Sbjct  153  VCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNCV  193


 Score = 80.9 bits (198),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T +++ +F L +++    YSNL+   L AED+AEA L+L SDESKYVSGHNL+V
Sbjct  194  SPYVVLTPLVKDFFKLDDNEVNRFYSNLREAVLKAEDIAEAALFLGSDESKYVSGHNLIV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>gb|KCW58914.1| hypothetical protein EUGRSUZ_H01537, partial [Eucalyptus grandis]
Length=235

 Score =   189 bits (479),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +DD  +S+CK+LGP  A FVHCDV+SE DV+NAV  AV  HG+L
Sbjct  4    RLFSKHGAKVIIADI-NDDLGKSVCKNLGPETASFVHCDVSSEPDVENAVATAVDKHGKL  62

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I     L+ILD D  DF  V  VN  G FLGTKHAAR M P QRGSIIN  S
Sbjct  63   DIMVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVFLGTKHAARAMIPSQRGSIINVGS  122

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAY  SKHAIVGL++N A +LGRYGIRVNC+
Sbjct  123  VSSSVGGVASHAYASSKHAIVGLSRNAAAELGRYGIRVNCL  163


 Score = 83.2 bits (204),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T +    F L E+ +  VYSNL GV L  EDVAEA L+L SDESKY+SGHNL V
Sbjct  164  SPYFIRTPLTEEMFKLDENPEFRVYSNLDGVTLQEEDVAEAALFLGSDESKYISGHNLAV  223

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  224  DGGFTTINPAF  234



>ref|XP_010070261.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   188 bits (478),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +DD  +S+CK+LGP  A FVHCDV+SE DV+NAV  AV  HG+L
Sbjct  34   RLFSKHGAKVIIADI-NDDLGKSVCKNLGPETASFVHCDVSSEPDVENAVATAVDKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I     L+ILD D  DF  V  VN  G FLGTKHAAR M P QRGSIIN  S
Sbjct  93   DIMVNNAAIGDPTKLNILDNDKADFEKVISVNLTGVFLGTKHAARAMIPSQRGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAY  SKHAIVGL++N A +LGRYGIRVNC+
Sbjct  153  VSSSVGGVASHAYASSKHAIVGLSRNAAAELGRYGIRVNCL  193


 Score = 83.2 bits (204),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T +    F L E+ +  VYSNL GV L  EDVAEA L+L SDESKY+SGHNL V
Sbjct  194  SPYFIRTPLTEEMFKLDENPEFRVYSNLDGVTLQEEDVAEAALFLGSDESKYISGHNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>emb|CDP06870.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   194 bits (493),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF ++GAKV+IAD +DD  ++ +C+DL P +A  VHCD T E+D++NAVN  VS +G+L
Sbjct  31   RLFVKYGAKVVIADIQDD-LAKKVCQDLDPSSASHVHCDTTQESDIENAVNTTVSKYGKL  89

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG+   +ILD   +DF  V  VN +G FLGTKHAARVM P + GSIINTAS
Sbjct  90   DIMFNNAGIAGSGTSNILDDKKSDFERVISVNLVGVFLGTKHAARVMIPNRCGSIINTAS  149

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S + GG  HAY  SKHA+VGLT+NTA+DLGRYGIRVNC+
Sbjct  150  VCSTLGGGAPHAYVSSKHAVVGLTRNTAIDLGRYGIRVNCL  190


 Score = 76.6 bits (187),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 10/76 (13%)
 Frame = +3

Query  642  SPYIIPTQMI-----RTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            SPY +PT +      R Y G+++     VY  L G +L AEDVA+A LYLASD+SKYVSG
Sbjct  191  SPYFVPTPLAADVVERIYGGVSK-----VYKFLDGAELKAEDVADAALYLASDDSKYVSG  245

Query  807  HNLVVDAGFSISNLAL  854
            HNLVVD G+SI N A+
Sbjct  246  HNLVVDGGYSIVNSAM  261



>ref|XP_007207105.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
 gb|EMJ08304.1| hypothetical protein PRUPE_ppa020955mg [Prunus persica]
Length=270

 Score =   187 bits (474),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +D   ++S+C+DL   +  FVHCDVT E DV+NAV  A   +G+L
Sbjct  34   RLFSKHGARVVIADVQDG-LAESVCRDLSSSSISFVHCDVTKEEDVENAVKTATRKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG  G    +ILD D  +F  V RVN +GAFLG KHAARVM P  +GSIINTAS
Sbjct  93   DIMFNNAGTGGVAKPNILDNDKAEFEQVIRVNLIGAFLGIKHAARVMIPAGQGSIINTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
            V S + GG  HAYT SKH IVGL +NTA++LG++GIRVNCV P I
Sbjct  153  VCSTIGGGSSHAYTSSKHGIVGLMRNTAVELGQHGIRVNCVSPYI  197


 Score = 83.6 bits (205),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPYI+ T + + +F L ++     YSNLKG  L  ED+AEA LYL SDESKYVSGHNL+V
Sbjct  194  SPYIVATPLAKNFFKLDDNGVHGAYSNLKGGVLKVEDIAEAALYLGSDESKYVSGHNLLV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>ref|XP_010246229.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=274

 Score =   192 bits (489),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF QHGAKV+IAD +D+    S+CK+LGP +A F+HCDVT+E+DV+NAVN AV+ HG+L
Sbjct  35   KLFSQHGAKVVIADIQDE-LGHSVCKELGPSSASFIHCDVTNESDVENAVNGAVARHGKL  93

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQ-RGSIINTA  519
            DIM+ NAGI G+  ++IL  D  DF  V  VN +G FLGTKHAARVM      GSIIN A
Sbjct  94   DIMLINAGIIGSPTVNILANDRGDFQQVLNVNVIGPFLGTKHAARVMILANGGGSIINMA  153

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S+  ++GG   HAYT SKHA++GLT+NTA++LGR+GIRVNC+
Sbjct  154  SICSIIGGATPHAYTSSKHAVLGLTRNTAVELGRFGIRVNCI  195


 Score = 77.8 bits (190),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY + T   R +  L ED  + D YSNLKGV L  EDVAEA LYL S++S YVSGHNLV
Sbjct  196  SPYAVATPQSRKFLKLEEDAAIVDAYSNLKGVALKPEDVAEAALYLGSEDSSYVSGHNLV  255

Query  819  VDAGFSISN  845
            +D  F++ N
Sbjct  256  LDGAFTVLN  264



>ref|XP_008246119.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Prunus 
mume]
Length=257

 Score =   184 bits (468),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD  ++SIC+DL   +  FVHCDVT E DV+NAV  A S +G+L
Sbjct  21   RLFSKHGAKVVIADVQDD-LAESICRDLSSSSTSFVHCDVTKEEDVENAVKTATSKYGKL  79

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG    +ILD D  +F  V  VN +G FLG KHAARVM    +GSIINTAS
Sbjct  80   DIMFNNAGIAGTAKTNILDNDKAEFEQVIGVNLVGVFLGIKHAARVMISAGQGSIINTAS  139

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
                +GG   HAYT SKH ++GL +NTA++LG++GIRVNCV P I
Sbjct  140  ACSTIGGCASHAYTSSKHGVLGLVRNTAIELGQHGIRVNCVSPYI  184


 Score = 85.1 bits (209),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPYI+ T + + +F L +D    VYSNLKG  L AED+AEA LYL SDESKYVSGHNL+V
Sbjct  181  SPYIVATPLAKDFFKLDDDGVHGVYSNLKGEVLKAEDIAEAALYLGSDESKYVSGHNLLV  240

Query  822  DAGFS  836
            D GF+
Sbjct  241  DGGFT  245



>ref|XP_006424148.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37388.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=276

 Score =   189 bits (481),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-----FVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+C+D+   ++      +VHCDVT E D++NAVN AVS
Sbjct  34   RLFSKHGAKVLIADIKDD-LGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVS  92

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  93   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  152

Query  508  INTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV GV+GG   HAYT SKH +VGL KNTA++LGR+GIRVN V
Sbjct  153  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNSV  198


 Score = 80.1 bits (196),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY + + M + +  L +D    +YSNL G  L  EDVAEA LYL SDESK VSGHNLVV
Sbjct  199  SPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEAALYLGSDESKCVSGHNLVV  258

Query  822  DAGFSISNLAL  854
            D GF+I N  L
Sbjct  259  DGGFTIVNEGL  269



>ref|XP_006424147.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
 gb|ESR37387.1| hypothetical protein CICLE_v10029025mg [Citrus clementina]
Length=273

 Score =   189 bits (481),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-----FVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+C+D+   ++      +VHCDVT E D++NAVN AVS
Sbjct  31   RLFSKHGAKVLIADIKDD-LGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVS  89

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  90   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  149

Query  508  INTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV GV+GG   HAYT SKH +VGL KNTA++LGR+GIRVN V
Sbjct  150  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNSV  195


 Score = 80.1 bits (196),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY + + M + +  L +D    +YSNL G  L  EDVAEA LYL SDESK VSGHNLVV
Sbjct  196  SPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEAALYLGSDESKCVSGHNLVV  255

Query  822  DAGFSISNLAL  854
            D GF+I N  L
Sbjct  256  DGGFTIVNEGL  266



>ref|XP_010040326.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW45304.1| hypothetical protein EUGRSUZ_L01033 [Eucalyptus grandis]
Length=270

 Score =   186 bits (471),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD RDD   +S+CKDLGP  A FVHCDV+SE+DV+ A+N AV  HG+L
Sbjct  34   RLFSKHGARVIIADIRDD-LGESVCKDLGPETASFVHCDVSSESDVEKAINTAVDKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA        +ILD D  DF  V  VN  G FLGTKHAAR M P +RGSIIN  S
Sbjct  93   DIMVNNAATGEPVKANILDNDKADFERVVSVNLTGVFLGTKHAARAMIPSRRGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAYT SKH +VGLT+N A +LGRYGIRVNC+
Sbjct  153  VSSSVGGVAPHAYTSSKHGVVGLTRNVAAELGRYGIRVNCL  193


 Score = 83.6 bits (205),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I + + R +F +  + ++ VYSNL GV L  EDVAEA L+L SDESKY+SGHNL V
Sbjct  194  SPYFILSPLSREFFNVVRNGRVGVYSNLDGVSLQKEDVAEASLFLGSDESKYISGHNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>emb|CDP06868.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   194 bits (493),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD  ++ +C+DL P +A  VHCD T E+D++NAVN  VS +G+L
Sbjct  34   RLFVKHGAKVVIADIQDD-LAKKVCQDLDPSSASHVHCDTTQESDIENAVNTTVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA-  519
            DIM NNAGIAG+   +ILD   +DF  V  VN +G FLGTKHAARVM P + GSIINTA 
Sbjct  93   DIMFNNAGIAGSGTSNILDDKKSDFERVISVNLVGVFLGTKHAARVMIPNRCGSIINTAS  152

Query  520  SVSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S S + GG  HAY  SKHA+VGLT+NTA+DLGRYGIRVNC+
Sbjct  153  SCSTLGGGAPHAYVSSKHAVVGLTRNTAIDLGRYGIRVNCL  193


 Score = 75.5 bits (184),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 10/76 (13%)
 Frame = +3

Query  642  SPYIIPTQMI-----RTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            SPY +PT +      R Y G+++     VY  L G +L AEDVA+A LYLASD+SKYVSG
Sbjct  194  SPYYVPTPLAADVVERIYGGVSK-----VYKFLDGAELKAEDVADAALYLASDDSKYVSG  248

Query  807  HNLVVDAGFSISNLAL  854
            HNLVVD G+SI N A+
Sbjct  249  HNLVVDGGYSIVNSAV  264



>emb|CDP06869.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   197 bits (502),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV++AD +DD  +Q +C+DL P +A  VHCDVT E+D++NAVN AVS +G+L
Sbjct  34   RLFVKHGAKVVVADIQDD-LAQKVCQDLDPSSASHVHCDVTQESDIENAVNTAVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G++  +ILD   +DF  V  VN +G FLG KHAARVM P + GSIINTAS
Sbjct  93   DIMFNNAGIGGSRTSNILDDKKSDFERVISVNLVGIFLGAKHAARVMIPNRCGSIINTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S + GG  HAY  SKHA+VGLT+NTA+DLGRYGIRVNC+
Sbjct  153  VCSTLGGGAPHAYVSSKHAVVGLTRNTAVDLGRYGIRVNCL  193


 Score = 71.2 bits (173),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 10/76 (13%)
 Frame = +3

Query  642  SPYIIPTQ-----MIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            SPY + T      + R Y G+++     VY+ L G +L AEDVA+A LYLASD+SKYVSG
Sbjct  194  SPYFVSTPSAADFVERIYGGVSK-----VYTYLDGAELKAEDVADAALYLASDDSKYVSG  248

Query  807  HNLVVDAGFSISNLAL  854
            HNLVVD G SI N A+
Sbjct  249  HNLVVDGGHSIVNSAM  264



>ref|XP_002272549.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF QHGAKVLIAD +D+ +   IC+DLGP +A F+HCDVT E DV NA+++AV+ HG+L
Sbjct  34   KLFSQHGAKVLIADIQDE-KGHLICRDLGPSSASFIHCDVTKELDVSNAIDEAVAKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G K ++ILD D  +F N  RVN LGAFLGTKHAARVM P  RG +IN+AS
Sbjct  93   DIMFNNAGILGPKIINILDNDAAEFENTMRVNVLGAFLGTKHAARVMVPAGRGCVINSAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  V+GG   H+Y  SKHAI+GLT+NTA++LG++GIRVNCV
Sbjct  153  VCSVVGGICTHSYVSSKHAILGLTRNTAVELGKFGIRVNCV  193


 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAEDVAEAVLYLASD  785
            LG         SPY++PT M R +    +DD L DVYSNLKGV LM +DVAEAVLYL SD
Sbjct  183  LGKFGIRVNCVSPYVVPTPMSRKFLNSEDDDPLEDVYSNLKGVALMPQDVAEAVLYLGSD  242

Query  786  ESKYVSGHNLVVDAGFSIS  842
            +SKYVSG+NLV+D G +++
Sbjct  243  DSKYVSGNNLVIDGGVTVA  261



>ref|XP_010049793.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW82605.1| hypothetical protein EUGRSUZ_C03995 [Eucalyptus grandis]
Length=270

 Score =   185 bits (470),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD RDD   +S+CKDLGP  A FVHCDV+SE+DV+ A+N AV  HG+L
Sbjct  34   RLFSKHGARVIIADIRDD-LGESVCKDLGPETASFVHCDVSSESDVEKAINTAVEKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA        +ILD D  DF  V  VN  G FLGTKHAAR M P +RGSIIN  S
Sbjct  93   DIMVNNAATGEPVKANILDNDKADFERVVSVNLTGVFLGTKHAARAMIPSRRGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAYT SKH ++GLT+N A +LGRYGIRVNC+
Sbjct  153  VSSSVGGVAPHAYTSSKHGVLGLTRNVAAELGRYGIRVNCL  193


 Score = 82.4 bits (202),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I + + R +F +  +  + VYSNL GV L  EDVAEA ++L SDESKY+SGHNL V
Sbjct  194  SPYFILSPLTREFFNVVRNGGVGVYSNLDGVSLQKEDVAEAAVFLGSDESKYISGHNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>ref|XP_010262933.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262934.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010262935.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=277

 Score =   180 bits (457),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF  HGAKV+IAD  +D+   SIC+++G  G   F+HCDVT +ADV+NAV+  V  HG+
Sbjct  34   RLFANHGAKVVIADV-EDELGHSICEEVGSEGTICFIHCDVTKDADVRNAVDSTVDKHGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAGI G+    ILD D  +F  V  VNT GAFLG KHA RVM P+++G+II T+
Sbjct  93   LDIMFSNAGITGSPTKKILDSDNENFRKVLEVNTFGAFLGAKHATRVMIPLKKGTIIFTS  152

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+ G   +AY  SKHA+VGLTKN +++LG+YGIRVNC+
Sbjct  153  SVASVIAGDTPYAYAASKHAVVGLTKNLSVELGQYGIRVNCI  194


 Score = 87.4 bits (215),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T M+RT  GL E++K++ Y    +NLKGV L AEDVAEA LYLASDES+YVSG 
Sbjct  195  SPYGLATPMLRTATGL-EEEKIEAYLSGGANLKGVVLKAEDVAEAALYLASDESRYVSGL  253

Query  810  NLVVDAGFSISN  845
            NLVVD GFSI+N
Sbjct  254  NLVVDGGFSITN  265



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   183 bits (465),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAKV+IAD +D+    S+ + LGP N+ +V CDVT EA ++NAV+KA+ST+G+L
Sbjct  34   KVFSHHGAKVVIADIQDE-LGHSVVEALGPSNSTYVRCDVTEEAQIKNAVDKAISTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGIA      I+D +  DF  V ++N  G FLG KHAARVM P + G+II+TAS
Sbjct  93   DIMLNNAGIADDSKARIIDNEMADFERVLKINVTGVFLGIKHAARVMIPARSGTIISTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS ++G    HAY CSKHA++GLT+N A +LG++GIRVNC+
Sbjct  153  VSSLLGAAASHAYCCSKHAVLGLTRNAAAELGQFGIRVNCL  193


 Score = 82.4 bits (202),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T + R + G+ +D+ L++    ++NLKGV L  EDVA A LYLASDE++Y+SGH
Sbjct  194  SPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAALYLASDEARYISGH  253

Query  810  NLVVDAGFSISN  845
            NL +D GFS+ N
Sbjct  254  NLFIDGGFSVQN  265



>emb|CDP06872.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   191 bits (486),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD  ++ +C+DL P +A  VHCD T E+D++NAVN AVS +G+L
Sbjct  34   RLFVKHGAKVVIADIQDD-LAKKVCQDLDPSSASHVHCDTTQESDIENAVNTAVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG+   +ILD   + F  V  VN +G FLG KHAARVM P + GSIINTAS
Sbjct  93   DIMFNNAGIAGSGTSNILDDKKSGFERVISVNLVGVFLGAKHAARVMIPNRCGSIINTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V S ++G   HAY  SKHA+VGLT+NTA+DLGRYGIRVNC+
Sbjct  153  VCSTIVGAAPHAYVSSKHAVVGLTRNTAVDLGRYGIRVNCL  193


 Score = 73.9 bits (180),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY +PT M   +          VY+ L G  L A+DVA+A LYLASD+SKYVSGHNLVV
Sbjct  194  SPYFVPTPMAVDFIERINGGVSKVYTYLDGAVLKADDVADAALYLASDDSKYVSGHNLVV  253

Query  822  DAGFSISNLAL  854
            D G+SI N A+
Sbjct  254  DGGYSIVNSAM  264



>ref|XP_002523859.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF38585.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=272

 Score =   188 bits (478),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDL-GPGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGA ++IAD +D+    S+C++L  P +  ++HC+VT E DV+NAVN AVS +G+
Sbjct  34   RLFSKHGANLVIADVQDE-LGHSVCRELDSPSSVSYIHCNVTREEDVENAVNTAVSKYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAG+ G    +ILD D  +F  +  VN +GAFLGTKHAARVM P ++GSIINTA
Sbjct  93   LDIMFNNAGVVGIAKPNILDNDKAEFEKIISVNLVGAFLGTKHAARVMIPNRKGSIINTA  152

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV  ++GG   HAYT SKH +VGLT+NTA++LGR+GIRVNCV
Sbjct  153  SVCSIIGGVASHAYTSSKHGVVGLTRNTAVELGRHGIRVNCV  194


 Score = 77.4 bits (189),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + +F L +D    VYS LK   L  EDVAEA LYL SDESKYVSGHNLVV
Sbjct  195  SPYLVATPLAKDFFKLDDDGVYRVYSVLKEAVLGPEDVAEAALYLGSDESKYVSGHNLVV  254

Query  822  DAGFSISN  845
            D GF+  N
Sbjct  255  DGGFTKVN  262



>ref|XP_009411944.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   193 bits (491),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLFC+HGAKV++AD +D+    ++C  LGP  A F+HCDVTSE DV  AV+ AV+  GRL
Sbjct  34   KLFCRHGAKVVVADVQDE-LGTAVCSGLGPA-ASFIHCDVTSEDDVSAAVDHAVAKFGRL  91

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL C+ +DF  V  VN +G FLGTKHAARVM P ++GSII T+S
Sbjct  92   DIMFNNAGITGAACHNILQCEKSDFERVVGVNLVGPFLGTKHAARVMIPARKGSIITTSS  151

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++GV+G    HAYTCSKHA+VGLTKN A +LG++G+RVNCV
Sbjct  152  LAGVIGAAAAHAYTCSKHAVVGLTKNAAAELGQFGVRVNCV  192


 Score = 71.6 bits (174),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP    T +   Y GL   A D  +   +NLKGV L  EDVA+AVLYLASD+SKYVSGHN
Sbjct  193  SPAAAATPLAMRYVGLEGEAFDMAMTAVANLKGVSLGTEDVADAVLYLASDDSKYVSGHN  252

Query  813  LVVDAGFSISNLALN  857
            LV+D G S++  + N
Sbjct  253  LVLDGGCSVAYPSFN  267



>ref|NP_001239862.1| uncharacterized protein LOC100794412 [Glycine max]
 gb|ACU19399.1| unknown [Glycine max]
 gb|KHN44551.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   178 bits (452),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+ K+L   +A +VHCDVT E DV+N VN  VS +G+L
Sbjct  34   RLFSKHGAYVVIADIQDD-LGLSVAKELE--SASYVHCDVTKEEDVENCVNTTVSKYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG++      ILD + +DF  V  VN +G FLGTKHAARVM P ++G IINTAS
Sbjct  91   DIMFNNAGVSDEIKTSILDNNKSDFERVISVNLVGPFLGTKHAARVMIPAKKGCIINTAS  150

Query  523  VSG-VMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G + GG  HAYT SKHA++GLTKNTA++LG++GIRVNC+
Sbjct  151  VAGCIGGGATHAYTSSKHALIGLTKNTAVELGQHGIRVNCL  191


 Score = 84.3 bits (207),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + YF + ED   ++YSNLKG  L+  DVAEA LYLA DESKYVSGHNLV+
Sbjct  192  SPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGDESKYVSGHNLVI  251

Query  822  DAGFS  836
            D G++
Sbjct  252  DGGYT  256



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   191 bits (485),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV I D  D+    S+ K +GP N+ ++HCDVT+E DV+NAV+K VST+G+L
Sbjct  34   KLFSKHGAKVAIVDVHDE-LGHSVIKQIGPSNSTYIHCDVTNEDDVRNAVDKTVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA    L I+D +  DF  V  VN  G FLG KHAARVM P + G+II+TAS
Sbjct  93   DIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTGVFLGMKHAARVMIPARGGAIISTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++  MGG   HAYTCSKHA+VGLT+N+A++LG+YGIRVNC+
Sbjct  153  IASGMGGAATHAYTCSKHAVVGLTRNSAIELGQYGIRVNCM  193


 Score = 71.2 bits (173),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + + + R Y G+ ED++L+      +NLKG  L A+D+A A L+LASD++KYVSG 
Sbjct  194  SPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAALFLASDDAKYVSGQ  252

Query  810  NLVVDAGFSISNLALN  857
            NL +D GF+I N A+ 
Sbjct  253  NLFIDGGFTIFNSAMQ  268



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   179 bits (454),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGA+V+IAD +D+    S+CK++     +  FVHCDVT E DV+NA+N AVS +G
Sbjct  31   RLFSKHGAQVVIADIQDE-LGHSLCKEIDRDGKYCSFVHCDVTKEEDVENALNSAVSKYG  89

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            +LDIM NNAGI G    +ILD +  +F  +  VN +GAFLGTKHAARVM P ++GSII T
Sbjct  90   KLDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLVGAFLGTKHAARVMIPNRKGSIITT  149

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            AS+   +GG   HAYT SKH +VGL +NTA++LG++GIRVNCV
Sbjct  150  ASICSTIGGVASHAYTSSKHGVVGLMRNTAVELGQHGIRVNCV  192


 Score = 82.4 bits (202),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + R +F L ++   DVYSNLK   L  EDVA+A LYL SD+SKY+SGHN+++
Sbjct  193  SPYVVNTPLARDFFKLDDNGIYDVYSNLKEAVLQPEDVAQAALYLGSDDSKYISGHNMII  252

Query  822  DAGFSISNLALN  857
            D GF+I N A +
Sbjct  253  DGGFTIVNPAFS  264



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   184 bits (468),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAKV++AD +D+   +S+ K LGP N+ +VHCDVT EA V+NAVN AV+T+G+L
Sbjct  30   KVFAHHGAKVVVADIQDES-GRSLAKALGPSNSTYVHCDVTDEAQVKNAVNAAVTTYGKL  88

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA      I+D +  DF  V + N  G FLG KHAARVM P + G+II+TAS
Sbjct  89   DIMFNNAGIADESKARIIDNEKVDFERVLQTNVTGVFLGIKHAARVMIPGRNGTIISTAS  148

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY CSKHA++GLTKN A++LG++GIRVNC+
Sbjct  149  VSSKVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIRVNCL  189


 Score = 76.6 bits (187),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T + +   GL +D++L+     +  LKGV L AEDVA A LYLASDE++YVSGH
Sbjct  190  SPYALATPLAKQVIGL-DDEQLENLMHAFGTLKGVTLQAEDVANAALYLASDEARYVSGH  248

Query  810  NLVVDAGFSISN  845
            NL +D GF+I N
Sbjct  249  NLFIDGGFTIQN  260



>gb|KHN11533.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   176 bits (447),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+ K+L   +A +VHCDVT+E DV+N VN AVS +G+L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSVAKELE--SASYVHCDVTNENDVENCVNTAVSKYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D   +DF  V  VN +G FLGTKHAARVM P ++G IINTAS
Sbjct  91   DIMFNNAGIIDEIKTSIVDNSKSDFERVIGVNLVGPFLGTKHAARVMIPAKKGCIINTAS  150

Query  523  VSG-VMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G + GG  HAYT SKHA++GLTKNTA++LG++GIRVNC+
Sbjct  151  VAGCIGGGATHAYTSSKHALIGLTKNTAVELGQHGIRVNCL  191


 Score = 84.3 bits (207),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + YF + ED   ++YSNLKG  L+  DVAEA LYLA DESKYVSGHNLV+
Sbjct  192  SPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGDESKYVSGHNLVI  251

Query  822  DAGFS  836
            D G++
Sbjct  252  DGGYT  256



>gb|AHH81853.1| short-chain alcohol dehydrogenase [Perilla frutescens]
Length=277

 Score =   189 bits (479),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV I D  D+    S+ K +GP N+ ++HCDVT+E DV+NAV+K VST+G+L
Sbjct  34   KLFSKHGAKVAIVDVHDE-LGHSVIKQIGPSNSTYIHCDVTNEDDVRNAVDKTVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA    L I+D +  DF  V  VN  G F G KHAARVM P + G+II+TAS
Sbjct  93   DIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVTGVFQGMKHAARVMIPARGGAIISTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++  MGG   HAYTCSKHA+VGLT+N+A++LG+YGIRVNC+
Sbjct  153  IASGMGGAATHAYTCSKHAVVGLTRNSAIELGQYGIRVNCM  193


 Score = 71.2 bits (173),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + + + R Y G+ ED++L+      +NLKG  L A+D+A A L+LASD++KYVSG 
Sbjct  194  SPYALASDLSRKYLGI-EDEELERMMNDKANLKGTTLKADDIANAALFLASDDAKYVSGQ  252

Query  810  NLVVDAGFSISNLALN  857
            NL +D GF+I N A+ 
Sbjct  253  NLFIDGGFTIFNSAMQ  268



>gb|KDP26161.1| hypothetical protein JCGZ_22863 [Jatropha curcas]
Length=270

 Score =   178 bits (452),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGA+V+IAD +D+    S+ K++     +  FVHCDVT E DV+NAVN AVS +G
Sbjct  31   RLFSKHGAQVVIADIQDE-LGHSVRKEIDRDGKYCSFVHCDVTKEEDVENAVNSAVSKYG  89

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             LDIM NNAGI GA   +ILD +  +F  +  VN +GAFLGTKHAARVM P ++GSI+ T
Sbjct  90   ELDIMFNNAGIVGAVKPNILDNEKAEFEKIISVNLVGAFLGTKHAARVMIPNRKGSIMTT  149

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+  +GG   HAYT SKH +VGL +NTA++LG++GIRVNC+
Sbjct  150  ASVASTIGGLAPHAYTSSKHGVVGLMRNTAVELGQHGIRVNCI  192


 Score = 80.9 bits (198),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + R +F L +    DVYSNLK   L  EDVA+A LYL SD+SKY+SGHN+++
Sbjct  193  SPYVVNTPLARDFFKLDDHGVYDVYSNLKEAVLEPEDVAQAALYLGSDDSKYISGHNMII  252

Query  822  DAGFSISNLALN  857
            D GF+I N A +
Sbjct  253  DGGFTIVNPAFS  264



>ref|XP_003546632.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=269

 Score =   175 bits (443),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+ K+L   +A +VHCD T+E DV+N VN AVS +G+L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSVAKELE--SASYVHCDATNENDVENCVNTAVSKYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D   +DF  V  VN +G FLGTKHAARVM P ++G IINTAS
Sbjct  91   DIMFNNAGIIDEIKTSIVDNSKSDFERVIGVNLVGPFLGTKHAARVMIPAKKGCIINTAS  150

Query  523  VSG-VMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G + GG  HAYT SKHA++GLTKNTA++LG++GIRVNC+
Sbjct  151  VAGCIGGGATHAYTSSKHALIGLTKNTAVELGQHGIRVNCL  191


 Score = 84.3 bits (207),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + YF + ED   ++YSNLKG  L+  DVAEA LYLA DESKYVSGHNLV+
Sbjct  192  SPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGDESKYVSGHNLVI  251

Query  822  DAGFS  836
            D G++
Sbjct  252  DGGYT  256



>ref|XP_010051779.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=318

 Score =   177 bits (449),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD RDD   +S+C DLG   A FVHCDV+ E+DV+NA+  AV   G+L
Sbjct  34   RLFSKHGAKVIIADIRDD-LGKSVCVDLGAETASFVHCDVSIESDVENAIATAVDKFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I+     +ILD D  DF  V  VN  G FLGTKHAAR M P + GSIIN  S
Sbjct  93   DIMVNNAAISDPLKANILDNDKADFERVISVNLTGVFLGTKHAARAMIPSRSGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAYT SKHAIVGLT+N A +LGRYGIRVNC+
Sbjct  153  VSSSVGGVASHAYTSSKHAIVGLTRNVASELGRYGIRVNCL  193


 Score = 80.9 bits (198),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T + + +F + E+  + VYSNL GV L  EDVA+A +YL SDESKYVSG NL V
Sbjct  194  SPYFILTPLTKEFFKIDENAGVRVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQNLAV  253

Query  822  DAGFSISNLALN  857
            DAGF+  N+ ++
Sbjct  254  DAGFTTINIIID  265



>ref|XP_004139501.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 ref|XP_004159104.1| PREDICTED: zerumbone synthase-like [Cucumis sativus]
 gb|KGN64962.1| TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   190 bits (482),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 139/186 (75%), Gaps = 3/186 (2%)
 Frame = +1

Query  91   LAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFV  270
            +A RL+G+VA+ITGG  GIG  TAKLF +HGAKV+IAD +D    Q++CKDLG  ++ FV
Sbjct  9    IARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDH-LGQTLCKDLGQSSSVFV  67

Query  271  HCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGI-AGAKGLDILDCDGTDFVNVFRVNTLG  447
            HCDVT E DV+ AV+ AVS +G+LDIM+NNAG+   +   DIL  D   F  V  VN +G
Sbjct  68   HCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDILKDDPLTFQRVVNVNLVG  127

Query  448  AFLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYG  624
            AFLGTKHAARVMKP  RGSI+ TAS+  V+GG   HAYT SKH ++GL +N A+DLGRYG
Sbjct  128  AFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAAVDLGRYG  187

Query  625  IRVNCV  642
            IRVNCV
Sbjct  188  IRVNCV  193


 Score = 67.8 bits (164),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAE-DVAEAVLYLASDESKYVSGHNL  815
            SP ++PT+M R  F + +  +    Y +LK  D++ E DV EAV+YL SDESK VSG NL
Sbjct  194  SPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYLGSDESKCVSGLNL  253

Query  816  VVDAGFSISNLAL  854
            +VD GF++ N AL
Sbjct  254  IVDGGFTVVNQAL  266



>gb|KCW83009.1| hypothetical protein EUGRSUZ_C04391, partial [Eucalyptus grandis]
Length=287

 Score =   177 bits (448),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD RDD   +S+C DLG   A FVHCDV+ E+DV+NA+  AV   G+L
Sbjct  34   RLFSKHGAKVIIADIRDD-LGKSVCVDLGAETASFVHCDVSIESDVENAIATAVDKFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I+     +ILD D  DF  V  VN  G FLGTKHAAR M P + GSIIN  S
Sbjct  93   DIMVNNAAISDPLKANILDNDKADFERVISVNLTGVFLGTKHAARAMIPSRSGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAYT SKHAIVGLT+N A +LGRYGIRVNC+
Sbjct  153  VSSSVGGVASHAYTSSKHAIVGLTRNVASELGRYGIRVNCL  193


 Score = 80.9 bits (198),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T + + +F + E+  + VYSNL GV L  EDVA+A +YL SDESKYVSG NL V
Sbjct  194  SPYFILTPLTKEFFKIDENAGVRVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQNLAV  253

Query  822  DAGFSISNLALN  857
            DAGF+  N+ ++
Sbjct  254  DAGFTTINIIID  265



>gb|KDP36171.1| hypothetical protein JCGZ_08815 [Jatropha curcas]
Length=276

 Score =   184 bits (466),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAK++IAD +D+   Q++ + LGP N+ +VHC+VT+EA ++NAV+KAV+T+G+L
Sbjct  33   KVFAHHGAKIVIADVQDE-LGQAVSQALGPSNSTYVHCNVTNEAHIKNAVDKAVATYGKL  91

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  VN  G FLG KHAARVM P ++GSII TAS
Sbjct  92   DIMFNNAGIVDPNKPRIIDNEKEDFERVLSVNVTGVFLGIKHAARVMIPARKGSIICTAS  151

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S ++G    HAYTCSKHA++GLT+N A++LG++G+RVNC+
Sbjct  152  ISSLVGAAASHAYTCSKHAVLGLTRNAAIELGQFGVRVNCL  192


 Score = 73.6 bits (179),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +   + GL ++   + +D  ++LKGV L AEDVA A LYLASDE +Y++GHN
Sbjct  193  SPYALATPLATKFVGLDDEGLENLMDSLASLKGVTLKAEDVANAALYLASDEGRYINGHN  252

Query  813  LVVDAGFSISN  845
            L +D GFSI N
Sbjct  253  LAIDGGFSIHN  263



>ref|XP_010050120.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=270

 Score =   178 bits (452),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD RDD   + +CKDLG   A FVHCDV+ E+DV+NA+  AV   G+L
Sbjct  34   RLFLKHGAKVIIADIRDD-LGKLVCKDLGAETASFVHCDVSIESDVENAIATAVDKFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I+     +ILD D  DF  V  VN  G FLGTKHAAR M P + GSIIN  S
Sbjct  93   DIMVNNAAISDPPKANILDNDKADFERVISVNLTGVFLGTKHAARAMIPSRSGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAYT SKHA+VGLT+N A +LGRYGIRVNCV
Sbjct  153  VSSSVGGVASHAYTSSKHAVVGLTRNVAAELGRYGIRVNCV  193


 Score = 79.0 bits (193),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T + + +F + E   + VYSNL GV L  EDVA+A +YL SDESKYVSG NL V
Sbjct  194  SPYFILTPLTKEFFKVDESSGVRVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>gb|KCW83006.1| hypothetical protein EUGRSUZ_C04389, partial [Eucalyptus grandis]
Length=265

 Score =   178 bits (452),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD RDD   + +CKDLG   A FVHCDV+ E+DV+NA+  AV   G+L
Sbjct  34   RLFLKHGAKVIIADIRDD-LGKLVCKDLGAETASFVHCDVSIESDVENAIATAVDKFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I+     +ILD D  DF  V  VN  G FLGTKHAAR M P + GSIIN  S
Sbjct  93   DIMVNNAAISDPPKANILDNDKADFERVISVNLTGVFLGTKHAARAMIPSRSGSIINVGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +GG   HAYT SKHA+VGLT+N A +LGRYGIRVNCV
Sbjct  153  VSSSVGGVASHAYTSSKHAVVGLTRNVAAELGRYGIRVNCV  193


 Score = 79.0 bits (193),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T + + +F + E   + VYSNL GV L  EDVA+A +YL SDESKYVSG NL V
Sbjct  194  SPYFILTPLTKEFFKVDESSGVRVYSNLDGVSLQEEDVAKAAVYLGSDESKYVSGQNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>gb|AAK83036.1|AF286651_1 TASSELSEED2-like protein [Cucumis sativus]
Length=271

 Score =   188 bits (477),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = +1

Query  91   LAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFV  270
            +A RL+G+VA+ITGG  GIG  TAKLF +HGAKV+IAD +D    Q++CKDLG  ++ FV
Sbjct  9    IARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDH-LGQTLCKDLGQSSSVFV  67

Query  271  HCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGI-AGAKGLDILDCDGTDFVNVFRVNTLG  447
            HCDVT E DV+ AV+ AVS +G+LDIM+NNAG+   +   D L  D   F  V  VN +G
Sbjct  68   HCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDFLKDDPLTFQRVVNVNLVG  127

Query  448  AFLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYG  624
            AFLGTKHAARVMKP  RGSI+ TAS+  V+GG   HAYT SKH ++GL +N A+DLGRYG
Sbjct  128  AFLGTKHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAAVDLGRYG  187

Query  625  IRVNCV  642
            IRVNCV
Sbjct  188  IRVNCV  193


 Score = 67.8 bits (164),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAE-DVAEAVLYLASDESKYVSGHNL  815
            SP ++PT+M R  F + +  +    Y +LK  D++ E DV EAV+YL SDESK VSG NL
Sbjct  194  SPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYLGSDESKCVSGLNL  253

Query  816  VVDAGFSISNLAL  854
            +VD GF++ N AL
Sbjct  254  IVDGGFTVVNQAL  266



>gb|ACU19531.1| unknown [Glycine max]
Length=269

 Score =   171 bits (434),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+ K+L   +A +VHCDVT+E DV+N VN AVS +G+L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSVAKELE--SASYVHCDVTNEIDVENCVNTAVSKYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DI+ NNAGI       I+D   +DF  V  V  +G FLGTKHAARVM P ++G IINTAS
Sbjct  91   DIIFNNAGIIDEIKTSIVDNSKSDFERVIGVILVGPFLGTKHAARVMIPAKKGCIINTAS  150

Query  523  VSG-VMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G + GG  HAYT SKHA++GLTKNTA++LG++GIRVNC+
Sbjct  151  VAGCIGGGATHAYTSSKHALIGLTKNTAVELGQHGIRVNCL  191


 Score = 84.3 bits (207),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + YF + ED   ++YSNLKG  L+  DVAEA LYLA DESKYVSGHNLV+
Sbjct  192  SPYLVVTPLSKKYFNIDEDKIREIYSNLKGAHLVPNDVAEAALYLAGDESKYVSGHNLVI  251

Query  822  DAGFS  836
            D G++
Sbjct  252  DGGYT  256



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   178 bits (451),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV+IA+ +DD    S+CK L P  A ++HCDVT+E  VQNAV+  V+ + +L
Sbjct  34   KLFTKHGAKVMIAEIQDD-LGLSVCKSLDPSVASYIHCDVTNEDHVQNAVDSTVAKYKKL  92

Query  343  DIMVNNAGIAGA-KGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            DIM NNAGIAG+    +ILD   +DF    + N +G FLGTKHAARVM P ++GSII TA
Sbjct  93   DIMFNNAGIAGSHPKPNILDITQSDFEETVKTNLIGPFLGTKHAARVMIPARQGSIITTA  152

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV  ++GG   HAYT SKH ++GLT++T ++ G+YGIRVNCV
Sbjct  153  SVCSIIGGVAPHAYTSSKHGVLGLTRSTTVEFGQYGIRVNCV  194


 Score = 77.4 bits (189),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SP+ +PT +   +  L ++    +YSNLKG     EDVA A L+LASD+SKYVSGHNL V
Sbjct  195  SPHAVPTPLFNKFLQLDDEGISKIYSNLKGTWCKVEDVANAALFLASDDSKYVSGHNLTV  254

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  255  DGGFTIMN  262



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +1

Query  169  FCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDI  348
            F +HGAKV+IADT+D+  + S+CKDL   +A F+HCDVT E DV+NAVN A+S HG+LD+
Sbjct  36   FFKHGAKVVIADTQDE-LAHSVCKDLNSESASFIHCDVTKETDVENAVNTAISRHGKLDV  94

Query  349  MVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVS  528
            M NNAGI G    +++D   ++F  V RVN +GAFLGTKHAARVMKP ++GSII T+SV 
Sbjct  95   MFNNAGIVGVVKTNMVDVSMSEFEEVIRVNLVGAFLGTKHAARVMKPARQGSIITTSSVC  154

Query  529  GVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            G++GGF  HAYT SKH ++GL +N A++LG++GIRVNCV
Sbjct  155  GILGGFASHAYTSSKHGVLGLMRNAAVELGQFGIRVNCV  193


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY + T+M R +  + +D+    YSNLKG  L  EDVAEA LYLAS++
Sbjct  183  LGQFGIRVNCVSPYTVATEMSRNFLKMTDDEIRSGYSNLKGAILTPEDVAEAALYLASED  242

Query  789  SKYVSGHNLVVDAGFSISN  845
            S+YVSGHNLVVD G +I N
Sbjct  243  SRYVSGHNLVVDGGHTIVN  261



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +1

Query  169  FCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDI  348
            F +HGAKV+IADT+D+  + S+CKDL   +A F+HCD+T E DV+NAVN A+S HG+LD+
Sbjct  36   FFKHGAKVVIADTQDE-LAHSVCKDLNSESASFIHCDITKETDVENAVNTAISRHGKLDV  94

Query  349  MVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVS  528
            M NNAGI G    +++D   ++F  V RVN +G FLGTKHAARVMKP ++GSII T+SV 
Sbjct  95   MFNNAGIVGVVKTNMVDVSMSEFEEVIRVNLVGPFLGTKHAARVMKPARQGSIITTSSVC  154

Query  529  GVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            G++GGF  HAYT SKH ++GL +NTA++LG++GIRVNCV
Sbjct  155  GILGGFASHAYTSSKHGVLGLMRNTAVELGQFGIRVNCV  193


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY + T+M R +  + +D+    YSNLKG  L  EDVAEA LYLASD+
Sbjct  183  LGQFGIRVNCVSPYTVATEMSRNFLKMTDDEIRSGYSNLKGAILTPEDVAEAALYLASDD  242

Query  789  SKYVSGHNLVVDAGFSISN  845
            S+YVSGHNLVVD G++I N
Sbjct  243  SRYVSGHNLVVDGGYTIVN  261



>gb|KDP36172.1| hypothetical protein JCGZ_08816 [Jatropha curcas]
Length=277

 Score =   183 bits (464),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAK++IAD +D+   Q++ + LGP N+ +VHC+VT+EA ++NAV+KAV+T+G+L
Sbjct  33   KVFAHHGAKLVIADVQDE-LGQAVSQALGPSNSTYVHCNVTNEAHIKNAVDKAVATYGKL  91

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  VN  G FLG KHAARVM P ++GSII TAS
Sbjct  92   DIMFNNAGIVDPNKPRIIDNEKEDFERVLSVNVTGVFLGIKHAARVMIPARKGSIICTAS  151

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S ++G    HAYTCSKHA++GLT+N A++LG++G+RVNC+
Sbjct  152  ISSLVGAAASHAYTCSKHAVLGLTRNAAIELGQFGVRVNCL  192


 Score = 70.9 bits (172),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +   + GL ++   + +D  ++LKGV L AEDVA A LYLASDE +Y++GHN
Sbjct  193  SPYALATPLATKFVGLDDEGLENLMDSLASLKGVTLKAEDVANAALYLASDEGRYINGHN  252

Query  813  LVVDAGFSISN  845
            L +D G SI N
Sbjct  253  LAIDGGISIHN  263



>ref|XP_009605456.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=263

 Score =   188 bits (477),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = +1

Query  91   LAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFV  270
            LA RL+GRVAIITG   GIG A A+LF +H AKV+IAD +DD  SQ +CK+L P +  FV
Sbjct  5    LARRLEGRVAIITGAASGIGEAAARLFSKHRAKVVIADIQDD-LSQKVCKELDPSSTTFV  63

Query  271  HCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGA  450
            HCDVT E +++NAVN AVS +G+LDIM NNAGI GA   +ILD + ++F  V  +N +G 
Sbjct  64   HCDVTKEEELENAVNIAVSKYGKLDIMYNNAGIMGAVKSNILDNEKSEFEKVISINLVGT  123

Query  451  FLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGI  627
            FLG K AARVM P ++GSII T SV   +GG   HAYT SKH ++GLT+N A+DLGRYGI
Sbjct  124  FLGIKQAARVMIPRRQGSIIVTGSVCSSIGGVCPHAYTSSKHGVLGLTRNAAVDLGRYGI  183

Query  628  RVNCV  642
            RVNCV
Sbjct  184  RVNCV  188


 Score = 65.1 bits (157),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ TQM          +  DVYS L G  L   DVAE  ++LASDESK VSG + V+
Sbjct  189  SPYVVLTQMAFDSLKKMGKEGSDVYSTLNGAILTPNDVAETAVFLASDESKCVSGQDFVI  248

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  249  DGGFTIEN  256



>gb|AAK83035.1|AF286650_1 CTA [Cucumis sativus]
Length=271

 Score =   185 bits (470),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = +1

Query  91   LAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFV  270
            +A RL+G+VA+ITGG  GIG  TAKLF +HGAKV+IAD +D    Q++CKDLG  ++ FV
Sbjct  9    IARRLEGKVAVITGGARGIGEQTAKLFFKHGAKVVIADIQDH-LGQTLCKDLGQSSSVFV  67

Query  271  HCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGI-AGAKGLDILDCDGTDFVNVFRVNTLG  447
            HCDVT E DV+ AV+ AVS +G+LDIM+NNAG+   +   DIL  D   F  V  VN +G
Sbjct  68   HCDVTKEKDVETAVDTAVSKYGKLDIMLNNAGVFEESPNFDILKDDPLTFQRVVNVNLVG  127

Query  448  AFLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYG  624
            A LGT+HAARVMKP  RGSI+ TAS+  V+GG   HAYT SKH ++GL +N A+DLGRYG
Sbjct  128  ASLGTRHAARVMKPAGRGSIVTTASICSVIGGIGTHAYTSSKHGVLGLMRNAAVDLGRYG  187

Query  625  IRVNCV  642
            IRVNCV
Sbjct  188  IRVNCV  193


 Score = 67.8 bits (164),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYSNLKGVDLMAE-DVAEAVLYLASDESKYVSGHNL  815
            SP ++PT+M R  F + +  +    Y +LK  D++ E DV EAV+YL SDESK VSG NL
Sbjct  194  SPNVVPTEMGRKLFKVKDGGEFPSFYWSLKNGDILREEDVGEAVVYLGSDESKCVSGLNL  253

Query  816  VVDAGFSISNLAL  854
            +VD GF++ N AL
Sbjct  254  IVDGGFTVVNQAL  266



>ref|XP_006430117.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43357.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=275

 Score =   176 bits (447),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F Q GAKV+IAD ++     S+ + +G  N+ +VHCDVT+E+ ++NA+++ V+THG+L
Sbjct  34   KVFAQQGAKVVIADIQEQ-LGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA    I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TAS
Sbjct  93   DIMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY C+KHA++GLTKN A++LG++GIRVNC+
Sbjct  153  VSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCL  193


 Score = 75.9 bits (185),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +  ++ G+ ++D    ++  +NLKGV L  ED+A A LYLASDE+KYVSGHN
Sbjct  194  SPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSGHN  253

Query  813  LVVDAGFSISNLAL  854
            L +D GF+I N +L
Sbjct  254  LFIDGGFTIVNPSL  267



>ref|XP_006430116.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
 gb|ESR43356.1| hypothetical protein CICLE_v10012261mg [Citrus clementina]
Length=312

 Score =   176 bits (447),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F Q GAKV+IAD ++     S+ + +G  N+ +VHCDVT+E+ ++NA+++ V+THG+L
Sbjct  71   KVFAQQGAKVVIADIQEQ-LGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKL  129

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA    I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TAS
Sbjct  130  DIMFNNAGIGGANKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTAS  189

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY C+KHA++GLTKN A++LG++GIRVNC+
Sbjct  190  VSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCL  230


 Score = 76.3 bits (186),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +  ++ G+ ++D    ++  +NLKGV L  ED+A A LYLASDE+KYVSGHN
Sbjct  231  SPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSGHN  290

Query  813  LVVDAGFSISNLAL  854
            L +D GF+I N +L
Sbjct  291  LFIDGGFTIVNPSL  304



>gb|AEC10992.1| alcohol dehydrogenase [Camellia sinensis]
Length=277

 Score =   175 bits (444),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +DD    S+CKDL   +  FVHCDVT+E  V NAV+ AV+  G+L
Sbjct  34   RLFSKHGAKVMIADIQDD-LGLSVCKDLDEKSVSFVHCDVTNETHVMNAVDAAVAQFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  + RVN +GAFLGTK AARVM   +RG+II TAS
Sbjct  93   DIMYNNAGIVGLAKPNILDNDKDEFEKIIRVNLVGAFLGTKQAARVMILNRRGTIITTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKH + GLTKN A++ G++GIRVNCV
Sbjct  153  VCSPIGGVASHAYTSSKHGVAGLTKNVAVEFGQHGIRVNCV  193


 Score = 77.0 bits (188),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY++ T + + ++ L ++    VYSNLKG  L  EDVA+A LYL SD+S YVSGHN +V
Sbjct  194  SPYLVGTPLAKDFYKLDDEGVYGVYSNLKGAVLRPEDVAQAALYLGSDDSMYVSGHNFIV  253

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  254  DGGFTIVN  261



>ref|XP_006481701.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=275

 Score =   176 bits (446),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F Q GAKV+IAD +++    S+ + +G  N+ +VHCDVT+E+ ++NA+++ V+THG+L
Sbjct  34   KVFAQQGAKVVIADIQEE-LGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TAS
Sbjct  93   DIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY C+KHA++GLTKN A++LG++GIRVNC+
Sbjct  153  VSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCL  193


 Score = 75.9 bits (185),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +  ++ G+ ++D    ++  +NLKGV L  ED+A A LYLASDE+KYVSGHN
Sbjct  194  SPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSGHN  253

Query  813  LVVDAGFSISNLAL  854
            L +D GF+I N +L
Sbjct  254  LFIDGGFTIVNPSL  267



>dbj|BAE72097.1| Lactuca sativa short-chain dehydrogenase/reductase 2
Length=271

 Score =   176 bits (445),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAK++IAD +D    Q++C+ +G  N+ ++HCDVT+E DV+ AV+ A++T+G+L
Sbjct  28   KLFAEHGAKIVIADIQDQ-LGQAVCEAIGSSNSIYIHCDVTNEEDVRKAVDIAIATYGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM  NAGI       I+D + +DF  V  VN  G FL  KHAARVM P + GSII+TAS
Sbjct  87   DIMFCNAGIIDPNKDHIIDNEKSDFERVLSVNVTGVFLSMKHAARVMVPTRAGSIISTAS  146

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYTCSKHA+ GLTKN A++LG++GIRVNC+
Sbjct  147  VVSNIGGLCPHAYTCSKHAVAGLTKNLAVELGQFGIRVNCL  187


 Score = 76.3 bits (186),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY I T     + GL  +D   K++  +NLKGV L  +DVA+A ++LASDE+KY+SGHN
Sbjct  188  SPYAIDTPQATGFTGLKGEDFKNKVNSVANLKGVTLTTDDVAKAAVFLASDEAKYISGHN  247

Query  813  LVVDAGFSISNLALN  857
            L +D GFSI N + N
Sbjct  248  LFIDGGFSIVNPSFN  262



>ref|XP_002523206.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF39237.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=270

 Score =   170 bits (430),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = +1

Query  169  FCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDI  348
            FC+HGAKV+IAD +DD   QS+ KD G   A FVHCDV+ E+DV+NAV+ AVS  G+LDI
Sbjct  36   FCKHGAKVVIADIQDD-LGQSVAKDHGQDVAMFVHCDVSVESDVKNAVDTAVSIFGKLDI  94

Query  349  MVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVS  528
            MVNNA     +   I+D D  D     RVN +G FLGTKHAARVM P ++GSII   SV 
Sbjct  95   MVNNAATGEPRKPSIVDNDLADVERALRVNLIGPFLGTKHAARVMIPARQGSIITLGSVC  154

Query  529  GVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVN  636
              +GG   H+YT +KH IVGL +N A +LGR+GIRVN
Sbjct  155  SSVGGVASHSYTIAKHGIVGLARNAAAELGRFGIRVN  191


 Score = 81.6 bits (200),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY I T +    F   ED +  VYSNL+GV L  EDVAEA +YLASDESK+VSGHNL +
Sbjct  194  SPYFIETPLSMKLFEEEEDGRSGVYSNLEGVKLKQEDVAEAAIYLASDESKFVSGHNLAL  253

Query  822  DAGFSISNLALN  857
            D GF+  N A  
Sbjct  254  DGGFTTINPAFG  265



>gb|KDO35956.1| hypothetical protein CISIN_1g046809mg, partial [Citrus sinensis]
Length=269

 Score =   175 bits (443),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F Q GAKV+IAD +++    S+ + +G  N+ +VHCDVT+E+ ++NA+++ V+THG+L
Sbjct  28   KVFAQQGAKVVIADIQEE-LGHSVVESIGTSNSSYVHCDVTNESHIKNAIDQTVATHGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     I+D +  DF  V  VN  G FLG KHAARVM P + GSI++TAS
Sbjct  87   DIMFNNAGIGGPNKTRIIDNEKADFERVLSVNVTGVFLGIKHAARVMIPARSGSILSTAS  146

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY C+KHA++GLTKN A++LG++GIRVNC+
Sbjct  147  VSSRVGAAASHAYCCAKHAVLGLTKNAAVELGQFGIRVNCL  187


 Score = 75.9 bits (185),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +  ++ G+ ++D    ++  +NLKGV L  ED+A A LYLASDE+KYVSGHN
Sbjct  188  SPYALATPLATSFVGITDEDLEGFMNSAANLKGVTLRTEDIAYAALYLASDEAKYVSGHN  247

Query  813  LVVDAGFSISNLAL  854
            L +D GF+I N +L
Sbjct  248  LFIDGGFTIVNPSL  261



>ref|XP_007027886.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY08388.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=276

 Score =   179 bits (453),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAKV+IAD +D+    S+C+ +GP N  +VHC+VT E  ++NAV+KAV+THG+L
Sbjct  34   KVFAHHGAKVVIADIQDE-LGHSVCEAVGPSNCSYVHCNVTDEDQIKNAVDKAVATHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D + +DF  V  VN  G FLG KHAARVM P + GSII+TAS
Sbjct  93   DIMFNNAGITDPIKARIIDNEKSDFERVLSVNVTGVFLGIKHAARVMVPARSGSIISTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY  SKHA++GLT+N A++LG++GIRVNC+
Sbjct  153  VSSTVGAAATHAYCASKHAVLGLTRNAAVELGQFGIRVNCL  193


 Score = 71.2 bits (173),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP+ + T +     G+ +++    + + +NLKGV L AED+A A LYLAS+E +YVSGHN
Sbjct  194  SPFALATPLATEVLGINDEELEKGMGLVANLKGVTLKAEDIANAALYLASEEGRYVSGHN  253

Query  813  LVVDAGFSISNLALN  857
            L VD GF+I N +L+
Sbjct  254  LFVDGGFTIFNPSLS  268



>ref|XP_009388139.1| PREDICTED: momilactone A synthase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   187 bits (474),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGA+++IAD +DD +  ++C  LGP  A +VHCDVT+E+DVQ AV+  VS HG+L
Sbjct  34   KLFARHGARIVIADVQDD-KGHALCSALGPSVASYVHCDVTNESDVQQAVDATVSHHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            D+M NNAGI G   L +L+ + +DF +V   N +G++LGTKHAAR M P +RGSI+ TAS
Sbjct  93   DVMFNNAGIIGEPCLRLLESEKSDFEHVVATNLVGSYLGTKHAARAMLPARRGSIVITAS  152

Query  523  VSGVMGGFQH-AYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+ V+      AYTCSKHA++GL K+ AL+LG++GIRVNCV
Sbjct  153  VASVIASITPVAYTCSKHAVLGLMKSAALELGQFGIRVNCV  193


 Score = 62.4 bits (150),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYV  800
            SPY +PT +    FG+ E++    ++ LKGV L AEDVAEAV+YLASDES+YV
Sbjct  194  SPYALPTPLAMKAFGMGEEE----HATLKGVRLKAEDVAEAVVYLASDESRYV  242



>ref|XP_003632648.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Vitis vinifera]
Length=275

 Score =   173 bits (439),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            + F QHGAKV+IAD +D+    S+ + LG  NA +VHCDVT E+ ++ AV+K  +THG+L
Sbjct  34   ETFTQHGAKVVIADIQDE-LGHSVIEALGQTNASYVHCDVTDESQIKAAVDKTAATHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  +N  G FLG KHAARVM P + GSII+TAS
Sbjct  93   DIMFNNAGIVNNYKPRIMDNEKADFERVLSINVTGVFLGMKHAARVMVPAKSGSIISTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY CSKHA++GLT+N A++LG++GIRVNC+
Sbjct  153  VSSNVGAAATHAYCCSKHAVLGLTRNAAIELGQFGIRVNCL  193


 Score = 75.9 bits (185),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +   +  L  ++    ++  +NLKGV L A+DVA A LYLASDES+YVSGHN
Sbjct  194  SPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDVANAALYLASDESRYVSGHN  253

Query  813  LVVDAGFSISN  845
            L +D GF+++N
Sbjct  254  LFIDGGFTVAN  264



>ref|XP_002281462.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Vitis vinifera]
Length=275

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            + F QHGAKV+IAD +D+    S+ + LG  NA +VHCDVT E+ ++ AV+K  +THG+L
Sbjct  34   ETFTQHGAKVVIADIQDE-LGHSVIEALGQTNASYVHCDVTDESQIKAAVDKTAATHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  +N  G FLG KHAARVM P + GSII+TAS
Sbjct  93   DIMFNNAGIVNNYKPRIMDNEKADFERVLSINVTGVFLGMKHAARVMVPAKSGSIISTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY CSKHA++GLT+N A++LG++GIRVNC+
Sbjct  153  VSSNVGAAATHAYCCSKHAVLGLTRNAAIELGQFGIRVNCL  193


 Score = 75.9 bits (185),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +   +  L  ++    ++  +NLKGV L A+DVA A LYLASDES+YVSGHN
Sbjct  194  SPYALATPLATNFLNLTAEELETAMNATANLKGVTLKAQDVANAALYLASDESRYVSGHN  253

Query  813  LVVDAGFSISN  845
            L +D GF+++N
Sbjct  254  LFIDGGFTVAN  264



>ref|XP_004244887.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum lycopersicum]
Length=263

 Score =   183 bits (465),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = +1

Query  91   LAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFV  270
            LA RL+G+VAIITG   GIG A+AKLF ++G+KV+IAD +DD  +Q++CKDL P +  FV
Sbjct  5    LARRLEGKVAIITGAASGIGEASAKLFSRYGSKVVIADIQDD-LAQNVCKDLDPSSTTFV  63

Query  271  HCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGA  450
            HCDVT E D++N VN  V  +G+LDIM NNAGI GA   +IL+ + +DF  V   N +G 
Sbjct  64   HCDVTKEEDLENVVNIVVDKYGKLDIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGT  123

Query  451  FLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGI  627
            FLG K AARVM P  +GSII T SV   +GG   H+YT SKH ++GLT+N A+DLGRYGI
Sbjct  124  FLGIKQAARVMIPRGQGSIITTGSVCASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGI  183

Query  628  RVNCV  642
            RVNCV
Sbjct  184  RVNCV  188


 Score = 65.9 bits (159),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYII-PTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY+I  T  + T   + ++D  DVYS L G  L   DVAEA ++LASDESKYV+G + V
Sbjct  189  SPYVIRTTSALDTLKKMGKEDS-DVYSTLNGPTLTPYDVAEAAVFLASDESKYVNGQDFV  247

Query  819  VDAGFSISNLALN  857
            +D GF+I N  L+
Sbjct  248  IDGGFTIENPGLS  260



>ref|XP_006367119.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   177 bits (450),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD  +Q +C++L P +  +VHCDVT E D++N VN AVS +G+L
Sbjct  29   RLFTRHGAVVVIADIQDD-LAQKVCENLDPSSITYVHCDVTKEDDLKNVVNTAVSKYGKL  87

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI      +ILD + ++F  V  +N +G F+G K AARVM P  +GSII+TAS
Sbjct  88   DIMYNNAGIVDEIKSNILDNEKSEFEKVININLIGTFVGIKEAARVMIPRGQGSIISTAS  147

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKH ++GLT+N A+DLGRYGIRVNCV
Sbjct  148  VCASIGGVCSHAYTSSKHGVLGLTRNAAVDLGRYGIRVNCV  188


 Score = 71.6 bits (174),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY + T M          D  +VYSNLKG  L   DVAEA ++LASDESK VSGH+L+V
Sbjct  189  SPYTVLTTMGLYTLKKIGKDSSNVYSNLKGATLTPNDVAEAAVFLASDESKCVSGHDLIV  248

Query  822  DAGFSISN  845
            D GF++ N
Sbjct  249  DGGFTVEN  256



>gb|AHH81851.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=275

 Score =   188 bits (477),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV+IAD +D    +++ + +GP N+ +VHCDVT E DV+NAV+KAVST+G+L
Sbjct  34   KLFSKHGAKVVIADIQDQ-LGEAVVRQIGPENSTYVHCDVTDENDVRNAVDKAVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNA         I+D +  DF  V  VN  G FLG KHAARVM PV+RG II+TAS
Sbjct  93   DIMYNNAATIDFGAHPIVDNEKKDFERVMAVNVTGVFLGMKHAARVMIPVRRGVIISTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++G +GG   HAYTCSKHA++GL+KN A++LG+YGIRVNCV
Sbjct  153  IAGHLGGTATHAYTCSKHAVIGLSKNLAIELGQYGIRVNCV  193


 Score = 60.8 bits (146),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAED--DKLDV-YSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T++ + Y  L  +  +K+     NL+G  L  +D+A A L+LASD++KYVSG N
Sbjct  194  SPYALATKLSKKYLKLDHELFEKMSHDKGNLQGATLKPDDIANAALFLASDDAKYVSGQN  253

Query  813  LVVDAGFSISNLALN  857
            L +D GF++ N A+ 
Sbjct  254  LFIDGGFTVFNSAMQ  268



>ref|XP_007043248.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99079.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   167 bits (422),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LFC+HGAKV+IAD +D+   QS+CKD+G   A FVHCD+  E+DV+ AVN A+S HG+L
Sbjct  34   RLFCEHGAKVIIADIQDE-LGQSVCKDIGLAVASFVHCDIVKESDVEIAVNTAISLHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRG-SIINTA  519
            DIMVNNA +       I++ +  DF  V  VN  G FLGTKHAARVM P ++G  I   +
Sbjct  93   DIMVNNAAVIDDAKPSIVENNVADFERVISVNLTGVFLGTKHAARVMIPARKGSIISLGS  152

Query  520  SVSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
              S V G   HAYT SKHAI+GLTKN A +LGR+GIRVNC+
Sbjct  153  VSSSVGGVASHAYTSSKHAILGLTKNVAAELGRFGIRVNCL  193


 Score = 82.0 bits (201),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            S Y I T+    +F L  D++  VYSNLKGV L  EDVA+A LYL SDESKYVSGHNL V
Sbjct  194  SSYFIATRSAMNFFKLDGDERPRVYSNLKGVVLQQEDVADAALYLGSDESKYVSGHNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>gb|KEH29817.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=271

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 124/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +DD +  S+CKDL   +A +VHCDVT E D++NAVN  +S +G+L
Sbjct  34   RLFTEHGAQVIIADIQDD-KGYSVCKDLHKSSASYVHCDVTKEKDIENAVNTTISMYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL+   ++F  V  VN +G FLGTKHA+RVM P +RGSIINTAS
Sbjct  93   DIMFNNAGIVGANKTNILEYKLSEFEEVINVNLVGVFLGTKHASRVMIPARRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
            V G +GG   HAYT SKHA++GL +NTA++LG + IRVNCV P I
Sbjct  153  VCGSIGGMASHAYTSSKHAVLGLMRNTAIELGPFSIRVNCVSPYI  197


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LG         SPYI+ T M + +  L ++  L +YSNLKG +L+ +DVAEA LYL SD
Sbjct  182  ELGPFSIRVNCVSPYIVATPMAKNFLKLDDEGLLGLYSNLKGTNLVPKDVAEASLYLGSD  241

Query  786  ESKYVSGHNLVVDAGFSISN  845
            ESKYVSGHNLVVD   S+SN
Sbjct  242  ESKYVSGHNLVVDGAVSVSN  261



>ref|XP_010059365.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
 gb|KCW90499.1| hypothetical protein EUGRSUZ_A02618 [Eucalyptus grandis]
Length=277

 Score =   176 bits (447),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F  HGAKV+IAD  +D    SI   L   NA FVHCDVT E+ V+ AV +AVST+G+L
Sbjct  34   RVFAHHGAKVVIADV-NDSLGHSIRDSLSRDNASFVHCDVTDESQVKAAVAEAVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     I+D D  DF  V  VN  G FLG KHAA+ M PV+RG IINTAS
Sbjct  93   DIMFNNAGITGPNKSRIVDNDKADFERVLAVNVTGVFLGMKHAAQAMIPVRRGCIINTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            + SG+ G   HAYTC+KHA++GLT+N A++LG++GIRVNC+
Sbjct  153  ISSGLAGITSHAYTCAKHAVLGLTRNAAVELGQFGIRVNCL  193


 Score = 72.0 bits (175),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP    T +   +FG+   +    +D  +NLKGV L  EDVA A L+LA DE++YVSGHN
Sbjct  194  SPNACATPLATKFFGMGPAELEAAIDAVTNLKGVTLKVEDVANAALFLAGDEARYVSGHN  253

Query  813  LVVDAGFSISN  845
            L +D GFS+ N
Sbjct  254  LFIDGGFSVVN  264



>gb|KDO58270.1| hypothetical protein CISIN_1g044923mg, partial [Citrus sinensis]
Length=214

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 124/166 (75%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-----FVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+C+D+   ++      +VHCDVT E D++NAVN AVS
Sbjct  31   RLFSKHGAKVLIADIKDD-LGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVS  89

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  90   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  149

Query  508  INTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV GV+GG   HAYT SKH +VGL KNTA++LGR+GIRVNCV
Sbjct  150  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNCV  195



>ref|XP_010324818.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum lycopersicum]
Length=256

 Score =   182 bits (461),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF ++G+KV+IAD +DD  +Q++CKDL P +  FVHCDVT E D++N VN  V  +G+L
Sbjct  22   KLFSRYGSKVVIADIQDD-LAQNVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKL  80

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL+ + +DF  V   N +G FLG K AARVM P  +GSII T S
Sbjct  81   DIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIPRGQGSIITTGS  140

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   H+YT SKH ++GLT+N A+DLGRYGIRVNCV
Sbjct  141  VCASIGGVCPHSYTSSKHGLLGLTRNAAIDLGRYGIRVNCV  181


 Score = 65.9 bits (159),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYII-PTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY+I  T  + T   + ++D  DVYS L G  L   DVAEA ++LASDESKYV+G + V
Sbjct  182  SPYVIRTTSALDTLKKMGKEDS-DVYSTLNGPTLTPYDVAEAAVFLASDESKYVNGQDFV  240

Query  819  VDAGFSISNLALN  857
            +D GF+I N  L+
Sbjct  241  IDGGFTIENPGLS  253



>ref|XP_010262932.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nelumbo nucifera]
Length=268

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LFC+HGAKV+IAD +DD    S+C D+G   A FVHCDVT+E+ ++ AV+  V+ +G+L
Sbjct  35   RLFCRHGAKVVIADVQDD-LGHSVCNDIGSKAASFVHCDVTNESHIRKAVDTTVAKYGKL  93

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +ILD D  +F  V  VN  G FLGTKHAARVM P +RGSII+TAS
Sbjct  94   DIMFNNAGIVGTPNPNILDNDKGEFEQVLAVNITGPFLGTKHAARVMIPARRGSIISTAS  153

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  ++GG   HAYTCSKHA+VGLTKN A++LG++G+RVNCV
Sbjct  154  VCSLVGGVASHAYTCSKHAVVGLTKNAAVELGKFGVRVNCV  194


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T + + +F L E+    +YSNLKG  L  EDVAEAVLYL SD+
Sbjct  184  LGKFGVRVNCVSPYLVVTPLTKKFFNLDENGSPGIYSNLKGRMLWPEDVAEAVLYLGSDD  243

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            S YVSGHNLVVD GF+I N A 
Sbjct  244  SLYVSGHNLVVDGGFTIVNPAF  265



>ref|XP_006362152.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   181 bits (458),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF ++GAKV+IAD +DD  +  +CKDL P +  FVHCDVT E D++N VN  V  +G+L
Sbjct  29   KLFSRYGAKVVIADIQDD-LAHKVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKL  87

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL+ + +DF  V   N +G FLG K AARVM P  +GSII T S
Sbjct  88   DIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARVMIPRGQGSIITTGS  147

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKH ++GLT+N A+DLGRYGIRVNCV
Sbjct  148  VCSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRVNCV  188


 Score = 66.6 bits (161),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYIIPT-QMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY+I T   + T   + ++D  DVYS+LKG  L   DVAE  ++LASDESKYV+G + +
Sbjct  189  SPYVILTASALNTLKKMGKEDS-DVYSSLKGATLTPNDVAETAVFLASDESKYVNGQDFI  247

Query  819  VDAGFSISNLALN  857
            +D GF+I N   +
Sbjct  248  IDGGFTIENRGFS  260



>gb|KCW90500.1| hypothetical protein EUGRSUZ_A02619 [Eucalyptus grandis]
Length=283

 Score =   176 bits (447),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  82   HNLLAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNA  261
            H L  HRL+G+VA+ITGG  GIG  TA++F  HGAKV+IAD  +D    S+C  LG   A
Sbjct  13   HFLKFHRLEGKVALITGGASGIGEITARVFAHHGAKVVIADV-NDSLGHSVCDSLGRDTA  71

Query  262  FFVHCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNT  441
             FVHC+VT E+  + AV +AVST G+LDIM NNAGI G     I+D D  DF  V  VN 
Sbjct  72   SFVHCNVTDESQTKAAVAEAVSTFGKLDIMFNNAGIGGLNKTRIIDNDKADFERVLAVNV  131

Query  442  LGAFLGTKHAARVMKPVQRGSIINTASVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGR  618
             G FLG KHAA+ M P +RG IINTAS+S  +GG   HAYTC+KHA++GLT+N A++LG+
Sbjct  132  TGVFLGVKHAAQAMIPARRGCIINTASISSGLGGAASHAYTCAKHAVLGLTRNAAVELGQ  191

Query  619  YGIRVNCV  642
            +GIRVNC+
Sbjct  192  FGIRVNCL  199


 Score = 70.1 bits (170),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY   T +   + G+   +    +   +NLKGV L AEDVA A L+LA DE++YVSGHN
Sbjct  200  SPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAALFLAGDEARYVSGHN  259

Query  813  LVVDAGFSISN  845
            L +D GFS+ N
Sbjct  260  LFIDGGFSVVN  270



>ref|XP_009773000.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=263

 Score =   182 bits (463),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = +1

Query  91   LAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFV  270
            LA RL+G+VA+ITG   GIG A A+LF +HGAKV+IAD +DD  +Q +CK+L   +  FV
Sbjct  5    LARRLEGKVAVITGAASGIGEAAARLFSRHGAKVVIADIQDD-LAQKVCKELDTSSTTFV  63

Query  271  HCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGA  450
            HC+VT E D++NAVN AVS +G+LDIM NNAGI GA   +ILD + ++F  V  VN +G 
Sbjct  64   HCNVTKEEDLENAVNIAVSKYGKLDIMYNNAGIMGAIKSNILDNEKSEFEKVISVNLVGT  123

Query  451  FLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGI  627
            FLG K AARVM P ++GSII T SV   +GG   HAYT SKH ++GL +N  +DLGRYGI
Sbjct  124  FLGIKQAARVMIPRRQGSIIVTGSVCSSIGGVCSHAYTSSKHGVLGLARNATVDLGRYGI  183

Query  628  RVNCVP  645
            RVNCV 
Sbjct  184  RVNCVS  189


 Score = 63.9 bits (154),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            SPY + TQM          +  DVYS L G  L  +DVAE  ++LASDESK  SG + ++
Sbjct  189  SPYAVLTQMAFDSLKKMGKEGWDVYSTLNGATLTPKDVAETAVFLASDESKCFSGQDFII  248

Query  822  DAGFSISN  845
            D GF+I N
Sbjct  249  DGGFTIEN  256



>ref|XP_010061227.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Eucalyptus grandis]
Length=307

 Score =   175 bits (443),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F  HGAKV+IAD  +D    S+   L    A FVHCDVT E+ ++ AV +AVST+G+L
Sbjct  64   RVFAHHGAKVVIADV-NDSLGHSVRDSLSRDTASFVHCDVTDESQIKAAVAEAVSTYGKL  122

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     I+D D  DF  V  VN  G FLG KHAA+ M PV+RG IINTAS
Sbjct  123  DIMFNNAGITGPNETRIIDNDKADFERVLAVNVTGVFLGMKHAAQAMIPVRRGCIINTAS  182

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            + SG+ G   HAYTC+KHA++GLT+N A++LG++GIRVNC+
Sbjct  183  ISSGLAGMTSHAYTCAKHAVLGLTRNAAVELGQFGIRVNCL  223


 Score = 71.2 bits (173),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP    T +   +FG++  +    +D  +NLKGV L  EDVA A L+LA DE++YVSGHN
Sbjct  224  SPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALFLAGDEARYVSGHN  283

Query  813  LVVDAGFSISN  845
            L +D GFS+ N
Sbjct  284  LSIDGGFSVVN  294



>ref|XP_006367118.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=263

 Score =   178 bits (451),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF ++GAKV+IAD +DD  +  +CKDL P +  FVHCDVT E D++N VN  V  +G+L
Sbjct  29   KLFSRYGAKVVIADIQDD-LAHKVCKDLDPSSTTFVHCDVTKEEDLENVVNIVVDKYGKL  87

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL+ + +DF  V   N +G FLG K AAR M P  +GSII T S
Sbjct  88   DIMYNNAGIMGAVKSNILENEKSDFEKVISTNLVGTFLGIKQAARDMIPRGQGSIITTGS  147

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKH ++GLT+N A+DLGRYGIRVNCV
Sbjct  148  VCSSIGGVCPHAYTSSKHGLLGLTRNAAVDLGRYGIRVNCV  188


 Score = 68.2 bits (165),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  642  SPYIIPT-QMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY+I T   + T   + ++D  DVYS LKG  L   DVAE  ++LASDESKYV+G + +
Sbjct  189  SPYVILTASALNTLKKMGKEDS-DVYSTLKGATLTPNDVAETTVFLASDESKYVNGQDFI  247

Query  819  VDAGFSISNLALN  857
            +D GF+I N  L+
Sbjct  248  IDGGFTIENRGLS  260



>ref|XP_006481515.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=273

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-----PGNAFFVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+C+D+           +VHCDVT E D++NAVN AVS
Sbjct  31   RLFSKHGAKVLIADIKDD-LGESVCEDISSSSSSANGCSYVHCDVTKEKDIENAVNTAVS  89

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAGI      +ILD D  +F  +  VN +GAFLGTKHAARVMKP  RGSI
Sbjct  90   QYGKLDIMFNNAGIVDEAKPNILDNDQAEFERILSVNLVGAFLGTKHAARVMKPAGRGSI  149

Query  508  INTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV GV+GG   HAYT SKH +VGL KNTA++LGR+GIRVNCV
Sbjct  150  ISTASVCGVIGGVTSHAYTSSKHGVVGLMKNTAVELGRFGIRVNCV  195


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LG         SPY + + M + +  L +D    +YSNL G  L  EDVAEA LYL SD
Sbjct  184  ELGRFGIRVNCVSPYAVSSPMAKGFLKLDDDGMSGIYSNLSGAVLKPEDVAEAALYLGSD  243

Query  786  ESKYVSGHNLVVDAGFSISNLAL  854
            ESK VSGHNLVVD GF+I N  L
Sbjct  244  ESKCVSGHNLVVDGGFTIVNEGL  266



>ref|XP_010061228.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW68145.1| hypothetical protein EUGRSUZ_F01817 [Eucalyptus grandis]
Length=277

 Score =   174 bits (442),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F  HGAKV+IAD  +D    S+   L    A FVHCDVT E+ ++ AV +AVST+G+L
Sbjct  34   RVFAHHGAKVVIADV-NDSLGHSVRDSLSRDTASFVHCDVTDESQIKAAVAEAVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     I+D D  DF  V  VN  G FLG KHAA+ M PV+RG IINTAS
Sbjct  93   DIMFNNAGITGPNETRIIDNDKADFERVLAVNVTGVFLGMKHAAQAMIPVRRGCIINTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            + SG+ G   HAYTC+KHA++GLT+N A++LG++GIRVNC+
Sbjct  153  ISSGLAGMTSHAYTCAKHAVLGLTRNAAVELGQFGIRVNCL  193


 Score = 71.2 bits (173),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP    T +   +FG++  +    +D  +NLKGV L  EDVA A L+LA DE++YVSGHN
Sbjct  194  SPNACATPLATGFFGMSPAELEAAIDAVANLKGVTLKVEDVANAALFLAGDEARYVSGHN  253

Query  813  LVVDAGFSISN  845
            L +D GFS+ N
Sbjct  254  LSIDGGFSVVN  264



>gb|KCW45306.1| hypothetical protein EUGRSUZ_L01036, partial [Eucalyptus grandis]
Length=230

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+I D RDD   +S+CKDLGP  A FVHCDV+SE+D++NA+  AV  HG+L
Sbjct  34   RLFSKHGARVIIGDIRDD-LGKSVCKDLGPETASFVHCDVSSESDIKNAIATAVDKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I       ILD D  DF  V  VN  G FLGTKHA R M P QRGSIIN  S
Sbjct  93   DIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTGVFLGTKHATRAMIPSQRGSIINLGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKHA++GLT+  A +LGRYG+R+NC+
Sbjct  153  VCSSVGGVASHAYTSSKHAVLGLTRKVAAELGRYGVRINCL  193



>ref|XP_010059374.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=321

 Score =   175 bits (443),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F  HGAKV+IAD  +D    S+C  LG   A FVHC+VT E+  + AV +AVST G+L
Sbjct  78   RVFAHHGAKVVIADV-NDSLGHSVCDSLGRDTASFVHCNVTDESQTKAAVAEAVSTFGKL  136

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     I+D D  DF  V  VN  G FLG KHAA+ M P +RG IINTAS
Sbjct  137  DIMFNNAGIGGLNKTRIIDNDKADFERVLAVNVTGVFLGVKHAAQAMIPARRGCIINTAS  196

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAYTC+KHA++GLT+N A++LG++GIRVNC+
Sbjct  197  ISSGLGGAASHAYTCAKHAVLGLTRNAAVELGQFGIRVNCL  237


 Score = 70.1 bits (170),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY   T +   + G+   +    +   +NLKGV L AEDVA A L+LA DE++YVSGHN
Sbjct  238  SPYACVTPLATEFVGVGPAELEAAMGALANLKGVTLKAEDVANAALFLAGDEARYVSGHN  297

Query  813  LVVDAGFSISN  845
            L +D GFS+ N
Sbjct  298  LFIDGGFSVVN  308



>emb|CBI18081.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   174 bits (442),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D    ++   L P +  FVHCDV+ E D++N +N  VS +GRL
Sbjct  50   RLFARHGAKVVIADV-EDTLGAALASSLAP-SVTFVHCDVSLEEDIENVINSTVSRYGRL  107

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG KHAARVM P   G II+T
Sbjct  108  DILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGIKHAARVMVPRGMGCIIST  167

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  168  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  210


 Score = 69.7 bits (169),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 10/72 (14%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ + T M+R      E +K++ +    +NLKG  L A+D+AEA LYLASDESKYVSGH
Sbjct  211  SPFGVATSMLR------EVEKMEEFVSGLANLKGHILRAKDIAEAALYLASDESKYVSGH  264

Query  810  NLVVDAGFSISN  845
            NLVVD G + S 
Sbjct  265  NLVVDGGITTSR  276



>ref|XP_010917565.1| PREDICTED: momilactone A synthase-like isoform X1 [Elaeis guineensis]
Length=272

 Score =   176 bits (446),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGA+V+IAD +DD + +++C+ LG   A +VHCDVT E+ V++AV+ AVS HG+L
Sbjct  34   KLFTRHGARVMIADIQDD-KGRALCESLGSAVASYVHCDVTDESHVRDAVDAAVSRHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIAG+  + I + +  DF  V  +N +G++LGTKHAARVM P +RGSI+ T S
Sbjct  93   DIMFNNAGIAGSLCMQIRESEKADFERVMGINLVGSYLGTKHAARVMIPARRGSIVMTGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+    G    AYTCSK A+VGL ++ A++LG++G+RVNCV
Sbjct  153  VASAAPGIGSAAYTCSKPAVVGLMRSAAVELGQFGVRVNCV  193


 Score = 68.2 bits (165),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +  T FG+  ++    +  ++ LKGV L  EDVAEAVL+L S+E++YVSG N
Sbjct  194  SPYGVATPLATTSFGIGVEEVEEFMHKHAILKGVRLKVEDVAEAVLFLGSEEARYVSGVN  253

Query  813  LVVDAGFSISN  845
            L+VD GF+ +N
Sbjct  254  LLVDGGFTTTN  264



>ref|XP_010040330.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=253

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+I D RDD   +S+CKDLGP  A FVHCDV+SE+D++NA+  AV  HG+L
Sbjct  34   RLFSKHGARVIIGDIRDD-LGKSVCKDLGPETASFVHCDVSSESDIKNAIATAVDKHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I       ILD D  DF  V  VN  G FLGTKHA R M P QRGSIIN  S
Sbjct  93   DIMVNNAAIGDPSKASILDNDKADFEKVVSVNLTGVFLGTKHATRAMIPSQRGSIINLGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKHA++GLT+  A +LGRYG+R+NC+
Sbjct  153  VCSSVGGVASHAYTSSKHAVLGLTRKVAAELGRYGVRINCL  193



>ref|XP_010104811.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01952.1| Momilactone A synthase [Morus notabilis]
Length=272

 Score =   166 bits (420),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAK++IAD +D     S+C+ +   N  +VHCDVT E  V+NAV+KAV  +G+L
Sbjct  34   KVFAHHGAKLIIADIQDA-LGHSLCQSIDETNCKYVHCDVTDETHVKNAVDKAVKAYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DI+ NNAG +    L IL     DF  V  VN  G FLG KHA+RVM P + GSII+TAS
Sbjct  93   DIIFNNAGTSDKSYLRILKDQKNDFERVMSVNATGVFLGIKHASRVMIPARSGSIISTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT SKHA++GLTK+ A++LG+YGIRVNC+
Sbjct  153  VCSYIGGAASHAYTASKHAVLGLTKSAAVELGQYGIRVNCL  193


 Score = 77.0 bits (188),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYS---NLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T ++  + G  + D  +++S   NLK V L AEDVA A LYLASDE++Y+SGHN
Sbjct  194  SPYGVATPLVEKFLGRKKGDIENLFSSAANLKNVTLEAEDVANAALYLASDEARYISGHN  253

Query  813  LVVDAGFSISNLALN  857
            L VD G+SI+N + N
Sbjct  254  LFVDGGYSIANPSFN  268



>ref|XP_006481517.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 123/166 (74%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-----FVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+CKD+G  ++      +VHCDVT E +++NAVN AVS
Sbjct  34   RLFSRHGAKVLIADIKDD-LGESVCKDIGSSSSSANGCSYVHCDVTKEKEIENAVNTAVS  92

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAGI      +ILD D  +F  V  VN +G FLGTKHAARVMKP  RGSI
Sbjct  93   QYGKLDIMFNNAGIVDEAKHNILDNDQAEFELVLSVNLVGVFLGTKHAARVMKPAGRGSI  152

Query  508  INTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV GV+GG   HAYT SKH +VGL KN A++LGR+GIRVNCV
Sbjct  153  ISTASVCGVIGGVASHAYTSSKHGVVGLMKNAAVELGRFGIRVNCV  198


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T + + ++ L +D    +YSNL G  L  EDVAEA LYL SDE
Sbjct  188  LGRFGIRVNCVSPYVVATPLAKDFYKLDDDGLSAIYSNLSGAVLKPEDVAEAALYLGSDE  247

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            SK VSGHNLVVD GF+I N  L
Sbjct  248  SKCVSGHNLVVDGGFTIVNEGL  269



>ref|XP_002530171.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF32226.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   166 bits (421),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAKV++AD +D+    S+C++LGP      ++HCDVT ++DVQNAV+ AVS +G
Sbjct  34   RLFVKHGAKVVVADVQDE-LGHSLCRELGPDQEIISYIHCDVTCDSDVQNAVDFAVSKYG  92

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            +LDIM +NAG+AG     I+D +  DF  VF +N  GAFL  KHAARVM P ++G I+ T
Sbjct  93   KLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAFLAAKHAARVMIPAKKGCILFT  152

Query  517  ASVSGVMGGFQ--HAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
             S   V   FQ  H Y  SKHAI+GL+KN +++LG++GIRVNCV P +
Sbjct  153  CSYLSV-SCFQAIHPYVASKHAILGLSKNLSVELGQHGIRVNCVSPFV  199


 Score = 75.9 bits (185),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK------LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVS  803
            SP+++ T M+R   G+ E +K      +   +NLK V L AED+AEA LYL SDESKYVS
Sbjct  196  SPFVVITPMMRKAMGVMEAEKEKLQEVVSASANLKNVTLEAEDIAEAALYLVSDESKYVS  255

Query  804  GHNLVVDAGFSISNLAL  854
            G NLVVD G++++N A 
Sbjct  256  GMNLVVDGGYTLTNPAF  272



>gb|AFK35915.1| unknown [Medicago truncatula]
Length=272

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 124/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +DD +  SICK+L   ++ +V CDVT E D++NAVN  V  +G+L
Sbjct  34   RLFSEHGAQVVIADIQDD-KGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+G     IL+   ++F +V +VN  G FLGTKHA+RVM P +RGSIINTAS
Sbjct  93   DIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHASRVMIPARRGSIINTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
            V G +GG   HAYT +KHA+VGL +NTA++LGR+GIRVNCV P I
Sbjct  153  VCGSIGGVAPHAYTSAKHAVVGLMRNTAIELGRFGIRVNCVSPYI  197


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDV-YSNLKGVDLMAEDVAEAVLYLASD  785
            LG         SPYI+ T +++ YF L +DD +   YSNLKG +L+ +DVAEA LYL SD
Sbjct  183  LGRFGIRVNCVSPYIVATPLVKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLGSD  242

Query  786  ESKYVSGHNLVVDAGFSISN  845
            ESKYVSGHNLV+D GF++ N
Sbjct  243  ESKYVSGHNLVIDGGFTVVN  262



>ref|XP_006854740.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
 gb|ERN16207.1| hypothetical protein AMTR_s00030p00244570 [Amborella trichopoda]
Length=276

 Score =   162 bits (411),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 111/162 (69%), Gaps = 5/162 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVST-HGR  339
            +LF QHGA+V+IAD +DD   QS    +   NA + HCDVT+E D+  A++ A +   G+
Sbjct  39   RLFSQHGARVIIADIQDD-LGQSTASSIP--NATYTHCDVTNEEDICQAIDLATTLGDGK  95

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI       IL+   +DF  V  VN +GAFLGTKHAARVM P Q G I+ TA
Sbjct  96   LDIMFNNAGIVDPPKPSILEYSLSDFDRVLGVNLVGAFLGTKHAARVMIPAQSGCILYTA  155

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SVS V+GG   HAY C+KHA+ GLTKN A++LG +GIRVNC+
Sbjct  156  SVSSVIGGAATHAYACTKHALAGLTKNAAVELGEFGIRVNCI  197


 Score = 80.1 bits (196),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T + + + GL +D +L+     ++NLKGV L +EDVA A LYLAS++ +YVSGH
Sbjct  198  SPYCLATPLAKKFVGLEQDKELEEVMGAHANLKGVVLKSEDVARAALYLASEDGRYVSGH  257

Query  810  NLVVDAGFSISNLALN  857
            NLVVD GF+I N +  
Sbjct  258  NLVVDGGFTIVNTSFQ  273



>ref|XP_006359043.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum tuberosum]
Length=280

 Score =   170 bits (430),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV I D +D+   Q +C+ LG   +A F+HCDVTSE DV NAV+ AV   G 
Sbjct  36   RLFHKHGAKVCIVDIQDE-LGQRVCESLGDEESACFIHCDVTSETDVSNAVDFAVEKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG+ GA   +ILD D + F NV  VN  G FLG KHAAR+M P +RGSI++ +
Sbjct  95   LDIMVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMIPRKRGSIVSLS  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+G +GG   HAYT SK A++GLT+N A ++G++GIRVNCV
Sbjct  155  SVAGSIGGLGPHAYTASKFAVLGLTQNVAAEMGKHGIRVNCV  196


 Score = 72.4 bits (176),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAE--DDKL-------DVYSNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY + T++  ++    +  DD +         ++NLKGVDLMA+DVA AVL+LASDE++
Sbjct  197  SPYAVATELGLSHLPPEQRNDDAIADFNSYFGKFANLKGVDLMAQDVANAVLFLASDEAR  256

Query  795  YVSGHNLVVDAGFSISNLAL  854
            Y+SGHNL VD GFS  N +L
Sbjct  257  YISGHNLKVDGGFSSVNHSL  276



>gb|KEH29815.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 124/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +DD +  SICK+L   ++ +V CDVT E D++NAVN  V  +G+L
Sbjct  28   RLFSEHGAQVVIADIQDD-KGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+G     IL+   ++F +V +VN  G FLGTKHA+RVM P +RGSIINTAS
Sbjct  87   DIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHASRVMIPARRGSIINTAS  146

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
            V G +GG   HAYT +KHA+VGL +NTA++LGR+GIRVNCV P I
Sbjct  147  VCGSIGGVAPHAYTSAKHAVVGLMRNTAIELGRFGIRVNCVSPYI  191


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDV-YSNLKGVDLMAEDVAEAVLYLASD  785
            LG         SPYI+ T +++ YF L +DD +   YSNLKG +L+ +DVAEA LYL SD
Sbjct  177  LGRFGIRVNCVSPYIVATPLVKKYFKLDDDDDVLDVYSNLKGANLVPKDVAEAALYLGSD  236

Query  786  ESKYVSGHNLVVDAGFSISN  845
            ESKYVSGHNLV+D GF++ N
Sbjct  237  ESKYVSGHNLVIDGGFTVVN  256



>ref|XP_004169912.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
Length=274

 Score =   164 bits (415),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K F  HGAKV+IAD  DD    S+   L   +  FVHC+VT E DV+N VN AVS +G+L
Sbjct  33   KHFFNHGAKVVIADILDD-LGNSLSNHLSSSSTSFVHCNVTKETDVENVVNTAVSKYGKL  91

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL+ + +DF NV  VN +GAFLGTKHAA+ M P  +GSII TAS
Sbjct  92   DIMFNNAGIPGALKFNILENEYSDFQNVLNVNLVGAFLGTKHAAKAMIPAGQGSIIITAS  151

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   +AYT SKH ++GL +N  +DLGRYGI+VNCV
Sbjct  152  VCSSIGGIGPYAYTSSKHGLLGLMRNATIDLGRYGIKVNCV  192


 Score = 77.8 bits (190),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYS-NLKGVDLM-AEDVAEAVLYLASDESKYVSGHN  812
            SP+++PTQM R +F L + D+  DVYS N K  D++  EDVAE  LYLASD S++VSGHN
Sbjct  193  SPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLYLASDASRFVSGHN  252

Query  813  LVVDAGFSISNLAL  854
             V+D GF+  N  L
Sbjct  253  FVLDGGFTAGNQGL  266



>ref|XP_007043243.1| Short chain alcohol dehydrogenase [Theobroma cacao]
 gb|EOX99074.1| Short chain alcohol dehydrogenase [Theobroma cacao]
Length=271

 Score =   159 bits (403),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LFC+HGAKV+I D +D+   QS+CKD+G   A FV CD+  E+DV+ AVN A+S HG+L
Sbjct  34   RLFCEHGAKVIITDIQDE-LGQSVCKDIGLAVASFVLCDIVKESDVEIAVNTAISLHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRG-SIINTA  519
            DIMVNNA +       I++ +  DF  V  +N  G FLGTKHAARVM P ++G  I   +
Sbjct  93   DIMVNNAAVIDDAKPSIVENNVADFERVISINLTGVFLGTKHAARVMIPARKGSIISLGS  152

Query  520  SVSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
              S V G   HAYT SKH ++GLTKN A +LGR+GIRVNC+
Sbjct  153  VSSSVGGVASHAYTSSKHGVIGLTKNAAAELGRFGIRVNCL  193


 Score = 81.6 bits (200),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            S Y I T +   +F L  ++   VYSNLKGV L  EDVAEA LYL SDESKYVSGHNL V
Sbjct  194  SSYFIATPLTTNFFKLDRNESDRVYSNLKGVFLQKEDVAEAALYLGSDESKYVSGHNLAV  253

Query  822  DAGFSISNLAL  854
            D GF+  N A 
Sbjct  254  DGGFTTINPAF  264



>gb|KDP36152.1| hypothetical protein JCGZ_08796 [Jatropha curcas]
Length=274

 Score =   171 bits (432),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF + GAKVLIAD +DD    SIC++        ++HC+VTS++DV+NAV+ AVS +G+
Sbjct  30   RLFVEQGAKVLIADVQDD-LGHSICQEFNNQEIISYIHCNVTSDSDVKNAVDTAVSRYGK  88

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAG++G+ G +IL  D  +F  VF VN  G FLG KHAARVM P ++G I+ TA
Sbjct  89   LDIMFNNAGVSGSPGANILGSDNEEFKKVFDVNVFGPFLGAKHAARVMIPEKKGCILFTA  148

Query  520  S-VSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S VS  +G   HAY  SKHA+VGL KN +++LG+YGIRVN +
Sbjct  149  SAVSVCLGESSHAYAASKHAVVGLAKNLSVELGKYGIRVNAI  190


 Score = 70.1 bits (170),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL----AEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ + T M+++  G+    A ++ +    NLK V L  ED+A A LYLASDESKYVSG 
Sbjct  191  SPFTVVTPMMKSLLGISDKRAAEEFISSIGNLKTVLLEPEDIANAALYLASDESKYVSGL  250

Query  810  NLVVDAGFSISN  845
            NLVVD GFS++N
Sbjct  251  NLVVDGGFSLTN  262



>ref|XP_003540812.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=269

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    SICK L   +A +VHCDVT+E DV+N VN  VS HG+L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSICKHLE--SASYVHCDVTNETDVENCVNTTVSKHGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     ILD   ++F  V  VN +G FLGTKHAARVM P +RGSI+NTAS
Sbjct  91   DIMFNNAGITGVNKTSILDNTKSEFEEVINVNLVGVFLGTKHAARVMIPARRGSIVNTAS  150

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKHA+VGLTKNTA++LG +G+RVNCV
Sbjct  151  VCGSIGGVASHAYTSSKHAVVGLTKNTAVELGAFGVRVNCV  191


 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LGA        SPY++ T + + +F L +D    +YSNLKG DL+  DVAEA LYLASD
Sbjct  180  ELGAFGVRVNCVSPYVVATPLAKNFFKLDDDGVQGIYSNLKGTDLVPNDVAEAALYLASD  239

Query  786  ESKYVSGHNLVVDAGFSISN  845
            ESKYVSGHNLVVD GF++ N
Sbjct  240  ESKYVSGHNLVVDGGFTVVN  259



>gb|KEH29814.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=265

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V+IAD +DD +  SICK+L   ++ +V CDVT E D++NAVN  V  +G+L
Sbjct  28   RLFSEHGAQVVIADIQDD-KGHSICKELQKSSSSYVRCDVTKEEDIENAVNTTVFKYGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+G     IL+   ++F +V +VN  G FLGTKHAARVM P +RGSIINTAS
Sbjct  87   DIMFNNAGISGVNKTKILENKLSEFEDVIKVNLTGVFLGTKHAARVMIPARRGSIINTAS  146

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKHA+VGL +NTA++LG +GIRVNCV
Sbjct  147  VGGSIGGCAPHAYTSSKHAVVGLMRNTAIELGPFGIRVNCV  187


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY + T M+  +F L +   LD++SNLKG +L+ +DVAEA LYL SDE
Sbjct  177  LGPFGIRVNCVSPYFLATPMVTNFFKLDDGGALDIFSNLKGTNLVPKDVAEAALYLGSDE  236

Query  789  SKYVSGHNLVVDAGFSISN  845
            SKYVSG NLV+D G S++N
Sbjct  237  SKYVSGLNLVIDGGVSVAN  255



>gb|KHN21175.1| Momilactone A synthase [Glycine soja]
Length=304

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    SICK L   +A +VHCDVT+E DV+N VN  VS HG+L
Sbjct  30   RLFSKHGAHVVIADIQDD-LGLSICKHLE--SASYVHCDVTNETDVENCVNTTVSKHGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G     ILD   ++F  V  VN +G FLGTKHAARVM P +RGSI+NTAS
Sbjct  87   DIMFNNAGITGVNKTSILDNTKSEFEEVINVNLVGVFLGTKHAARVMIPARRGSIVNTAS  146

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKHA+VGLTKNTA++LG +G+RVNCV
Sbjct  147  VCGSIGGVASHAYTSSKHAVVGLTKNTAVELGAFGVRVNCV  187


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LGA        SPY++ T + + +F L +D    +YSNLKG DL+  DVAEA LYLASD
Sbjct  176  ELGAFGVRVNCVSPYVVATPLAKNFFKLDDDGVQGIYSNLKGTDLVPNDVAEAALYLASD  235

Query  786  ESKYVSGHNLVVDAGFSISNL  848
            ESKYVSGHNLVVD GF++ N+
Sbjct  236  ESKYVSGHNLVVDGGFTVVNM  256



>ref|XP_004137687.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 ref|XP_004156632.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN58711.1| hypothetical protein Csa_3G730750 [Cucumis sativus]
Length=308

 Score =   175 bits (443),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 114/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D   Q++   L P    FVHCDV+SE DV+N V+  V  HG++
Sbjct  53   RLFAKHGAKVVIADV-EDILGQALANTLSPSPVSFVHCDVSSEDDVENLVSTTVCLHGQV  111

Query  343  DIMVNNAGIAGAKG---LDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            DI+ NNAG+ G +      ILD D  +F  V RVN  G  LG KHAARVM P   G II+
Sbjct  112  DIIFNNAGVLGNQSNSHKSILDFDPDEFERVMRVNVKGVALGIKHAARVMIPRATGCIIS  171

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            TASV+GV+GG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  172  TASVAGVLGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  215


 Score = 64.7 bits (156),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 12/72 (17%)
 Frame = +3

Query  639  CSPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            C  Y +P+         AE DK++ +    +NLKG  L  +D+A+A LYLASDESKY+SG
Sbjct  239  CMNYGVPSA--------AEVDKMEEFVRGLANLKGPTLKPKDIAQAALYLASDESKYISG  290

Query  807  HNLVVDAGFSIS  842
            HNLVVD G + S
Sbjct  291  HNLVVDGGVTTS  302



>ref|XP_009605455.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Nicotiana tomentosiformis]
Length=250

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF  HGAKV+IAD +D+  +Q +CKDL P +  FVHCD+T E D++NA N AV  +G+L
Sbjct  16   RLFSIHGAKVVIADIQDE-LAQKVCKDLDPTSTTFVHCDITKEEDLENAANTAVDKYGKL  74

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +IL+ +  +F  V  VN +G FLGTK AARVM P  RGSII TAS
Sbjct  75   DIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVMIPNGRGSIITTAS  134

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++  +GG   HAYTCSKH ++GLT+N A+DLGR+GIRVNCV
Sbjct  135  ITATIGGSGSHAYTCSKHGVLGLTRNAAVDLGRFGIRVNCV  175


 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T +   Y  +      DVYS L G  L  +DVAE  L+LASDE
Sbjct  165  LGRFGIRVNCVSPYLVLTPLALDYLKMNGKKASDVYSTLNGATLTPKDVAETALFLASDE  224

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            SKYVSG N +VD GF+  N  L+
Sbjct  225  SKYVSGQNFIVDGGFTAENPGLS  247



>ref|XP_009605454.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Nicotiana tomentosiformis]
Length=263

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF  HGAKV+IAD +D+  +Q +CKDL P +  FVHCD+T E D++NA N AV  +G+L
Sbjct  29   RLFSIHGAKVVIADIQDE-LAQKVCKDLDPTSTTFVHCDITKEEDLENAANTAVDKYGKL  87

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +IL+ +  +F  V  VN +G FLGTK AARVM P  RGSII TAS
Sbjct  88   DIMYNNAGIVGIIKSNILEDEKYEFEKVTSVNLVGTFLGTKQAARVMIPNGRGSIITTAS  147

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++  +GG   HAYTCSKH ++GLT+N A+DLGR+GIRVNCV
Sbjct  148  ITATIGGSGSHAYTCSKHGVLGLTRNAAVDLGRFGIRVNCV  188


 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T +   Y  +      DVYS L G  L  +DVAE  L+LASDE
Sbjct  178  LGRFGIRVNCVSPYLVLTPLALDYLKMNGKKASDVYSTLNGATLTPKDVAETALFLASDE  237

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            SKYVSG N +VD GF+  N  L+
Sbjct  238  SKYVSGQNFIVDGGFTAENPGLS  260



>ref|XP_010039348.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
 gb|KCW88250.1| hypothetical protein EUGRSUZ_A00637 [Eucalyptus grandis]
Length=304

 Score =   173 bits (439),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 116/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D    ++   L P +  +VHCDV+SE DV+N V   VS +GRL
Sbjct  50   RLFARHGAKVVIADI-EDLLGTALANSLSP-SVTYVHCDVSSEEDVENLVTSTVSRYGRL  107

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            D+M NNAG+ G  +K   I+D D  +F +V  +N  G+ LG KHAARVM P + G II+T
Sbjct  108  DVMFNNAGLLGNQSKRKSIMDFDVGEFESVMSINVKGSALGIKHAARVMAPRRSGCIIST  167

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKN A +LGRYGIRVNC+
Sbjct  168  ASVAGVMGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVNCI  210


 Score = 66.2 bits (160),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 21/89 (24%)
 Frame = +3

Query  642  SPYIIPTQMI----RTYFGLAEDD-------------KLDVY----SNLKGVDLMAEDVA  758
            SP+ + T M+    R+  G  ED+             K++ +    +NLKG  L A+D+A
Sbjct  211  SPFGVATSMLINAWRSSDGEEEDEGMSFGVPSEGEVEKMEEFVRGLANLKGATLRAKDIA  270

Query  759  EAVLYLASDESKYVSGHNLVVDAGFSISN  845
            EA LYLASDESKYVSGHNLVVD G + S 
Sbjct  271  EAALYLASDESKYVSGHNLVVDGGVTTSR  299



>gb|AFV30207.1| borneol dehydrogenase [Lavandula x intermedia]
Length=259

 Score =   159 bits (403),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+  + +ICKDLG   + FVHCDVT E DV+ AVN AVST+G+L
Sbjct  29   RLFSRHGAKVVIADIQDE-LALNICKDLG---STFVHCDVTKEFDVETAVNTAVSTYGKL  84

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRG-SIINTA  519
            DIM+NNAGI+GA    I +   +DF  V  VN +G FLGTKHAARVM P + G  I   +
Sbjct  85   DIMLNNAGISGAPKYKISNTQLSDFKRVVDVNLVGVFLGTKHAARVMIPNRSGSIISTAS  144

Query  520  SVSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            + +    G  + Y CSKH +VGLT+N A+++G +GIRVNCV
Sbjct  145  AATAAAAGTPYPYICSKHGVVGLTRNAAVEMGGHGIRVNCV  185


 Score = 79.7 bits (195),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 49/73 (67%), Gaps = 7/73 (10%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLV  818
            SPY + T M R      +DD +   +SNLKG  L AEDVAEA LYLASDESKYVSGHNL+
Sbjct  186  SPYYVATPMTR------DDDWIQGCFSNLKGAVLTAEDVAEAALYLASDESKYVSGHNLL  239

Query  819  VDAGFSISNLALN  857
            VD G SI N   N
Sbjct  240  VDGGVSIMNQGCN  252



>sp|F1SWA0.1|ZERSY_ZINZE RecName: Full=Zerumbone synthase [Zingiber zerumbet]
 dbj|BAK09296.1| short-chain dehydrogenase/reductase1 [Zingiber zerumbet]
Length=267

 Score =   160 bits (405),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAK+ I D +D+   Q   +  G  +A + HCDVT E DV+ AV+     +G +
Sbjct  23   RLFIEHGAKICIVDVQDELGQQVSQRLGGDPHACYFHCDVTVEDDVRRAVDFTAEKYGTI  82

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNAGI G K +DI D D  +F  VF +N  G FLG KHAAR+M P  +GSI++ AS
Sbjct  83   DIMVNNAGITGDKVIDIRDADFNEFKKVFDINVNGVFLGMKHAARIMIPKMKGSIVSLAS  142

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS V+ G   H YT +KHA+VGLTK+ A +LGR+GIRVNCV
Sbjct  143  VSSVIAGAGPHGYTGAKHAVVGLTKSVAAELGRHGIRVNCV  183


 Score = 79.0 bits (193),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAE--DDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT++   Y   +E  +D L  +       +NLKGVDLM  DVAEAVLYLA++ESK
Sbjct  184  SPYAVPTRLSMPYLPESEMQEDALRGFLTFVRSNANLKGVDLMPNDVAEAVLYLATEESK  243

Query  795  YVSGHNLVVDAGFSISNLALN  857
            YVSG NLV+D GFSI+N  L 
Sbjct  244  YVSGLNLVIDGGFSIANHTLQ  264



>ref|XP_006383023.1| hypothetical protein POPTR_0005s10820g, partial [Populus trichocarpa]
 gb|ERP60820.1| hypothetical protein POPTR_0005s10820g, partial [Populus trichocarpa]
Length=189

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CK+L P  A F+HCDVT E DV+NAVN AVS +G+L
Sbjct  34   RLFVKHGAKVVIADIQDE-LGHSVCKELEPEPASFIHCDVTQEKDVENAVNTAVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG  G    +IL+ D  +F  +   N +GAFLGTKHAARVM P +RGSII TAS
Sbjct  93   DIMFNNAGTGGTPKTNILENDKAEFEKIICANLVGAFLGTKHAARVMIPARRGSIITTAS  152

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIR  630
            V  ++ GG  HAYT SKH ++GL +NTA++LG+YGIR
Sbjct  153  VCAIIGGGSSHAYTSSKHGVLGLMRNTAVELGQYGIR  189



>ref|XP_002526911.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35464.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   164 bits (414),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 7/168 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAKV++AD +D+    S+CK+LG       ++HCDVT ++DVQNAV+ AVS +G
Sbjct  34   RLFVKHGAKVVVADVQDE-LGYSLCKELGSDQEIISYIHCDVTCDSDVQNAVDFAVSKYG  92

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            +LDIM +NAG+AG     I+D +  DF  VF +N  GAFL  KHAARVM P ++G I+ T
Sbjct  93   KLDIMFSNAGVAGNVYPSIVDTENEDFKRVFDINVFGAFLAAKHAARVMIPAKKGCILFT  152

Query  517  ASVSGVMGGFQ--HAYTCSKHAIVGLTKNTALDLGRYGIRVNCV-PLI  651
             S   V   FQ  H Y  SKHAI+GL+KN +++LG++GIRVNCV P +
Sbjct  153  CSYLSV-SCFQAIHPYVASKHAILGLSKNLSVELGQHGIRVNCVSPFV  199


 Score = 75.1 bits (183),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK------LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVS  803
            SP+++ T M+R   G+ E +K      +   +NLK V L AED+AEA LYL SDESKYVS
Sbjct  196  SPFVVITPMMRKAMGVMEAEKEKLQEVVSASANLKNVMLEAEDIAEAALYLVSDESKYVS  255

Query  804  GHNLVVDAGFSISNLAL  854
            G NLVVD G++++N A 
Sbjct  256  GMNLVVDGGYTLTNPAF  272



>ref|XP_008243484.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Prunus mume]
Length=276

 Score =   163 bits (412),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F QHGAK++IAD +DD    S+ + +GP +  FVHCDVT EA ++NAV+KAV+T+G+L
Sbjct  34   KIFAQHGAKIVIADVQDD-LGHSVRESIGPTDCTFVHCDVTDEAQIKNAVHKAVATYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  VN  G FLG KHAA+ M P + GSII+TAS
Sbjct  93   DIMFNNAGIVDDNKARIIDNEKADFERVLSVNVTGVFLGIKHAAQAMIPARAGSIISTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+
Sbjct  153  ISSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCL  193


 Score = 75.9 bits (185),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 5/76 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T + R + GL ED++++      +NLKGV L A DVA A LYLASDE++Y+SGH
Sbjct  194  SPYALVTPLARKFVGL-EDEEMENAMSALANLKGVTLKAVDVANAALYLASDEARYISGH  252

Query  810  NLVVDAGFSISNLALN  857
            NL++D  FSI N   N
Sbjct  253  NLLIDGAFSIVNPCFN  268



>ref|XP_009631422.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   167 bits (422),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV IAD +D    Q +C+ LG   + F+HCDVT+EAD+  AV+ AV   G L
Sbjct  36   RLFHKHGAKVCIADIQDK-LGQRVCESLGDDQSAFIHCDVTAEADISQAVDFAVQKFGTL  94

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DI+VNNAG+ G    DI D + + F NV  VN  G FLG KHAAR+M P+++GSI++ +S
Sbjct  95   DILVNNAGLTGTTYTDIRDYELSVFDNVIDVNVKGVFLGMKHAARIMIPLKKGSIVSLSS  154

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             +  +GG   HAYT SKHA+ GLTKN A +LG++GIRVNCV
Sbjct  155  AASAIGGLAPHAYTASKHAVSGLTKNVAAELGQHGIRVNCV  195


 Score = 71.6 bits (174),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 13/79 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +  ++  L ED + D            ++NL+GVDL+ EDVA AVL+LASDE
Sbjct  196  SPYAVATGLGLSH--LPEDQRDDDAIADFHAYFGKFANLQGVDLLVEDVANAVLFLASDE  253

Query  789  SKYVSGHNLVVDAGFSISN  845
            ++Y+SGHNL+VD GFS  N
Sbjct  254  ARYISGHNLMVDGGFSCVN  272



>ref|XP_010264499.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X3 [Nelumbo nucifera]
Length=280

 Score =   173 bits (438),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D+   ++   L P    ++HCDV+ E DV+N +N  VS HGRL
Sbjct  29   RLFARHGAKVVIADV-EDEIGIALSNSLAP-CVTYIHCDVSLEEDVENLINSTVSWHGRL  86

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+T
Sbjct  87   DILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIIST  146

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  147  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  189


 Score = 65.1 bits (157),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 18/86 (21%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD--------------KLDVY----SNLKGVDLMAEDVAEAV  767
            SP+ + T M+   +   +D+              K++ +    +NLKG  L A+D+AEA 
Sbjct  190  SPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAA  249

Query  768  LYLASDESKYVSGHNLVVDAGFSISN  845
            LYLASDESKYVSGHNLVVD G + S 
Sbjct  250  LYLASDESKYVSGHNLVVDGGVTTSR  275



>ref|XP_002265892.1| PREDICTED: short-chain dehydrogenase reductase 2a [Vitis vinifera]
Length=303

 Score =   174 bits (441),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D    ++   L P +  FVHCDV+ E D++N +N  VS +GRL
Sbjct  50   RLFARHGAKVVIADV-EDTLGAALASSLAP-SVTFVHCDVSLEEDIENVINSTVSRYGRL  107

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG KHAARVM P   G II+T
Sbjct  108  DILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGIKHAARVMVPRGMGCIIST  167

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  168  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  210


 Score = 63.9 bits (154),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 12/73 (16%)
 Frame = +3

Query  639  CSPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            C  + IP +         E +K++ +    +NLKG  L A+D+AEA LYLASDESKYVSG
Sbjct  234  CMNFGIPCER--------EVEKMEEFVSGLANLKGHILRAKDIAEAALYLASDESKYVSG  285

Query  807  HNLVVDAGFSISN  845
            HNLVVD G + S 
Sbjct  286  HNLVVDGGITTSR  298



>ref|XP_004139590.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN64963.1| hypothetical protein Csa_1G168890 [Cucumis sativus]
Length=274

 Score =   160 bits (405),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K F   GAKV+IAD  DD    S+   L   +  FVHC+VT E DV+N VN AVS +G+L
Sbjct  33   KHFFNPGAKVVIADILDD-LGNSLSNHLSSSSTSFVHCNVTKETDVENVVNTAVSKYGKL  91

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI GA   +IL+ + +DF NV  VN +GAFLGTKHAA+ M P  +GSI+ TAS
Sbjct  92   DIMFNNAGIPGALKFNILENEYSDFQNVLNVNLVGAFLGTKHAAKAMIPAGQGSIVITAS  151

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   +AYT SKH ++GL +N  +DLGRYGI+VNCV
Sbjct  152  VCSSIGGIGPYAYTSSKHGLLGLMRNATIDLGRYGIKVNCV  192


 Score = 77.8 bits (190),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYS-NLKGVDLM-AEDVAEAVLYLASDESKYVSGHN  812
            SP+++PTQM R +F L + D+  DVYS N K  D++  EDVAE  LYLASD S++VSGHN
Sbjct  193  SPHVVPTQMTREHFKLKDGDEFPDVYSHNFKCGDILRKEDVAEVGLYLASDASRFVSGHN  252

Query  813  LVVDAGFSISNLAL  854
             V+D GF+  N  L
Sbjct  253  FVLDGGFTAGNQGL  266



>ref|XP_007202842.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
 gb|EMJ04041.1| hypothetical protein PRUPE_ppa014608mg, partial [Prunus persica]
Length=263

 Score =   164 bits (415),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F QHGAK++IAD +DD    S+ + +GP +  FVHCDVT EA ++NAV+KAV+T+G+L
Sbjct  21   KIFAQHGAKIVIADVQDD-LGHSVRESMGPTDCTFVHCDVTDEAQIKNAVHKAVATYGKL  79

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  +  VN  G FLG KHAA+VM P + GSII+TAS
Sbjct  80   DIMFNNAGIVDDNKARIIDNEKADFERILSVNVTGVFLGIKHAAQVMIPARAGSIISTAS  139

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+
Sbjct  140  ISSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCL  180


 Score = 73.9 bits (180),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T + R + GL ED++++      +NLKGV L A DVA A LYLASDE++Y+SGH
Sbjct  181  SPYALVTPLARKFVGL-EDEEMENTMSALANLKGVTLKAVDVANAALYLASDEARYISGH  239

Query  810  NLVVDAGFSISN  845
            NL++D  FSI N
Sbjct  240  NLLIDGAFSIVN  251



>ref|XP_006651946.1| PREDICTED: zerumbone synthase-like [Oryza brachyantha]
Length=297

 Score =   166 bits (419),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q +   LG   +A F+HCDVT E +V  AV+      G 
Sbjct  52   RLFREHGAKVCIADIKDE-AGQKLWDSLGGDQHALFLHCDVTVEEEVSRAVDATAEKFGT  110

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDI+VNNAGI G K  DI + D  +F  V  +N +G F G KHAARVM P +RGSII+ A
Sbjct  111  LDIIVNNAGITGNKITDIRNVDFAEFRKVIDINLVGVFHGMKHAARVMIPNKRGSIISLA  170

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ VMGG   HAYT SKHA+VGLTKN A +LG++GIRVNCV
Sbjct  171  SVASVMGGLGPHAYTASKHAVVGLTKNVAAELGKHGIRVNCV  212


 Score = 72.4 bits (176),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY +PT +   Y  L ED++ D             +NLKGVDL+ +DVAEAVLYLASDE
Sbjct  213  SPYAVPTALSMPY--LPEDERKDDALKGFLAFVGGEANLKGVDLLPKDVAEAVLYLASDE  270

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            ++YVS  NL+VD GF+  NL L 
Sbjct  271  ARYVSALNLMVDGGFTSVNLNLR  293



>ref|XP_010264500.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X4 [Nelumbo nucifera]
Length=273

 Score =   172 bits (437),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D+   ++   L P    ++HCDV+ E DV+N +N  VS HGRL
Sbjct  22   RLFARHGAKVVIADV-EDEIGIALSNSLAP-CVTYIHCDVSLEEDVENLINSTVSWHGRL  79

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+T
Sbjct  80   DILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIIST  139

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  140  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  182


 Score = 65.1 bits (157),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 18/86 (21%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD--------------KLDVY----SNLKGVDLMAEDVAEAV  767
            SP+ + T M+   +   +D+              K++ +    +NLKG  L A+D+AEA 
Sbjct  183  SPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAA  242

Query  768  LYLASDESKYVSGHNLVVDAGFSISN  845
            LYLASDESKYVSGHNLVVD G + S 
Sbjct  243  LYLASDESKYVSGHNLVVDGGVTTSR  268



>gb|EMS67256.1| Xanthoxin dehydrogenase [Triticum urartu]
Length=317

 Score =   171 bits (433),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 129/184 (70%), Gaps = 3/184 (2%)
 Frame = +1

Query  97   HRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVH  273
            HRL+G+VA++TGG  GIG A  +LF QHGAKV IAD +D+   Q +C  LG   +  FVH
Sbjct  50   HRLEGKVALVTGGASGIGEAIVRLFRQHGAKVCIADVQDE-AGQQLCDSLGGDPDVLFVH  108

Query  274  CDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAF  453
            CDVT E D+  AV+ A    G LDIMVNNAGI G K  DI + D  D   VF +N  G  
Sbjct  109  CDVTVEEDISRAVDVAAEKFGTLDIMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGML  168

Query  454  LGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIR  630
            LG KHAARVM P ++GSI++ ASV+ V+GG   HAYT SKHA+VGLTK+ AL+LGR+GIR
Sbjct  169  LGMKHAARVMIPSKKGSIVSLASVASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIR  228

Query  631  VNCV  642
            VNCV
Sbjct  229  VNCV  232


 Score = 66.6 bits (161),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY---------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +    E     V          +NLKGVDL+ +DVAEAVLYLASDE +
Sbjct  233  SPYAVPTALSMPHLPQGEHKGDAVRDFLAFVGSEANLKGVDLLPKDVAEAVLYLASDEGR  292

Query  795  YVSGHNLVVDAGFSISN  845
            Y+S  NLVVD GF+  N
Sbjct  293  YISALNLVVDGGFTSVN  309



>ref|XP_010264497.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Nelumbo nucifera]
Length=291

 Score =   172 bits (436),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D+   ++   L P    ++HCDV+ E DV+N +N  VS HGRL
Sbjct  40   RLFARHGAKVVIADV-EDEIGIALSNSLAP-CVTYIHCDVSLEEDVENLINSTVSWHGRL  97

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V RVN  G  LG K+AARVM P   G II+T
Sbjct  98   DILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGMKYAARVMVPRGSGCIIST  157

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  158  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  200


 Score = 65.1 bits (157),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%), Gaps = 18/86 (21%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD--------------KLDVY----SNLKGVDLMAEDVAEAV  767
            SP+ + T M+   +   +D+              K++ +    +NLKG  L A+D+AEA 
Sbjct  201  SPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRAKDIAEAA  260

Query  768  LYLASDESKYVSGHNLVVDAGFSISN  845
            LYLASDESKYVSGHNLVVD G + S 
Sbjct  261  LYLASDESKYVSGHNLVVDGGVTTSR  286



>ref|XP_008392031.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Malus 
domestica]
Length=268

 Score =   161 bits (408),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F QHGAKV+IAD +DD    S+ + +GP +  FVHCDVT E+ +++AV+KAV+T+G+L
Sbjct  26   KIFVQHGAKVVIADVQDD-LGHSVRESIGPSDCTFVHCDVTDESQIKDAVHKAVATYGKL  84

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  +N  G FLG KHAA+ M P + GSII+TAS
Sbjct  85   DIMFNNAGIVDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIPARTGSIISTAS  144

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+
Sbjct  145  ISSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCL  185


 Score = 76.3 bits (186),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T + RT+ G+ +++  +V    +NLKGV L A DVA A LYLASDE++Y+SGHN
Sbjct  186  SPYALATPLARTFVGVDDEELENVMGSLANLKGVTLKAVDVANAALYLASDEARYISGHN  245

Query  813  LVVDAGFSISN  845
            L++D GFSI N
Sbjct  246  LLIDGGFSILN  256



>ref|XP_008360614.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Malus domestica]
Length=280

 Score =   160 bits (405),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F QHGAKV+IAD +DD    S+ + +GP +  FVHCDVT E  +++AV+KAV+T+G+L
Sbjct  38   KIFVQHGAKVVIADVQDD-LGHSVRESIGPSDCTFVHCDVTDEXQIKDAVHKAVATYGKL  96

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  +N  G FLG KHAA+ M P + GSII+TAS
Sbjct  97   DIMFNNAGIXDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIPARTGSIISTAS  156

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+
Sbjct  157  ISSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCL  197


 Score = 77.0 bits (188),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T + RT+ G+ +++  +V    +NLKGV L A DVA A LYLASDE++Y+SGHN
Sbjct  198  SPYALATPLARTFVGVXDEELENVMGSLANLKGVTLKAVDVANAALYLASDEARYISGHN  257

Query  813  LVVDAGFSISN  845
            L++D GFSI N
Sbjct  258  LLIDGGFSILN  268



>ref|XP_006354114.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=277

 Score =   165 bits (417),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPG-NAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKVLIAD +DD   QSI K++G   +  +VHCDV  E DV+N V+ A+S +G+
Sbjct  31   RLFTKHGAKVLIADVQDD-HGQSIIKEIGENRDVSYVHCDVKVEKDVKNVVDMAISKYGK  89

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAG+ G     IL  D  +F NVF VN  GA +  KHA RVM P ++GSII T+
Sbjct  90   LDIMFSNAGVPGQPDTTILKLDYENFKNVFDVNVFGALMCAKHATRVMIPPKKGSIIFTS  149

Query  520  SVSGV-MGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S++ V  G   H Y  SKHAIVGL KN  ++LG++GIRVNCV
Sbjct  150  SIASVTYGDVAHTYLASKHAIVGLAKNLGVELGQHGIRVNCV  191


 Score = 72.0 bits (175),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ + T M+    G+ + ++++ +    SNLKG  L  EDVA+A LYLASDESKY+SG 
Sbjct  192  SPFGVATPMLMNGLGIHDKEEVEEFVSQISNLKGTILEGEDVAQAALYLASDESKYISGM  251

Query  810  NLVVDAGFSISNLALN  857
            N+++D G+S +N+AL 
Sbjct  252  NILIDGGYSTTNVALK  267



>ref|XP_007026536.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY07038.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=304

 Score =   170 bits (431),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D    ++   L P +  FVHCDV  E D++N +N  +S +GRL
Sbjct  50   RLFARHGAKVVIADL-EDTLGAALANSLSP-SVTFVHCDVRLEEDIENLINSTISRYGRL  107

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G   K   I+D D  +F NV RVN  G  LG KHAAR M P   G II+T
Sbjct  108  DILFNNAGVLGNQKKHKSIVDFDVDEFDNVMRVNVRGMALGIKHAARAMIPRGGGCIIST  167

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  168  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  210


 Score = 66.6 bits (161),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 21/88 (24%)
 Frame = +3

Query  642  SPYIIPTQMI----RTY----------FGLA---EDDKLDVY----SNLKGVDLMAEDVA  758
            SP+ + T M+    R++          FG+    E +K++ +    +NLKG  L A+D+A
Sbjct  211  SPFGVATSMLVNAWRSHDDDEEEDSINFGIPCQQETEKMEEFVRGLANLKGPTLRAKDIA  270

Query  759  EAVLYLASDESKYVSGHNLVVDAGFSIS  842
            EA LYLASDESKYVSGHNLVVD G + S
Sbjct  271  EAALYLASDESKYVSGHNLVVDGGVTTS  298



>ref|XP_007027905.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08407.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=281

 Score =   176 bits (447),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 139/189 (74%), Gaps = 3/189 (2%)
 Frame = +1

Query  82   HNLLAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLG-PGN  258
             +L+A RL+G+VA+ITGG  GIG +TA+LF +HGAKVLIAD +D+    S+CK+LG P  
Sbjct  5    QSLVAKRLEGKVALITGGASGIGESTARLFVKHGAKVLIADIQDE-LGHSLCKELGTPDF  63

Query  259  AFFVHCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVN  438
              ++HCDVT E DVQNAV+ AVS +G+LDIM NNAGI G   +  +  D  +F  V  VN
Sbjct  64   ISYIHCDVTCETDVQNAVDLAVSEYGKLDIMFNNAGIPGDLEIRAITSDIENFKRVLDVN  123

Query  439  TLGAFLGTKHAARVMKPVQRGSIINTASVSGVMG-GFQHAYTCSKHAIVGLTKNTALDLG  615
              GAFLG KHAARVM P ++G I+ TASV+ ++  G  HAYT SKHA+VG+TK+ +++LG
Sbjct  124  VFGAFLGAKHAARVMIPAKKGCILFTASVASLVCLGISHAYTTSKHAVVGMTKSLSVELG  183

Query  616  RYGIRVNCV  642
             YGIRVNC+
Sbjct  184  EYGIRVNCI  192


 Score = 60.5 bits (145),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK----LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ + T +++   G+ +  K    L   + LKG  L  EDVA+A L+LASDE+KY+SG 
Sbjct  193  SPHAVVTPLLQKTLGILDKRKGEEILSTTAVLKGTILEPEDVAQAALFLASDEAKYLSGV  252

Query  810  NLVVDAGFSISN  845
            NL VD G+S++N
Sbjct  253  NLPVDGGYSLNN  264



>ref|XP_002533789.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28591.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=303

 Score =   171 bits (432),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 112/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D     +   L P    FVHCDV+ E D++N +N  VS +GRL
Sbjct  49   RLFAKHGAKVVIADV-EDTPGTILANSLSP-FVTFVHCDVSQEEDIENLINSTVSHYGRL  106

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G   K   IL+ D  +F  V RVN  G  LG KHAARVM P   G II+T
Sbjct  107  DILFNNAGLLGNQPKNKSILEFDVDEFDRVMRVNVKGVALGIKHAARVMIPRGVGCIIST  166

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  167  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  209


 Score = 65.5 bits (158),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +3

Query  681  FGLA---EDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FGL    E +K++ +    +NLKG  L  +D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  237  FGLPCEQEVEKMEEFVRGLANLKGTTLRGKDIAEAALYLASDESKYVSGHNLVVDGGITT  296

Query  840  S  842
            S
Sbjct  297  S  297



>ref|XP_009350131.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
 ref|XP_009350149.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Pyrus x bretschneideri]
Length=276

 Score =   160 bits (406),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F QHGAKV+IAD +DD    S+ + +GP +  FVHCDVT EA +++AV+K+V+T+G+L
Sbjct  34   KIFVQHGAKVVIADVQDD-LGHSVRESIGPSDCTFVHCDVTDEAQIKDAVHKSVATYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG+       I+D +  DF  V  +N  G FLG KHAA+ M P + GSII+TAS
Sbjct  93   DIMFNNAGVVDPNKARIIDNEKADFERVLSINVTGVFLGIKHAAQAMIPARTGSIISTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY CSKHA+ GLTKN A++LG++GIRVNC+
Sbjct  153  ISSYVGGAASHAYCCSKHAVNGLTKNAAVELGQFGIRVNCL  193


 Score = 75.9 bits (185),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T + R + G+ ED++L+      +NLKGV L A DVA A LYLASDE++Y+SGH
Sbjct  194  SPYALATPLARNFVGV-EDEELENVMGSLANLKGVTLKAVDVANAALYLASDEARYISGH  252

Query  810  NLVVDAGFSISN  845
            NL++D GFSI N
Sbjct  253  NLLIDGGFSILN  264



>ref|XP_006481516.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Citrus sinensis]
Length=276

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 123/166 (74%), Gaps = 7/166 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-----FVHCDVTSEADVQNAVNKAVS  327
            +LF +HGAKVLIAD +DD   +S+CKD+G  ++      +VHCDVT E D++NAVN AV+
Sbjct  34   RLFSKHGAKVLIADIKDD-LGESVCKDIGSSSSSASGCSYVHCDVTKEKDIENAVNTAVT  92

Query  328  THGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSI  507
             +G+LDIM NNAG       +ILD D  +F  +  +N +GAFLGTKHAARVMKP  RGSI
Sbjct  93   QYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSI  152

Query  508  INTASVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            I+TASV G++GG   HAY  SKH ++GL KNTA++LGR+GIRVNCV
Sbjct  153  ISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCV  198


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T + + +  LA+D    +YSNLKG  L  ED+AEA LYL SDE
Sbjct  188  LGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAALYLGSDE  247

Query  789  SKYVSGHNLVVDAGFSISN  845
            SK VSGHNLVVD GF+I N
Sbjct  248  SKCVSGHNLVVDGGFAIVN  266



>emb|CDP02837.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   165 bits (418),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F  HGAKV+  D  +++  +S+C DLG  NA F++CDVT E+D++NA+N+ V  HG+L
Sbjct  105  RVFVNHGAKVVCVDI-NEELGRSVCDDLGAENASFLYCDVTKESDIENAINRTVHEHGKL  163

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGIA      ILD D +DF  V R+N  G FLG KHAARVM P + G IIN  S
Sbjct  164  DIMINNAGIADEGKTSILDNDLSDFERVMRLNLSGVFLGIKHAARVMIPARSGGIINLGS  223

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +SG +GG   H+Y+ SKHA+VGLT+N A +LG++GIRVNC+
Sbjct  224  ISGSIGGITSHSYSSSKHAVVGLTRNAAAELGKHGIRVNCL  264


 Score = 70.9 bits (172),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVV  821
            S +++ T + + +F   E+ +  VY+NL+G+ L  ED+A A +YLAS+E++++SGHNL++
Sbjct  265  SSHVVLTPLSQNFFNFGEEGQSRVYTNLEGMVLKPEDLANAAVYLASEEARFMSGHNLML  324

Query  822  DAGFSISNLAL  854
            D GF+++N A 
Sbjct  325  DGGFTVTNPAF  335



>ref|XP_006338927.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=279

 Score =   169 bits (428),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV++AD +DD   Q++CK+LG  +   F HCDVT+E D++NA+++AVS +G+
Sbjct  34   RLFTKHGAKVVVADIQDD-LGQALCKELGSNDTISFTHCDVTNENDMENAIDRAVSRYGK  92

Query  340  LDIMVNNAGIAG-AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            LDIM +NAGI G  K   IL  D  +F NVF VN  GAFLG K AA+ M P ++GSI+ T
Sbjct  93   LDIMFSNAGITGNMKDPSILATDYNNFKNVFDVNVYGAFLGAKIAAKAMIPTKKGSILFT  152

Query  517  ASVSGVMGGFQHA--YTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +SV+ V+GG      Y  SKHA+VGLT + A++LG+YGIRVNC+
Sbjct  153  SSVASVIGGIGSPITYASSKHAVVGLTNHLAVELGKYGIRVNCI  196


 Score = 67.0 bits (162),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T ++R   G  + +K +      +NLKG  L  ED+AEA +YL SDESKYVSG 
Sbjct  197  SPYTVATPLVREILGKMDKEKAEEIIMETANLKGGILEPEDIAEAAVYLGSDESKYVSGV  256

Query  810  NLVVDAGFSISN  845
            NLV+D G+S +N
Sbjct  257  NLVIDGGYSKTN  268



>gb|KHG10215.1| hypothetical protein F383_13541 [Gossypium arboreum]
Length=272

 Score =   179 bits (455),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            ++F +HGA VL+AD +D+   QS+CK LG P    + HCDV SE+DVQNAV+ AVS +G+
Sbjct  32   RVFVEHGATVLVADIQDE-LGQSLCKQLGSPETVSYTHCDVKSESDVQNAVDTAVSRYGK  90

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGIAG     ++  +  +F  VF VN LG FLG KHAARVM P ++G I+ TA
Sbjct  91   LDIMFNNAGIAGEAEPRLIASNLHNFKRVFDVNVLGGFLGAKHAARVMIPAKKGCILFTA  150

Query  520  S-VSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S VS +  G  HAYT SKHA+VGLT+N A++LG YGIRVNC+
Sbjct  151  SIVSKICMGLSHAYTTSKHAVVGLTENLAVELGEYGIRVNCI  192


 Score = 56.6 bits (135),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK----LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY I T + +   G+++ +K    L     LKG  L   DVA+A L+LASD++KY++G 
Sbjct  193  SPYAIVTPLFQKTSGVSKKEKVEGILSAAGVLKGAILEPSDVAQAALFLASDDAKYLNGV  252

Query  810  NLVVDAGFSISN  845
            NL VD G+S++N
Sbjct  253  NLPVDGGYSLNN  264



>ref|XP_006429516.1| hypothetical protein CICLE_v10012298mg [Citrus clementina]
 ref|XP_006481135.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Citrus 
sinensis]
 gb|ESR42756.1| hypothetical protein CICLE_v10012298mg [Citrus clementina]
 gb|KDO63299.1| hypothetical protein CISIN_1g021960mg [Citrus sinensis]
Length=305

 Score =   171 bits (434),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D     +   L P    FVHCDV+ E D++N +N  VS +GRL
Sbjct  49   RLFARHGAKVVIADV-EDTLGSVLASTLAPAPVTFVHCDVSLEEDIENLINSTVSRYGRL  107

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G   K   I+D D  +F NV RVN  G  LG KHAARVM     G II+T
Sbjct  108  DILYNNAGVLGNQRKHKSIIDFDADEFDNVMRVNVKGMALGIKHAARVMINRGGGCIIST  167

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKN A +LGRYGIRVNC+
Sbjct  168  ASVAGVMGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVNCI  210


 Score = 64.7 bits (156),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 12/72 (17%)
 Frame = +3

Query  639  CSPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            C  + IP+Q         E  K++ +     NLKG  L ++D+AEA LYLASDES+YVSG
Sbjct  236  CMNFGIPSQ--------KEVRKMEEFVSGLGNLKGTTLRSKDIAEAALYLASDESRYVSG  287

Query  807  HNLVVDAGFSIS  842
            HNLVVD G + S
Sbjct  288  HNLVVDGGVTTS  299



>gb|KEH24184.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=195

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF QHGAKV+IAD +D+   QS+C +LGP N  +VHC+VT+E+D++N V+ AVS +G+L
Sbjct  28   KLFVQHGAKVIIADIQDE-VGQSLCNELGPKNILYVHCNVTTESDIKNVVDTAVSNYGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+  K  +IL+ D   F  VF VN  GAFLG KHAARVM P ++G I+ TAS
Sbjct  87   DIMFNNAGISDDKNREILNYDSEAFKRVFDVNVYGAFLGAKHAARVMIPNKKGVILFTAS  146

Query  523  VSGVMGGFQ-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+    G   HAY+ SKHA+VGL KN  ++LG+YGI+VNC+
Sbjct  147  VATETAGESTHAYSSSKHALVGLMKNLCVELGQYGIKVNCI  187



>ref|XP_008442351.1| PREDICTED: short-chain dehydrogenase reductase 2a [Cucumis melo]
Length=307

 Score =   170 bits (431),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D   Q++   L P    FVHCDV+SE DV+  V+  V  HG +
Sbjct  52   RLFAKHGAKVVIADV-EDILGQALADTLSPSPVSFVHCDVSSEDDVERLVSTTVCLHGHV  110

Query  343  DIMVNNAGIAGAKGLD---ILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            DI+ NNAG+ G++      ILD D  +F  V RVN  G  LG KHAARVM P   G II+
Sbjct  111  DIIFNNAGVLGSQSKSHKSILDFDPDEFERVMRVNVKGVALGIKHAARVMIPRATGCIIS  170

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            TASV+GV+GG   HAYT SKHAIVGLTKNTA +LGR+GIRVNC+
Sbjct  171  TASVAGVLGGLGPHAYTASKHAIVGLTKNTACELGRHGIRVNCI  214


 Score = 65.1 bits (157),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 12/73 (16%)
 Frame = +3

Query  639  CSPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            C  Y +P+         AE DK++ +    +NLKG  L  +D+A+A LYLASDESKY+SG
Sbjct  238  CMNYGVPSA--------AEVDKMEEFVRGLANLKGPTLRPKDIAQAALYLASDESKYISG  289

Query  807  HNLVVDAGFSISN  845
            HNLVVD G + S 
Sbjct  290  HNLVVDGGITTST  302



>ref|XP_006354216.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum tuberosum]
Length=271

 Score =   155 bits (393),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+IAD +DD   QSI +++G  +   ++HCDV  E DV+N V+  VS +G+
Sbjct  27   RLFIKHGAKVVIADIQDD-LGQSIIQEIGENDVISYMHCDVKVEKDVENVVDMTVSKYGK  85

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAGI+      I   D   F NVF VN  GA +  KHA+RVM P ++GSII T+
Sbjct  86   LDIMFSNAGISEELDSTISKIDYEIFKNVFDVNVFGALMCAKHASRVMIPAKKGSIIFTS  145

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S++ VM  G  H Y  SKHA+VGL KN  ++LG++GIRVNCV
Sbjct  146  SIASVMCAGASHTYLASKHAVVGLAKNLGVELGQHGIRVNCV  187


 Score = 79.7 bits (195),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 4/76 (5%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ +PT M++   G+ E +K++ +    +NLK   L  EDVA+A LYLASDESKY+SG 
Sbjct  188  SPFCVPTPMLKNGLGIDEKEKIEEFVCEIANLKETILDVEDVAQATLYLASDESKYISGM  247

Query  810  NLVVDAGFSISNLALN  857
            N+V+D GFS +N+AL 
Sbjct  248  NIVIDGGFSTTNVALK  263



>ref|XP_004981317.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=329

 Score =   164 bits (414),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAK+ IAD +D+   Q +   LG  +  FVHCDVT E +V  AV+      G L
Sbjct  85   RLFREHGAKICIADIQDE-AGQQLRDALGDQDVMFVHCDVTVEDEVSAAVDAVAQRFGSL  143

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            D+MVNNAGI G+K  DI + D  +   VF +N  G FLG KHAARVM P +RGSI++ AS
Sbjct  144  DVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFLGMKHAARVMIPQKRGSIVSLAS  203

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+ V+GG   HAYT SKHA+ GLTK+ A +LGR+G+RVNCV
Sbjct  204  VASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRVNCV  244


 Score = 71.6 bits (174),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 48/77 (62%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +   G   DD L  +       +NLKGVDLM  DVAEAVLYLASDE++
Sbjct  245  SPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDLMPRDVAEAVLYLASDEAR  304

Query  795  YVSGHNLVVDAGFSISN  845
            YVS  NL VD GF+  N
Sbjct  305  YVSALNLTVDGGFTAVN  321



>ref|XP_004981321.1| PREDICTED: zerumbone synthase-like [Setaria italica]
Length=282

 Score =   161 bits (408),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGN-AFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF  HGAKV IAD +D+   Q +   LG G+   FVHCDVT E DV  AV+      G 
Sbjct  37   RLFKNHGAKVCIADIQDE-AGQKLRDALGGGDDVMFVHCDVTVEEDVSAAVDAVAQRFGA  95

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LD+MVNNAGI G+K  DI + D  +   VF +N  G F+G KHAARVM P +RGSI++ A
Sbjct  96   LDVMVNNAGITGSKVTDIRNVDFAEVRKVFDINVHGVFMGMKHAARVMIPRKRGSIVSLA  155

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+GG   HAYT SKHA+ GLTK+ A +LGR+G+RVNCV
Sbjct  156  SVASVIGGMGPHAYTASKHAVAGLTKSVAGELGRHGVRVNCV  197


 Score = 73.6 bits (179),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +   G   DD +  +       +NLKGVDLM EDVAEAVLYLASDE+K
Sbjct  198  SPYAVPTALSMPHLPKGARADDAVKDFLAFAGGAANLKGVDLMPEDVAEAVLYLASDEAK  257

Query  795  YVSGHNLVVDAGFSISN  845
            YVS  NLVVD GF+  N
Sbjct  258  YVSALNLVVDGGFTSVN  274



>ref|NP_001275184.1| short-chain dehydrogenase/reductase [Solanum tuberosum]
 gb|AAT75153.1| short-chain dehydrogenase/reductase [Solanum tuberosum]
Length=275

 Score =   161 bits (408),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD RD+   Q +C+ LG   N  F+HCDVT EADV NAV+  V   G 
Sbjct  31   RLFHKHGAKVCIADIRDE-VGQHVCETLGNDQNVCFIHCDVTVEADVSNAVDFTVQKFGT  89

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI D + + F NV  VN  GAFLG KHAAR+M P+++G+I++  
Sbjct  90   LDIMVNNAGLSGPPIRDIRDYELSVFENVLDVNLKGAFLGMKHAARIMIPLKKGAIVSLC  149

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   H Y  SK+A++GLT+N A ++G++G+RVNCV
Sbjct  150  SVASAIGGIGPHGYAASKYAVLGLTQNVAAEMGKHGVRVNCV  191


 Score = 73.9 bits (180),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +   +  L ED+K D             +NL+GV+LMA DVA AVL+LASDE
Sbjct  192  SPYAVATGLALAH--LPEDEKTDDAMEGFRDFVARNANLQGVELMANDVANAVLFLASDE  249

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            S+Y+SGHNL+VD GFS  N +L
Sbjct  250  SRYISGHNLMVDGGFSCVNHSL  271



>ref|XP_011046902.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   178 bits (452),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF QHGAKVLIAD +DD    S C++ GP     +VHC+VT ++DVQNAV+ AVS +G+
Sbjct  34   RLFVQHGAKVLIADIQDD-LGHSFCQEFGPQETISYVHCNVTCDSDVQNAVDTAVSKYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI G +   IL CD  +F  V  VN  G FLG KHAARVM P ++G I+ T+
Sbjct  93   LDIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFLGAKHAARVMIPAKKGCILFTS  152

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+ G   HAYT SK+AIVGL KN +++LG+YGIRVN +
Sbjct  153  SVASVLYGELAHAYTASKNAIVGLAKNLSVELGQYGIRVNSI  194


 Score = 57.0 bits (136),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T ++     +   A ++ +   + LK V L  EDV++A LYLAS+ESKYVSG N
Sbjct  195  SPYAVATPLLTDGLSMTKEAAEELVASAATLKDVVLEPEDVSQAALYLASEESKYVSGVN  254

Query  813  LVVDAGFSISN  845
            LV+D G++++N
Sbjct  255  LVIDGGYNLTN  265



>gb|EMT02624.1| Xanthoxin dehydrogenase [Aegilops tauschii]
Length=285

 Score =   168 bits (425),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 108/161 (67%), Gaps = 1/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF QHGAKV IAD +D+   Q      G  +  FVHCDVT E D+  AV+      G L
Sbjct  40   RLFRQHGAKVCIADVQDEAGQQLRDSLGGDPDVLFVHCDVTVEEDISRAVDATAEKFGTL  99

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNAGI G K  DI + D  D   VF +N  G  LG KHAARVM P ++GSI++ AS
Sbjct  100  DIMVNNAGITGDKVTDIRNLDFADVKKVFDINVHGMLLGMKHAARVMIPSKKGSIVSLAS  159

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+ V+GG   HAYT SKHA+VGLTK+ AL+LGR+GIRVNCV
Sbjct  160  VASVIGGMGPHAYTASKHAVVGLTKSVALELGRHGIRVNCV  200


 Score = 67.0 bits (162),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY---------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +    E     V          +NLKGVDL+ +DVAEAVLYLASDE++
Sbjct  201  SPYAVPTALSMPHLPQGEQKGDAVRDFLAFVGSEANLKGVDLLPKDVAEAVLYLASDEAR  260

Query  795  YVSGHNLVVDAGFSISN  845
            Y+S  NLVVD GF+  N
Sbjct  261  YISALNLVVDGGFTSVN  277



>ref|XP_003538100.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN08820.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+CK L   +A +VHCDVT+E DVQNAVN A+S +G L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSLCKHLE--SASYVHCDVTNENDVQNAVNTAISKYGNL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       ILD    DF  V  VN +G FLGTKHAARVM P +RGSIINTAS
Sbjct  91   DIMFNNAGIIDEIKTSILDNSKFDFERVISVNLVGPFLGTKHAARVMIPAKRGSIINTAS  150

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G   GG  HAYT SKHA++GL KNTA++LG++GIRVNC+
Sbjct  151  VAGTFSGGASHAYTSSKHALIGLMKNTAVELGQFGIRVNCL  191


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T + +  F L ED   ++YSNLKGV L+  DVAEA LYLA DE
Sbjct  181  LGQFGIRVNCLSPYVVATPLTKKCFNLDEDRNGEIYSNLKGVHLVPNDVAEAALYLAGDE  240

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            SKYVSGHNLV+D GF+  N+  
Sbjct  241  SKYVSGHNLVLDGGFTNLNVGF  262



>ref|XP_002466226.1| hypothetical protein SORBIDRAFT_01g003880 [Sorghum bicolor]
 gb|EER93224.1| hypothetical protein SORBIDRAFT_01g003880 [Sorghum bicolor]
Length=282

 Score =   166 bits (420),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 111/164 (68%), Gaps = 6/164 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNA---FFVHCDVTSEADVQNAVNKAVSTH  333
            +LF +HGAKV IAD +D+   Q   +D   G+A    FVHCDVTSE DV  AV+ A    
Sbjct  36   RLFTEHGAKVCIADIQDEAGQQ--LRDALGGDAQGVMFVHCDVTSEEDVSRAVDAAAERF  93

Query  334  GRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            G LD+MVNNAG+ GAK  DI   D  +   V  +N  G FLG KHAARVM P +RGSI++
Sbjct  94   GALDVMVNNAGVTGAKVTDIRAVDFAEVRRVLDINVHGVFLGMKHAARVMIPQKRGSIVS  153

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             ASV+  +GG   HAYT SKHA+VGLTK+ A +LGR+G+RVNCV
Sbjct  154  LASVASAIGGLGPHAYTASKHAVVGLTKSVAAELGRHGVRVNCV  197


 Score = 68.6 bits (166),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +   G   DD L  +       +NLKGVD M +DVA+AVLYLASDE++
Sbjct  198  SPYAVPTALSMPHLPQGARADDALTDFLAFVGGEANLKGVDAMPKDVAQAVLYLASDEAR  257

Query  795  YVSGHNLVVDAGFSISN  845
            YVS  NL+VD GF+  N
Sbjct  258  YVSALNLMVDGGFTAVN  274



>gb|ACU18273.1| unknown [Glycine max]
Length=269

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+CK L   +A +VHCDVT+E DVQNAVN A+S +G L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSLCKHLE--SASYVHCDVTNENDVQNAVNTAISKYGNL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       ILD    DF  V  VN +G FLGTKHAARVM P +RGSIINTAS
Sbjct  91   DIMFNNAGIIDEIKTSILDNSKFDFERVISVNLVGPFLGTKHAARVMIPAKRGSIINTAS  150

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G   GG  HAYT SKHA++GL KNTA++LG++GIRVNC+
Sbjct  151  VAGTFSGGASHAYTSSKHALIGLMKNTAVELGQFGIRVNCL  191


 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY++ T + +  F L ED   ++YSNLK V L+  DVAEA LYLA DE
Sbjct  181  LGQFGIRVNCLSPYVVATPLTKKCFNLDEDRNGEIYSNLKSVHLVPNDVAEAALYLAGDE  240

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            SKYVSG N V+D GF+  N+  
Sbjct  241  SKYVSGPNFVLDGGFTNLNVGF  262



>ref|XP_008808776.1| PREDICTED: zerumbone synthase [Phoenix dactylifera]
Length=280

 Score =   164 bits (416),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAK+ + D +D+   Q +CK LG G+ +  F HCDVT E DV  AV+  V  +G
Sbjct  36   RLFREHGAKICVVDIQDN-LGQQLCKSLG-GDPYVVFFHCDVTIEDDVHRAVDFTVRKYG  93

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             +DI+VNNAGI G+K +DI + D  +F  VF VN  G FLG KHA+RVM P  +GSII+ 
Sbjct  94   TIDILVNNAGITGSKVVDIRNVDLKEFKKVFDVNVNGVFLGMKHASRVMIPKSKGSIISL  153

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+ V+GG   H YT SKHA++GLT+N A +LGR+GIRVNCV
Sbjct  154  ASVASVIGGMGPHGYTGSKHAVLGLTRNVAAELGRHGIRVNCV  196


 Score = 69.3 bits (168),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV-----------YSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY  PT +   +  L E+++ +            ++NLKG +LM +DVA+AVLYLASDE
Sbjct  197  SPYATPTSLSMPH--LPENERREAALKGFLSFAGSHANLKGAELMVDDVAQAVLYLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            +KY+SG NL+VD GF+  N +L 
Sbjct  255  AKYISGLNLMVDGGFTCVNHSLQ  277



>ref|XP_010227919.1| PREDICTED: zerumbone synthase isoform X1 [Brachypodium distachyon]
Length=283

 Score =   168 bits (425),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQ---SICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTH  333
            +LF QHGAKV IAD +D+   Q   S+  D G  +  FVHCDVT E DV  AV+ A    
Sbjct  36   RLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGT-DVLFVHCDVTVEEDVSRAVDAAAEKF  94

Query  334  GRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            G LDIMVNNAGI G K  DI + D  +   VF +N  G  LG KHAARVM P ++GSI++
Sbjct  95   GTLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGMLLGMKHAARVMIPGKKGSIVS  154

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             ASV+ VMGG   HAYT SKHA+VGLTK+ AL+LG++GIRVNCV
Sbjct  155  LASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGIRVNCV  198


 Score = 65.5 bits (158),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY---------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +    E     V          +NLKGVDL+ +DVA+AVLYLASDE++
Sbjct  199  SPYAVPTALSMPHLPQGEHKGDAVRDFLAFVGGEANLKGVDLLPKDVAQAVLYLASDEAR  258

Query  795  YVSGHNLVVDAGFSISN  845
            Y+S  NLVVD GF+  N
Sbjct  259  YISALNLVVDGGFTSVN  275



>ref|XP_003563948.1| PREDICTED: zerumbone synthase isoform X2 [Brachypodium distachyon]
Length=282

 Score =   168 bits (425),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQ---SICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTH  333
            +LF QHGAKV IAD +D+   Q   S+  D G  +  FVHCDVT E DV  AV+ A    
Sbjct  35   RLFRQHGAKVCIADVQDEAGQQVRDSLGDDAGT-DVLFVHCDVTVEEDVSRAVDAAAEKF  93

Query  334  GRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            G LDIMVNNAGI G K  DI + D  +   VF +N  G  LG KHAARVM P ++GSI++
Sbjct  94   GTLDIMVNNAGITGDKVTDIRNLDFAEVRKVFDINVHGMLLGMKHAARVMIPGKKGSIVS  153

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             ASV+ VMGG   HAYT SKHA+VGLTK+ AL+LG++GIRVNCV
Sbjct  154  LASVASVMGGMGPHAYTASKHAVVGLTKSVALELGKHGIRVNCV  197


 Score = 65.5 bits (158),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY---------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +    E     V          +NLKGVDL+ +DVA+AVLYLASDE++
Sbjct  198  SPYAVPTALSMPHLPQGEHKGDAVRDFLAFVGGEANLKGVDLLPKDVAQAVLYLASDEAR  257

Query  795  YVSGHNLVVDAGFSISN  845
            Y+S  NLVVD GF+  N
Sbjct  258  YISALNLVVDGGFTSVN  274



>ref|XP_002308240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE91763.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   167 bits (424),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF + GAKV+IAD  +D    S+   L P +  FVHCDV+ E D++N +N  +S +G+L
Sbjct  53   RLFARQGAKVVIADV-EDALGTSLVNSLAP-SVSFVHCDVSLEKDIENLINSTISQYGKL  110

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V  VN  G  LG KHAARVM P   G II+T
Sbjct  111  DILFNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMALGIKHAARVMIPRGGGCIIST  170

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  171  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  213


 Score = 65.5 bits (158),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 19/86 (22%)
 Frame = +3

Query  642  SPYIIPTQMI----RTY--------FGLAEDDKLDVY-------SNLKGVDLMAEDVAEA  764
            SP+ + T M+    R+         FGL  + +++         +NLKG  L A D+AEA
Sbjct  214  SPFGVATSMLVNAWRSSGEEEDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIAEA  273

Query  765  VLYLASDESKYVSGHNLVVDAGFSIS  842
             LYLASDESKYVSGHNLVVD G + S
Sbjct  274  ALYLASDESKYVSGHNLVVDGGITTS  299



>ref|XP_010931582.1| PREDICTED: LOW QUALITY PROTEIN: zerumbone synthase-like [Elaeis 
guineensis]
Length=277

 Score =   162 bits (410),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 112/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAK+ + D +D+   Q +CK LG G+ +  F HCDVT E DV+ AV+     +G
Sbjct  35   RLFRKHGAKICVVDIQDN-LGQQLCKSLG-GDPYVCFFHCDVTIEDDVRRAVDFTADKYG  92

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             +DIMVNNAGI G+K  DI D D  +F  VF VN  G FLG KHAAR+M P ++GSII+ 
Sbjct  93   TIDIMVNNAGITGSKVKDIRDADFNEFKKVFDVNVNGVFLGMKHAARIMIPQRKGSIISL  152

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+   GG   H YT SKHA++GLTKN A +LG+ GIRVNCV
Sbjct  153  ASVASTTGGLGPHGYTGSKHAVLGLTKNVAAELGKRGIRVNCV  195


 Score = 70.9 bits (172),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 11/77 (14%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---------LDVYSNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY  PT +   +  L E+++         +  ++NLKGVDLM +DVA+AVLYLASDE++
Sbjct  196  SPYATPTSLSMPH--LPEEERQEDAXFLSFVGSHANLKGVDLMVDDVAQAVLYLASDEAR  253

Query  795  YVSGHNLVVDAGFSISN  845
            Y+SG NL+VD GF+  N
Sbjct  254  YISGLNLMVDGGFTCVN  270



>ref|XP_004237829.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=280

 Score =   162 bits (410),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV I D +D    + +C+ LG   +A F+HCDVTSE DV NAV+ AV   G 
Sbjct  36   RLFHKHGAKVCIVDIQDA-FGKRVCESLGDEDSACFIHCDVTSETDVSNAVDFAVERFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDI+VNNAG+ GA   +ILD D + F NV  VN  G FLG KHAAR+M P +RGSI++  
Sbjct  95   LDIIVNNAGLTGAPCSNILDYDLSVFDNVLDVNVRGVFLGMKHAARIMIPRKRGSIVSLC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+G +GG   HAYT SK A++GLT+N A ++G++G+RVNCV
Sbjct  155  SVAGSIGGLGPHAYTASKFALLGLTQNVAAEMGKHGVRVNCV  196


 Score = 70.5 bits (171),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  642  SPYIIPTQM--------IRTYFGLAE-DDKLDVYSNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY + T++         RT   +A+ +     ++NLKGVDLMA+DVA+AVL+LASDE+ 
Sbjct  197  SPYAVATELGLLHLPPEQRTDDAIADFNSHFGKFANLKGVDLMAQDVAKAVLFLASDEAS  256

Query  795  YVSGHNLVVDAGFSISNLAL  854
            Y+SGH+L VD GFS  N +L
Sbjct  257  YISGHDLKVDGGFSSVNHSL  276



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA ++IAD +DD    S+CK L   +A +VHCDVT E DV+N VN AVS +G+L
Sbjct  34   RLFSKHGAHLVIADIQDD-LGLSLCKHLE--SASYVHCDVTKEEDVENCVNTAVSKYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGI       ILD + +DF +V  VN +G FLGTKHAARVM   +RGSIINTAS
Sbjct  91   DIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHAARVMIAAKRGSIINTAS  150

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G++GG   HAYT SKHA++GL K+TA++LG++GIRVNCV
Sbjct  151  VAGILGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVNCV  191


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LG         SPY++PT + + +  + E+   ++YSNLKGV L+  DVAEA LYLA D
Sbjct  180  ELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  239

Query  786  ESKYVSGHNLVVDAGFSISNLALN  857
            ESKYVSGHNLV+D G++  N+  +
Sbjct  240  ESKYVSGHNLVLDGGYTDVNIGFS  263



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +DD    S+CK L   +A +VHCDVT E DV+N VN AVS +G+L
Sbjct  34   RLFSKHGAHVVIADIQDD-LGLSLCKHLE--SASYVHCDVTKEEDVENCVNTAVSKYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGI       ILD + +DF +V  VN +G FLGTKHAARVM   +RGSIINTAS
Sbjct  91   DIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHAARVMIAAKRGSIINTAS  150

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G +GG   HAYT SKHA++GL K+TA++LG++GIRVNCV
Sbjct  151  VAGTLGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVNCV  191


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LG         SPY++PT + + +  + E+   ++YSNLKGV L+  DVAEA LYLA D
Sbjct  180  ELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  239

Query  786  ESKYVSGHNLVVDAGFSISNLALN  857
            ESKYVSGHNLV+D G++  N+  +
Sbjct  240  ESKYVSGHNLVLDGGYTDVNIGFS  263



>ref|XP_010104812.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01953.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   159 bits (403),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAK++IAD +DD    S+C+ LG  N+ +VHC+VT E+ V+NAV++AV T+GRL
Sbjct  34   KVFAHHGAKLVIADIQDD-LGHSVCESLGQTNSKYVHCNVTDESHVENAVDEAVKTYGRL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA      I+D +  DF  V  VN  G FLG KHAA+ M P + GSII+TAS
Sbjct  93   DIMFNNAGIADENKARIIDSEKADFERVMSVNVTGVFLGIKHAAQAMIPSRSGSIISTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY CSKHA++GLTKN A++LG++GIRVN +
Sbjct  153  ISSYVGGAASHAYCCSKHAVIGLTKNAAVELGQFGIRVNSL  193


 Score = 73.2 bits (178),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +   + GL ++   + ++   NLK V L AEDVA A LYLASDE +Y+SGHN
Sbjct  194  SPYALATPLATKFVGLDDEGLENLMNSLGNLKHVTLKAEDVANAALYLASDEGRYISGHN  253

Query  813  LVVDAGFSISNLALN  857
            L++D GFSI N + N
Sbjct  254  LLIDGGFSIVNPSFN  268



>ref|XP_004302582.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   168 bits (425),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV+IAD  +D    ++   LGP +  FVHCDV+ E D++N +   VS +G+L
Sbjct  50   KLFAKHGAKVVIADV-EDSTGTALANSLGP-SVTFVHCDVSLEEDIENLIQSTVSRYGQL  107

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DIM NNAGI G  +K   I++ D  +F  V RVN  G  LG KHAARVM P   G II+T
Sbjct  108  DIMFNNAGILGNQSKHKSIVNFDVDEFDRVMRVNVRGTALGIKHAARVMIPGGGGCIIST  167

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GV GG   HAYT SKHAIVGLTKN A +LGRYGIRVNCV
Sbjct  168  ASVAGVAGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVNCV  210


 Score = 64.3 bits (155),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +3

Query  681  FGLA---EDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FG+    E +K++ +    +NLKG  L  +D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  239  FGMPCEQEVEKMEEFVRGLANLKGPTLRTKDIAEAALYLASDESKYVSGHNLVVDGGITT  298

Query  840  SN  845
            S 
Sbjct  299  SR  300



>gb|KHN02192.1| Momilactone A synthase [Glycine soja]
Length=960

 Score =   159 bits (403),  Expect(2) = 7e-52, Method: Composition-based stats.
 Identities = 86/161 (53%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F Q GAKV+IAD +D+    S+ + +GP    +VHCDVT E  ++NAV KAV  +G+L
Sbjct  717  EVFAQQGAKVVIADIQDE-LGHSVAQSIGPSTCCYVHCDVTDENQIKNAVQKAVDAYGKL  775

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D D  DF  V  VN  G FLG KHAA+ M P + GSII+TAS
Sbjct  776  DIMFNNAGIVDPNKNRIIDNDKADFERVLSVNVTGVFLGMKHAAQAMIPARSGSIISTAS  835

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY C+KHA+VGLTKN A++LG++GIRVNC+
Sbjct  836  ISSYVGGAASHAYCCAKHAVVGLTKNAAVELGQFGIRVNCL  876


 Score = 72.8 bits (177),  Expect(2) = 7e-52, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T +   + G A D++L+      +NLKGV L AEDVA A LY ASD+S+YVSG 
Sbjct  877  SPYALATPLATKFVG-ANDEELETIMNSLANLKGVTLKAEDVANAALYFASDDSRYVSGQ  935

Query  810  NLVVDAGFSISN  845
            NL++D GFSI N
Sbjct  936  NLLIDGGFSIVN  947



>gb|KCW90498.1| hypothetical protein EUGRSUZ_A02616, partial [Eucalyptus grandis]
Length=275

 Score =   166 bits (420),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = +1

Query  70   LIIFHNLLAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLG  249
             I++  L+ +RL+GRVA+ITGG  GIG  TA++F  HGAKV+IAD  +D   QS+   LG
Sbjct  1    FILYAFLIFNRLEGRVALITGGASGIGEITARVFAHHGAKVVIADV-NDSLGQSVRDSLG  59

Query  250  PGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVF  429
               A +VHCDVT+E+ ++ AV +AVS +G+LDIM NNAGI       I+D D  DF  V 
Sbjct  60   QDTASYVHCDVTNESQIKAAVAEAVSAYGKLDIMFNNAGITDPNKARIVDNDKADFERVL  119

Query  430  RVNTLGAFLGTKHAARVMKPVQRGSIINTASVSGVMGG-FQHAYTCSKHAIVGLTKNTAL  606
             VN  G FLG KHAA+ M   +RG IINTAS+S  +GG   HAYTC+KHA++GLT+N A+
Sbjct  120  AVNVTGVFLGVKHAAQAMIAARRGCIINTASISSNIGGSASHAYTCAKHAVLGLTRNAAV  179

Query  607  DLGRYGIRVNCV  642
            +LG++GI VNC+
Sbjct  180  ELGQFGIWVNCL  191


 Score = 66.2 bits (160),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP+   T +   + GL     +  +   +NLKGV L AEDVA A L+LASDE++YVSGHN
Sbjct  192  SPFGCGTPLATKFVGLGPVEMEALIGATANLKGVTLKAEDVANAALFLASDEARYVSGHN  251

Query  813  LVVDAGFSISN  845
            L +D G ++ N
Sbjct  252  LFIDGGVTVVN  262



>ref|XP_006431968.1| hypothetical protein CICLE_v10003833mg, partial [Citrus clementina]
 gb|ESR45208.1| hypothetical protein CICLE_v10003833mg, partial [Citrus clementina]
Length=273

 Score =   166 bits (421),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 115/165 (70%), Gaps = 6/165 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAKV+IAD  DD    ++   L   +    + HCDV+ E D+QN +N  +S HG
Sbjct  21   RLFVKHGAKVVIADI-DDAAGIALADSLLSSSPLVTYRHCDVSLEQDIQNLINFTISKHG  79

Query  337  RLDIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSII  510
            RLDI+ NNAG+ G  +K   I D D  +F N+ R+N  GA LG K+AA+VM P + G II
Sbjct  80   RLDILFNNAGVLGNQSKHKSITDFDANEFDNIIRINVRGAALGMKYAAKVMVPRRSGCII  139

Query  511  NTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +TASV+G+MGG   HAYT SKHAIVGLTKNTA +LG+YGIRVNC+
Sbjct  140  STASVAGIMGGLGPHAYTASKHAIVGLTKNTACELGKYGIRVNCI  184


 Score = 65.5 bits (158),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 18/84 (21%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV-----------------YSNLKGVDLMAEDVAEAVL  770
            SP+ + T M+   +   ED  +D+                  +NL+ V L A D+AEA L
Sbjct  185  SPFGVATSMLVNAWKSCED-CMDIGTPCVEEEEKMEEFVRGLANLQAVTLKARDIAEAAL  243

Query  771  YLASDESKYVSGHNLVVDAGFSIS  842
            YLASDESKY+SGHNLVVD GF+ S
Sbjct  244  YLASDESKYISGHNLVVDGGFTTS  267



>gb|ABS87381.1| short-chain dehydrogenase/reductase protein [Lactuca sativa]
Length=271

 Score =   171 bits (433),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF  HGAKV+IAD +D    Q++ + +G  N+ ++HCD+T+E +V+N ++ AV+T+G+L
Sbjct  28   KLFAAHGAKVIIADVQDQ-LGQAVSEAIGSSNSMYIHCDITNEEEVKNTIDTAVATYGKL  86

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA A    I+D +  D   V  VN +G FL  KHAARVM P + GSII T+S
Sbjct  87   DIMFNNAGIADAFKPRIMDNEKKDIERVLGVNVIGTFLCMKHAARVMVPQKSGSIITTSS  146

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ++  +GG   HAY+CSKHA+VGLT+N A++L  +GIRVNCV
Sbjct  147  LTSHLGGMASHAYSCSKHALVGLTRNLAVELAPFGIRVNCV  187


 Score = 60.8 bits (146),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP+ I T M   + GL  +   + ++  +NLKGV    +DVA A LYLASDE+KYV+  N
Sbjct  188  SPFGIATPMTADFIGLEREVFENMINGVANLKGVTHKPDDVAYAALYLASDEAKYVTAQN  247

Query  813  LVVDAGFSISNLALN  857
            ++VD G S  N + N
Sbjct  248  MLVDGGLSYCNNSFN  262



>ref|XP_009387285.1| PREDICTED: momilactone A synthase-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF QHGA+V++ D +DD +  S+C DLGP  A +VHCDVT EADV++AV+ AVS HG+L
Sbjct  34   KLFAQHGARVVVVDIQDD-KGHSLCADLGPAVASYVHCDVTIEADVKHAVDTAVSLHGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG+        L+C+ + F  V  VN LGA+LGTKHAARVM P + GSI+ TAS
Sbjct  93   DIMFNNAGVVDDLSSGFLNCEKSAFEMVVAVNVLGAYLGTKHAARVMAPARAGSIVTTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             + VMGG    AYTCSKHA+VGL +  A +LG + +R NCV
Sbjct  153  AASVMGGLASPAYTCSKHAVVGLMRCAAAELGPFRVRANCV  193


 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 56/83 (67%), Gaps = 4/83 (5%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLD----VYSNLKGVDLMAEDVAEAVLYL  776
            LG  R  +   SP+ + T M +T  G  +D++L+      +NLKG  L A+D+AEAVLYL
Sbjct  183  LGPFRVRANCVSPHAVATPMAKTALGFTDDEELERLVEATANLKGTMLKAQDLAEAVLYL  242

Query  777  ASDESKYVSGHNLVVDAGFSISN  845
             SD+S+YV+GHNL+VD GF+++ 
Sbjct  243  GSDKSRYVNGHNLLVDGGFTVTK  265



>ref|XP_011032578.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   167 bits (422),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D     +   L P +  FVHCDV+ E D++N +N  VS +G+L
Sbjct  53   RLFARHGAKVVIADV-EDTLGTLVANSLAP-SVSFVHCDVSLEGDIENLINSTVSHYGKL  110

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            D++ NNAG+ G  +K   I++ D  +F  V  VN  G  LG KHAARVM P   G II+T
Sbjct  111  DVLFNNAGVLGNQSKNKSIVNFDAEEFDRVMHVNVRGVALGIKHAARVMIPRGVGCIIST  170

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  171  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  213


 Score = 64.7 bits (156),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 7/61 (11%)
 Frame = +3

Query  681  FGLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FGL  + +++         +NLKG  L A D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  239  FGLPSEKEVEKMEDFVRGLANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVDGGITT  298

Query  840  S  842
            +
Sbjct  299  T  299



>ref|XP_002323034.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF04795.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   166 bits (420),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D     +   L P +  FVHCDV+ E D++N +N  VS +G+L
Sbjct  53   RLFARHGAKVVIADV-EDTLGTLLANSLAP-SVSFVHCDVSLEEDIENLINSTVSHYGKL  110

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            D++ NNAG+ G  +K   I + D  +F  V +VN  G  LG KHAARVM P   G II+T
Sbjct  111  DVLFNNAGVLGNQSKNKSIANFDAEEFDRVMQVNVRGVALGIKHAARVMIPRGVGCIIST  170

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  171  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  213


 Score = 65.5 bits (158),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +3

Query  681  FGLA---EDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FGL    E +K++ +    +NLKG  L A D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  239  FGLPCEKEVEKMEDFVRGLANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVDGGITT  298

Query  840  S  842
            S
Sbjct  299  S  299



>ref|XP_008643649.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X2 [Zea 
mays]
 gb|AFW67244.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   161 bits (407),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG--PGNAFFVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAKV IAD +D+   Q +   LG     A FVHCDVTSE DV  AV+ A    G
Sbjct  37   RLFMEHGAKVCIADIQDE-AGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFG  95

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             LD+MVNNAG+ G K  DI + D  +   V  VN  G FLG KHAAR M P +RGSI++ 
Sbjct  96   ALDVMVNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVFLGMKHAARAMIPRKRGSIVSL  155

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+  +GG   H YT SKHA+VGLTK+ A +LGR+G+RVNCV
Sbjct  156  ASVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCV  198


 Score = 70.5 bits (171),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +   G   DD L  +       +NLKGVD M EDVA+AVLYLASDE++
Sbjct  199  SPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLASDEAR  258

Query  795  YVSGHNLVVDAGFSISN  845
            YVS  NL+VD GF+  N
Sbjct  259  YVSAVNLMVDGGFTAVN  275



>ref|XP_011019045.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   166 bits (419),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF + GAKV+IAD  +D    S+   L P +  FVHCDV  E D++N +N  +S +G+L
Sbjct  53   RLFARQGAKVVIADV-EDALGTSLVNSLAP-SVSFVHCDVGLEKDIENLINSTISQYGKL  110

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DI+ NNAG+ G  +K   I+D D  +F  V  VN  G  LG KHAARVM P   G II+T
Sbjct  111  DILFNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMALGIKHAARVMIPRGGGCIIST  170

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  171  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  213


 Score = 65.9 bits (159),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 19/86 (22%)
 Frame = +3

Query  642  SPYIIPTQMI----RTY--------FGLAEDDKLDVY-------SNLKGVDLMAEDVAEA  764
            SP+ + T M+    R+         FGL  + +++         +NLKG  L A D+AEA
Sbjct  214  SPFGVATSMLVNAWRSCGEEEDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIAEA  273

Query  765  VLYLASDESKYVSGHNLVVDAGFSIS  842
             LYLASDESKYVSGHNLVVD G + S
Sbjct  274  ALYLASDESKYVSGHNLVVDGGITTS  299



>ref|XP_010922188.1| PREDICTED: zerumbone synthase-like [Elaeis guineensis]
Length=280

 Score =   162 bits (411),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 117/163 (72%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF--FVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAK+ + D +D+   Q +C+ LG G+ +  F HC+VT E DV +A++  V  +G
Sbjct  36   RLFRKHGAKICVVDIQDN-LGQQLCESLG-GDPYVCFFHCNVTIEDDVHHAIDFTVRKYG  93

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             +DIMVNNAGI G+K +DI D D  +F  VF VN  G FLG KHAARVM P ++GSII+ 
Sbjct  94   TIDIMVNNAGITGSKVVDIRDVDFNEFKKVFDVNVNGVFLGMKHAARVMIPKKKGSIISL  153

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+ V+GG   H YT +KHA++GLT+N A +LG++GIRVNCV
Sbjct  154  ASVASVIGGMGPHGYTGTKHAVLGLTRNVAAELGKHGIRVNCV  196


 Score = 68.6 bits (166),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK-----------LDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY  PT++   +  L E+++           +  ++NLKGVDL  +DVA+AVLYLASDE
Sbjct  197  SPYATPTRLSMPH--LPENERQEDALNGFLSFVGTHANLKGVDLAVDDVAQAVLYLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            +KYVSG NL+VD  F+  N +L 
Sbjct  255  AKYVSGLNLMVDGAFTCVNHSLR  277



>ref|XP_010024677.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Eucalyptus 
grandis]
Length=277

 Score =   165 bits (417),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F  HGAKV+IAD  +D   QS+   LG   A +VHCDVT+E+ ++ AV +AVS +G+L
Sbjct  34   RVFAHHGAKVVIADV-NDSLGQSVRDSLGQDTASYVHCDVTNESQIKAAVAEAVSAYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D D  DF  V  VN  G FLG KHAA+ M   +RG IINTAS
Sbjct  93   DIMFNNAGITDPNKARIVDNDKADFERVLAVNVTGVFLGVKHAAQAMIAARRGCIINTAS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAYTC+KHA++GLT+N A++LG++GI VNC+
Sbjct  153  ISSNIGGSASHAYTCAKHAVLGLTRNAAVELGQFGIWVNCL  193


 Score = 66.6 bits (161),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP+   T +   + GL     +  +   +NLKGV L AEDVA A L+LASDE++YVSGHN
Sbjct  194  SPFGCGTPLATKFVGLGPVEMEALIGATANLKGVTLKAEDVANAALFLASDEARYVSGHN  253

Query  813  LVVDAGFSISN  845
            L +D G ++ N
Sbjct  254  LFIDGGVTVVN  264



>gb|KHG08861.1| Xanthoxin dehydrogenase -like protein [Gossypium arboreum]
Length=282

 Score =   170 bits (431),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPG-NAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV I D +D+   Q +C+ LG G N  F HCDVT E  V+ AV+ AV   G 
Sbjct  38   RLFHKHGAKVCIVDVQDNLGLQ-VCQSLGNGPNVCFFHCDVTIEEQVRAAVDYAVEKFGT  96

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI + D +DF  V  VN  G FLG KHAAR+M P ++GSII+T 
Sbjct  97   LDIMVNNAGLSGPPYNDIRNYDLSDFEKVMNVNVKGVFLGMKHAARIMIPHEKGSIISTC  156

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SVSGV+GG   HAYT SKHA++GLT+N A +LG+YGIRVNCV
Sbjct  157  SVSGVIGGLGPHAYTGSKHAVLGLTRNVASELGKYGIRVNCV  198


 Score = 60.8 bits (146),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-DVYS----------NLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T++   +  L ED++  DV +          NL GVDL  E VA AVL+LASD+
Sbjct  199  SPYAVATEL--AFAHLHEDERTEDVRTGFRAFIGKNANLNGVDLTVEHVANAVLFLASDD  256

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            + Y+SG NL+VD GF+ SN +L
Sbjct  257  AGYISGDNLMVDGGFTSSNHSL  278



>gb|KDP34955.1| hypothetical protein JCGZ_09243 [Jatropha curcas]
Length=270

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = +1

Query  169  FCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDI  348
            FC+HGAKV+I D +DD   QS+ K+LG   A FVHCDVT E+D++NAV+ A+S   +LDI
Sbjct  36   FCKHGAKVIIVDIQDD-LGQSLSKELGTDKAIFVHCDVTIESDIKNAVDIAISIFRKLDI  94

Query  349  MVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVS  528
            MVNNA IA  + L I+D D +DF  V +VN +G FLGTKHAARVM P ++GSII   SV 
Sbjct  95   MVNNAAIADPRKLSIVDNDISDFERVVKVNLIGVFLGTKHAARVMIPARQGSIITLGSVC  154

Query  529  GVMGGFQ-HAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
              +GG   HAYT +KH +VGL KN A +LGR+GIRVNC+
Sbjct  155  SSVGGVAFHAYTSTKHGVVGLAKNAAAELGRFGIRVNCL  193


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         S Y I T +   +F + ED K  VYSNL+GV L  EDVA+A +YL SDE
Sbjct  183  LGRFGIRVNCLSCYFIETPLTMNFFKMEEDGKSGVYSNLEGVKLKEEDVAQAAIYLGSDE  242

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            SKYVSGHNL +D G +  N A  
Sbjct  243  SKYVSGHNLALDGGSTTINPAFG  265



>gb|KDP36160.1| hypothetical protein JCGZ_08804 [Jatropha curcas]
Length=278

 Score =   166 bits (420),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDL-GPGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKVLIAD +DD    S+C++   P    FVHCDV+S++DV+NAV+ AVS +G+
Sbjct  34   RLFVKHGAKVLIADVQDD-LGLSLCQEFDSPETISFVHCDVSSDSDVKNAVDLAVSRYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI G     IL  +  DF  VF VN  G+FLG K+AA+VM P ++G I+ T+
Sbjct  93   LDIMYNNAGIGGNPDPSILSAENEDFKKVFDVNVFGSFLGAKYAAKVMIPNKKGCILFTS  152

Query  520  SVSGV-MGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V   G  +AY  SKHA+VGL KN +++LG+YGIRVN +
Sbjct  153  SVASVCCSGSLYAYIASKHAVVGLAKNLSVELGQYGIRVNSI  194


 Score = 64.7 bits (156),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ + T M+R   G  E  +++      + LK V L  ED+A A LYLASDESKYVSG 
Sbjct  195  SPFGVATPMLRNAVGNKEKKEVEQVIASAATLKEVILEPEDIANAALYLASDESKYVSGI  254

Query  810  NLVVDAGFSISN  845
            NLVVD G+S++N
Sbjct  255  NLVVDGGYSLTN  266



>gb|KDP36095.1| hypothetical protein JCGZ_08739 [Jatropha curcas]
Length=275

 Score =   169 bits (429),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRD---DDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTH  333
            +LF +HGAKVLIAD ++      S+ I  + G     ++ CDVT E DV+NAVN AVS H
Sbjct  34   RLFARHGAKVLIADVQNKLGQSLSEEIRSETGQ-PVSYIQCDVTQETDVENAVNTAVSMH  92

Query  334  GRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            G+LDIM NNAGI G    +IL  +  DF +V  +N  GAFLG KHAARVM P ++G+I+ 
Sbjct  93   GKLDIMYNNAGIIGKFDPNILSLEREDFKSVMDINLYGAFLGAKHAARVMVPEKKGNILF  152

Query  514  TASVSGV-MGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            TASV+ V  GG    Y  SKHA+VGLTKN A++LG+YGIRVNC+
Sbjct  153  TASVAAVTYGGTPLPYAASKHAVVGLTKNLAVELGKYGIRVNCI  196


 Score = 61.2 bits (147),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV---YSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP  IPT M     G       +V    +NLKGV + A+DVAEA LYL S+ESK+VSG N
Sbjct  197  SPAGIPTPMAAKIMGADIKTVQEVSMAVANLKGVKIEADDVAEAALYLGSEESKFVSGLN  256

Query  813  LVVDAGFSISN  845
            LVVD G S+ +
Sbjct  257  LVVDGGHSLRH  267



>ref|XP_011094269.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Sesamum indicum]
Length=276

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV IAD +D+  + S+   +G  N+ ++HCDVT+E  V+NAV+K VST+G+L
Sbjct  34   KLFSKHGAKVAIADIQDE-LAHSVVNSIGHSNSTYIHCDVTNEDHVKNAVDKTVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA      I+D + +DF  V  +N  G FLG KHAARVM P + G+II+TAS
Sbjct  93   DIMFNNAGIADRPKPRIIDNEKSDFERVMSINVTGVFLGMKHAARVMVPARSGTIISTAS  152

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            + SG+ G   HAYTCSKHA+VGLT+N A++LG++GIRVNC+
Sbjct  153  LGSGIGGAATHAYTCSKHAVVGLTRNLAVELGQFGIRVNCL  193


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLA  779
            LG         SPY + T + + +  L ++   + +   +NLKGV L AEDVA A L+LA
Sbjct  183  LGQFGIRVNCLSPYALATPLAKKFLELDDEGVENAMSYMANLKGVTLKAEDVANAALFLA  242

Query  780  SDESKYVSGHNLVVDAGFSISNLAL  854
            SDE++YVSG NL +D GF I N A+
Sbjct  243  SDEARYVSGQNLFIDGGFGIVNSAI  267



>ref|XP_002513092.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF49595.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=280

 Score =   164 bits (414),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV + D  DD+  Q++CK LG   N  + HCDVT E +VQ AV+  V   G 
Sbjct  36   RLFHKHGAKVCLVDL-DDNLGQNVCKSLGGEPNICYFHCDVTVEDEVQRAVDFTVDKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI   + +DF  VF VNT G F+G KHAARVM P+ RGSII+  
Sbjct  95   LDIMVNNAGLSGPPCSDIRCTELSDFQKVFDVNTKGTFIGMKHAARVMIPLNRGSIISLC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   HAYT SKHA++GLT+N A +LG++GIRVNCV
Sbjct  155  SVASTIGGLGPHAYTGSKHAVLGLTRNVAAELGKHGIRVNCV  196


 Score = 66.6 bits (161),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY +PT +   +  L ED++ +             +N++G++L A+DVA +VL+LAS+E
Sbjct  197  SPYAVPTNLALAH--LPEDERTEDAMAGFKAFARKNANMQGIELTADDVANSVLFLASEE  254

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            S+Y+SG NL++D GF+ SN +L
Sbjct  255  SRYISGANLMIDGGFTTSNHSL  276



>ref|XP_002323404.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|EEF05165.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=279

 Score =   172 bits (437),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF QHG+KVLIAD +DD   +++C++ G      +VHC+VT ++DVQNAV+ AVS +G+
Sbjct  34   RLFVQHGSKVLIADVQDD-LGRALCQEYGSEEIISYVHCNVTVDSDVQNAVDTAVSRYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI+G     IL+ D  DF+ V  +N  G FLG KHAARVM P ++G I+ TA
Sbjct  93   LDIMFNNAGISGNTKSSILNSDNEDFMRVLNINVCGGFLGAKHAARVMIPAKKGCILFTA  152

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+ G   HAYT SK+AIVGL KN ++DLG++GIRVN +
Sbjct  153  SVASVLYGELAHAYTASKNAIVGLAKNLSVDLGQHGIRVNSI  194


 Score = 57.4 bits (137),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP  + T M+     +   A +  +   +NLK   L  EDVA+A LYLASD+SKYVSG N
Sbjct  195  SPTAVATPMLTDALRMTKEAAEKFVASAANLKEAVLEPEDVAQAALYLASDDSKYVSGVN  254

Query  813  LVVDAGFSISNLAL  854
            LV+D G++++N +L
Sbjct  255  LVIDGGYNLTNPSL  268



>gb|KDP36159.1| hypothetical protein JCGZ_08803 [Jatropha curcas]
Length=279

 Score =   164 bits (414),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            ++F +HGAKVLIAD +DD   +SIC++   P    +VHCDV+S++DV+NAV+ AVS +G+
Sbjct  34   RVFVKHGAKVLIADIQDD-LGKSICQEYSSPETISYVHCDVSSDSDVKNAVDLAVSRYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI+G     I   D  DF  V  VN  GAFLG KHAARVM P ++G I+ +A
Sbjct  93   LDIMFNNAGISGTMEQRISSTDNQDFKKVIDVNVFGAFLGAKHAARVMIPNKKGCILFSA  152

Query  520  S-VSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S VS       HAYT SKHA+VGL KN +++LG+YGIRVN +
Sbjct  153  SAVSVCCVESPHAYTTSKHAVVGLAKNLSVELGQYGIRVNSI  194


 Score = 66.2 bits (160),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 5/73 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK-----LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSG  806
            SP+ + T M+R   G   + K     +   +NLK V L  ED+A A LYLASDESKYVSG
Sbjct  195  SPFGVATPMLRNALGGVVEKKEVEEAVSSSANLKEVILEPEDIAHAALYLASDESKYVSG  254

Query  807  HNLVVDAGFSISN  845
             NLVVD G+S++N
Sbjct  255  INLVVDGGYSLTN  267



>ref|XP_010685947.1| PREDICTED: sex determination protein tasselseed-2-like [Beta 
vulgaris subsp. vulgaris]
Length=306

 Score =   164 bits (415),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 114/164 (70%), Gaps = 6/164 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D    ++   L P +A F+HCDV+ E DV   V+ AV+ HGRL
Sbjct  55   RLFIRHGAKVVIADV-EDTLGNALANALSP-SATFIHCDVSVEDDVCTVVDTAVALHGRL  112

Query  343  DIMVNNAGIAGAKGLD---ILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            DI+VNNAG+ G++      IL+ D  +F  +  +N  G  LG KHAARVM P   G II+
Sbjct  113  DILVNNAGVLGSQTKSRKSILNFDPNEFDQIMSINVKGMALGIKHAARVMMPKGSGCIIS  172

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             +SV+GVMGG   HAYT SKHAIVGLTKNTA +LGR+GIRVNCV
Sbjct  173  ISSVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRFGIRVNCV  216


 Score = 65.5 bits (158),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 48/84 (57%), Gaps = 17/84 (20%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV-----------------YSNLKGVDLMAEDVAEAVL  770
            SP+ + T M+   +   E+D +++                  + LKG  L  +D+AEA L
Sbjct  217  SPFGVATSMLINAWRSGEEDDMELGLPNGEEVEKMEEFVRGLATLKGATLKPKDIAEASL  276

Query  771  YLASDESKYVSGHNLVVDAGFSIS  842
            YLASDES+YVSGHNLVVD GF+ S
Sbjct  277  YLASDESRYVSGHNLVVDGGFTTS  300



>ref|XP_002530513.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF31845.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=226

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAKV+IAD +D+    S+ + LGP N+ +VHC+VT E+ ++ AV+KAVST+G+L
Sbjct  34   KVFAHHGAKVVIADVQDE-LGHSVSESLGPSNSTYVHCNVTDESHIKIAVDKAVSTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D +  DF  V  VN  G FLG KHAARVM P + GSII+TAS
Sbjct  93   DIMFNNAGIVDVNKPRIVDNEKADFERVLSVNVTGVFLGIKHAARVMIPSRSGSIISTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY CSKHA++GLTKN A++LG++GIRVNC+
Sbjct  153  VSSSVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIRVNCL  193



>ref|XP_004237828.1| PREDICTED: xanthoxin dehydrogenase-like [Solanum lycopersicum]
Length=275

 Score =   155 bits (392),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q +C+ LG   N  F+HCDVT EAD+ NAV+  V   G 
Sbjct  31   RLFHKHGAKVCIADIQDE-VGQHVCETLGNDQNVCFIHCDVTVEADISNAVDFTVQKFGT  89

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI + + + F NV  VN  G FLG KHAAR+M P+++G+I++  
Sbjct  90   LDIMVNNAGLSGPPIGDIREYELSVFENVLDVNLKGTFLGMKHAARIMIPLKKGAIVSLC  149

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   H YT SK+A++GLT+N A +LG++G+ VNCV
Sbjct  150  SVASAIGGVGPHGYTASKYAVLGLTQNVAAELGKHGVHVNCV  191


 Score = 73.9 bits (180),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY +PT +   +  L ED+K D             +NL+GV+L  +DVA AVL+LASDE
Sbjct  192  SPYAVPTGLALAH--LPEDEKTDDAMEGFRDFAARNANLQGVELTVDDVANAVLFLASDE  249

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            S+Y+SGHNL+VD GFS  N +L
Sbjct  250  SRYISGHNLMVDGGFSCVNHSL  271



>ref|XP_011043648.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=279

 Score =   173 bits (438),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF QHG+KVLIAD +DD    ++C++ G      +VHC+VT ++DVQNAV+ AVS +G+
Sbjct  34   RLFVQHGSKVLIADVQDD-LGLALCQEYGSEEIISYVHCNVTVDSDVQNAVDTAVSRYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI+G     IL+ D  DF+ V  +N  G FLG KHAARVM P ++G I+ TA
Sbjct  93   LDIMFNNAGISGNSKSSILNSDNEDFMRVLNINVYGGFLGAKHAARVMIPAKKGCILFTA  152

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+ G   HAYT SK+AIVGL KN ++DLG++GIRVN +
Sbjct  153  SVASVLYGELAHAYTASKNAIVGLAKNLSVDLGQHGIRVNSI  194


 Score = 56.2 bits (134),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  717  SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSISNLAL  854
            +NLK   L  EDVA+A LYLASD+SKYVSG NLV+D G++++N +L
Sbjct  223  ANLKEAVLEPEDVAQAALYLASDDSKYVSGVNLVIDGGYNLTNPSL  268



>ref|XP_007027908.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08410.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=274

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF QHGAKVLIAD +D+    S+C++LG     +VHCDVT E+DVQNAV  AVS + +L
Sbjct  31   RLFVQHGAKVLIADIQDE-LGHSLCQELGTETISYVHCDVTCESDVQNAVELAVSKYRKL  89

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGI G   + + D D  +F  VF +N LG FLG KHAARVM P ++G I+ TAS
Sbjct  90   DIMLNNAGIMGHHEVRVTDADTENFKTVFDINVLGGFLGAKHAARVMVPAKKGCILFTAS  149

Query  523  V-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            + S +  G  HAY  SKHA+VGLTK+ +++LG YGIRVNC+
Sbjct  150  LASKISMGTPHAYKASKHAVVGLTKSLSVELGEYGIRVNCI  190


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 11/88 (13%)
 Frame = +3

Query  594  EYCPRLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDK----LDVYSNLKGVDLMAEDVAE  761
            EY  R+  I       SP+ + T + +   G+ +  K    +   + LKG  L  ED A 
Sbjct  182  EYGIRVNCI-------SPHAVATPLFQKTLGVFDKKKGEEAVSASAVLKGAVLEPEDFAN  234

Query  762  AVLYLASDESKYVSGHNLVVDAGFSISN  845
            A LYLASDE+KY+SG NL +D G+S+SN
Sbjct  235  AALYLASDEAKYLSGVNLTIDGGYSLSN  262



>ref|XP_009395947.1| PREDICTED: zerumbone synthase [Musa acuminata subsp. malaccensis]
Length=283

 Score =   157 bits (396),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG--PGNAFFVHCDVTSEADVQNAVNKAVSTHG  336
            KLF +HGAK+ + D +D    Q +C+ LG  P   FF HCDVT E DV+ AV+ A   +G
Sbjct  38   KLFRKHGAKICVVDVQDA-VGQQLCEFLGGDPYACFF-HCDVTVEDDVRRAVDFAAERYG  95

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             +DIMVNNAGI G K +DI + +  +F  VF +N  G FLG KHAARVM P  +GSII+ 
Sbjct  96   TIDIMVNNAGITGEKVVDIRNVNFDEFKRVFDINVNGVFLGMKHAARVMIPQGKGSIISL  155

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             SV+ V GG   H YT SKHA+VGLTKN A +LG++GIRVNCV
Sbjct  156  GSVASVNGGMGPHGYTGSKHAVVGLTKNVAGELGKHGIRVNCV  198


 Score = 72.0 bits (175),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 10/76 (13%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV----------YSNLKGVDLMAEDVAEAVLYLASDES  791
            SPY +PT++   +   +E  + D            +NLKGVDL+  DVAEAVLYLASDE+
Sbjct  199  SPYAVPTKLSMPHLPESERQEEDAVEGFLTFVRSCANLKGVDLLRNDVAEAVLYLASDEA  258

Query  792  KYVSGHNLVVDAGFSI  839
            KYVSG NLVVD GF+ 
Sbjct  259  KYVSGLNLVVDGGFTC  274



>ref|XP_007162945.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
 gb|ESW34939.1| hypothetical protein PHAVU_001G193400g [Phaseolus vulgaris]
Length=273

 Score =   155 bits (392),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F QHGAKV+IAD +D+    S+ + +GP    +VHCDVT E  V+NA+++AV T+G+L
Sbjct  32   EVFAQHGAKVVIADIQDE-LGHSVAESIGPSTCCYVHCDVTDEDQVKNAIHRAVETYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGIA      I+D D  DF  V  VN  G FLG KHAA+ M P + GSII+TAS
Sbjct  91   DIMFNNAGIADPNKHRIIDNDKADFERVLAVNVTGVFLGMKHAAQAMIPGRSGSIISTAS  150

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY C+KHA+ GLTKN A++LG++GIRVNC+
Sbjct  151  ISSYVGGAASHAYCCAKHAVAGLTKNAAVELGQFGIRVNCL  191


 Score = 73.2 bits (178),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T +   + G A D++L+      +NLKGV L A+DVA A LY ASD+S+YVSGH
Sbjct  192  SPYALATPLATNFVG-ANDEQLETIMNSLANLKGVTLKADDVANAALYFASDDSRYVSGH  250

Query  810  NLVVDAGFSISN  845
            NL++D GFSI N
Sbjct  251  NLLIDGGFSIVN  262



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA ++IAD +DD    S+CK L   +A +VHCDVT E DV+N VN AVS +G+L
Sbjct  103  RLFSKHGAHLVIADIQDD-LGLSLCKHLE--SASYVHCDVTKEEDVENCVNTAVSKYGKL  159

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGI       ILD + +DF +V  VN +G FLGTKHAARVM   +RGSIINTAS
Sbjct  160  DIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHAARVMIAAKRGSIINTAS  219

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G +GG   HAYT SKHA++GL K+TA++LG++GIRVNCV
Sbjct  220  VAGTLGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVNCV  260


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LG         SPY++PT + + +  + E+   ++YSNLKGV L+  DVAEA LYLA D
Sbjct  249  ELGQFGIRVNCVSPYVVPTPLTKKHANIDEEGVREIYSNLKGVHLVPNDVAEAALYLAGD  308

Query  786  ESKYVSGHNLVVDAGFSISNLALN  857
            ESKYVSGHNLV+D G++  N+  +
Sbjct  309  ESKYVSGHNLVLDGGYTDVNIGFS  332



>ref|XP_009776711.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=284

 Score =   156 bits (394),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 109/162 (67%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF QHGAKV+IAD +D   + S+ +++G  NA F+HCDV  E+DVQNAV+  V+  G+L
Sbjct  34   RLFVQHGAKVIIADIQDS-LATSVVQEIGTENATFIHCDVAIESDVQNAVDATVAKFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM +NAG+ G     IL+ D      VF VN +G F   KHAARVM P ++G I+ TAS
Sbjct  93   DIMYSNAGVLGKPISSILEVDYDIIKTVFDVNIVGKFFCAKHAARVMIPAKKGVILFTAS  152

Query  523  VSGVMGG--FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             S  + G    H Y+ SK+A++GL+KN  ++LG YGIRVNCV
Sbjct  153  ASTEVYGAAVPHTYSASKNALLGLSKNVGVELGEYGIRVNCV  194


 Score = 72.0 bits (175),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY I T ++   FG+ +   D       NLKG  L  EDVA+AVLYLASD+SKY SG N
Sbjct  195  SPYYISTPLVLNGFGIDKQMADKWFAAGGNLKGALLGVEDVAKAVLYLASDDSKYASGMN  254

Query  813  LVVDAGFSISNLALN  857
            LV+D GFS +N+AL 
Sbjct  255  LVLDGGFSTTNVALT  269



>ref|XP_011091814.1| PREDICTED: xanthoxin dehydrogenase [Sesamum indicum]
 ref|XP_011091815.1| PREDICTED: xanthoxin dehydrogenase [Sesamum indicum]
 ref|XP_011091816.1| PREDICTED: xanthoxin dehydrogenase [Sesamum indicum]
Length=280

 Score =   163 bits (412),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPG-NAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            ++F + GAKV IAD +DD   Q IC+ LG G +  F HCDVT E DV+NAV+  V  +G 
Sbjct  36   RVFHKQGAKVCIADIQDD-LGQRICESLGGGLDISFCHCDVTIEDDVKNAVDVTVDRYGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG AG    DI + + + F  +F VN  G F+G KHAAR+M P ++GSII+ A
Sbjct  95   LDIMVNNAGTAGPPRPDIREVELSLFEQIFDVNVKGVFIGMKHAARIMIPAKKGSIISLA  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   HAYT SKHA+VGLTK+ A +LG++GIRVNCV
Sbjct  155  SVASAVGGIGGHAYTGSKHAVVGLTKSVAAELGKHGIRVNCV  196


 Score = 65.1 bits (157),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T M   +  L E+++ +             +NL+G++L  EDVA AVL+LASDE
Sbjct  197  SPYAVATPMALAH--LPEEERTEDVLTGFRRFAEANANLQGIELTTEDVANAVLFLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            ++Y+SG NL+VD GF+ SN +L 
Sbjct  255  ARYISGDNLMVDGGFASSNHSLR  277



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            K+F  HGAKV+IAD +D+    S+ + LGP N+ +V CDVT EA ++N V+ A+ST+G+L
Sbjct  34   KVFSHHGAKVIIADIQDE-LGHSVVEALGPSNSTYVRCDVTEEAQIKNVVDTAISTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+NNAGIA      I+D +  DF  V ++N  G FLG KHAARVM P + G+II+TAS
Sbjct  93   DIMLNNAGIADDNKSRIIDNEMADFERVLKINVTGVFLGIKHAARVMIPARSGTIISTAS  152

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS ++G    HAY CSKHA++GLT+N A +LG++GIRVNC+
Sbjct  153  VSSLLGAAASHAYCCSKHAVLGLTRNAAAELGQFGIRVNCL  193


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVLYL  776
            LG         SPY + T + R + G+ +D+ L++    ++NLKGV L  EDVA A LYL
Sbjct  183  LGQFGIRVNCLSPYALATPLARKFIGVDDDEALEIAMNSFANLKGVTLKTEDVANAALYL  242

Query  777  ASDESKYVSGHNLVVDAGFSISN  845
            ASDE++Y+SGHNL +D GFS+ N
Sbjct  243  ASDEARYISGHNLFIDGGFSVQN  265



>ref|XP_003522142.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
1 [Glycine max]
Length=311

 Score =   164 bits (414),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F ++GA+V+IAD  +D     + + L P +A +VHCDV+ E +V+N V   VS +G+L
Sbjct  51   RVFAKNGARVVIADV-EDALGTMLAETLAP-SATYVHCDVSKEEEVENLVRSTVSRYGQL  108

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DIM NNAG+ G  +K   I++ D  +F  V  VN  G  LG KHAARVM P   G II+T
Sbjct  109  DIMFNNAGVLGNQSKNKSIINFDPEEFDKVMSVNVKGMALGIKHAARVMIPKGIGCIIST  168

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  169  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  211


 Score = 64.3 bits (155),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 7/61 (11%)
 Frame = +3

Query  681  FGLA---EDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FGL    E +K++ +    +NL+G  L A+D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  245  FGLPYQEEVEKMEGFVRGLANLQGATLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTS  304

Query  840  S  842
            S
Sbjct  305  S  305



>gb|KHN33244.1| Sex determination protein tasselseed-2 [Glycine soja]
Length=305

 Score =   164 bits (414),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F ++GA+V+IAD  +D     + + L P +A +VHCDV+ E +V+N V   VS +G+L
Sbjct  45   RVFAKNGARVVIADV-EDALGTMLAETLAP-SATYVHCDVSKEEEVENLVRSTVSRYGQL  102

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DIM NNAG+ G  +K   I++ D  +F  V  VN  G  LG KHAARVM P   G II+T
Sbjct  103  DIMFNNAGVLGNQSKNKSIINFDPEEFDKVMSVNVKGMALGIKHAARVMIPKGIGCIIST  162

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  163  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  205


 Score = 64.3 bits (155),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 7/61 (11%)
 Frame = +3

Query  681  FGLA---EDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FGL    E +K++ +    +NL+G  L A+D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  239  FGLPYQEEVEKMEGFVRGLANLQGATLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTS  298

Query  840  S  842
            S
Sbjct  299  S  299



>ref|XP_003553613.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN02191.1| Momilactone A synthase [Glycine soja]
Length=280

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF QHGAKV+IAD +D+   Q  CK LG  N  +VHCDVTS++DV+N V  AVS +G+L
Sbjct  34   KLFVQHGAKVIIADVQDE-LGQFHCKTLGTTNIHYVHCDVTSDSDVKNVVEFAVSKYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI+G     I   D   F NVF VN  GAFLG KHAARVM P +RG I+ T+S
Sbjct  93   DIMYNNAGISGDSNRSITTSDNEGFKNVFGVNVYGAFLGAKHAARVMIPAKRGVILFTSS  152

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+ ++GG   HAY  SKHA+VGL KN  ++LG +GIRVNCV
Sbjct  153  VASLLGGETTHAYAVSKHAVVGLMKNLCVELGEHGIRVNCV  193


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 3/85 (4%)
 Frame = +3

Query  600  CPRLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVL  770
            C  LG          P  IPT M+     + + +  +V      LKG  L AED+A+A +
Sbjct  180  CVELGEHGIRVNCVCPGGIPTPMLNNALKMNKKETQEVLCKVAVLKGTVLEAEDIAKAAV  239

Query  771  YLASDESKYVSGHNLVVDAGFSISN  845
            YL SDE+K+VSG N V+D G+SI+N
Sbjct  240  YLCSDEAKFVSGVNFVLDGGYSITN  264



>gb|ADK56099.1| alcohol dehydrogenase [Artemisia annua]
Length=265

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +DD  + +C+DLG   A FVHCDVT E+D++N +N  ++ HG+L
Sbjct  30   RLFVKHGAKVVIADV-NDDLGKLLCQDLGSKFACFVHCDVTIESDIENLINTTIAKHGQL  88

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNAG      L ILD + +DF  V  +N  G FLGTKHAARVM P   GSII TAS
Sbjct  89   DIMVNNAGTVDEPKLSILDNEKSDFDRVVSINLAGVFLGTKHAARVMIPKCSGSIITTAS  148

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +  V GG   HAYT SKH +VGL KN A +LG+Y IRVNCV
Sbjct  149  ICSVTGGVASHAYTSSKHGVVGLAKNAAAELGKYNIRVNCV  189


 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LG         SPY +PT++   +  +  D+    YSNL+G  L  +D+A A L+LASD
Sbjct  178  ELGKYNIRVNCVSPYFVPTKLAFKFLNM--DETSSFYSNLQGKTLGPQDIANATLFLASD  235

Query  786  ESKYVSGHNLVVDAGFSISNLAL  854
            ES YVSGHNLVVD G+S+ N A 
Sbjct  236  ESGYVSGHNLVVDGGYSVLNPAF  258



>ref|XP_010917566.1| PREDICTED: momilactone A synthase-like isoform X2 [Elaeis guineensis]
Length=229

 Score =   160 bits (404),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 111/151 (74%), Gaps = 2/151 (1%)
 Frame = +1

Query  193  LIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIA  372
            +IAD +DD + +++C+ LG   A +VHCDVT E+ V++AV+ AVS HG+LDIM NNAGIA
Sbjct  1    MIADIQDD-KGRALCESLGSAVASYVHCDVTDESHVRDAVDAAVSRHGKLDIMFNNAGIA  59

Query  373  GAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVSGVMGGF-Q  549
            G+  + I + +  DF  V  +N +G++LGTKHAARVM P +RGSI+ T SV+    G   
Sbjct  60   GSLCMQIRESEKADFERVMGINLVGSYLGTKHAARVMIPARRGSIVMTGSVASAAPGIGS  119

Query  550  HAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             AYTCSK A+VGL ++ A++LG++G+RVNCV
Sbjct  120  AAYTCSKPAVVGLMRSAAVELGQFGVRVNCV  150


 Score = 67.4 bits (163),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDK---LDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +  T FG+  ++    +  ++ LKGV L  EDVAEAVL+L S+E++YVSG N
Sbjct  151  SPYGVATPLATTSFGIGVEEVEEFMHKHAILKGVRLKVEDVAEAVLFLGSEEARYVSGVN  210

Query  813  LVVDAGFSISN  845
            L+VD GF+ +N
Sbjct  211  LLVDGGFTTTN  221



>ref|XP_002309402.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
 gb|EEE92925.2| hypothetical protein POPTR_0006s22270g, partial [Populus trichocarpa]
Length=275

 Score =   175 bits (443),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF QHGAKVLIAD +DD    S C++ GP     +VHC+VT ++DVQNAV+ AV  +G+
Sbjct  21   RLFVQHGAKVLIADIQDD-LGHSFCQEFGPQETISYVHCNVTCDSDVQNAVDTAVFKYGK  79

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI G +   IL CD  +F  V  VN  G FLG KHAARVM P ++G I+ T+
Sbjct  80   LDIMFNNAGIPGDRKSGILTCDNENFKRVLDVNVYGGFLGAKHAARVMIPAKKGCILFTS  139

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+ G   HAYT SK+AIVGL KN +++LG+YGIRVN +
Sbjct  140  SVASVLYGELAHAYTASKNAIVGLAKNLSVELGQYGIRVNSI  181


 Score = 52.4 bits (124),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T ++     +   A ++ +   + LK V L  EDV++A LYLAS+ESKYVSG N
Sbjct  182  SPYAVATPLLTDGLSMTKEAAEELVASAATLKDVVLEPEDVSQAALYLASEESKYVSGVN  241

Query  813  LVVDAG  830
            LV+D G
Sbjct  242  LVIDGG  247



>ref|XP_009789920.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana sylvestris]
Length=280

 Score =   159 bits (401),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q+IC  LG   +A FVHCDVT+EAD+ NAV+  +   G 
Sbjct  36   RLFHKHGAKVCIADIQDE-LGQNICSTLGNDQSACFVHCDVTAEADISNAVDLTIQKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI D + + F +V  VN  G FLG KHAAR+M P ++GSI++  
Sbjct  95   LDIMVNNAGLSGPPIPDIRDYELSVFESVLDVNLKGTFLGIKHAARIMIPQKKGSIVSLC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV   + G   HAY  SKHA++GLT+N A ++G++G+RVNCV
Sbjct  155  SVGSAIAGIGPHAYIASKHAVLGLTQNVAAEMGKHGVRVNCV  196


 Score = 68.6 bits (166),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-----------DVYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T++   +  L ED++            +  +NL+GV+L  +DVA AVL+LASDE
Sbjct  197  SPYAVATELALAH--LPEDERTNDALAGFRAFTEKNANLQGVELKTQDVANAVLFLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            ++Y+SGHNL+VD GFS  N +L
Sbjct  255  ARYISGHNLMVDGGFSCVNHSL  276



>gb|ACG37730.1| sex determination protein tasselseed-2 [Zea mays]
Length=283

 Score =   157 bits (396),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 106/163 (65%), Gaps = 4/163 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG--PGNAFFVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAKV IAD +D+   Q +   LG     A FVHCDVTSE DV  AV+ A    G
Sbjct  37   RLFMEHGAKVCIADIQDE-AGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFG  95

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             LD+MVNNAG+ G K  DI   D  +   V  VN  G FL  KHAAR M P +RGSI++ 
Sbjct  96   ALDVMVNNAGVTGTKVTDIRTVDFAEARRVLDVNVHGVFLVMKHAARAMIPRKRGSIVSL  155

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+  +GG   H YT SKHA+VGLTK+ A +LGR+G+RVNCV
Sbjct  156  ASVASAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCV  198


 Score = 70.5 bits (171),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +   G   DD L  +       +NLKGVD M EDVA+AVLYLASDE++
Sbjct  199  SPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLASDEAR  258

Query  795  YVSGHNLVVDAGFSISN  845
            YVS  NL+VD GF+  N
Sbjct  259  YVSAVNLMVDGGFTAVN  275



>gb|KDP36096.1| hypothetical protein JCGZ_08740 [Jatropha curcas]
Length=269

 Score =   167 bits (424),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGN---AFFVHCDVTSEADVQNAVNKAVSTH  333
            +LF + GAKV+I D + D    S+   +   +     ++HCDV+ E+DVQNAVN AVS H
Sbjct  28   RLFARQGAKVVITDIQSD-LGHSVSNQIESESNQPVSYIHCDVSKESDVQNAVNAAVSMH  86

Query  334  GRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            G LDIM NNAGI G     IL  +  DF  V  +N  G  LG KHAARVM P ++G+I+ 
Sbjct  87   GHLDIMFNNAGITGNYNPSILSIEREDFKKVMDINVYGGLLGAKHAARVMIPEKKGAILF  146

Query  514  TASVSGV-MGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            T+SV+ V  GG  HAYT SKHAIVGLTKN A++LG+YGIRVNC+
Sbjct  147  TSSVAAVTYGGVPHAYTTSKHAIVGLTKNLAVELGKYGIRVNCI  190


 Score = 59.3 bits (142),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD---VYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP  + T  +    G+ E    +     +NLKGV + A D+AEA LYLAS ESK+VSG N
Sbjct  191  SPAAVATPSVVKALGMDEKQIEEFNLAIANLKGVKVDANDMAEAALYLASGESKFVSGLN  250

Query  813  LVVDAGFSI  839
            LVVD GFS+
Sbjct  251  LVVDGGFSL  259



>ref|XP_004252598.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Solanum lycopersicum]
Length=281

 Score =   152 bits (385),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 132/191 (69%), Gaps = 4/191 (2%)
 Frame = +1

Query  79   FHNLLAHRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLG-PG  255
            F + +A +L+G+VAIITGG  GIG+ATA+LF QHGAKV+IAD +DD   +S+ KD+G   
Sbjct  6    FQSPIAKKLEGKVAIITGGASGIGAATARLFVQHGAKVIIADIQDD-LGKSLVKDIGTEQ  64

Query  256  NAFFVHCDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRV  435
               + HC+V+ E+DVQN V+  V+  G+LDIM +NAG++G     IL+ D     NVF V
Sbjct  65   TVIYAHCNVSIESDVQNVVDATVAKFGKLDIMCSNAGVSGKPITSILEVDHDIIKNVFDV  124

Query  436  NTLGAFLGTKHAARVMKPVQRGSIINTASVSGVM--GGFQHAYTCSKHAIVGLTKNTALD  609
            N +GAF   KHAARVM P ++G I+ T S S V+   G  H Y  SK A++GL+KN  ++
Sbjct  125  NVVGAFFCAKHAARVMTPNKKGVILFTTSASTVVFGTGVPHTYVSSKCAVLGLSKNVGVE  184

Query  610  LGRYGIRVNCV  642
            LG+YGIRVNCV
Sbjct  185  LGKYGIRVNCV  195


 Score = 74.3 bits (181),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 5/75 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T ++   FG+ E+ K D +     NLKG  L  +DVA  VLYL SD+SKYVSGH
Sbjct  196  SPYCVSTPLVVDGFGI-EEQKADKWFEEAGNLKGALLDEQDVANGVLYLTSDDSKYVSGH  254

Query  810  NLVVDAGFSISNLAL  854
            NL++D GFS +N+AL
Sbjct  255  NLILDGGFSTTNVAL  269



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 6/161 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF QHGAKV++AD +D+   +S+C  +G   A FVHCDVT E+DVQ A++ AV+ HG+L
Sbjct  29   RLFSQHGAKVVVADIQDE-RGRSVCDTIG---ATFVHCDVTKESDVQKAIDTAVTGHGKL  84

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI  A G  I D   +DF  V  V   GAFLGTKHAARVM P  RGSII+TAS
Sbjct  85   DIMFNNAGIIDA-GKPITDTALSDFHKVIDVIVTGAFLGTKHAARVMVPAGRGSIISTAS  143

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+ V+GG   HAYT +KHA+ GLT++ A++LGR+G+RVNCV
Sbjct  144  VASVIGGVGTHAYTAAKHAVAGLTRSAAVELGRFGVRVNCV  184


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAE---DDKLDVYSNLKGVDLMAEDVAEAVLYLA  779
            LG         SPY + T++   +  + E   ++ +  ++ L+G  L  EDVA AVLYLA
Sbjct  174  LGRFGVRVNCVSPYAVATRLAVEFARIDEKVFEEAMSKFATLQGTLLKPEDVAMAVLYLA  233

Query  780  SDESKYVSGHNLVVDAGFSISNLAL  854
            SDESKYVSGHNL+VD G+SI N AL
Sbjct  234  SDESKYVSGHNLMVDGGYSIVNRAL  258



>gb|KDP36155.1| hypothetical protein JCGZ_08799 [Jatropha curcas]
Length=280

 Score =   165 bits (417),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGP-GNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+IAD +D+    S+C++     N  +VHCDVTS+ DV+NAV+ A S +G+
Sbjct  35   RLFVEHGAKVVIADVQDE-LGLSLCQEFSSQENICYVHCDVTSDEDVKNAVDLAFSRYGK  93

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAGI G    ++L C   +F  VF VN  GAFL  KHAARVM P ++G I+ TA
Sbjct  94   LDIMYSNAGIGGKLETEVLGCSNENFKKVFDVNVFGAFLVAKHAARVMIPAKKGCILFTA  153

Query  520  SVSGVMG---GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SVS V+G      HAY  SK+A+VGL+KN +++LG+YGIRVN +
Sbjct  154  SVSSVIGMGDAASHAYASSKYALVGLSKNLSVELGQYGIRVNSI  197


 Score = 61.6 bits (148),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVYSN---LKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SP+ + T ++     + +    ++ S+   LK   L AEDVA+A LYLASDESKYVSG N
Sbjct  198  SPFAVATPLVSKGLNMEKKKAEELISSTGILKEAVLEAEDVAQAALYLASDESKYVSGLN  257

Query  813  LVVDAGFSISN  845
            L+VD G+S++N
Sbjct  258  LIVDGGYSLTN  268



>ref|XP_007008811.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY17621.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=283

 Score =   165 bits (417),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPG-NAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV I D +D+   Q +C+ LG   N  F HCDVT E +V++AV+ AV   G 
Sbjct  39   RLFHKHGAKVCIVDVQDN-LGQKVCESLGDAPNVCFFHCDVTIEEEVRSAVDFAVEKFGT  97

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI + D +DF  V  VN  G FLG KHAAR+M P ++GSI++  
Sbjct  98   LDIMVNNAGLSGPPYHDIRNYDLSDFQKVMDVNVKGVFLGMKHAARIMIPHEKGSIVSVC  157

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+GV+GG   HAYT SKHA++GL +N A +LG+YGIRVNCV
Sbjct  158  SVAGVIGGLGPHAYTGSKHAVLGLNRNVAAELGKYGIRVNCV  199


 Score = 61.6 bits (148),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY +PT +   +  L ED++ +             +NL GVDL A+ VA AVL+LASDE
Sbjct  200  SPYGVPTGLSLRH--LPEDERTEDALVGFRAFVAKSANLNGVDLTADHVANAVLFLASDE  257

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            + Y+SG NL+VD GF+  N ++ 
Sbjct  258  AGYISGDNLMVDGGFTCVNHSMR  280



>gb|KDP34951.1| hypothetical protein JCGZ_09239 [Jatropha curcas]
Length=246

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            + FC+HGAKV+I D +DD   QS+ K+LG   A FVHCDVT E+D++NAV+ A+S  G+L
Sbjct  34   RTFCKHGAKVIIVDIQDD-LGQSLSKELGTDKAVFVHCDVTIESDIENAVDTAISIFGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DI+VNNA I   +   I+D D  DF  V +VN +G FLG KHAARVM P ++GSII   S
Sbjct  93   DIIVNNAAIGDPRKPSIVDNDVVDFKRVVKVNLIGVFLGPKHAARVMIPARQGSIITLGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT +KH IVGL KN A +LG++GIRVNC+
Sbjct  153  VCSSVGGVASHAYTSTKHGIVGLAKNAAAELGQFGIRVNCL  193


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         S Y I T +   +F + ED K  VYSNLKGV L  EDVAEA +YL SDE
Sbjct  183  LGQFGIRVNCLSSYFIETPLTMNFFKMKEDGKSGVYSNLKGVKLKEEDVAEAAIYLGSDE  242

Query  789  SKYV  800
            SKYV
Sbjct  243  SKYV  246



>ref|XP_006428245.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428246.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428251.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428253.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428254.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006428256.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 ref|XP_006480290.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Citrus sinensis]
 ref|XP_006480291.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Citrus sinensis]
 ref|XP_006480292.1| PREDICTED: xanthoxin dehydrogenase isoform X3 [Citrus sinensis]
 ref|XP_006480293.1| PREDICTED: xanthoxin dehydrogenase isoform X4 [Citrus sinensis]
 gb|ESR41485.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41486.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41491.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41493.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41494.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|ESR41496.1| hypothetical protein CICLE_v10012415mg [Citrus clementina]
 gb|KDO45361.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45362.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45363.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
 gb|KDO45364.1| hypothetical protein CISIN_1g023573mg [Citrus sinensis]
Length=280

 Score =   167 bits (424),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q +C+ LG   + FF HCDVT E DV +AV+  V   G 
Sbjct  36   RLFHKHGAKVCIADVQDN-LGQQVCQSLGGEPDTFFCHCDVTKEEDVCSAVDLTVEKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAGI+GA   DI + D ++F  VF +N  G F G KHAAR+M P  +G+II+  
Sbjct  95   LDIMVNNAGISGAPCPDIREADLSEFEKVFDINVKGVFHGMKHAARIMIPQTKGTIISIC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+G +GG   HAYT SKHA++GL KN A +LG+YGIRVNCV
Sbjct  155  SVAGAIGGLGPHAYTGSKHAVLGLNKNVAAELGKYGIRVNCV  196


 Score = 58.5 bits (140),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +   +  L E+++ +             +N++G +L A DVA AVL+LASDE
Sbjct  197  SPYAVATGLALAH--LPEEERTEDAMVGFRNFVARNANMQGTELTANDVANAVLFLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            ++Y+SG NL+VD GF+  N +L
Sbjct  255  ARYISGTNLMVDGGFTSVNHSL  276



>gb|KDP32981.1| hypothetical protein JCGZ_13012 [Jatropha curcas]
Length=243

 Score =   160 bits (406),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = +1

Query  175  QHGAKVLIADTRDDDESQSICKDLGPGN-AFFVHCDVTSEADVQNAVNKAVSTHGRLDIM  351
             HGAK++IAD +D+    S+CK LGP     +VHCD+T+++DVQNAV+ A+  +G+LDIM
Sbjct  1    MHGAKIIIADIQDE-LGYSLCKQLGPEEICSYVHCDITNDSDVQNAVDLAIFKYGKLDIM  59

Query  352  VNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS-VS  528
             +NAGI+G     IL  +  DF  VF VN  GAFL  KHAAR+M P ++G I+ T+S VS
Sbjct  60   FSNAGISGPMDPRILTTENEDFKRVFDVNVFGAFLAAKHAARIMIPAKKGCILFTSSLVS  119

Query  529  GVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
                   HAY  SKHA+VGL KN A+++G+YGIRVNC+
Sbjct  120  VTCLQAPHAYAASKHALVGLAKNLAVEIGQYGIRVNCI  157


 Score = 65.5 bits (158),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 6/74 (8%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY------SNLKGVDLMAEDVAEAVLYLASDESKYVS  803
            SPY   T ++R   GL E +K  +       +NLKGV L  ED+AEA +YL SDESKYVS
Sbjct  158  SPYAAVTPLLRNSLGLMEIEKEKIEEMISDSANLKGVVLEPEDIAEAAVYLGSDESKYVS  217

Query  804  GHNLVVDAGFSISN  845
            G NLVVD G+S++N
Sbjct  218  GINLVVDGGYSLTN  231



>gb|KCW47495.1| hypothetical protein EUGRSUZ_K01263 [Eucalyptus grandis]
Length=279

 Score =   160 bits (406),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 129/187 (69%), Gaps = 6/187 (3%)
 Frame = +1

Query  97   HRLDgrvaiitggvggigsataKLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVH  273
            HRL+G+VAI+TGG  GIG A  +LF +HGAKV++AD  +D   +++   L P     +VH
Sbjct  2    HRLEGKVAIVTGGARGIGEAAVRLFARHGAKVVVADV-EDVLGEALASSLAPNYCVTYVH  60

Query  274  CDVTSEADVQNAVNKAVSTHGRLDIMVNNAGIAGA---KGLDILDCDGTDFVNVFRVNTL  444
            CDV+SE DV+N V+  VS +G LDI+ NNAG+ G+   K   IL+ D  +F  V RVN  
Sbjct  61   CDVSSEPDVENMVSSTVSRYGHLDILFNNAGVLGSQSGKSKSILNFDAEEFDCVMRVNVR  120

Query  445  GAFLGTKHAARVMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRY  621
            G  LG KHAA  M P   G II+TASV+GV+GG   HAYT SKHAIVGLTKN A +LGR+
Sbjct  121  GTALGMKHAAGAMIPRGSGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNAACELGRH  180

Query  622  GIRVNCV  642
            GIRVNC+
Sbjct  181  GIRVNCI  187


 Score = 65.1 bits (157),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 19/87 (22%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLA---------------EDDKLDVY----SNLKGVDLMAEDVAEA  764
            SP+ + T M+   +G                 E +K++ +    +NL+G  L A+DVAEA
Sbjct  188  SPFGVATSMLVNAWGGGDREDECMSFGVPCEQEVEKMEEFVSSLANLRGPTLRAKDVAEA  247

Query  765  VLYLASDESKYVSGHNLVVDAGFSISN  845
             LYLASDESKY+SGHNLVVD G + S 
Sbjct  248  ALYLASDESKYISGHNLVVDGGITTSR  274



>ref|XP_007132475.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
 gb|ESW04469.1| hypothetical protein PHAVU_011G097200g [Phaseolus vulgaris]
Length=268

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD +D+    S+CKD+   ++F+VHCDVT E  V+ AVN AVS  G+L
Sbjct  35   RLFAKHGAKVVIADIQDE-LGHSVCKDID--SSFYVHCDVTKEEHVERAVNTAVSRFGKL  91

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G    +I+    +DF  V R N +G FLG KHAARVM P +RGSII TAS
Sbjct  92   DIMHNNAGIIGVWNPNIIHNKKSDFEEVIRTNLVGVFLGMKHAARVMAPSRRGSIIATAS  151

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
              G +GG   HAYTCSKH IVGL +N A++LG  GIRVNCV
Sbjct  152  TCGRIGGMASHAYTCSKHGIVGLVRNAAVELGPLGIRVNCV  192


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG +       SPY +PT M +++    ++    +YSNLKGV L  +DVAEAV+YL SDE
Sbjct  182  LGPLGIRVNCVSPYAVPTPMSKSFLNTDDEGIAALYSNLKGVTLKPQDVAEAVVYLGSDE  241

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            SKYVSGH+LVVD GF++ N  +
Sbjct  242  SKYVSGHDLVVDGGFTVVNAGM  263



>ref|XP_007134614.1| hypothetical protein PHAVU_010G061700g [Phaseolus vulgaris]
 gb|ESW06608.1| hypothetical protein PHAVU_010G061700g [Phaseolus vulgaris]
Length=308

 Score =   161 bits (407),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F ++GA+V+IAD  +D     + + L P +A +VHCDV+ E +V+N V+  VS +G++
Sbjct  51   RVFVKNGARVVIADV-EDALGTMLAETLAP-SATYVHCDVSVEEEVENLVSSTVSRYGQV  108

Query  343  DIMVNNAGIAG--AKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
            DIM NNAG+ G  +K   IL+ D  +F  V +VN  G  LG KHAAR M P   G II+T
Sbjct  109  DIMFNNAGVLGNQSKNKSILNFDPNEFDRVMQVNVKGMALGIKHAARAMIPKGIGCIIST  168

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            ASV+GVMGG   HAYT SKHAIVGLTKNTA +LGRYGIRVNC+
Sbjct  169  ASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVNCI  211


 Score = 64.7 bits (156),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 7/61 (11%)
 Frame = +3

Query  681  FGLA---EDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSI  839
            FGL    E +K++ +    +NLKG  L A+D+AEA LYLASDESKYVSGHNLVVD G + 
Sbjct  242  FGLPFQEEVEKMEGFVRGLANLKGQTLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTS  301

Query  840  S  842
            S
Sbjct  302  S  302



>ref|XP_004136701.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
 ref|XP_004164972.1| PREDICTED: momilactone A synthase-like [Cucumis sativus]
Length=278

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKD-LGPGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            KLF  HGAKV+IAD +DD    ++C + LG  N+ +VHCDVT E+ VQ AV  AV T G+
Sbjct  36   KLFVHHGAKVVIADIQDD-LGHALCANVLGSTNSLYVHCDVTEESQVQEAVAAAVETFGK  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM+NNAGIA      I+D D  DF  V  +N  G FLG KHAA+ M P + GSI++TA
Sbjct  95   LDIMMNNAGIADPSKPRIIDNDKHDFDRVLSINVTGVFLGIKHAAQAMIPAKTGSILSTA  154

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+   GG   HAYTCSKHA+VGLTKN A++LG++GIRVNC+
Sbjct  155  SVASYTGGSASHAYTCSKHAVVGLTKNAAVELGQFGIRVNCL  196


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGL--AEDDK-LDVYSNLKGVDLMAEDVAEAVLYL  776
             LG         SP+ + T +   + GL   E +K +   +NLKGV L AEDVA A L+L
Sbjct  185  ELGQFGIRVNCLSPFALVTPLATKFVGLDGPEFEKIMGSKANLKGVTLKAEDVANAALFL  244

Query  777  ASDESKYVSGHNLVVDAGFSISN  845
            ASDES+YVSGHNL +D GFSI N
Sbjct  245  ASDESRYVSGHNLFIDGGFSIVN  267



>ref|XP_006339148.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Solanum tuberosum]
 ref|XP_006339149.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Solanum tuberosum]
Length=304

 Score =   160 bits (404),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV+IAD +D+  +  I    G  N+ ++HCDVT+E  VQ AV++ ++T G+L
Sbjct  62   KLFSEHGAKVVIADVQDELGNSVINALGGSSNSIYIHCDVTNEDHVQEAVDRTIATFGKL  121

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+ NAGI       I+D    DF  V  +N  G FL  KHAARVM P + G II+TAS
Sbjct  122  DIMICNAGICDETKSRIIDNTKADFERVLSINVTGVFLSMKHAARVMVPTRSGCIISTAS  181

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY  SKHA++GLTKN A++LG++GIRVNC+
Sbjct  182  VSSTVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRVNCL  222


 Score = 65.9 bits (159),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +     GL  ++    +    NLKG  L  +DVA+A L+LASD+++Y+SGHN
Sbjct  223  SPYAMVTPLATKVIGLENEELENAMSAVGNLKGATLKVDDVAKAALFLASDDAQYISGHN  282

Query  813  LVVDAGFSISNLAL  854
            L +D GF++ N  L
Sbjct  283  LFIDGGFTVCNPGL  296



>ref|XP_009802753.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
 ref|XP_009802755.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
sylvestris]
Length=276

 Score =   163 bits (412),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            KLF +HGAKV+IAD +D+  S S+   LG P ++ ++HCDVT+E  VQNAV++ +ST G+
Sbjct  34   KLFSEHGAKVVIADVQDE-RSNSVSNALGSPSHSIYIHCDVTNEDHVQNAVDRTISTFGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDI++ NAGI+      I+D    DF  V  +N  G FL  KHAARVM P + G II+TA
Sbjct  93   LDIIICNAGISDETKPRIIDNTKEDFERVLSINVTGVFLCMKHAARVMVPARSGCIISTA  152

Query  520  SVSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SVS  +G    HAY  SKHA++GLTKN A++LG++GIRVNC+
Sbjct  153  SVSSRVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRVNCL  194


 Score = 62.8 bits (151),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +     GL  +     L +  NLKG  L  +DVA+A L+LA ++SKY+SGHN
Sbjct  195  SPYAMVTPLATKVVGLENEMFETALSMAGNLKGAILRVDDVAKAALFLAGEDSKYISGHN  254

Query  813  LVVDAGFSISNLAL  854
            L +D GF++ N +L
Sbjct  255  LFIDGGFTVYNPSL  268



>ref|NP_001148513.1| short chain alcohol dehydrogenase1 [Zea mays]
 ref|XP_008643650.1| PREDICTED: short chain alcohol dehydrogenase1 isoform X1 [Zea 
mays]
 gb|ACG31792.1| sex determination protein tasselseed-2 [Zea mays]
 gb|ACG45115.1| sex determination protein tasselseed-2 [Zea mays]
 gb|AFW67240.1| sex determination protein tasselseed-2 isoform 1 [Zea mays]
 gb|AFW67241.1| sex determination protein tasselseed-2 isoform 2 [Zea mays]
 gb|AFW67242.1| sex determination protein tasselseed-2 isoform 3 [Zea mays]
 gb|AFW67243.1| sex determination protein tasselseed-2 isoform 4 [Zea mays]
Length=244

 Score =   155 bits (392),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 105/159 (66%), Gaps = 4/159 (3%)
 Frame = +1

Query  175  QHGAKVLIADTRDDDESQSICKDLG--PGNAFFVHCDVTSEADVQNAVNKAVSTHGRLDI  348
            +HGAKV IAD +D+   Q +   LG     A FVHCDVTSE DV  AV+ A    G LD+
Sbjct  2    EHGAKVCIADIQDE-AGQQLRDALGGDAQGAMFVHCDVTSEEDVSRAVDAAAERFGALDV  60

Query  349  MVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTASVS  528
            MVNNAG+ G K  DI + D  +   V  VN  G FLG KHAAR M P +RGSI++ ASV+
Sbjct  61   MVNNAGVTGTKVTDIRNVDFAEARRVLDVNVHGVFLGMKHAARAMIPRKRGSIVSLASVA  120

Query  529  GVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
              +GG   H YT SKHA+VGLTK+ A +LGR+G+RVNCV
Sbjct  121  SAIGGTGPHVYTASKHAVVGLTKSVAAELGRHGVRVNCV  159


 Score = 70.1 bits (170),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +   G   DD L  +       +NLKGVD M EDVA+AVLYLASDE++
Sbjct  160  SPYAVPTALSMPHLPQGARADDALKDFLAFVGGEANLKGVDAMPEDVAQAVLYLASDEAR  219

Query  795  YVSGHNLVVDAGFSISN  845
            YVS  NL+VD GF+  N
Sbjct  220  YVSAVNLMVDGGFTAVN  236



>dbj|BAA13541.1| CPRD12 protein [Vigna unguiculata]
Length=267

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 116/161 (72%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF QHGA V++AD +DD    S+C +L   +A +VHCDVT E D++  V+ AVS  G+L
Sbjct  34   RLFSQHGAHVVVADIQDD-VGLSLCNELK--SAIYVHCDVTKEEDIEKCVDTAVSKFGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAG        ILD   +DF  V  VN +G FLGTKHAARVM P +RG IINTAS
Sbjct  91   DIMFNNAGTGDEFKKSILDNTKSDFERVISVNLVGPFLGTKHAARVMIPARRGCIINTAS  150

Query  523  VSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+G + GG  HAYT SKHA+VGLTKNTA++LG++GIRVNCV
Sbjct  151  VAGCIGGGATHAYTSSKHALVGLTKNTAVELGQFGIRVNCV  191


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SP+ I T ++  YF L E+     Y NLKG   +  DVAEA LYLASDE
Sbjct  181  LGQFGIRVNCVSPFAIVTPLLNKYFNLDEEGVRKTYMNLKGWYPVPNDVAEAALYLASDE  240

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            SK+VS HNLV+D G   SN+  
Sbjct  241  SKFVSSHNLVIDGGLINSNVGF  262



>ref|XP_006339150.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X3 
[Solanum tuberosum]
 ref|XP_006339151.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X4 
[Solanum tuberosum]
 ref|XP_006339152.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X5 
[Solanum tuberosum]
Length=276

 Score =   159 bits (403),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGAKV+IAD +D+  +  I    G  N+ ++HCDVT+E  VQ AV++ ++T G+L
Sbjct  34   KLFSEHGAKVVIADVQDELGNSVINALGGSSNSIYIHCDVTNEDHVQEAVDRTIATFGKL  93

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM+ NAGI       I+D    DF  V  +N  G FL  KHAARVM P + G II+TAS
Sbjct  94   DIMICNAGICDETKSRIIDNTKADFERVLSINVTGVFLSMKHAARVMVPTRSGCIISTAS  153

Query  523  VSGVMG-GFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            VS  +G    HAY  SKHA++GLTKN A++LG++GIRVNC+
Sbjct  154  VSSTVGAAASHAYCSSKHAVLGLTKNLAVELGQFGIRVNCL  194


 Score = 65.9 bits (159),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY + T +     GL  ++    +    NLKG  L  +DVA+A L+LASD+++Y+SGHN
Sbjct  195  SPYAMVTPLATKVIGLENEELENAMSAVGNLKGATLKVDDVAKAALFLASDDAQYISGHN  254

Query  813  LVVDAGFSISNLAL  854
            L +D GF++ N  L
Sbjct  255  LFIDGGFTVCNPGL  268



>gb|ABK23507.1| unknown [Picea sitchensis]
 gb|ABK26813.1| unknown [Picea sitchensis]
Length=304

 Score =   155 bits (391),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 112/162 (69%), Gaps = 4/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV++AD  D+   +++   L P  A +VHCDV+ E DV+ AV+ A+  HG+L
Sbjct  45   RLFTKHGAKVILADIADE-AGRNLAGSLSP-PATYVHCDVSKEQDVRAAVDLAMEKHGQL  102

Query  343  DIMVNNAGIAGAKGLD-ILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            DIM NNAG      ++ + + +   F  V  VN  GA LG KHAARVM P ++G II+TA
Sbjct  103  DIMYNNAGTIEFVAVESVAEYEMLQFDRVMSVNVRGAMLGIKHAARVMIPRKKGCIISTA  162

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+G++GG   +AYT SKHAI+GLTKN A +LG+YGIRVN V
Sbjct  163  SVAGILGGLTPYAYTASKHAILGLTKNGAAELGKYGIRVNTV  204


 Score = 70.5 bits (171),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 6/59 (10%)
 Frame = +3

Query  687  LAEDDKLDVYS------NLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSISN  845
            ++EDDK  V +      NL+G  L AED+AEA LYLASDE+KYVSGHNLVVD GFS+ N
Sbjct  226  VSEDDKAAVEAYCTSIGNLEGATLRAEDIAEAGLYLASDEAKYVSGHNLVVDGGFSVVN  284



>ref|XP_010035975.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
Length=307

 Score =   160 bits (405),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 6/165 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV++AD  +D   +++   L P     +VHCDV+SE DV+N V+  VS +G 
Sbjct  52   RLFARHGAKVVVADV-EDVLGEALASSLAPNYCVTYVHCDVSSEPDVENMVSSTVSRYGH  110

Query  340  LDIMVNNAGIAGA---KGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSII  510
            LDI+ NNAG+ G+   K   IL+ D  +F  V RVN  G  LG KHAA  M P   G II
Sbjct  111  LDILFNNAGVLGSQSGKSKSILNFDAEEFDCVMRVNVRGTALGMKHAAGAMIPRGSGCII  170

Query  511  NTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +TASV+GV+GG   HAYT SKHAIVGLTKN A +LGR+GIRVNC+
Sbjct  171  STASVAGVLGGLGPHAYTASKHAIVGLTKNAACELGRHGIRVNCI  215


 Score = 65.1 bits (157),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 19/87 (22%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLA---------------EDDKLDVY----SNLKGVDLMAEDVAEA  764
            SP+ + T M+   +G                 E +K++ +    +NL+G  L A+DVAEA
Sbjct  216  SPFGVATSMLVNAWGGGDREDECMSFGVPCEQEVEKMEEFVSSLANLRGPTLRAKDVAEA  275

Query  765  VLYLASDESKYVSGHNLVVDAGFSISN  845
             LYLASDESKY+SGHNLVVD G + S 
Sbjct  276  ALYLASDESKYISGHNLVVDGGITTSR  302



>ref|XP_009611083.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=326

 Score =   154 bits (390),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF QHGAKV+IAD +D   + S+ +++G  NA FVHCDV  E+DVQNAV+  V+  G+L
Sbjct  79   RLFVQHGAKVIIADIQDR-LATSVVQEIGTENAAFVHCDVAIESDVQNAVDATVAKFGKL  137

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM +NAG+ G     IL+ D      VF VN +GAF   KHAARVM P ++G I+ TAS
Sbjct  138  DIMFSNAGVLGKPISSILEVDYDIIKTVFDVNIVGAFFCAKHAARVMIPAKKGVILFTAS  197

Query  523  VSG--VMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             S    +    H  + SK+A+VGL+KN  ++LG YGIRVNCV
Sbjct  198  ASTEVYVPAIMHTSSASKNALVGLSKNVGVELGEYGIRVNCV  239


 Score = 70.9 bits (172),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL---AEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDESKYVSGHN  812
            SPY I T ++ + +G+     D       NLKG  L  EDVA+AVLYLASD+SKY SG N
Sbjct  240  SPYYISTPLVLSGYGIDKQTADKWFAEAGNLKGALLGVEDVAKAVLYLASDDSKYASGMN  299

Query  813  LVVDAGFSISNLALN  857
            LV+D GFS +N+AL 
Sbjct  300  LVLDGGFSTTNVALT  314



>gb|EYU42960.1| hypothetical protein MIMGU_mgv1a011480mg [Erythranthe guttata]
Length=280

 Score =   162 bits (410),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+IAD +DD  SQ + + LG G+    VHCDVT E  V+NAV+ AV  +G 
Sbjct  36   RLFHRHGAKVVIADIQDDLGSQ-LHERLGGGSEISTVHCDVTMEDHVRNAVDLAVEKYGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG +G    DI D +   F  +F +N  G F+G KHAAR+M P +RGSI++ A
Sbjct  95   LDIMVNNAGTSGPPCPDIRDFEIPIFEKIFDINVKGVFIGMKHAARIMIPAKRGSIVSIA  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V+GG   HAY  SKHA++GLT+N A +LG++GIRVNCV
Sbjct  155  SVASVVGGAGPHAYAGSKHAVLGLTRNVAAELGKHGIRVNCV  196


 Score = 63.2 bits (152),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +   +  L E+++ +             +NL GV+L  +DVA AV++LASDE
Sbjct  197  SPYAVETGLAVAH--LPEEERTEDALAGFRNFVGAQANLSGVELTVDDVANAVVFLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            ++YVSG NLVVD GF+ SN +L 
Sbjct  255  ARYVSGANLVVDGGFTTSNHSLR  277



>ref|XP_010917564.1| PREDICTED: momilactone A synthase-like [Elaeis guineensis]
Length=270

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF +HGA+V+IAD +DD + +++C+ LG   A +VHCD+T E+ V++AV+ AVS HG+L
Sbjct  29   KLFTRHGARVMIADVQDD-KGRALCESLGSSVASYVHCDMTDESHVRDAVDAAVSRHGKL  87

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI G+  + IL  +  DF  V  +N +G++LGTKHAARVM P +RGSI+ TAS
Sbjct  88   DIMFNNAGIIGSPCMQILKSEKADFERVVGINLVGSYLGTKHAARVMIPARRGSIVMTAS  147

Query  523  VSGVMGGFQH-AYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V+ V       AYTCSKHA++GL ++ A++LG++G+RVNCV
Sbjct  148  VASVDPAMTPVAYTCSKHAVLGLMRSAAVELGQFGVRVNCV  188


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAED---DKLDVYSNLKGVDLMAEDVAEAVLYLA  779
            LG         SPY + T +  T FG+  +   D +  ++ LKGV L AED+AEAVL+L 
Sbjct  178  LGQFGVRVNCVSPYALATPLAATAFGMGGEELEDFMHEHAILKGVRLKAEDIAEAVLFLG  237

Query  780  SDESKYVSGHNLVVDAGFSISN  845
            S+E+KYVSG NL+VD GF+ +N
Sbjct  238  SEEAKYVSGLNLLVDGGFTTAN  259



>gb|ABK22004.1| unknown [Picea sitchensis]
 gb|ACN40745.1| unknown [Picea sitchensis]
Length=289

 Score =   155 bits (392),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 7/163 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  D+   +++ + L P  A ++HCDV+ E D+  AV+ A+  HG+L
Sbjct  45   RLFTKHGAKVIIADIADE-AGRTLAESLSP-PATYLHCDVSKEQDISAAVDLAMEKHGQL  102

Query  343  DIMVNNAGIAGA---KGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            DIM NNAGI  +   KG  + + D   F  V  VN  G  LG KHAARVM P ++G II+
Sbjct  103  DIMYNNAGINDSVMVKG--VAEYDMEQFDRVMSVNVRGVMLGIKHAARVMIPRKKGCIIS  160

Query  514  TASVSGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            T SV+G++GG +++YT SKHA++GLTKN A +LG++GIRVN V
Sbjct  161  TGSVAGILGGARYSYTASKHAVIGLTKNGAAELGKFGIRVNAV  203


 Score = 70.1 bits (170),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  714  YSNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSISN  845
            ++NL+G  L A+DVAEA LYLASDE+KYVSGHNLVVD GFS++N
Sbjct  239  FANLQGTTLKAKDVAEAGLYLASDEAKYVSGHNLVVDGGFSVAN  282



>ref|XP_003554452.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
Length=275

 Score =   153 bits (387),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            ++F Q GAKV+IAD +D+    S+ + +GP    +VHCDVT E  ++NAV KAV  +G+L
Sbjct  32   EVFAQQGAKVVIADIQDE-LGHSVAQSIGPSTCCYVHCDVTDENQIKNAVQKAVDAYGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I+D D  DF  V  VN  G FLG KHAA+ M P + GSII+TAS
Sbjct  91   DIMFNNAGIVDPNKNRIIDNDKADFERVLSVNVTGVFLGMKHAAQAMIPARSGSIISTAS  150

Query  523  VSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAY C+KHA+VGLTKN A++LG++GIRVNC+
Sbjct  151  ISSYVGGAASHAYCCAKHAVVGLTKNAAVELGQFGIRVNCL  191


 Score = 71.6 bits (174),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 5/72 (7%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV----YSNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SPY + T +   + G A D++L+      +NLKGV L AEDVA A LY ASD+S+YVSG 
Sbjct  192  SPYALATPLATKFVG-ANDEELETIMNSLANLKGVTLKAEDVANAALYFASDDSRYVSGQ  250

Query  810  NLVVDAGFSISN  845
            NL++D GFSI N
Sbjct  251  NLLIDGGFSIVN  262



>ref|XP_009631424.1| PREDICTED: xanthoxin dehydrogenase-like [Nicotiana tomentosiformis]
Length=280

 Score =   157 bits (398),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q++C  LG   NA FVHCDVT+EAD+ NAV+  V   G 
Sbjct  36   RLFHKHGAKVCIADIQDE-LGQNVCGTLGNDQNACFVHCDVTAEADISNAVDLTVQKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI + + + F +V  VN  G FLG KHAAR+M P ++GSI++  
Sbjct  95   LDIMVNNAGLSGPPIPDIRNYELSVFESVLDVNLKGTFLGIKHAARIMIPQKKGSIVSLC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV   + G   HAY  SKHA++GLT+N A ++G++G+RVNCV
Sbjct  155  SVGSAIAGIGPHAYIASKHAVLGLTQNVAAEMGKHGVRVNCV  196


 Score = 67.4 bits (163),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKL-----------DVYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +   +  L ED++            +  +NL+GV+L  +DVA AVL+LASDE
Sbjct  197  SPYAVATGLALAH--LPEDERTNDALAGFRAFAEKNANLQGVELKTQDVANAVLFLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            ++Y+SGHNL+VD GFS  N +L
Sbjct  255  ARYISGHNLMVDGGFSCVNHSL  276



>ref|XP_007132471.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
 gb|ESW04465.1| hypothetical protein PHAVU_011G096800g [Phaseolus vulgaris]
Length=269

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA V+IAD +D     S+ K+L   +A ++HCDVT+E  V+NAVN  VS HG+L
Sbjct  34   RLFSKHGAHVVIADIQDH-LGLSLSKELE--SASYIHCDVTNEDHVENAVNTVVSKHGKL  90

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            D M NNAGI GA    ILD   ++F  V  VN +G FLGTKHAARVM P  RGSI+NTAS
Sbjct  91   DTMFNNAGITGANKTSILDNTKSEFEAVINVNLVGVFLGTKHAARVMIPAGRGSIVNTAS  150

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V G +GG   HAYT SKH +VGLT+NTA++LG +G+RVNCV
Sbjct  151  VCGSIGGVASHAYTSSKHGVVGLTRNTAVELGAFGVRVNCV  191


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASD  785
             LGA        SPY++ T + + +F L +     VY+NLKG  L  +DVAEA LYLASD
Sbjct  180  ELGAFGVRVNCVSPYVVATPLAKNFFKLDDKGVHGVYTNLKGAVLEPKDVAEAALYLASD  239

Query  786  ESKYVSGHNLVVDAGFSISN  845
            ESKYVSGHNLVVD  F++ N
Sbjct  240  ESKYVSGHNLVVDGAFTVVN  259



>gb|ABK24197.1| unknown [Picea sitchensis]
Length=289

 Score =   158 bits (399),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (68%), Gaps = 4/161 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  D+   + + + L P    +VHCDV+ E D+  AV+ A+  HG+L
Sbjct  44   RLFTKHGAKVIIADIADEAGGK-LAESLSP-RGTYVHCDVSKEQDMSAAVDLAMEKHGQL  101

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI  A G  + + D   F  V RVN  G  LG KHAARVM P ++G IINTAS
Sbjct  102  DIMYNNAGILAA-GKSVAEYDMEQFDRVMRVNVRGVMLGIKHAARVMIPRKKGCIINTAS  160

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V  ++GG   ++YT SKHA++GLTKN A +LG+YGIRVN V
Sbjct  161  VVSIVGGLTPYSYTASKHAVIGLTKNGAAELGKYGIRVNAV  201


 Score = 66.6 bits (161),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 13/81 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF-------GLAEDDK------LDVYSNLKGVDLMAEDVAEAVLYLAS  782
            SPY + T +   YF         +E DK       D  +NL+G  L  EDVAEA LYLAS
Sbjct  202  SPYGLATALTVEYFKEGDASSSASEIDKAAVDAFCDGVANLEGTILKVEDVAEAGLYLAS  261

Query  783  DESKYVSGHNLVVDAGFSISN  845
            DE+KYVSGHNLVVD G ++ N
Sbjct  262  DEAKYVSGHNLVVDGGITVVN  282



>gb|AER92598.1| putative short-chain alcohol dehydrogenase [Linum usitatissimum]
Length=314

 Score =   156 bits (395),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 108/176 (61%), Gaps = 26/176 (15%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDD------------DESQSICKDLGPGNAFFVHCDVTSEADVQN  306
            +LF +HGAKV+IAD +D               S  IC          VHCDV+SE DV+N
Sbjct  62   RLFAKHGAKVVIADIQDSLGHALLHSLTNTTSSSIIC----------VHCDVSSEEDVEN  111

Query  307  AVNKAVSTHGRLDIMVNNAGIAGAKGL---DILDCDGTDFVNVFRVNTLGAFLGTKHAAR  477
             V   +S  GRLDI+VNNAGI G++      I+D D  +F  V RVN  G  L  KHAAR
Sbjct  112  LVASTLSKFGRLDILVNNAGILGSQAPGAKSIMDFDAEEFERVMRVNVKGTALCMKHAAR  171

Query  478  VMKPVQRGSIINTASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             M     G I++TASV+GVMGG   HAYT SKHA+VGLTKN A DLG+YGIRVNC+
Sbjct  172  AMLAAGGGCIVSTASVAGVMGGMGPHAYTSSKHAVVGLTKNAACDLGKYGIRVNCI  227


 Score = 67.8 bits (164),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +3

Query  717  SNLKG-VDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSISN  845
            +NLKG   L AEDVAEA LYLASDESKYVSGHNLVVD GF+ SN
Sbjct  266  ANLKGGATLKAEDVAEAALYLASDESKYVSGHNLVVDGGFTSSN  309



>gb|KDP34949.1| hypothetical protein JCGZ_09237 [Jatropha curcas]
Length=270

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            + FC+HGAKV+I D +DD   QS+ K+LG   A FVHCDVT E+D++NAV+ A+    +L
Sbjct  34   RTFCKHGAKVIIVDIQDD-LGQSLSKELGTDKAIFVHCDVTIESDIENAVDTAIFIFKKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIMVNNA I   +   I+D D  DF  V +VN +G FLGTKHAARVM P ++GSII   S
Sbjct  93   DIMVNNAAIGDPRKPSIVDNDIADFERVVKVNLIGVFLGTKHAARVMIPARQGSIITLGS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            V   +GG   HAYT +KH +VGL KN A +LGR+GIRVNC+
Sbjct  153  VCSSVGGVASHAYTSTKHGVVGLAKNAAAELGRFGIRVNCL  193


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +3

Query  609  LGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVYSNLKGVDLMAEDVAEAVLYLASDE  788
            LG         SPY I T +   +F + ED K  VYSNL+GV L  EDVA+A +YL SDE
Sbjct  183  LGRFGIRVNCLSPYFIETPLSMNFFKMKEDGKSGVYSNLEGVKLTEEDVAQAAIYLGSDE  242

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            SKYVSGHNL +D GF+  N A 
Sbjct  243  SKYVSGHNLALDGGFTTINPAF  264



>ref|XP_010922187.1| PREDICTED: zerumbone synthase-like [Elaeis guineensis]
Length=289

 Score =   153 bits (387),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +L  +HGAK+ + D +DD     +CK LG   NA F HC+VT E DV   ++  V  HG 
Sbjct  35   RLLRKHGAKICVIDIQDD-LGHRLCKSLGGEPNACFFHCNVTVEDDVHRTIDLIVEKHGT  93

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            +DIMVNNAGI G    DI   +  +F  VF VN  G FLG KHAARVM P ++GSI++ A
Sbjct  94   IDIMVNNAGITGKMVPDIRKVNLDEFKKVFDVNVHGVFLGMKHAARVMVPQKKGSIVSVA  153

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S + ++GG   H YT SKHA++GLT+N A +LG +GIRVNCV
Sbjct  154  SAASIVGGMGPHGYTGSKHAVLGLTRNVAAELGEHGIRVNCV  195


 Score = 70.9 bits (172),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 10/77 (13%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDV---------YSNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   +F      K+ V         ++NLKGVDL  +DVA AVLYLASDE+K
Sbjct  196  SPYAVPTGLTLPHF-PGSTSKVGVKGFLSYVGGHANLKGVDLHKDDVANAVLYLASDEAK  254

Query  795  YVSGHNLVVDAGFSISN  845
            YVSG NL+VD GF+  N
Sbjct  255  YVSGFNLMVDGGFTCVN  271



>gb|KDP37624.1| hypothetical protein JCGZ_06967 [Jatropha curcas]
Length=279

 Score =   157 bits (397),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 110/163 (67%), Gaps = 6/163 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+I D +D     S+C++L       ++HCDVT ++DVQNAVN A+S +G+
Sbjct  32   RLFLKHGAKVIIGDIQDT-LGHSLCQELNSKETLSYIHCDVTCDSDVQNAVNFAISKYGK  90

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAGIAG     I+D    DF   F VN  GAFL  KHAARVM P ++G II TA
Sbjct  91   LDIMFSNAGIAGNMD-SIIDIKNEDFKRCFDVNVFGAFLVAKHAARVMIPAKKGCIIFTA  149

Query  520  SVSGVMGGFQ--HAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            S   V   FQ  H Y  SKHA+VGL KN +++LG+YGIRVNCV
Sbjct  150  SNLSVT-CFQGMHPYIASKHAVVGLAKNLSIELGKYGIRVNCV  191


 Score = 66.6 bits (161),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 6/74 (8%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY------SNLKGVDLMAEDVAEAVLYLASDESKYVS  803
            SP+ + T + R   GL + +K  +        NLK V L  EDVAEAV++L SDESKYVS
Sbjct  192  SPFAVATPLFRKSTGLVDMEKEKIQELVSGSGNLKEVILEPEDVAEAVVFLGSDESKYVS  251

Query  804  GHNLVVDAGFSISN  845
            G NLV+D G+S++N
Sbjct  252  GLNLVIDGGYSLTN  265



>ref|XP_002275746.2| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=280

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 119/162 (73%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGP-GNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV+IAD +DD    SIC+ LG  G A FVHCDVTS++DV+N V+ AVS +G+
Sbjct  34   RLFVRHGAKVIIADVQDDI-GLSICEALGSHGTASFVHCDVTSDSDVKNVVDTAVSKYGK  92

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM NNAGI+G     IL  +  +F  VF VN  GAFLG KHAARVM P ++G I+ T+
Sbjct  93   LDIMFNNAGISGNLDPTILGTENENFRRVFDVNVYGAFLGAKHAARVMIPAKKGVILFTS  152

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V  G   HAYT SKHA+VGLTKN  ++LG++GIRVNC+
Sbjct  153  SVASVTSGESPHAYTMSKHAVVGLTKNLCVELGQHGIRVNCI  194


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +3

Query  600  CPRLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVY---SNLKGVDLMAEDVAEAVL  770
            C  LG         SP  I T ++R   GL +     +    +NLKGV   AEDVAEA +
Sbjct  181  CVELGQHGIRVNCISPCAIATPLLRNAMGLEKKTVEGIVCASANLKGVVAEAEDVAEAAV  240

Query  771  YLASDESKYVSGHNLVVDAGFSISN  845
            YL SDESKYVSG NLVVD G+S +N
Sbjct  241  YLGSDESKYVSGLNLVVDGGYSTTN  265



>ref|XP_009592996.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Nicotiana 
tomentosiformis]
Length=258

 Score =   155 bits (391),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGP-GNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAK++IAD +DD   QSI  ++G  G   ++HCDV  E +V+NAV+ A+S + +
Sbjct  35   RLFIKHGAKIVIADIQDD-LGQSIIDEIGERGEVSYIHCDVKVEKNVENAVDMAISKYRK  93

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAGI       IL+ D  +F NV  VN  GA +  KHAARVM P  +GSII T+
Sbjct  94   LDIMFSNAGIPEELNSTILNIDYDNFKNVIEVNVFGALMCAKHAARVMIPANKGSIIFTS  153

Query  520  SVSGVM-GGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V   G  H Y  SKHA+VG  KN  ++LG++GIRVNCV
Sbjct  154  SVASVTHSGVAHTYLASKHAVVGFAKNLGVELGQHGIRVNCV  195


 Score = 68.9 bits (167),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAVLYLASDESKYVSGH  809
            SP+ + T M+R  F + E +K + +    +NLKG  L AEDVAEA LYLASDESKY+SG 
Sbjct  196  SPFCVATPMLRNGFRIKEKEKTEEFVSEVANLKGTILEAEDVAEAALYLASDESKYISGT  255

Query  810  NLV  818
            NLV
Sbjct  256  NLV  258



>ref|XP_002527336.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF35088.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=280

 Score =   157 bits (396),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV + D  +D+  Q++C+ LG   N  + HCDVT E +VQ AV   V   G 
Sbjct  36   RLFHKHGAKVCLVDL-EDNLGQNVCESLGGEPNICYFHCDVTVEDEVQRAVEFTVDKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG++G    DI   + +DF  VF VN  G F+G KHAAR+M P+ +GSII+  
Sbjct  95   LDIMVNNAGLSGPPCPDIRYTELSDFQKVFDVNVKGTFIGMKHAARIMIPLNKGSIISLC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   H YT SKHA++GLT+N A +LG++GIRVNCV
Sbjct  155  SVASTIGGLGPHGYTGSKHAVLGLTRNVAAELGKHGIRVNCV  196


 Score = 67.0 bits (162),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 13/82 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY +PT +   +  L ED++ +             +NL+GV+L A+DVA +VL+LAS+E
Sbjct  197  SPYAVPTNLALAH--LHEDERTEDAMAGFKAFARKNANLQGVELTADDVANSVLFLASEE  254

Query  789  SKYVSGHNLVVDAGFSISNLAL  854
            S+Y+SG NL++D GF+ SN +L
Sbjct  255  SRYISGENLMIDGGFTNSNHSL  276



>gb|ABK24336.1| unknown [Picea sitchensis]
 gb|ACN40053.1| unknown [Picea sitchensis]
Length=291

 Score =   155 bits (391),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 112/162 (69%), Gaps = 4/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV++AD  D+   +++   L P  A +VHCDV+ E DV+ AV+ A+  HG+L
Sbjct  45   RLFTKHGAKVILADIADE-AGRNLAGSLSP-PATYVHCDVSKEQDVRAAVDLAMEKHGQL  102

Query  343  DIMVNNAGIAGAKGLD-ILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            DIM NNAG      ++ + + +   F  V  VN  GA LG KHAARVM P ++G II+TA
Sbjct  103  DIMYNNAGTIEFVAVESVAEYEMEQFDRVMSVNVRGAMLGIKHAARVMIPRKKGCIISTA  162

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+G++GG   +AYT SKHAI+GLTKN A +LG+YGIRVN V
Sbjct  163  SVAGILGGLTPYAYTASKHAILGLTKNGAAELGKYGIRVNTV  204


 Score = 68.9 bits (167),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 6/59 (10%)
 Frame = +3

Query  687  LAEDDKLDVYS------NLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSISN  845
            ++E+DK  V +      NL+G  L AED+AEA LYLASDE+KYVSGHNLVVD GFS+ N
Sbjct  226  VSEEDKAAVEAYCTSIGNLEGATLRAEDIAEAGLYLASDEAKYVSGHNLVVDGGFSVVN  284



>ref|NP_001051666.1| Os03g0810800 [Oryza sativa Japonica Group]
 gb|AAP73842.1| putative short chain alcohol dehydrogenase [Oryza sativa Japonica 
Group]
 gb|AAT77908.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 gb|ABF99487.1| Sex determination protein tasselseed 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13580.1| Os03g0810800 [Oryza sativa Japonica Group]
 gb|EAZ29016.1| hypothetical protein OsJ_13064 [Oryza sativa Japonica Group]
 dbj|BAG91826.1| unnamed protein product [Oryza sativa Japonica Group]
Length=281

 Score =   154 bits (389),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q +   LG   +  FVHCDV+ E DV  AV+      G 
Sbjct  36   RLFREHGAKVCIADIQDE-AGQKLRDSLGGDQDVLFVHCDVSVEEDVARAVDATAEKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG  G K  DI + D ++   V  +N +G F G KHAAR+M P ++GSII+  
Sbjct  95   LDIMVNNAGFTGQKITDIRNIDFSEVRKVIDINLVGVFHGMKHAARIMIPNKKGSIISLG  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SVS V+GG   H+YT +KHA+VGLTKN A +LG++GIRVNCV
Sbjct  155  SVSSVIGGLGPHSYTATKHAVVGLTKNVAGELGKHGIRVNCV  196


 Score = 69.3 bits (168),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   Y   G  +DD L  +       +NLKGVDL+ +DVA+AVLYLASDE++
Sbjct  197  SPYAVPTALSMPYLPQGERKDDALKDFFAFVGGEANLKGVDLLPKDVAQAVLYLASDEAR  256

Query  795  YVSGHNLVVDAGFSISN  845
            Y+S  NL+VD GF+  N
Sbjct  257  YISALNLMVDGGFTSVN  273



>gb|EAY92297.1| hypothetical protein OsI_14018 [Oryza sativa Indica Group]
Length=278

 Score =   154 bits (389),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF +HGAKV IAD +D+   Q +   LG   +  FVHCDV+ E DV  AV+      G 
Sbjct  33   RLFREHGAKVCIADIQDE-AGQKLRDSLGGDQDVLFVHCDVSVEEDVARAVDATAEKFGT  91

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG  G K  DI + D ++   V  +N +G F G KHAAR+M P ++GSII+  
Sbjct  92   LDIMVNNAGFTGQKITDIRNIDFSEVRKVIDINLVGVFHGMKHAARIMIPNKKGSIISLG  151

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SVS V+GG   H+YT +KHA+VGLTKN A +LG++GIRVNCV
Sbjct  152  SVSSVIGGLGPHSYTATKHAVVGLTKNVAGELGKHGIRVNCV  193


 Score = 69.3 bits (168),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 9/77 (12%)
 Frame = +3

Query  642  SPYIIPTQMIRTYF--GLAEDDKLDVY-------SNLKGVDLMAEDVAEAVLYLASDESK  794
            SPY +PT +   Y   G  +DD L  +       +NLKGVDL+ +DVA+AVLYLASDE++
Sbjct  194  SPYAVPTALSMPYLPQGERKDDALKDFFAFVGGEANLKGVDLLPKDVAQAVLYLASDEAR  253

Query  795  YVSGHNLVVDAGFSISN  845
            Y+S  NL+VD GF+  N
Sbjct  254  YISALNLMVDGGFTSVN  270



>ref|XP_010104810.1| Momilactone A synthase [Morus notabilis]
 gb|EXC01951.1| Momilactone A synthase [Morus notabilis]
Length=275

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            KLF  HGAKV+IAD +D+    S+C+ +G  N+ +VHCDVT E+ V+NAV++A+ T+G+L
Sbjct  34   KLFAHHGAKVVIADIQDN-LGHSVCESIGQTNSKYVHCDVTDESQVKNAVDEAIKTYGKL  92

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTAS  522
            DIM NNAGI       I + +   F +V  VN  G FLG KHAARVM P + G II+TAS
Sbjct  93   DIMFNNAGIIDKSSPRITENEKAVFEHVLSVNVTGVFLGIKHAARVMIPARSGCIISTAS  152

Query  523  VSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            +S  +GG   HAYTC+KHA++GLTKN A++LG++GIRVNCV
Sbjct  153  LSSCIGGTASHAYTCAKHAVLGLTKNAAVELGQFGIRVNCV  193


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +3

Query  606  RLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDD---KLDVYSNLKGVDLMAEDVAEAVLYL  776
             LG         SP+ + T M   Y G + +D    +   +NLK V L AEDVA A L++
Sbjct  182  ELGQFGIRVNCVSPFGVATPMAIKYAGSSAEDLENGMSFLANLKNVTLKAEDVANAALFI  241

Query  777  ASDESKYVSGHNLVVDAGFSISNLALN  857
            +SDE +Y+SGHNL++D GF+I+N + N
Sbjct  242  SSDEGRYISGHNLLIDGGFAIANPSFN  268



>ref|XP_002446247.1| hypothetical protein SORBIDRAFT_06g009610 [Sorghum bicolor]
 gb|EES10575.1| hypothetical protein SORBIDRAFT_06g009610 [Sorghum bicolor]
Length=276

 Score =   154 bits (390),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGA+V++AD +D+  ++ +C D+G G A + HCDVTSE DV  AV+ AV+T G L
Sbjct  36   RLFVEHGARVVVADIQDEAGAR-VCADVGAGAASYFHCDVTSEDDVAAAVDHAVATFGAL  94

Query  343  DIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGS-IINTA  519
            DIM NNAG++G     + D    DF  V  VN +G FLGTKHAARVM P +RG  II T+
Sbjct  95   DIMFNNAGVSGPACYSVRDSGKADFERVLAVNLVGPFLGTKHAARVMVPARRGGCIIGTS  154

Query  520  SV-SGVMGGFQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV + V G   +AY C+K A+V LT+N A +LGR+GIRVNCV
Sbjct  155  SVAAAVTGASSYAYACAKRALVALTENAAAELGRHGIRVNCV  196


 Score = 68.9 bits (167),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGL---AEDDKLDVYSNLKGVD-LMAEDVAEAVLYLASDESKYVSGH  809
            SP  + T +   Y GL   A +  ++  SNLKGV  L A+DVA AVL+LASD+++Y+SGH
Sbjct  197  SPAGVATPLTMRYMGLEAEAFEQAMEAISNLKGVGALRADDVAAAVLFLASDDARYISGH  256

Query  810  NLVVDAGFSISN  845
            NL VD G SI+N
Sbjct  257  NLFVDGGISIAN  268



>ref|XP_011094266.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Sesamum indicum]
Length=284

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 112/162 (69%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF QHGAKV+IAD +D+   Q+ C+D+G      +VHCDVT+E DV+N VN AVS +G+
Sbjct  39   RLFVQHGAKVVIADVQDE-LGQTACRDIGSSEVISYVHCDVTNETDVENVVNTAVSKYGK  97

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAG+ G     IL  D  D   VF VN  G FL  KHAARVM P +RGSI+ T+
Sbjct  98   LDIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFLCAKHAARVMIPAKRGSIVFTS  157

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V  G   HAY  SKHA+VGLTKN  ++LG YGIRVNCV
Sbjct  158  SVASVTHGVVPHAYVASKHAVVGLTKNLCIELGEYGIRVNCV  199


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +3

Query  600  CPRLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAV  767
            C  LG         SP+ + T M+     L E  K++      +NLKG  + A DVAEAV
Sbjct  186  CIELGEYGIRVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAV  245

Query  768  LYLASDESKYVSGHNLVVDAGFSISNLAL  854
            ++L+SDE KYVSG NLV+D G+S++N+AL
Sbjct  246  IFLSSDEGKYVSGQNLVIDGGYSLTNIAL  274



>ref|XP_010999595.1| PREDICTED: xanthoxin dehydrogenase isoform X1 [Populus euphratica]
Length=302

 Score =   162 bits (409),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LFC+HGAKV IAD +D+   +++C+ LG      ++HCDVT E DV+ AV+ AV   G 
Sbjct  58   RLFCRHGAKVCIADLQDN-LGRNVCESLGGEPKTCYIHCDVTIEDDVRQAVDFAVDKFGT  116

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG+ G    DI +   +DF  VF VN  G FLG KHAAR+M P+ +GSI++  
Sbjct  117  LDIMVNNAGLGGPPCPDIREVALSDFEKVFDVNVKGVFLGMKHAARIMIPLNKGSIVSLC  176

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   HAYT SKHA++GLT++ A +LG++GIRVNCV
Sbjct  177  SVASAIGGLGPHAYTGSKHAVLGLTRSVAAELGKHGIRVNCV  218


 Score = 61.2 bits (147),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +   +  L ED++ +             +NL+GV+L  +DVA AVL+LASDE
Sbjct  219  SPYGVATSLAVAH--LPEDERTEDALIGFRSFVGRNANLQGVELTVDDVANAVLFLASDE  276

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            ++Y+SG NL++D GF+ +N +L 
Sbjct  277  ARYISGDNLMLDGGFTCTNHSLR  299



>ref|XP_006828171.1| hypothetical protein AMTR_s00023p00118310 [Amborella trichopoda]
 gb|ERM95587.1| hypothetical protein AMTR_s00023p00118310 [Amborella trichopoda]
Length=297

 Score =   157 bits (397),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (71%), Gaps = 7/164 (4%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAFFVHCDVTSEADVQNAVNKAVSTHGRL  342
            +LF +HGAKV+IAD  +D   +++   L PG A +VHCDV+ E+DV N +++A++ +GRL
Sbjct  50   RLFSRHGAKVVIADI-NDVSGEALAASL-PG-ALYVHCDVSQESDVCNLIDRALTRYGRL  106

Query  343  DIMVNNAGIAGAKGL---DILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIIN  513
            DI+ NNAG+ G++      IL+ D  +F  V  VN  G  LG KHAAR M P   G II+
Sbjct  107  DILFNNAGVLGSQSQGRKSILEFDPDEFDRVMSVNVRGVALGMKHAARAMLPRGCGCIIS  166

Query  514  TASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            TASV+GV+GG   H+YT SKHAIVGLTKN A +LG++GIRVNC+
Sbjct  167  TASVAGVLGGLGPHSYTASKHAIVGLTKNAACELGKHGIRVNCI  210


 Score = 65.9 bits (159),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  717  SNLKGVDLMAEDVAEAVLYLASDESKYVSGHNLVVDAGFSISN  845
            +NLKG +L A+DVAEA LYLASDESKYVSGHNLVVD G + + 
Sbjct  250  ANLKGANLRAKDVAEAALYLASDESKYVSGHNLVVDGGVTTAR  292



>ref|XP_011094267.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Sesamum indicum]
Length=280

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 112/162 (69%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLGPGNAF-FVHCDVTSEADVQNAVNKAVSTHGR  339
            +LF QHGAKV+IAD +D+   Q+ C+D+G      +VHCDVT+E DV+N VN AVS +G+
Sbjct  35   RLFVQHGAKVVIADVQDE-LGQTACRDIGSSEVISYVHCDVTNETDVENVVNTAVSKYGK  93

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIM +NAG+ G     IL  D  D   VF VN  G FL  KHAARVM P +RGSI+ T+
Sbjct  94   LDIMFSNAGVPGNNDPRILATDYEDLRRVFDVNVFGGFLCAKHAARVMIPAKRGSIVFTS  153

Query  520  SVSGVMGG-FQHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+ V  G   HAY  SKHA+VGLTKN  ++LG YGIRVNCV
Sbjct  154  SVASVTHGVVPHAYVASKHAVVGLTKNLCIELGEYGIRVNCV  195


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +3

Query  600  CPRLGAIRYPSQLCSPYIIPTQMIRTYFGLAEDDKLDVY----SNLKGVDLMAEDVAEAV  767
            C  LG         SP+ + T M+     L E  K++      +NLKG  + A DVAEAV
Sbjct  182  CIELGEYGIRVNCVSPFGVATPMLMRTVELDEKAKVEELVSGIANLKGEKMEAVDVAEAV  241

Query  768  LYLASDESKYVSGHNLVVDAGFSISNLAL  854
            ++L+SDE KYVSG NLV+D G+S++N+AL
Sbjct  242  IFLSSDEGKYVSGQNLVIDGGYSLTNIAL  270



>ref|XP_010671866.1| PREDICTED: xanthoxin dehydrogenase-like [Beta vulgaris subsp. 
vulgaris]
Length=281

 Score =   156 bits (395),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG--PGNAFFVHCDVTSEADVQNAVNKAVSTHG  336
            +LF +HGAKV I D   DD  + +C  LG  P   FF H DVT E DV+ AV+  V + G
Sbjct  37   RLFHKHGAKVCIVDI-SDDAGRRLCDSLGGYPTICFF-HGDVTKEDDVKRAVDFTVESFG  94

Query  337  RLDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINT  516
             LDIMVNNAGI G    DI + + +DF  VF VN  G FLG KHA+R+M P ++GSII+ 
Sbjct  95   ALDIMVNNAGITGPPCDDIRNVNLSDFERVFDVNVKGVFLGMKHASRIMIPSKKGSIISL  154

Query  517  ASVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
             SVSG++GG   HAYT SKHA++GLTK+ A +LG +GIRVNCV
Sbjct  155  CSVSGLLGGLGPHAYTGSKHAVLGLTKSVAAELGLHGIRVNCV  197


 Score = 66.6 bits (161),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY IPT +   +  L ED++ +             +NLKG++L  +DVA +VL+LASDE
Sbjct  198  SPYAIPTNLAFPH--LPEDERTEDVIAGFRAFSGSKANLKGLELTVDDVANSVLFLASDE  255

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            ++YVSG NL+VD GF++ N +L 
Sbjct  256  ARYVSGDNLMVDGGFTVVNHSLQ  278



>ref|XP_010999596.1| PREDICTED: xanthoxin dehydrogenase isoform X2 [Populus euphratica]
Length=280

 Score =   162 bits (409),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  163  KLFCQHGAKVLIADTRDDDESQSICKDLG-PGNAFFVHCDVTSEADVQNAVNKAVSTHGR  339
            +LFC+HGAKV IAD +D+   +++C+ LG      ++HCDVT E DV+ AV+ AV   G 
Sbjct  36   RLFCRHGAKVCIADLQDN-LGRNVCESLGGEPKTCYIHCDVTIEDDVRQAVDFAVDKFGT  94

Query  340  LDIMVNNAGIAGAKGLDILDCDGTDFVNVFRVNTLGAFLGTKHAARVMKPVQRGSIINTA  519
            LDIMVNNAG+ G    DI +   +DF  VF VN  G FLG KHAAR+M P+ +GSI++  
Sbjct  95   LDIMVNNAGLGGPPCPDIREVALSDFEKVFDVNVKGVFLGMKHAARIMIPLNKGSIVSLC  154

Query  520  SVSGVMGGF-QHAYTCSKHAIVGLTKNTALDLGRYGIRVNCV  642
            SV+  +GG   HAYT SKHA++GLT++ A +LG++GIRVNCV
Sbjct  155  SVASAIGGLGPHAYTGSKHAVLGLTRSVAAELGKHGIRVNCV  196


 Score = 61.2 bits (147),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 13/83 (16%)
 Frame = +3

Query  642  SPYIIPTQMIRTYFGLAEDDKLD-----------VYSNLKGVDLMAEDVAEAVLYLASDE  788
            SPY + T +   +  L ED++ +             +NL+GV+L  +DVA AVL+LASDE
Sbjct  197  SPYGVATSLAVAH--LPEDERTEDALIGFRSFVGRNANLQGVELTVDDVANAVLFLASDE  254

Query  789  SKYVSGHNLVVDAGFSISNLALN  857
            ++Y+SG NL++D GF+ +N +L 
Sbjct  255  ARYISGDNLMLDGGFTCTNHSLR  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1688554632492