BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25023_g3_i1 len=1807 path=[1:0-239 241:240-253 255:254-294
296:295-307 309:308-372 374:373-390 392:391-426 428:427-553
555:554-589 591:590-630 632:631-682 684:683-843 845:844-910
912:911-951 953:952-1029 1031:1030-1184 1186:1185-1198
1200:1199-1427 1429:1428-1432 1434:1433-1468 1470:1469-1471
1473:1472-1553 1555:1554-1556 1558:1557-1619 1621:1620-1627
1629:1628-1806]

Length=1807
                                                                      Score     E

ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          744   0.0      
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          744   0.0      
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          729   0.0      
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    728   0.0      
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               727   0.0      
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    726   0.0      
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      712   0.0      
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          709   0.0      
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    709   0.0      
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    708   0.0      
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               707   0.0      
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               706   0.0      
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      704   0.0      
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          701   0.0      
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    701   0.0      
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      699   0.0      
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          697   0.0      
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          696   0.0      
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          695   0.0      
gb|ABC69419.1|  CYP72A56                                                694   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69422.1|  CYP72A58                                                693   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          693   0.0      
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          692   0.0      
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               689   0.0      
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               689   0.0      
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               684   0.0      
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          684   0.0      
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               683   0.0      
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          682   0.0      
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    682   0.0      
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               681   0.0      
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          681   0.0      
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          677   0.0      
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               672   0.0      
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    671   0.0      
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          669   0.0      
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          669   0.0      
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          664   0.0      
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          662   0.0      
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          662   0.0      
emb|CDP19599.1|  unnamed protein product                                662   0.0      
ref|XP_011082965.1|  PREDICTED: cytochrome P450 CYP72A219-like          661   0.0      
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               660   0.0      
gb|ABC69417.1|  CYP72A54                                                660   0.0      Nicotiana tabacum [American tobacco]
emb|CDP15988.1|  unnamed protein product                                659   0.0      
gb|ABC69393.1|  CYP72A55v2                                              657   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69392.1|  CYP72A55v1                                              656   0.0      Nicotiana tabacum [American tobacco]
emb|CDP19600.1|  unnamed protein product                                655   0.0      
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          655   0.0      
gb|AAZ07706.1|  cytochrome P450 monooxygenase                           654   0.0      Sesamum indicum [beniseed]
emb|CDP15976.1|  unnamed protein product                                652   0.0      
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          652   0.0      
emb|CDP15975.1|  unnamed protein product                                650   0.0      
emb|CDP15978.1|  unnamed protein product                                649   0.0      
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                646   0.0      
emb|CDP15973.1|  unnamed protein product                                645   0.0      
emb|CDP19609.1|  unnamed protein product                                644   0.0      
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          643   0.0      
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          642   0.0      Vitis vinifera
ref|XP_010092744.1|  Secologanin synthase                               644   0.0      
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               640   0.0      Vitis vinifera
ref|XP_010092742.1|  Secologanin synthase                               640   0.0      
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               640   0.0      Vitis vinifera
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    638   0.0      
emb|CBI39886.3|  unnamed protein product                                639   0.0      
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          637   0.0      
emb|CDP19601.1|  unnamed protein product                                637   0.0      
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    633   0.0      
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               636   0.0      
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          635   0.0      
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    635   0.0      
gb|KEH38475.1|  cytochrome P450 family 72 protein                       634   0.0      
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          634   0.0      Vitis vinifera
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               634   0.0      Vitis vinifera
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          634   0.0      Vitis vinifera
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          633   0.0      
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               632   0.0      Vitis vinifera
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               633   0.0      
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    630   0.0      
emb|CDP15983.1|  unnamed protein product                                630   0.0      
gb|AJD25171.1|  cytochrome P450 CYP72A330                               628   0.0      
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          625   0.0      
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               627   0.0      
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               627   0.0      
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          626   0.0      
gb|ABC69389.1|  CYP72A52v1                                              626   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               625   0.0      
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               624   0.0      
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          624   0.0      
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          624   0.0      
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          624   0.0      
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          623   0.0      
emb|CDP11335.1|  unnamed protein product                                624   0.0      
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                623   0.0      
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          622   0.0      
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          622   0.0      
gb|KEH38478.1|  cytochrome P450 family 72 protein                       620   0.0      
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             620   0.0      
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          620   0.0      
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               620   0.0      
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               620   0.0      Vitis vinifera
emb|CAN67740.1|  hypothetical protein VITISV_015554                     620   0.0      Vitis vinifera
emb|CBI22134.3|  unnamed protein product                                620   0.0      
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          620   0.0      
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          620   0.0      
gb|KHN14193.1|  Secologanin synthase                                    619   0.0      
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               619   0.0      
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  619   0.0      Medicago truncatula
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      619   0.0      
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               619   0.0      
gb|ABC69390.1|  CYP72A53v1                                              618   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               618   0.0      
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               618   0.0      
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    617   0.0      
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          617   0.0      
gb|KHN36820.1|  Secologanin synthase                                    615   0.0      
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    616   0.0      
gb|AJD25170.1|  cytochrome P450 CYP72A329                               615   0.0      
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             615   0.0      
emb|CDP15982.1|  unnamed protein product                                614   0.0      
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          613   0.0      
gb|KHG14489.1|  Secologanin synthase                                    613   0.0      
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    613   0.0      
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    613   0.0      
gb|KHN44057.1|  Secologanin synthase                                    613   0.0      
gb|AJD25169.1|  cytochrome P450 CYP72A328                               612   0.0      
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                612   0.0      
gb|KHN44056.1|  Secologanin synthase                                    612   0.0      
gb|AJD25168.1|  cytochrome P450 CYP72A327                               612   0.0      
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          611   0.0      
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    612   0.0      
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    611   0.0      
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          612   0.0      
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    611   0.0      
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          611   0.0      
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    610   0.0      
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               609   0.0      
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    609   0.0      
gb|AIA82924.1|  SLS1                                                    609   0.0      
gb|KHN47456.1|  Secologanin synthase                                    609   0.0      
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    606   0.0      
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      608   0.0      
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               608   0.0      
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          607   0.0      
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             606   0.0      
emb|CDP15979.1|  unnamed protein product                                605   0.0      
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    600   0.0      
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    603   0.0      
ref|XP_006348305.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    599   0.0      
emb|CDP15981.1|  unnamed protein product                                602   0.0      
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              602   0.0      
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             602   0.0      
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             602   0.0      
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               602   0.0      
gb|AHK60841.1|  CYP72A225                                               602   0.0      
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          601   0.0      
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like               602   0.0      
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    601   0.0      
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          601   0.0      
dbj|BAF98466.1|  cytochrome P450                                        601   0.0      Coptis japonica var. dissecta
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          601   0.0      
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    600   0.0      
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              600   0.0      
emb|CDP15980.1|  unnamed protein product                                600   0.0      
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             600   0.0      
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          599   0.0      
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          600   0.0      
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          598   0.0      
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               598   0.0      
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                597   0.0      
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    597   0.0      
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    597   0.0      
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               597   0.0      
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     596   0.0      
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          596   0.0      Vitis vinifera
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          596   0.0      
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    595   0.0      
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          595   0.0      
gb|AJD25172.1|  cytochrome P450 CYP72A331                               595   0.0      
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    595   0.0      
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               595   0.0      
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          594   0.0      
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          594   0.0      
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          593   0.0      
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    593   0.0      
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                593   0.0      
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    595   0.0      
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    593   0.0      
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    593   0.0      
gb|KEH38469.1|  cytochrome P450 family 709 protein                      592   0.0      
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              592   0.0      
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    592   0.0      
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          592   0.0      
emb|CDX97592.1|  BnaA05g24870D                                          591   0.0      
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          591   0.0      
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              590   0.0      
emb|CDP15985.1|  unnamed protein product                                590   0.0      
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              589   0.0      
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    589   0.0      
ref|XP_004300362.1|  PREDICTED: secologanin synthase-like               589   0.0      
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             588   0.0      
ref|XP_004294189.1|  PREDICTED: secologanin synthase-like               588   0.0      
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          588   0.0      
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              587   0.0      
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          587   0.0      
emb|CBI39929.3|  unnamed protein product                                584   0.0      
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          586   0.0      
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          586   0.0      
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      585   0.0      
emb|CAN72865.1|  hypothetical protein VITISV_029731                     585   0.0      Vitis vinifera
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             585   0.0      
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          585   0.0      
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              583   0.0      
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          584   0.0      
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          584   0.0      
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          581   0.0      
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          583   0.0      
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   582   0.0      
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             582   0.0      
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                582   0.0      
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             582   0.0      
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          582   0.0      
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          582   0.0      
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               582   0.0      
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    580   0.0      
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    581   0.0      
gb|AJD25167.1|  cytochrome P450 CYP72A326                               580   0.0      
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    580   0.0      
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          580   0.0      
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          579   0.0      
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          578   0.0      
gb|AGX93044.1|  secologanin synthase-like protein                       578   0.0      
gb|KHG18227.1|  Secologanin synthase                                    577   0.0      
emb|CBI39917.3|  unnamed protein product                                575   0.0      
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          578   0.0      
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    577   0.0      
emb|CBI39937.3|  unnamed protein product                                575   0.0      
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              577   0.0      
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          577   0.0      
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    576   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     576   0.0      
emb|CBI39923.3|  unnamed protein product                                573   0.0      
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          575   0.0      
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          573   0.0      
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          575   0.0      
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               574   0.0      
gb|AGX93046.1|  secologanin synthase-like protein                       574   0.0      
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              573   0.0      
emb|CDX98485.1|  BnaC05g38900D                                          573   0.0      
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              575   0.0      
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    573   0.0      
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          573   0.0      
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          573   0.0      
emb|CDP15974.1|  unnamed protein product                                570   0.0      
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              574   0.0      
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              572   0.0      
ref|XP_002882888.1|  CYP72A15                                           572   0.0      
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             572   0.0      
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             572   0.0      
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               572   0.0      
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              571   0.0      
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             572   0.0      
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              571   0.0      
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    571   0.0      
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          571   0.0      
emb|CDX98486.1|  BnaC05g38890D                                          570   0.0      
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               570   0.0      
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              570   0.0      
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              570   0.0      
emb|CDP06076.1|  unnamed protein product                                570   0.0      
gb|EPS69403.1|  hypothetical protein M569_05363                         569   0.0      
emb|CDX97593.1|  BnaA05g24860D                                          569   0.0      
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              569   0.0      
gb|KEH38476.1|  cytochrome P450 family 72 protein                       568   0.0      
gb|AGX93047.1|  secologanin synthase-like protein                       568   0.0      
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          568   0.0      
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          568   0.0      
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          568   0.0      
gb|EPS70870.1|  hypothetical protein M569_03891                         568   0.0      
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    568   0.0      
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              567   0.0      
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             566   0.0      
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          567   0.0      
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   566   0.0      
emb|CBI39938.3|  unnamed protein product                                564   0.0      
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    566   0.0      
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             566   0.0      
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          565   0.0      
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      565   0.0      
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    563   0.0      
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              565   0.0      
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      564   0.0      
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        564   0.0      
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like               564   0.0      
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              564   0.0      
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              564   0.0      
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    564   0.0      
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              564   0.0      
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like               563   0.0      
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             563   0.0      
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              563   0.0      
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      563   0.0      
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    563   0.0      
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             563   0.0      
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               564   0.0      
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          563   0.0      
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    563   0.0      
gb|AAA17732.1|  cytochrome P450                                         563   0.0      
emb|CBI39916.3|  unnamed protein product                                562   0.0      
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          563   0.0      
gb|AGX93048.1|  secologanin synthase-like protein                       562   0.0      
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          562   0.0      
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          562   0.0      
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          563   0.0      
gb|AEI59772.1|  cytochrome P450                                         562   0.0      
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              561   0.0      
emb|CDY51038.1|  BnaA06g03010D                                          561   0.0      
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    562   0.0      
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              561   0.0      
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             561   0.0      
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        561   0.0      
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              561   0.0      
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  560   0.0      
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    560   0.0      
emb|CDX98484.1|  BnaC05g38910D                                          560   0.0      
gb|AGX93049.1|  secologanin synthase-like protein                       560   0.0      
gb|AAA17746.1|  cytochrome P450                                         559   0.0      
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          560   0.0      
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               560   0.0      
gb|AGX93064.1|  secologanin synthase                                    560   0.0      
gb|AGX93045.1|  secologanin synthase-like protein                       559   0.0      
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          559   0.0      
emb|CDP14360.1|  unnamed protein product                                554   0.0      
emb|CDX82468.1|  BnaA03g33530D                                          558   0.0      
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          558   0.0      
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              557   0.0      
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              557   0.0      
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              557   0.0      
gb|EPS61172.1|  hypothetical protein M569_13627                         556   0.0      
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          556   0.0      
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          555   0.0      
gb|KEH37983.1|  cytochrome P450 family 72 protein                       556   0.0      
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    556   0.0      
emb|CDX97591.1|  BnaA05g24880D                                          555   0.0      
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          556   0.0      
gb|ADU19849.1|  putative secologanin synthase                           556   0.0      
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          556   0.0      
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    555   0.0      
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      568   0.0      
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              555   0.0      
ref|NP_001043632.1|  Os01g0627500                                       555   0.0      
emb|CDY51036.1|  BnaA06g02990D                                          554   0.0      
dbj|BAP90521.1|  secologanin synthase                                   554   0.0      
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             553   0.0      
emb|CDX82471.1|  BnaA03g33500D                                          553   0.0      
gb|EPS65653.1|  hypothetical protein M569_09124                         553   0.0      
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        553   0.0      
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          553   0.0      
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              553   0.0      
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g             552   0.0      
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    552   0.0      
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              552   0.0      
emb|CDY28093.1|  BnaC06g02740D                                          551   0.0      
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             552   0.0      
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    551   0.0      
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              551   0.0      
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     552   0.0      
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    551   0.0      
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  551   0.0      
emb|CDY32348.1|  BnaC01g36670D                                          551   0.0      
emb|CBI22133.3|  unnamed protein product                                555   0.0      
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    551   0.0      
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               550   0.0      
gb|KFK38819.1|  hypothetical protein AALP_AA3G164600                    550   0.0      
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              550   0.0      
emb|CDY20078.1|  BnaA01g29240D                                          550   0.0      
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    550   0.0      
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            551   0.0      
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              550   0.0      
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               549   0.0      
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                550   0.0      
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    549   0.0      
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      550   0.0      
emb|CDP15986.1|  unnamed protein product                                548   0.0      
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              549   0.0      
emb|CDP19607.1|  unnamed protein product                                548   0.0      
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               549   0.0      
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              548   0.0      
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              548   0.0      
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           547   0.0      
gb|KHN47459.1|  Secologanin synthase                                    547   0.0      
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      546   0.0      
emb|CDY32349.1|  BnaC01g36680D                                          545   0.0      
gb|EYU44092.1|  hypothetical protein MIMGU_mgv1a0044501mg               540   0.0      
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              545   0.0      
gb|AEI59770.1|  cytochrome P450                                         545   0.0      
gb|EYU26263.1|  hypothetical protein MIMGU_mgv1a019274mg                545   0.0      
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              544   0.0      
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          545   0.0      
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    543   0.0      
emb|CDP19608.1|  unnamed protein product                                541   0.0      
emb|CDP06075.1|  unnamed protein product                                548   0.0      
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    544   0.0      
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    543   0.0      
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             542   0.0      
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    542   0.0      
gb|EAY75042.1|  hypothetical protein OsI_02938                          543   0.0      
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    541   0.0      
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               542   0.0      
ref|XP_010644760.1|  PREDICTED: cytochrome P450 CYP72A219-like          537   0.0      
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               541   0.0      
gb|AAL38603.1|AF446870_1  AT3g14620/MIE1_12                             540   0.0      
emb|CBI22131.3|  unnamed protein product                                539   0.0      
ref|NP_188080.1|  cytochrome P450, family 72, subfamily A, polype...    540   0.0      
gb|EPS61577.1|  hypothetical protein M569_13217                         540   0.0      
gb|EYU26273.1|  hypothetical protein MIMGU_mgv1a004412mg                540   0.0      
emb|CDX97588.1|  BnaA05g24910D                                          540   0.0      
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             540   0.0      
dbj|BAN19916.1|  cytochrome P450                                        539   0.0      
dbj|BAB87118.1|  cytochrome P450                                        539   0.0      
dbj|BAN19928.1|  cytochrome P450                                        539   0.0      
emb|CDP19603.1|  unnamed protein product                                534   0.0      
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    538   0.0      
ref|XP_004969229.1|  PREDICTED: secologanin synthase-like               538   0.0      
ref|NP_001043635.1|  Os01g0627900                                       538   0.0      
dbj|BAJ95191.1|  predicted protein                                      536   0.0      
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   538   0.0      
ref|NP_001044129.1|  Os01g0728300                                       537   0.0      
dbj|BAJ89369.1|  predicted protein                                      537   0.0      
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          537   0.0      
gb|KHN44046.1|  Secologanin synthase                                    536   0.0      
ref|XP_004969234.1|  PREDICTED: secologanin synthase-like               537   0.0      
gb|AFK42047.1|  unknown                                                 537   0.0      
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      536   0.0      
ref|XP_002458201.1|  hypothetical protein SORBIDRAFT_03g028620          537   0.0      
gb|EAY75694.1|  hypothetical protein OsI_03601                          536   0.0      
dbj|BAN19927.1|  cytochrome P450                                        536   0.0      
dbj|BAL45208.1|  cytochrome P450 monooxygenase                          536   0.0      
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             536   0.0      
dbj|BAN19913.1|  cytochrome P450                                        536   0.0      
emb|CDX97589.1|  BnaA05g24900D                                          535   0.0      
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          535   0.0      
gb|AAK38094.1|  putative cytochrome P450                                535   0.0      
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              535   0.0      
ref|XP_009146337.1|  PREDICTED: cytochrome P450 72A13                   535   0.0      
ref|XP_003569406.1|  PREDICTED: cytochrome P450 72A14-like              535   0.0      
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    534   0.0      
gb|AAK38093.1|  putative cytochrome P450                                534   0.0      
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          533   0.0      
ref|XP_002455991.1|  hypothetical protein SORBIDRAFT_03g028590          534   1e-180   
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             533   1e-180   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             532   2e-180   
ref|XP_004969230.1|  PREDICTED: secologanin synthase-like               533   2e-180   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               533   2e-180   
emb|CBI39912.3|  unnamed protein product                                530   2e-180   
ref|XP_004969239.1|  PREDICTED: secologanin synthase-like               533   3e-180   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    532   3e-180   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          532   4e-180   
emb|CDM83378.1|  unnamed protein product                                533   4e-180   
gb|AAK38090.1|  putative cytochrome P450                                532   6e-180   
ref|XP_003569207.1|  PREDICTED: cytochrome P450 72A15-like              532   6e-180   
dbj|BAB02396.1|  cytochrome P450                                        531   8e-180   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               531   9e-180   
ref|XP_006362153.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      526   1e-179   
gb|AEI59771.1|  cytochrome P450                                         530   1e-179   
ref|XP_006477950.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    527   1e-179   
ref|XP_002455994.1|  hypothetical protein SORBIDRAFT_03g028650          531   1e-179   
gb|EAZ12776.1|  hypothetical protein OsJ_02693                          531   1e-179   
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   529   1e-179   
ref|XP_003569402.1|  PREDICTED: cytochrome P450 72A13-like              531   2e-179   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              530   2e-179   
gb|KHG20902.1|  Secologanin synthase                                    528   5e-179   
gb|EMT23021.1|  Secologanin synthase                                    529   5e-179   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          529   6e-179   
gb|EMT26606.1|  Secologanin synthase                                    530   6e-179   
gb|EAY75044.1|  hypothetical protein OsI_02940                          534   7e-179   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       529   8e-179   
gb|EYU26264.1|  hypothetical protein MIMGU_mgv1a004586mg                528   8e-179   
ref|XP_004969233.1|  PREDICTED: secologanin synthase-like               530   1e-178   
gb|AAK38092.1|  putative cytochrome P450                                528   1e-178   
ref|XP_002455992.1|  hypothetical protein SORBIDRAFT_03g028630          528   2e-178   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    528   2e-178   
ref|XP_006646126.1|  PREDICTED: secologanin synthase-like               527   4e-178   
ref|XP_002455993.1|  hypothetical protein SORBIDRAFT_03g028640          528   4e-178   
ref|NP_001043634.1|  Os01g0627800                                       527   5e-178   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    526   5e-178   
ref|XP_006644655.1|  PREDICTED: secologanin synthase-like               526   5e-178   
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    526   6e-178   
ref|XP_006644394.1|  PREDICTED: secologanin synthase-like               526   9e-178   
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          525   2e-177   
gb|AAK38091.1|  putative cytochrome P450                                525   2e-177   
dbj|BAJ99602.1|  predicted protein                                      526   2e-177   
ref|XP_010248211.1|  PREDICTED: cytochrome P450 CYP72A219-like          521   2e-177   
ref|XP_003566917.1|  PREDICTED: cytochrome P450 72A15-like              525   2e-177   
emb|CDY20075.1|  BnaA01g29270D                                          525   3e-177   
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    523   3e-177   
gb|AAQ13551.1|AF123610_7  cytochrome P450                               525   3e-177   
ref|NP_001043631.1|  Os01g0627400                                       525   6e-177   
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              524   7e-177   
ref|XP_009394609.1|  PREDICTED: cytochrome P450 72A15-like              524   7e-177   



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/516 (66%), Positives = 437/516 (85%), Gaps = 1/516 (0%)
 Frame = -1

Query  1738  MEMvfslaavsfavvflVCLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTK  1559
             MEM + +    FAV  ++ +W++LNWAWFRPRKL +CLR+QGLKGN YK IFGDLK+L+K
Sbjct  1     MEMAYYIVLSLFAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSK  60

Query  1558  TTKEAKSKPMNLSHD-ISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTK  1382
             + +EAKSKP+N+S D I PR+LP+FI+AI++ G+NSF+WLGPNP+V +++P +++D+LTK
Sbjct  61    SIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTK  120

Query  1381  NTIYHKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLG  1202
             +++Y KP + PL +LLA+GI +YEEDKW+KHR+I+NPAFHMEK+KHM+PA  +SC EM+ 
Sbjct  121   HSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAIQLSCSEMVS  180

Query  1201  NLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRS  1022
               ++    +G  E+D+WP+LQ++  DAISRTAFGSNYEEGRKIFELQKEQA+H   +  +
Sbjct  181   QWKEAASVKGSCELDIWPYLQRLSSDAISRTAFGSNYEEGRKIFELQKEQAEHVIAISST  240

Query  1021  IYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNE  842
             +YIPGWRF+PT RNRRMK+IEK+VQA +R IIDKRVK M+AGE + DDLLGILL+SNF E
Sbjct  241   LYIPGWRFMPTKRNRRMKEIEKEVQATVRGIIDKRVKTMKAGEANADDLLGILLDSNFKE  300

Query  841   IEKHGNKDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLF  662
             IE+HG+K+FG++T+EVIEECKLFYF GQETTSVLLVWTMVLL RH EWQ RAREEV ++F
Sbjct  301   IEQHGSKNFGMSTQEVIEECKLFYFAGQETTSVLLVWTMVLLSRHPEWQARAREEVLQVF  360

Query  661   GKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVIL  482
             G    + DGLN +KIVTMIL+ESLRLY PV +L R+   +T+LG+L LP GV++S+P++L
Sbjct  361   GDGMLEFDGLNRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPMLL  420

Query  481   NHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAM  302
              HHDE+IWG+DAKEF PERFSEGVSKATKGQ+TF PFG GPRIC+GLNFAM+EAK+ +AM
Sbjct  421   VHHDEEIWGEDAKEFKPERFSEGVSKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAM  480

Query  301   ILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             ILQR+SFELSPSY HAP S +++QPQYGAPL+  KL
Sbjct  481   ILQRFSFELSPSYTHAPQSVITMQPQYGAPLILHKL  516



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/497 (68%), Positives = 415/497 (84%), Gaps = 0/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WRVLNW WFRP+KL+K LRKQGLKGN Y+ ++GD+K+L+   KEA SKPMNLS DI+P
Sbjct  22    CIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKELSGMIKEANSKPMNLSDDIAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF+D I++ G+ SFVWLGP P+V + +P LI+++ +KN +Y KP +NPL KLLA+G
Sbjct  82    RLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKEVFSKNYLYQKPHSNPLTKLLAQG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + + EEDKW+KHR+I+ PAFH+EKLKHM+PAF +SC EML   E  +  +G  E+D+WP 
Sbjct  142   LVSQEEDKWAKHRKIVTPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVAVEGSHEIDIWPG  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YE GR+IFELQKEQAQ   E +RS+YIPGWRFLPT RNRRMK+
Sbjct  202   LQQLTSDVISRTAFGSSYEAGRRIFELQKEQAQFLMEAIRSVYIPGWRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IEK VQAL+R IIDKRVK+M+AGE + +DLLGILLESNF EIE+HGNKDFG++  EVI+E
Sbjct  262   IEKDVQALVRGIIDKRVKSMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIQE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT++LL RHQ+WQ  AREEV ++FG  KPD DGLN +KIVTMI
Sbjct  322   CKLFYFAGQETTSVLLVWTLILLSRHQDWQALAREEVLQVFGNQKPDFDGLNRLKIVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY PV++LTR+ KE+T LGD+ LP GVLIS+PVIL HHDE+IWG DAK+F PER
Sbjct  382   LYESLRLYPPVVTLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +GVS ATKGQ+TF PF  GPRIC+G NFAMLEAK  +AMILQR+SFELSPSYAHAP S
Sbjct  442   FRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTTLAMILQRFSFELSPSYAHAPQS  501

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGAPL+  K+
Sbjct  502   IITLQPQYGAPLILHKI  518



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/497 (67%), Positives = 413/497 (83%), Gaps = 0/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WRVLNW WFRP+KL+K LRKQGLKGN YK ++GD+K+L+   KEA SKPMNLS DI+P
Sbjct  22    CIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSGMIKEANSKPMNLSDDIAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF+D I++ G+ SFVWLGP P+VLI +P LI++I +K  +Y KP  NP+ KLL +G
Sbjct  82    RLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFSKYYLYQKPHGNPVTKLLVQG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + + EEDKW+KHR+IINPAFH+EKLKHM+PAF +SC EML   E  +  +G  E+DVWPH
Sbjct  142   LVSLEEDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLCKWEDIVSIKGSHEIDVWPH  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+Q+  D ISRTAFGSN+EEG++IFELQKEQAQ+  E +RS+YIPGWRFLPT RNRRMK+
Sbjct  202   LEQLSSDVISRTAFGSNFEEGKRIFELQKEQAQYFVEAIRSVYIPGWRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             +EK V+A IR IIDKRVKAM+AGE S +DLLGILLESNF E E+H +KD  ++  EVI+E
Sbjct  262   VEKDVRASIRGIIDKRVKAMKAGEASNEDLLGILLESNFTEAEQHRHKDSAMSIEEVIQE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFY  GQETTSVLLVWT++LL RHQ+WQ+RAREEVF++FG  KPD DGLN +K+VTMI
Sbjct  322   CKLFYVAGQETTSVLLVWTLILLSRHQDWQSRAREEVFQVFGNQKPDFDGLNRLKVVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY+PV+SL R+  E+  LG++ LP GVL+S+PVIL HHDE+IWG DAK+FNPER
Sbjct  382   LYESLRLYSPVVSLIRRPNEDAILGNVSLPEGVLLSLPVILLHHDEEIWGKDAKKFNPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +GVS ATKGQ+TF PF  GPRIC+G NFAMLEAK  +AMILQR+SFELSPSYAHAP S
Sbjct  442   FRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTALAMILQRFSFELSPSYAHAPQS  501

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQ+GAPL+  K+
Sbjct  502   ILTMQPQHGAPLILHKI  518



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/497 (68%), Positives = 410/497 (82%), Gaps = 2/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WRVLNW WFRP+KL+K  RKQGLKGN Y+ ++GD+K+L+   +EA SKPMNLS DI+P
Sbjct  22    CIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGMIEEANSKPMNLSDDIAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF+D I++ G+ SFVWLGP P+V I +P LI+++ +KN +Y KP +NPL KLLA+G
Sbjct  82    RLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKNYLYEKPHSNPLTKLLAQG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + + E DKW+KHR+II PAFH+EKLKHM+PAF +SC EML   E  +  +G  E+D+WP 
Sbjct  142   LVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVAVEGSHEIDIWPG  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGR+IFELQKEQAQH  + +RSIYIPGWRFLPT RNRRMK+
Sbjct  202   LQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IEK VQA I  IIDKR  AM+AGE + +DLLGILLESNF EIE+HGNKDFG++  EVIEE
Sbjct  262   IEKDVQASITGIIDKR--AMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEE  319

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT++LL RHQ+WQ +AREEV ++FG  KPD DGLN +KIV  +
Sbjct  320   CKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRLKIVREL  379

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY PV+SLTR+ KE+T LGD+ LP GVLIS+PVIL HHDE+IWG DAK+F PER
Sbjct  380   LYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPER  439

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +GVS A KGQ+T+ PF  GPRIC+GLNFAMLEAK  +AMILQR+SFELSPSYAHAP S
Sbjct  440   FRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSYAHAPQS  499

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGAPL+  K+
Sbjct  500   IITLQPQYGAPLILHKI  516



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/497 (66%), Positives = 415/497 (84%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W++L+WAWFRPRKL+KCLRKQGLKGN YK IFGDLK+L K+ ++ KSKP+N+   DI+PR
Sbjct  22    WKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDVKSKPLNVFDDDITPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P+F+D I+++G+N F+W+GP PMVL+ +  +IRD+  K  +Y KP   PL KLLA+G+
Sbjct  82    IVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFNKYVLYQKPKPTPLTKLLAQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             A+YEEDKW+ HR+I+NPAFHMEK+K+MVPA ++SC EM+   E+ +  +G + E+D+WP+
Sbjct  142   ASYEEDKWAMHRKILNPAFHMEKIKNMVPAIHLSCTEMVSQWEESISTKGTSCEIDIWPY  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISRTAFGSNYEEGR IFELQKEQAQH  E  R++YI G RFLPT +NRRMK+
Sbjct  202   LQKLSSDVISRTAFGSNYEEGRMIFELQKEQAQHFIEATRTLYILGSRFLPTKKNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+K VQA+IR IIDKRVKA++AGE + DDLLG+LLESNF +IE+HGNKDFG++TRE+IEE
Sbjct  262   IDKNVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHGNKDFGMSTREIIEE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTM+LL RH +WQTRAREEV ++FG  K + DGLN +KIVTMI
Sbjct  322   CKLFYFAGQETTSVLLVWTMILLSRHLDWQTRAREEVLQVFGDSKLEFDGLNRLKIVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNESLRLY P  SL RK    T+LG+L LP GV++ +P+IL HHD++IWG+DA EF PER
Sbjct  382   LNESLRLYPPADSLNRKTTTNTKLGELSLPAGVMLVLPIILLHHDKEIWGEDATEFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGVSKATKGQ+TF PFGGGPRIC+GLNF M+EAK+ +AMILQ +SFELSPSY HAP S
Sbjct  442   FSEGVSKATKGQMTFFPFGGGPRICIGLNFTMIEAKMALAMILQHFSFELSPSYTHAPQS  501

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGAPL+  KL
Sbjct  502   VITIQPQYGAPLILHKL  518



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/497 (67%), Positives = 410/497 (82%), Gaps = 2/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WRVLNW WFRP+KL+K  RKQGLKGN Y+ ++GD+K+L+   +EA SKPMNLS DI+P
Sbjct  22    CIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGMIEEANSKPMNLSDDIAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF+D I++ G+ SFVWLGP P+V I +P LI+++ +KN +Y KP +NPL KLLA+G
Sbjct  82    RLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKNYLYEKPHSNPLTKLLAQG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + + E DKW+KHR+II PAFH+EKLKHM+PAF +SC EML   E  +  +G  E+D+WP 
Sbjct  142   LVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVAVEGSHEIDIWPG  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGR+IFELQKEQAQH  + +RSIYIPGWRFLPT RNRRMK+
Sbjct  202   LQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IEK  +  +  IIDKRVKAM+AGE + +DLLGILLESNF EIE+HGNKDFG++  EVIEE
Sbjct  262   IEKDSK--VTGIIDKRVKAMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEE  319

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT++LL RHQ+WQ +AREEV ++FG  KPD DGLN +KIV  +
Sbjct  320   CKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRLKIVREL  379

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY PV+SLTR+ KE+T LGD+ LP GVLIS+PVIL HHDE+IWG DAK+F PER
Sbjct  380   LYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPER  439

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +GVS A KGQ+T+ PF  GPRIC+GLNFAMLEAK  +AMILQR+SFELSPSYAHAP S
Sbjct  440   FRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSYAHAPQS  499

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGAPL+  K+
Sbjct  500   IITLQPQYGAPLILHKI  516



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/497 (64%), Positives = 415/497 (84%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+L+WAWF PRKL+KCLR+QGLKGN YK I+GD+K+L+K+ ++A+SKP+N+S D ++PR
Sbjct  22    WRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIEDAESKPLNVSDDDLTPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP+F+  I++ G+N F+W+GP P+V++ +P +IRD+  K+ +Y KP + PL KLLA+GI
Sbjct  82    ILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFNKHALYQKPKSTPLTKLLAQGI  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMG-DQGLAEVDVWPH  1145
              +YEEDKW+KHR+I+NPAFHMEK+K M+ A  +SC EM+   E+ +   +   E+D+WP+
Sbjct  142   VSYEEDKWAKHRKILNPAFHMEKIKDMLQAVLLSCSEMVNQWEEAVSMKESSTELDIWPY  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISRTAFGSNYEEGRKIFELQKEQA+H  E+ R++YIPGWRFLPT RNRRMK+
Sbjct  202   LQRLTSDVISRTAFGSNYEEGRKIFELQKEQAEHVIEVSRTLYIPGWRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IE++VQA IR IIDKRVK M+AGE + DDLLGILLESNF EIE+HGNK+FG+T +EVIEE
Sbjct  262   IEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHGNKNFGMTIKEVIEE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSV LVWTM+LL RH +WQ RAREEV ++FG   P  DGLN +K+VTMI
Sbjct  322   CKLFYFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQVFGDGMPGFDGLNRLKVVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L+ESLRLY PV +L R+   +T+LG+L LP GV++S+P IL HHD++IWG+DA EF PER
Sbjct  382   LHESLRLYPPVSALGRRITTKTKLGELNLPAGVMLSLPTILVHHDKEIWGEDATEFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEG+SKATKGQ+TF PFG GPRIC+GLNFAM+EAK+ +AMILQR++FELSPSY HAP S
Sbjct  442   FSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMTMAMILQRFAFELSPSYTHAPQS  501

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QP+YGAPL+  +L
Sbjct  502   VITMQPKYGAPLVLHRL  518



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/498 (64%), Positives = 404/498 (81%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS-HDIS  1508
             CLW+VLNW WF+P+KL+K LRKQGL GN Y+F++GD+K  +K  KEA SKPMN+  HD++
Sbjct  17    CLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMIKEANSKPMNMDDHDLA  76

Query  1507  PRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAE  1328
             PR++PFF++ I++ G+  F W+GP P +LI +P LI+++L+K  +Y KP  NPL  L  +
Sbjct  77    PRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTYVYQKPHGNPLGTLFVQ  136

Query  1327  GIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWP  1148
             G+ +YE+DKW+KHR+IINPAFH+EKLKHM+PAFY+SC EML   E  +  +G  E+DVWP
Sbjct  137   GLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLSKWEDVVRVEGSHEIDVWP  196

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
             HLQQ+  D ISRTAFGS+YEEGRKIFELQKEQAQH  E++RS+YIPGWRFLPT RNRRMK
Sbjct  197   HLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQHFLEVIRSVYIPGWRFLPTKRNRRMK  256

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             +++  V++ IR IIDKR+KAMEAG    +DLLGILLESNF EIE HGNKDFG++  EVIE
Sbjct  257   ELKNDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIE  316

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF G ETTSV ++WT+VLL RH +WQ RAREEV ++ G  KPD DGLNH+K+VTM
Sbjct  317   ECKLFYFAGAETTSVWILWTLVLLSRHPDWQERAREEVLQVLGSRKPDFDGLNHLKVVTM  376

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY+P+  LTR+  E+  LG++ LP GVL+S+P+IL HHD+ IWG+DA +FNPE
Sbjct  377   ILYESLRLYSPITVLTRRVYEDITLGEVSLPTGVLVSLPMILLHHDKDIWGEDATKFNPE  436

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEG+S ATKGQ+T+ PF  GPRIC+G NFA+LEAK+ + MILQ +SFELSPSY HAP 
Sbjct  437   RFSEGISSATKGQVTYFPFAWGPRICIGQNFAILEAKMTLCMILQSFSFELSPSYTHAPQ  496

Query  247   STVSLQPQYGAPLLFRKL  194
             S V+ QPQYGAPL+F KL
Sbjct  497   SLVTTQPQYGAPLIFHKL  514



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/498 (66%), Positives = 404/498 (81%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDIS  1508
             CLWRVLNW WFRP+KL+K L++QG+KGN Y  ++GD K+L+   KE  SK M+L   DI+
Sbjct  22    CLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSLRIKEVTSKSMSLYDDDIA  81

Query  1507  PRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAE  1328
              R +PFF+D I++ G+ SF+WLGP P+V I +P LI+++ TK  IY K  TNPL KLLA+
Sbjct  82    QRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQ  141

Query  1327  GIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWP  1148
             G+   E DKW+KHR+IINPAFH+EKLKHM+PAF +SC EML   E  +  +   E+DVWP
Sbjct  142   GLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVSVERAYEIDVWP  201

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
             HLQQ+  D ISRTAFGS+YEEGR+IFELQ EQAQ+  E +RS+YIPGW FLPT RNRRMK
Sbjct  202   HLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMK  261

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             +IE+ VQA IR IIDKRVKAM+ GE + +DLLGILLESNF EIE+HG+K+FG++  EVIE
Sbjct  262   EIERHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFGLSIEEVIE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTS LLVWT++LL RH +WQTRAREEV ++FG  KPD DGLNH+K+VTM
Sbjct  322   ECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRKPDFDGLNHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY PV+++TR+  E+T LGD+ LP GVL+S+P +L HHDE+IWG+DAK+FNPE
Sbjct  382   ILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIWGEDAKKFNPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EGVS ATKGQ+TF PF  GPRIC+G NFAMLEAK+V+AMILQR+SF+LS SYAHAP 
Sbjct  442   RFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFDLSSSYAHAPH  501

Query  247   STVSLQPQYGAPLLFRKL  194
             S ++ QPQYGAPL+  +L
Sbjct  502   SVITTQPQYGAPLILHRL  519



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/498 (64%), Positives = 405/498 (81%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS-HDIS  1508
             CLW+VLNW WF P+KL+K LRKQGL GN Y+ ++GD+K L+   KEA SKPMN+S H+++
Sbjct  22    CLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDLSGMIKEANSKPMNMSDHNLA  81

Query  1507  PRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAE  1328
             PR++PFF++ I++ G+ SF+W+GP P +LI +P LI+++L+KN +Y KP  NPL  L  +
Sbjct  82    PRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELIKEVLSKNYVYQKPHGNPLGTLFVQ  141

Query  1327  GIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWP  1148
             G+ +YE+DKW+KHR+IINPAFH+EKLKHM+PAFY+SC EML   E  +  +G  E+DVWP
Sbjct  142   GLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLSKWEDVVQVEGSHEIDVWP  201

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
             HLQQ+  D ISRTAFGS+YEEGRKIFELQ+EQAQH  E++RS+YIPGWRFLPT RNRRMK
Sbjct  202   HLQQLTCDVISRTAFGSSYEEGRKIFELQQEQAQHFLEVIRSVYIPGWRFLPTKRNRRMK  261

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             +I+K V++ IR IIDKR+KAMEAG    +DLLGILLESNF EIE HGNKDFG++  EVIE
Sbjct  262   EIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF G ETTSV ++WT+VLL R+ +WQ RAREEV ++FG  KPD DGLNH+K+VTM
Sbjct  322   ECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAREEVLQVFGSRKPDFDGLNHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY+P+  L R+  E+  LG++ LP GVL+S+P+IL HHD+ IWG+DA +FNPE
Sbjct  382   ILYESLRLYSPITVLARRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKFNPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EG+S ATKGQ+T+ PF  GPRIC+G NFAMLEAK+ + MILQ + FELSPSY HAP 
Sbjct  442   RFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTVCMILQSFFFELSPSYTHAPQ  501

Query  247   STVSLQPQYGAPLLFRKL  194
             S V+ QPQYGAPL+F KL
Sbjct  502   SLVTTQPQYGAPLIFHKL  519



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/495 (67%), Positives = 409/495 (83%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAWFRP+KL+  LR++GLKGN YK ++GDL +LTK+  EAKSK +N+S DI+ RL
Sbjct  22    WRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKSINISDDITQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+D+I +NG++SF+WLGP P VLI  P  +++ILTKN +Y K    NP  KLLA+G+
Sbjct  82    IPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILTKNYVYLKQTHPNPFAKLLAQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
                EEDKW+KHR+IINPAFH+EKLKHM+PAFYMSC EM+   E  +  +   E+DVWP L
Sbjct  142   VLVEEDKWAKHRKIINPAFHVEKLKHMLPAFYMSCSEMISKWEDIVSKETSYELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  + ISRTAFGS+YEEGR +FELQ+EQA+H  ++ RSIYIPG RFLPT RN+RM +I
Sbjct  202   QIMTSEVISRTAFGSSYEEGRIVFELQQEQAEHIMDISRSIYIPGSRFLPTKRNKRMLEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQ+Q  IR IIDKR++AMEAGE SKDDLLGILLESN  EIE+HGNKDFG+TT EVIEEC
Sbjct  262   EKQIQTTIRHIIDKRLRAMEAGETSKDDLLGILLESNMKEIEQHGNKDFGLTTTEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMVLL  H EWQ RAREEV ++FG +KPD++GL+H+KIVTMIL
Sbjct  322   KLFYFAGQETTSVLLVWTMVLLCLHPEWQVRAREEVLQVFGNEKPDLEGLSHLKIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E+LRL+ P+   +R+NKEE +LG+L LP  V++ IP I  H+D++IWG+DAKEF PERF
Sbjct  382   YETLRLFPPLPVFSRRNKEEVKLGELQLPAEVILIIPAIFIHYDKEIWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ++F+PFG GPRIC+G NFAM+EAK+ IAMILQ++SFELSPSY HAP +T
Sbjct  442   SEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPFAT  501

Query  241   VSLQPQYGAPLLFRK  197
             +++ PQYGAPLL RK
Sbjct  502   ITIHPQYGAPLLLRK  516



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/498 (65%), Positives = 401/498 (81%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-IS  1508
             CLW+VLNW WFRP+KL+K LRKQGLKGN Y+ ++GD+K  +   KEA SKPMN+S+D +S
Sbjct  22    CLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKDFSGMIKEANSKPMNISNDDLS  81

Query  1507  PRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAE  1328
             PRL+PFF++ I++ G+  F W+GP P +LI +P LI+++L+K  +Y KP  NPL  L  +
Sbjct  82    PRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTYVYQKPHANPLGTLFVQ  141

Query  1327  GIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWP  1148
             G+ TYE+DKW+KHR+IINPAFH+EKLKHM+PAFY+SC EML   E  +  +G  E+DVWP
Sbjct  142   GLVTYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLSKWEDVVQVEGSHEIDVWP  201

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
             HLQQ+  D ISRTAFGS+YEEGRKIFELQ+EQ QH  E+ RS+YIPGWRFLPT RNRRMK
Sbjct  202   HLQQLTCDVISRTAFGSSYEEGRKIFELQQEQTQHFLEVTRSVYIPGWRFLPTKRNRRMK  261

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             +I+K V++ IR IIDKR+KAMEAG    +DLLGILLESNF EIE HGNKDFG++  EVIE
Sbjct  262   EIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF G ETTSV ++WT+VLL R  +WQ RAREEV ++ G  KPD DGLNH+K+VTM
Sbjct  322   ECKLFYFAGTETTSVWILWTLVLLSRCPDWQARAREEVLQVLGSRKPDFDGLNHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY+P+  LTR+  E+  LG++ LP GVL+S+P+IL HHD+ IWG+DA +FNPE
Sbjct  382   ILYESLRLYSPITVLTRRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKFNPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EG+S ATKGQ+T+ PF  GPRIC+G NFAMLEAK+ + MILQ +SFELSPSY HAP 
Sbjct  442   RFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQ  501

Query  247   STVSLQPQYGAPLLFRKL  194
             S V+ QPQYGAPL+F KL
Sbjct  502   SLVTTQPQYGAPLIFHKL  519



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/497 (65%), Positives = 415/497 (84%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W++L+WAWFRPRKL+KCLRKQGLKGN YK IFGDLK+L K+ ++A SKP+ +S D I PR
Sbjct  22    WKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDANSKPLKVSDDDICPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P+F+D I+++G+N F+W+GP PMVL++EP +IRD+  K  +Y KP + P+ KLLA+G+
Sbjct  82    IVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFNKYVLYQKPKSTPITKLLAQGV  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             ++YEEDKW  HR+I+NPAFHMEK+K MVPA ++SC EM+   E+ +  +G + E+D+WP+
Sbjct  142   SSYEEDKWEMHRKILNPAFHMEKIKSMVPAVHLSCTEMVSQWEESISTKGTSCEIDIWPY  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISRTAFGSNYEEGRKIFELQKE AQH  E  R++YIPG RFLPT +NRRMK+
Sbjct  202   LQRLTSDVISRTAFGSNYEEGRKIFELQKELAQHVIEATRTLYIPGSRFLPTKKNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+K+VQA+IR IIDKRVKA++AGE + DDLLG+LLESNF +IE+HGNKDFG+TTRE+IEE
Sbjct  262   IDKKVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHGNKDFGMTTREIIEE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLL W M+LL +H +WQ  AREEV ++FG  K + DGLN +KIVTMI
Sbjct  322   CKLFYFAGQETTSVLLGWAMILLSKHPDWQAHAREEVLQVFGDGKLEFDGLNRLKIVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE+LRLY PV + +RK    T+LG+L LP GV++ +P+IL HHD++IWG+DA EF PER
Sbjct  382   LNETLRLYPPVDATSRKTTTNTKLGELSLPAGVMLLLPIILLHHDKEIWGEDATEFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGVSKATKGQ+TF PFGGGPRIC+GLNFAM+EAK+ +AMILQ +SFELSPSY HAP S
Sbjct  442   FSEGVSKATKGQMTFFPFGGGPRICIGLNFAMIEAKMALAMILQHFSFELSPSYTHAPQS  501

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGAPL+  +L
Sbjct  502   VITIQPQYGAPLILHRL  518



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/497 (64%), Positives = 410/497 (82%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+L+WAWFRPRKL KCLR+QGLKGN YK IFGD+K+L+K+ ++A+SKP+++S D ++PR
Sbjct  22    WRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELSKSIEDAESKPLDVSDDDLTPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP+F+  I++ G+N F+W+G  P+V++ +P +IRD+  K+ +Y KP + PL KLLA+GI
Sbjct  82    ILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFNKHALYQKPKSTPLTKLLAQGI  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMG-DQGLAEVDVWPH  1145
              +YEE KW+KHR+I+NPAFHMEK+K M+ A ++SC EM+   E+ +   +   E+D+WP+
Sbjct  142   VSYEEVKWAKHRKILNPAFHMEKIKDMLQAVHLSCSEMVSQWEEAVSMKESSTELDIWPY  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D IS TAFGSNYEEGRKIFELQKEQA+H   + R++YIPGWRFLPT RNRRMK+
Sbjct  202   LQRLTSDVISHTAFGSNYEEGRKIFELQKEQAEHVIAVSRTLYIPGWRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IE +VQ  IR IIDKRVK ++AGE + DDLLGILLESNF EIE+HGNKDFG+T +EVIEE
Sbjct  262   IEGKVQTTIRGIIDKRVKGIKAGEANTDDLLGILLESNFKEIEQHGNKDFGMTIKEVIEE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTM+LL RH +WQ RAREEV ++FG   P  DGLN +K+VTMI
Sbjct  322   CKLFYFAGQETTSVLLVWTMILLSRHPDWQVRAREEVLQVFGDGMPGFDGLNRLKVVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L+ESLRLY PV +L R+   +T+LG+L LP GV++S+P IL HHD++IWG+DA EF PER
Sbjct  382   LHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPTILVHHDKEIWGEDATEFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F+EG+SKATKGQ+TF PFG GPRIC+GLNFAM+EAK+ +AMILQR++FELSP Y HAP S
Sbjct  442   FNEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAFELSPLYTHAPQS  501

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QP+YGAPL+  KL
Sbjct  502   VITMQPKYGAPLVLHKL  518



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/496 (66%), Positives = 408/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWF P+KL+ CLR++GLKGN YK ++GDL +LTK+  EAKSKP+N S DI+ RL
Sbjct  31    WKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPINFSDDIAQRL  90

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+++I +NG++SF+WLGP P+VLI +P  +++I TKN +Y K    NP  KLLA+G+
Sbjct  91    IPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKLLAKGL  150

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              + EEDKW+KHR+IINP FH+EKLKHM+PAFY+ C EM+   E+ +      E+DVWP L
Sbjct  151   VSLEEDKWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMISKWEEIVPKGTSTEIDVWPDL  210

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             +++  + ISRTAFGS+YEEGR +FELQKEQA+H  E+ RSIYIPG RFLPT RN+RM +I
Sbjct  211   EKMTSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRNKRMLEI  270

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EK++Q  IR IIDKR++AME GE SKDDLLGILLESN  EIE+HG+KDFG+TT EVIEEC
Sbjct  271   EKEIQTTIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTVEVIEEC  330

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  H EWQ RAREEV ++FG DKPD++GL  +KIVTMIL
Sbjct  331   KLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLKIVTMIL  390

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E+LRL+ P+ +  R NKEE +LG+L LP GV++ +P IL H+D++IWG+DAKEF PERF
Sbjct  391   YETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKEFKPERF  450

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ +F+PFGGGPRIC+G NFAM+EAK+ +AMILQR+SFELSPSY HAP + 
Sbjct  451   SEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQRFSFELSPSYTHAPFAV  510

Query  241   VSLQPQYGAPLLFRKL  194
             V++ PQYGAPLL RKL
Sbjct  511   VTIHPQYGAPLLMRKL  526



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/497 (64%), Positives = 410/497 (82%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+L+WAWFRPRKL+KCLRKQGLKGN YK I+GD+K+L+K+ ++AKSKP+N S D ++PR
Sbjct  23    WRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKELSKSIEDAKSKPLNASDDDLTPR  82

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP+F+  I++ G+N F+W+GP P+V++ +P +IRD+  K+ +Y KP   P  KLLA+GI
Sbjct  83    ILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVFNKHALYQKPKYPPQTKLLAKGI  142

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMG-DQGLAEVDVWPH  1145
              +YE+DKW+KHRRI+NPAFHMEK+K M+   ++SC EM+   E+ +   +   E+D+WP+
Sbjct  143   LSYEDDKWAKHRRILNPAFHMEKIKDMLHTVHLSCSEMVSQWEEAVSMKESSTELDIWPY  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISRTAFGSNYEEGRKIFELQKEQA+H  E+ R++YI GWRFLPT RNRRMK+
Sbjct  203   LQRLTSDVISRTAFGSNYEEGRKIFELQKEQAKHVIEVSRTLYILGWRFLPTKRNRRMKE  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IE++VQA IR IIDKRVK M+AGE + DDLLGILLESNF EIE+HGNK+FG+T ++VIEE
Sbjct  263   IEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHGNKNFGMTIKDVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLF+F GQETTSV LVWTM+LL RH +WQ RAREEV +LFG   P+ DGLN +K+VTMI
Sbjct  323   CKLFFFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQLFGDGMPEFDGLNRLKVVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L+ESLRLY P  +L R+   + +LG L LP GV++S+P IL HHD++IWG+DA +F PE+
Sbjct  383   LHESLRLYPPTAALGRRITTKMKLGKLNLPEGVMLSLPTILVHHDKEIWGEDATKFKPEK  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEG+SKATKGQ+TF PFG GPRIC+GLNFAM+EAK+ +AMILQR++FELSPSY HAP S
Sbjct  443   FSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAFELSPSYTHAPQS  502

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QP+YGAPL+  KL
Sbjct  503   VITMQPKYGAPLMLHKL  519



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/498 (65%), Positives = 395/498 (79%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDIS  1508
             C+W VLNW WFRP+KL+K L++QG+KGN Y  ++GD K+L+   KE  SK M++   DI+
Sbjct  22    CIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKSMSVYDDDIA  81

Query  1507  PRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAE  1328
             PR LPFF+D I++ G+ SF+WLGP P+V I +P LI+++ TK  IY K  TNPL KLLA+
Sbjct  82    PRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQ  141

Query  1327  GIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWP  1148
             G+   E DKW+KHR+IINPAFH+EKLKHM+PAFY+SC EML   E  +  +   E+DVWP
Sbjct  142   GLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFYLSCTEMLSKWEDVVSVERSHEIDVWP  201

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
             HLQQ+  D ISRTAFGS+YEEGR+IFELQ EQAQ+  E +RS+YIPGW FLPT RNRRMK
Sbjct  202   HLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMK  261

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             +IEK VQA IR IIDKRVKAM  GE +  DLLGILLESNF EI++HG+KDFG++  EVIE
Sbjct  262   EIEKHVQATIRGIIDKRVKAMTGGEANNKDLLGILLESNFKEIKQHGDKDFGLSIEEVIE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTS LLVWT++LL RH +WQTRAR EV ++FG  KPD DGL H+K+VTM
Sbjct  322   ECKLFYFAGQETTSALLVWTLILLCRHHDWQTRARTEVLQVFGSRKPDFDGLTHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY PV ++TR+  E+  LGD+ LP  VL+S+P +L HHDE+IWG+DAK+FNPE
Sbjct  382   ILYESLRLYPPVTTVTRRLNEDAVLGDISLPADVLLSLPAVLLHHDEEIWGEDAKKFNPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EGVS ATKGQ+TF PF  GPRIC+G NFAMLEAK+V+AMILQR+S +LS SY HA  
Sbjct  442   RFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSLDLSTSYTHALH  501

Query  247   STVSLQPQYGAPLLFRKL  194
             S ++ QPQYGAPL+  KL
Sbjct  502   SVITTQPQYGAPLILHKL  519



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/496 (66%), Positives = 406/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWF P+K++KCLR++GLKGN YK ++GDL +LTK+  EAKSKP+N S DI+ RL
Sbjct  21    WKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPINFSDDIAQRL  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+DAI +NG+NSFVWLGP P+VLI +P  +++I TKN +Y K    NP  KLLA G+
Sbjct  81    IPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              + EEDKW+KHR+II+PAFH+EKLKHM+PAFY+SC EM+   E+ +  +   E+DVWP L
Sbjct  141   VSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMISKWEEVVPKETSFELDVWPDL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  + ISRTAFGS+YEEGR +FELQKEQA++  ++ RSIYIPG RFLPT RN+RM +I
Sbjct  201   QIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNKRMLEI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  IR IIDKR+KAME GE SKDDLLGILLESN  EIE HG  DFGITT EVIEEC
Sbjct  261   EKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDFGITTSEVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  H EWQ RAR+EV ++FG DKPD++GL+ +KIVTMIL
Sbjct  321   KLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E+LRL+ P+ +  R+NKEE +LG+L LP GVL+ IP IL H+D++IWG+DAKEF PERF
Sbjct  381   YETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKAT GQ++F+PF  GPR+C+G NFAM+EAK+ + MILQ++SFELSPSY HAP + 
Sbjct  441   SEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTHAPFAI  500

Query  241   VSLQPQYGAPLLFRKL  194
             V++ PQYGAPLL R+L
Sbjct  501   VTIHPQYGAPLLMRRL  516



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/496 (65%), Positives = 406/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWFRP+K++ CLR++GLKGN YK ++GDL +LTK+  EAKSKP+N S DI+ RL
Sbjct  30    WKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPINFSDDIAQRL  89

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF++AI +NG+NSFVWLGP P+VLI +P  +++I TKN +Y K    NP  KLLA G+
Sbjct  90    IPFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHGL  149

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              + EEDKW+KHR+IINPAFH++KLKHM+P+FY+SC EM+   E+ +  +   E+D+WP L
Sbjct  150   ISLEEDKWAKHRKIINPAFHVQKLKHMLPSFYLSCSEMISKWEEVVPKETSFELDIWPDL  209

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  + ISRTAFGS+YEEGR +FELQKEQA++  E+ RSIYIPG RFLPT RN+RM +I
Sbjct  210   QIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMEIGRSIYIPGSRFLPTKRNKRMLEI  269

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  I+ IIDKR+KAME GE SKDDLLGILLESN  EIE HG K+FGITT EVIEEC
Sbjct  270   EKQVQTTIKRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRKEFGITTSEVIEEC  329

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  H EWQ RAREEV ++FG DKPD++GL+ +KIVTMIL
Sbjct  330   KLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLSRLKIVTMIL  389

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E+LRL+ P+ +  R+NKEE +LG L LP GVL+ IP IL H+D++IWG+DAKEF PERF
Sbjct  390   YETLRLFPPLPAFGRRNKEEVKLGKLHLPAGVLLIIPAILVHYDKEIWGEDAKEFKPERF  449

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
              EGVSKAT GQ++F+PF  GPR+C+G NFAM+EAK+ +AMILQ++SFELSPSY HAP + 
Sbjct  450   KEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVAMILQKFSFELSPSYTHAPFAI  509

Query  241   VSLQPQYGAPLLFRKL  194
             V++ PQYGAPLL R+L
Sbjct  510   VTIHPQYGAPLLMRRL  525



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/496 (66%), Positives = 405/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWF P+K++KCLR++GLKGN YK ++GDL +LTK+  EAKSKP+N S DI+ RL
Sbjct  21    WKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPINFSDDIAQRL  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+DAI +NG+NSFVWLGP P+VLI +P  +++I TKN +Y K    NP  KLLA G+
Sbjct  81    IPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              + EEDKW+KHR+II+PAFH+EKLKHM+PAFY+SC EM+   E+ +  +   E+DVWP L
Sbjct  141   VSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMISKWEEVVPKETSFELDVWPDL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  + ISRTAFGS+YEEGR +FELQKEQA++  ++ RSIYIPG RFLPT RN+RM +I
Sbjct  201   QIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNKRMLEI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  IR IIDKR+KAME GE SKDDLLGILLESN  EIE HG  D GITT EVIEEC
Sbjct  261   EKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDLGITTSEVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  H EWQ RAR+EV ++FG DKPD++GL+ +KIVTMIL
Sbjct  321   KLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E+LRL+ P+ +  R+NKEE +LG+L LP GVL+ IP IL H+D++IWG+DAKEF PERF
Sbjct  381   YETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKAT GQ++F+PF  GPR+C+G NFAM+EAK+ + MILQ++SFELSPSY HAP + 
Sbjct  441   SEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTHAPFAI  500

Query  241   VSLQPQYGAPLLFRKL  194
             V++ PQYGAPLL R+L
Sbjct  501   VTIHPQYGAPLLMRRL  516



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/497 (66%), Positives = 411/497 (83%), Gaps = 0/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WRVLNW WFRP+KL+  LRKQGL+GN YK ++GD+K+ +   KEA SKPM+LS D++P
Sbjct  17    CIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPMSLSDDVAP  76

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF++ I++ G+ SF+W GP P+VLI +P LI+++L+K  +Y KP  NPL  LL +G
Sbjct  77    RLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNPLATLLVQG  136

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             IATYEEDKW+KHR+IINPAFH+EKLK M+PAF +SC EML   E  +      E+DVW H
Sbjct  137   IATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIVSADSSHEIDVWSH  196

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+Q+  D ISRTAFGS+YEEGRKIFELQKEQAQ+  E+ RS+YIPG RFLPT RNRRMK+
Sbjct  197   LEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKRNRRMKE  256

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+K V+A I+ IIDKR+KAM+AG+ + +DLLGILLESN  EIE+HGNKDFG++  EVIEE
Sbjct  257   IKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSIEEVIEE  316

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLL+W++VLL R+Q+WQ RAREE+ ++FG  KPD DGLNH+KIVTMI
Sbjct  317   CKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHLKIVTMI  376

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY  +I+LTR+  E+  LG+L LP GVL+S+P+IL HHDE+IWG+DAKEF PER
Sbjct  377   LYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAKEFKPER  436

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EG+S ATKGQLT+ PF  GPRIC+G NFAMLEAK+ ++MILQR+SFELSPSYAHAP S
Sbjct  437   FREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSYAHAPRS  496

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGAPL+F KL
Sbjct  497   IITVQPQYGAPLIFHKL  513



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/497 (66%), Positives = 411/497 (83%), Gaps = 0/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WRVLNW WFRP+KL+  LRKQGL+GN YK ++GD+K+ +   KEA SKPM+LS D++P
Sbjct  23    CIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPMSLSDDVAP  82

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF++ I++ G+ SF+W GP P+VLI +P LI+++L+K  +Y KP  NPL  LL +G
Sbjct  83    RLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNPLATLLVQG  142

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             IATYEEDKW+KHR+IINPAFH+EKLK M+PAF +SC EML   E  +      E+DVW H
Sbjct  143   IATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIVSADSSHEIDVWSH  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+Q+  D ISRTAFGS+YEEGRKIFELQKEQAQ+  E+ RS+YIPG RFLPT RNRRMK+
Sbjct  203   LEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKRNRRMKE  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+K V+A I+ IIDKR+KAM+AG+ + +DLLGILLESN  EIE+HGNKDFG++  EVIEE
Sbjct  263   IKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSIEEVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLL+W++VLL R+Q+WQ RAREE+ ++FG  KPD DGLNH+KIVTMI
Sbjct  323   CKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHLKIVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY  +I+LTR+  E+  LG+L LP GVL+S+P+IL HHDE+IWG+DAKEF PER
Sbjct  383   LYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAKEFKPER  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EG+S ATKGQLT+ PF  GPRIC+G NFAMLEAK+ ++MILQR+SFELSPSYAHAP S
Sbjct  443   FREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSYAHAPRS  502

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGAPL+F KL
Sbjct  503   IITVQPQYGAPLIFHKL  519



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/496 (65%), Positives = 405/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAWF+P+KL+K LRK GLKGN YK ++GD K+LT    EA+SKP+N S DI+ RL
Sbjct  22    WRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKELTNKLNEARSKPINFSDDIAQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFFID+I +NG++SFVWLGP P+VLI  P  +++I TKN  Y K    NP  KLLA G+
Sbjct  82    VPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFTKNCAYQKQAHPNPFAKLLAIGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  EEDKW+KHR+IINPAFH+EKLKHM+PAFY SC EML   E+ +  +   E+DVWP L
Sbjct  142   ALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCTEMLSKWEEIIQKETSVELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q + G+ ISRTAFGS+YEEGR +FELQKEQA++  ++ RS+YIPG RFLPT +N+RM +I
Sbjct  202   QLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDITRSVYIPGSRFLPTKKNKRMLEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  IR IIDKR++AMEAGE SK+DLLGILLESN  EIE+HG+KDFG+TT E+IEEC
Sbjct  262   EKQVQTTIRRIIDKRLRAMEAGEPSKNDLLGILLESNMKEIEQHGSKDFGMTTIELIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQE TSVLLVWTM+LL  H EWQ RAREEV ++FG +KP+++GL+ +KIVTMIL
Sbjct  322   KLFYFAGQEATSVLLVWTMILLSVHPEWQVRAREEVLQVFGNEKPNLEGLSRLKIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E+LRL+ PV +  R+N  E +LG+L LP GVL+ IP +L H+D+++WG+DAKEF PERF
Sbjct  382   HETLRLFPPVPTYRRRNIHEVKLGELSLPAGVLLFIPTVLIHYDKELWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVS ATKGQ++F+PFG GPRIC+G NFAM+EAK+ IAMILQ++ FELSPSY+HAP + 
Sbjct  442   SEGVSNATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFCFELSPSYSHAPVAI  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++ QPQYGAPLL RKL
Sbjct  502   ITTQPQYGAPLLMRKL  517



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/496 (65%), Positives = 405/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWF+P+KL+K LRK GLKGN YK ++GD K+LT    EA+SKP+N + DI+ RL
Sbjct  22    WKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKELTNKLNEARSKPINFNDDIAQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+D+I +NG+NSFVWLGP P+VLI +P  ++ I TKN  Y K    NP  KLLA G+
Sbjct  82    IPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFTKNYGYQKQAHPNPFAKLLAIGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  EEDKW+KHR+IINPAFH+EKLKHM+PAFY SC EM+   E  +  +   E+DVWP L
Sbjct  142   ALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMISKWEDIVPKETSVELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q + G+ ISRTAFGS+YEEGR +FELQKEQA++  ++ RS+YIPG RFLPT RN+RM  I
Sbjct  202   QLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDITRSVYIPGSRFLPTKRNKRMLAI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  IR IIDKR++AMEAGE SK+DLLGILLESN  EIE+HG+K+FG+TT E+IEEC
Sbjct  262   EKQVQTTIRRIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKEFGMTTIELIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQE TSVLLVWTM+LL  H EWQ RAREEV ++FG +KP+++GL+ +KI+TMIL
Sbjct  322   KLFYFAGQEATSVLLVWTMILLSLHPEWQVRAREEVLQVFGNEKPNLEGLSRLKIMTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E+LRL+ PV +  R+NK E +LG+L LP GVL+ IP +L H+D+++WG+DAKEF PERF
Sbjct  382   HETLRLFPPVPTYRRRNKHEVKLGELSLPSGVLLFIPTVLIHYDKELWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ++F+PFG GPRIC+G NFAM+EAK+ IAMILQ++SF+LSPSY HAP + 
Sbjct  442   SEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFKLSPSYTHAPVAI  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++ QPQYGAPLL RKL
Sbjct  502   ITTQPQYGAPLLMRKL  517



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/496 (65%), Positives = 405/496 (82%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWF+P+KL+K LRK GLKGN+YK ++GDLK+LT    EAKSKP++ S D+  RL
Sbjct  22    WKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELTNKLNEAKSKPIHFSGDVPQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF D+I +NG++SF+WLGP P+VLI +P  +++ILTKN +Y +    NP  K LA G+
Sbjct  82    IPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILTKNYVYQRQTHPNPFAKKLALGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  EEDKW+KHR+II PAF +EKLKHM+PAFY SC EM+   E+ +  +   E+DVWP L
Sbjct  142   AKLEEDKWAKHRKIIQPAFQLEKLKHMLPAFYQSCSEMISKWEEIIPKETSFELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q I  + ISRTAFGS+YEEGR +FELQKEQA++   ++RS+YIPG RFLPT RN+RM +I
Sbjct  202   QLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVINIIRSVYIPGTRFLPTKRNKRMLEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  IR IIDKR++AMEAGE SKDDLLGILLESN  EIE+H +KDFGITT E+IEEC
Sbjct  262   EKQVQTTIRRIIDKRLRAMEAGETSKDDLLGILLESNMREIEQHRSKDFGITTIEMIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQET SVLLVWTM+LL  H EWQ RAREEV ++FG +KP+ +GL+H+KI+TMIL
Sbjct  322   KLFYFAGQETASVLLVWTMILLSLHPEWQARAREEVLQVFGNEKPNSEGLSHLKIMTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E+LRL+  V +  R+NK E +LG+L LP GVL+ IP IL H+D+++WG+DAKEF PERF
Sbjct  382   HETLRLFPSVPTYRRRNKHEVKLGELSLPAGVLLIIPTILIHYDKELWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ++F+PFGGGPR+C+G NFAM+EAK+ IAMILQ++SFELSPSY HAP  T
Sbjct  442   SEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPLVT  501

Query  241   VSLQPQYGAPLLFRKL  194
             +++ PQYGAPLL RKL
Sbjct  502   INIHPQYGAPLLLRKL  517



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/497 (65%), Positives = 402/497 (81%), Gaps = 0/497 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             CLW+VLNW WF P+KL+  LRKQGL GN YK ++GDL       +EA SKPMNLS DI+P
Sbjct  22    CLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLNDFIGMIREATSKPMNLSDDIAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF++ I++ G+  F+WLGP P V+I +P LI+++L+K  +Y KP  NP   LL +G
Sbjct  82    RLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEVLSKTYLYQKPGGNPFAALLVQG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +ATYEEDKW+KHR+IINPAFH+EKLKHM+PAF++ C EMLG LE  +      E+DVWPH
Sbjct  142   LATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLCCTEMLGKLEDAIPVGSSHEIDVWPH  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGRKIFELQKEQAQ+  + +R +Y+PG RFLPT RNRRMK+
Sbjct  202   LQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQNFIDAVREVYVPGRRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+ +V+  ++ IIDKR+KAM+AG    +DLLGILLESNF EIE+HGNKDFG++  EVIEE
Sbjct  262   IKNEVRTSVKGIIDKRMKAMKAGNADNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT+VLL R+Q+WQT+AREEV ++FG  KPD DGLNH+K+VTMI
Sbjct  322   CKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQAREEVLQVFGSRKPDFDGLNHLKVVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY P+I+L R+  E+  LG+L LP GVL+S+PVIL HHDE++WG+DA +FNPER
Sbjct  382   LYESLRLYPPLITLNRQVNEDIVLGELSLPAGVLVSLPVILLHHDEEVWGEDANKFNPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EG+S ATKGQ+T+ PF  GPRIC+G NFAMLEAK+ + MILQ +SFELSPSY HAP +
Sbjct  442   FREGLSSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALCMILQSFSFELSPSYTHAPKA  501

Query  244   TVSLQPQYGAPLLFRKL  194
              V++QPQ+GAPL+  KL
Sbjct  502   IVTMQPQFGAPLILHKL  518



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/497 (65%), Positives = 398/497 (80%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAWFRP+KL+K LRK GLKGN YK  +GDL ++T    EA+SKP+N S DI+ RL
Sbjct  22    WRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEITNKVNEARSKPINFSDDIAQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+D+I +NG+ SFVWLGPNP VLI +P  +++I TKN  Y K P  NP     A+G+
Sbjct  82    IPFFLDSINKNGKRSFVWLGPNPAVLITDPEHVKEIFTKNYAYQKIPHPNPFANSFAKGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             A  EEDKW+KHR+IINPAFH EK KHM+PAFY SC EM+    K++  +G + E+DVWP 
Sbjct  142   AFLEEDKWTKHRKIINPAFHFEKFKHMLPAFYQSCSEMISKW-KEINPKGTSVELDVWPD  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             +Q + G+ ISRT+FGS YEEGRK+FELQ+EQA++  ++  S+YIPG RFLPT RN+RM +
Sbjct  201   IQLMTGEVISRTSFGSCYEEGRKVFELQREQAEYVMDMTHSVYIPGSRFLPTKRNKRMLE  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             IEKQ+Q  IR IIDKR++AMEAGE SK+DLLGILLESN  EIE+HGNKDFG+TT E+IEE
Sbjct  261   IEKQIQTTIRHIIDKRLRAMEAGEASKNDLLGILLESNMKEIEQHGNKDFGMTTTELIEE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQE  SVLLVWTM+LL  H EWQ RAREEV ++ G ++P+++GLN + IVTMI
Sbjct  321   CKLFYFAGQEGNSVLLVWTMILLCLHPEWQVRAREEVLQVLGNERPNLEGLNRLHIVTMI  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE+LR++ PV    R+ K+E +LG+L LP GVL+ IP +L H+D+K+WG+DA EF PER
Sbjct  381   LNETLRVFPPVAMFRRRIKDEVKLGELSLPAGVLLFIPTVLIHYDKKLWGEDANEFKPER  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGVSKATKGQ +F PFG GPRIC+GLNFAM+EAK+ +AMILQ +SFELSPSYAHAP +
Sbjct  441   FSEGVSKATKGQASFFPFGRGPRICIGLNFAMMEAKMALAMILQNFSFELSPSYAHAPFA  500

Query  244   TVSLQPQYGAPLLFRKL  194
              VS QPQYGAPLL RKL
Sbjct  501   VVSTQPQYGAPLLMRKL  517



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/496 (65%), Positives = 396/496 (80%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAWF+P+KL+K LRK GLKGN YK  +GDL +LT    EA+SKP+N S DI+ RL
Sbjct  22    WRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNELTNKLNEARSKPINFSDDIAQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF+D+I +NG++SFVWLGP P VLI +P  +++I TKN  Y K    NP  K  A+G+
Sbjct  82    IPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFTKNYGYQKIAHPNPFAKSFAKGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  EEDKW+KHR+IINPAFH E LKHM+PAFY SC EM+   E  +  +   E+DVWP L
Sbjct  142   AFLEEDKWAKHRKIINPAFHFENLKHMLPAFYQSCSEMISKWEDIVPKETSVELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q + G+ ISRTAFGS+YEEGRK+FELQKEQA++  ++  S+YIPG RFLPT RN+RMK+I
Sbjct  202   QLMTGEVISRTAFGSSYEEGRKVFELQKEQAEYVMDMTHSVYIPGSRFLPTKRNKRMKEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQ+Q  IR II+KR++AMEAGE SK+DLLGILLESN  EIE+HGNKDFG+TT E+IEEC
Sbjct  262   EKQIQTTIRRIINKRLRAMEAGETSKNDLLGILLESNMKEIEQHGNKDFGMTTIELIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQE  SVLL+WTM+LL  H EWQ RAREEV ++FG +K +++GL+ + IVTMIL
Sbjct  322   KLFYFAGQEGNSVLLIWTMILLCLHPEWQVRAREEVLQVFGNEKTNLEGLSRLNIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE+LRL+ PV +  R+ KEE +LGDL LP GV + IP +L H+D+++WG+DAKEF PERF
Sbjct  382   NETLRLFPPVATFRRRIKEEVKLGDLSLPAGVQLFIPTVLIHYDKELWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKG+ +F PFG GPRIC+G NFAM+EAK+ IAMILQ +SFELSPSY HAP + 
Sbjct  442   SEGVSKATKGEASFFPFGRGPRICIGQNFAMMEAKMAIAMILQNFSFELSPSYTHAPLAI  501

Query  241   VSLQPQYGAPLLFRKL  194
             VS QPQYGAPLL RKL
Sbjct  502   VSTQPQYGAPLLMRKL  517



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/516 (63%), Positives = 410/516 (79%), Gaps = 1/516 (0%)
 Frame = -1

Query  1738  MEMvfslaavsfavvflVCLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTK  1559
             MEM+  + A     + L+C W+VLNWAWFRP+KL+K   + GLKG  YK ++GDL +LTK
Sbjct  1     MEMLSKIIATICVAILLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELTK  60

Query  1558  TTKEAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKN  1379
             +  EAKSKP+N S DI+ RL+PFF+D+I +NG++SF+WLGP P++LI +P  +++I TKN
Sbjct  61    SIVEAKSKPINFSDDIAQRLIPFFLDSINKNGKSSFMWLGPYPVILITDPEHVKEIFTKN  120

Query  1378  TIYHK-PFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLG  1202
              +Y K    NP+ KLLA+G+A  E DKW+KHR+IINP FH+EKLKHM+PAFYMSC EML 
Sbjct  121   YVYLKQTHPNPMTKLLAQGLANIEGDKWAKHRKIINPVFHVEKLKHMLPAFYMSCSEMLS  180

Query  1201  NLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRS  1022
               E+ +      E+DVWP LQ +  + ISRTAFGS+YEEGR +FELQKEQA++  E  +S
Sbjct  181   KWEEIVPTGTSFELDVWPDLQIMTSEVISRTAFGSSYEEGRTVFELQKEQAEYVIEKGQS  240

Query  1021  IYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNE  842
             IYIPG RFLPT RN+RM +IEK++Q  IRCIIDKR++AMEAG+ SKDDLLGILLESN  E
Sbjct  241   IYIPGSRFLPTKRNKRMLEIEKEIQTTIRCIIDKRLRAMEAGDTSKDDLLGILLESNLKE  300

Query  841   IEKHGNKDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLF  662
             IE HG KDFG+T  +V++ECKLFYF GQETTSVLLVWTM+LL  H EWQ RAREEV ++F
Sbjct  301   IELHGKKDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQIF  360

Query  661   GKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVIL  482
             G +KPD++GLN +KIVTMIL E+LRL+ P+    R+ +EE +L +L LP GVL+ IP IL
Sbjct  361   GNNKPDLEGLNRLKIVTMILYETLRLFPPLPIFGRRTEEEVKLRELNLPAGVLLIIPTIL  420

Query  481   NHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAM  302
              H+D++IWG+DAKEF PERFSEGVSKATKGQ++F+PF  GPR+C+G NFAM+EAK+ +AM
Sbjct  421   VHYDKEIWGEDAKEFKPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMALAM  480

Query  301   ILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             ILQR+SFELSPSY HAP + V++ PQYGAPLL  KL
Sbjct  481   ILQRFSFELSPSYTHAPFAVVTIHPQYGAPLLMHKL  516



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/496 (65%), Positives = 400/496 (81%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNW WFRP+KL+KCLR++GLKGN YK ++GDL +LTK+  EAKSKP+N S DI+ RL
Sbjct  19    WKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPINFSDDIAQRL  78

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF++AI +NG+ SFVWLGP P+VLI  P  +++ILTK+ +Y K    NPL KLLA+ +
Sbjct  79    IPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSYVYLKQTHPNPLTKLLAQSL  138

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
                EE+KW+KHR+IINPAFH+EKLKHM+PAFY SC EML   E+ +  +   E DVWP L
Sbjct  139   VNLEEEKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMLSKWEEIVPKETSFEFDVWPDL  198

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  + ISRTAFGS+Y+EGR +FELQKEQA++  E  RSIY+PG RFLPT  N+RM +I
Sbjct  199   QVMTSEVISRTAFGSSYQEGRIVFELQKEQAEYVMEKGRSIYVPGSRFLPTKTNKRMLEI  258

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EK++Q  IR IIDKR++AM+AGE + +DLLGILLESN  EIE HG+K+FG+T  EVIEEC
Sbjct  259   EKEIQTTIRRIIDKRLRAMKAGETNNEDLLGILLESNLEEIELHGSKEFGMTASEVIEEC  318

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  H EWQ  AREEV ++FG DKPD++GLN +KIVTMIL
Sbjct  319   KLFYFAGQETTSVLLVWTMILLCLHPEWQVLAREEVLQVFGNDKPDLEGLNRLKIVTMIL  378

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E+LRL+ P+    R+ KEE +LG+L LP GV++ IP +L H+D++IWG+DAKEF PERF
Sbjct  379   YETLRLFPPLPVFGRRTKEEVKLGELNLPDGVVLLIPAVLVHYDKEIWGEDAKEFKPERF  438

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKAT GQ++++PFGGGPRIC+G NFAMLEAK  I MILQR+SFELSPSY HAP + 
Sbjct  439   SEGVSKATNGQVSYIPFGGGPRICIGQNFAMLEAKTAITMILQRFSFELSPSYTHAPFAV  498

Query  241   VSLQPQYGAPLLFRKL  194
             V++ PQYGAPLL RKL
Sbjct  499   VTIHPQYGAPLLMRKL  514



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/496 (65%), Positives = 402/496 (81%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAW +P+KL+K LRK GLKGN YK   GDLK+ T    EAKSKP+N S DI+ RL
Sbjct  22    WRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSKPINFSDDIAQRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF D+I +NG++SFVWLGP P+VLI +P  +++I TKN +Y K    NP  KLLA G+
Sbjct  82    IPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETHPNPFSKLLAIGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  EEDKW+KHR+IINPAF  EKLKHM+PAFY SC E++   E+ +  +   E+DVWP L
Sbjct  142   AKLEEDKWAKHRKIINPAFQTEKLKHMLPAFYQSCSEIISKWEEIIPKETSFELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  + ISRTAFGS+YEEGR +FELQ EQA++ T++ RSIYIPG RFLPT R +RM +I
Sbjct  202   QLMTAEVISRTAFGSSYEEGRIVFELQNEQAEYVTDINRSIYIPGSRFLPTKRYKRMLEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EKQVQ  I+ IIDKR++AMEAGE SK+DLLGILLESN  EIE+HG+KDFG+TT EVI+EC
Sbjct  262   EKQVQTTIKRIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKDFGMTTTEVIDEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K FYF GQETT+VLLVWTM+LL  H EWQ RAREE  ++FG +KP+++GL+ +KIVTMIL
Sbjct  322   KFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPNLEGLSRLKIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E+LRL+ PV +  R+NK E +LG+L LP GVL+ IP IL H+D+++WG+DAKEF PERF
Sbjct  382   HETLRLFPPVPTYRRRNKHEVKLGELSLPAGVLLVIPAILIHYDKELWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKG+++F+PF GGPR+C+G NFAM+EAK+ IAMILQ++SFELSPSYAHAP +T
Sbjct  442   SEGVSKATKGRISFIPFTGGPRVCIGQNFAMMEAKIGIAMILQKFSFELSPSYAHAPFAT  501

Query  241   VSLQPQYGAPLLFRKL  194
             +++ PQYGAPLL RKL
Sbjct  502   ITIHPQYGAPLLMRKL  517



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/495 (64%), Positives = 398/495 (80%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             RVLNWAWF+P+KL+K LRK GLKGN YK  +GDL ++T    EA+SKP+N S DI+ RL+
Sbjct  23    RVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEITNKLNEARSKPINFSDDIAQRLI  82

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGIA  1319
             PFFID+I +NG++SFVW GP P+VLI +P  +++I TKN +Y K    NP  K LA GI 
Sbjct  83    PFFIDSINKNGKSSFVWQGPCPIVLITDPEHVKEIFTKNYVYQKDTHPNPFSKFLAVGIL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               EE+KW+KHR+IINP F +EKLKHM+PAFY SC EM+   E  +  +   E+DVWP LQ
Sbjct  143   KLEENKWAKHRKIINPVFQVEKLKHMLPAFYQSCSEMISKWEDIVPKETSVELDVWPDLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  + ISRTAFGS++EEGR +FELQKEQA+H  E+ R+IYIPG RFLPT RN+RM +IE
Sbjct  203   LMTAEIISRTAFGSSFEEGRIVFELQKEQAEHVMEISRTIYIPGSRFLPTKRNKRMLEIE  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             KQVQ  IR IIDKR++AMEAGE SK+DLLGILLESN  EIE+HG+KDFG+TT EVI+ECK
Sbjct  263   KQVQTTIRHIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKDFGMTTTEVIDECK  322

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
              FYF GQETT+VLLVWTM+LL  H EWQ RAREE  ++FG +KP+++GL+ +KIVT+IL+
Sbjct  323   FFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPNLEGLSRLKIVTIILH  382

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E+LRL+ PV +  R+NK E +LG+L LP GVL+ IP +L H+D+++WG+DA EF PERFS
Sbjct  383   ETLRLFPPVATYRRRNKHEVKLGELSLPAGVLLFIPTVLIHYDKELWGEDANEFKPERFS  442

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATKG  +F+PF GGPR+C+G NFAM+EAKL IAMILQ++SFELSPSY HAP+ST+
Sbjct  443   EGVSKATKGHFSFIPFSGGPRVCIGQNFAMMEAKLAIAMILQKFSFELSPSYTHAPSSTI  502

Query  238   SLQPQYGAPLLFRKL  194
             ++ PQYGAPLL RKL
Sbjct  503   TIHPQYGAPLLMRKL  517



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/496 (64%), Positives = 398/496 (80%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWFRP+KL+K LRK GLKGN YK ++GDLK+L     EAKSKP+N S  I+ R+
Sbjct  22    WKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELKNKLNEAKSKPINFSDGIAQRI  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
              PFF +AI +NG++SFVWLGP P+VLI EP  +++ILTKN +Y +    NP  K LA G+
Sbjct  82    NPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILTKNYVYQRQTHANPFAKKLALGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  EEDKW+KHR+II PAF +EKLKHM+PAFY SC EM+   E+ +  +   E+DVWP L
Sbjct  142   AKLEEDKWAKHRKIIQPAFQVEKLKHMLPAFYQSCSEMISKWEEIIPKETPFELDVWPDL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q I  + ISRTAFGS+YEEGR +FELQKEQA++  +++RS+YIPG RFLPT RN+RM +I
Sbjct  202   QLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVIDIIRSVYIPGTRFLPTKRNKRMLEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             E +VQ  IR IIDKR++AMEAGE SK DLLGILLESN  EI++H + DFGITT E+IEEC
Sbjct  262   ENKVQTTIRSIIDKRLRAMEAGEASKTDLLGILLESNMREIKQHRSNDFGITTAEMIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL WTM+LL  H EWQ RAREEV ++FG +KP+ +GL+ +KIVTMIL
Sbjct  322   KLFYFAGQETTSVLLAWTMILLSLHPEWQARAREEVLQVFGNEKPNSEGLSRLKIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E+LRL+  V +  R+NK E +LG+L LP GV + IP IL H+D+++WG+DAKEF PERF
Sbjct  382   HETLRLFPSVPTYRRRNKHEVKLGELSLPAGVQLIIPTILIHYDKELWGEDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ++F+PFGGGPR+C+G NFAM+EAK+ IAMILQ++SFELSPSY HAP  T
Sbjct  442   SEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPVLT  501

Query  241   VSLQPQYGAPLLFRKL  194
             +++ PQYGAPLL RKL
Sbjct  502   ITIHPQYGAPLLMRKL  517



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/498 (63%), Positives = 401/498 (81%), Gaps = 5/498 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS-HDISP  1505
             LW+VLNW WF P+KL+  LRKQGLKGN Y+ ++GD+K +T+  KEA SKPMN+S HD++P
Sbjct  20    LWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTRMIKEANSKPMNMSDHDLAP  79

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++PFF++ I + G+  F W+GP P VLI +P LI+++L+K  +Y KP  NPL  L  +G
Sbjct  80    RMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKEVLSKTYLYQKPGGNPLGSLFVQG  139

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + +YE+DKW+K+R+IINPAFH+EKLKHM+PAFY+SC EML   E   G     E+DVWPH
Sbjct  140   LVSYEKDKWAKNRKIINPAFHLEKLKHMLPAFYLSCSEMLSKWEDVEGSH---EIDVWPH  196

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGRKIFELQ EQ  H  E MRS+YIPGWRFLPT RNRRMK+
Sbjct  197   LQQLTSDVISRTAFGSSYEEGRKIFELQNEQVPHFIEAMRSVYIPGWRFLPTKRNRRMKE  256

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIE  788
             I+K V++LIR IIDKR+KAMEAG+   +DLLGILLESNF EIE+ G NKDFG++  E+IE
Sbjct  257   IKKDVRSLIRGIIDKRLKAMEAGDADNEDLLGILLESNFKEIEQQGGNKDFGMSIDEIIE  316

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF G ETTSV L+WT+VLL R+Q+WQ +AREEV ++FG  KPD +GLN +K+VTM
Sbjct  317   ECKLFYFAGSETTSVWLLWTLVLLSRYQDWQAQAREEVLQVFGSRKPDFNGLNRLKVVTM  376

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY+PV +LTR   E+  LG++ LP GVL+S+P ++ HHD++IWG+DA +FNPE
Sbjct  377   ILYESLRLYSPVTTLTRLAIEDITLGEVSLPAGVLVSLPTVILHHDKEIWGEDANKFNPE  436

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EG+S ATKGQ+T+ PF  GPRIC+G NFAMLEAK+ ++MILQ +SFELSPSY HAP 
Sbjct  437   RFREGISSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALSMILQTFSFELSPSYTHAPQ  496

Query  247   STVSLQPQYGAPLLFRKL  194
              +V++QPQYGAPL+F KL
Sbjct  497   YSVTVQPQYGAPLIFHKL  514



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/498 (63%), Positives = 401/498 (81%), Gaps = 3/498 (1%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             CLW+VLNW WFRP+KL+K LRKQGL GN Y+ ++GD+K  +K  KEA SKPMNLS+DI+P
Sbjct  18    CLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSKMIKEANSKPMNLSNDITP  77

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF++ I++ G+ SF+WL P P VLI +P LI+++ +KN  Y KP  NP   LL +G
Sbjct  78    RLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKNYFYQKPHGNPFAALLVQG  137

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YEEDKW+KHR+IINPAFH+EKLKHM+PAF++SC EML   E  +  +G  E+DVWPH
Sbjct  138   LAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEMLSKWEDAV--EGSCEIDVWPH  195

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGRKIFELQ+EQAQH  + +RS+ IP WRFLPT RNRRMK+
Sbjct  196   LQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDTVRSVNIPRWRFLPTKRNRRMKE  255

Query  964   IEKQVQALIRCIIDKRVKAMEAG-EGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             I+ +V+  ++ IIDKR+KAM+AG +   +DLLG+LLESNF EIE+HGNKDFG++  EVIE
Sbjct  256   IKNEVRTSMKGIIDKRMKAMKAGHDADNEDLLGVLLESNFKEIEQHGNKDFGMSIEEVIE  315

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQET +VLLVWT+VLL R+Q+WQT+AREEV ++FG  KPD DGLNH+K+VTM
Sbjct  316   ECKLFYFAGQETIAVLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPDFDGLNHLKVVTM  375

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY+P+ +  R+  E+T L +L LP  VL+S+P I+ HHD+ IWG+DA +FNPE
Sbjct  376   ILYESLRLYSPLFTHNRQASEDTVLVELCLPADVLVSLPTIILHHDKDIWGEDANKFNPE  435

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EG+S AT G++T+ PF  GPRIC+G NFAMLEAK+ + MILQ +SFELSPSY HAP 
Sbjct  436   RFREGISSATMGKVTYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQ  495

Query  247   STVSLQPQYGAPLLFRKL  194
               +++ PQYGAPL+F KL
Sbjct  496   PLLTIHPQYGAPLIFHKL  513



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/498 (64%), Positives = 397/498 (80%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             CLW+VLNW W  P+KL+  LRKQGL GN YK ++GDL       +EA SKPMNLS DI+P
Sbjct  22    CLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLNDFIGMIREASSKPMNLSDDIAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF++  ++ G+  F+WLGP P V+I +P LI+++L+K  +Y KP  NP   LL +G
Sbjct  82    RLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIKEVLSKTYLYQKPGGNPFAALLVQG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +ATYEEDKW+KHR+IINPAFH+EKLKHM+PAF++SC EML   E  +      E+DVWPH
Sbjct  142   LATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCTEMLSKWEDAVPLGSSREIDVWPH  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGRKIFELQ EQAQ+  + +R +YIPG RFLPT RNRRMK+
Sbjct  202   LQQLTCDVISRTAFGSSYEEGRKIFELQTEQAQNFIDAVREVYIPGRRFLPTKRNRRMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             I+ +V+  ++ IIDKR+KAM+AG   + +DLLGILLESNF EIE+HGNKDFG++  EVIE
Sbjct  262   IKNEVRTSVKGIIDKRMKAMKAGNADNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWT+VLL R+Q+WQT+AREEV ++F   KPD DGLNH+K+VTM
Sbjct  322   ECKLFYFAGQETTSVLLVWTLVLLSRYQDWQTQAREEVLQVFESRKPDFDGLNHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY P+I+L R+  E+  LG+L LP GVL+S+P+IL HHD+ IWG+DA EFNPE
Sbjct  382   ILYESLRLYPPLITLNRQVNEDIVLGELCLPAGVLVSLPMILLHHDKDIWGEDANEFNPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EG+S ATKG++T+ PF  GPRIC+G NFAMLEAK+ + MILQ +SFELSPSY HAP 
Sbjct  442   RFREGISSATKGKVTYFPFSWGPRICIGQNFAMLEAKMALCMILQSFSFELSPSYTHAPK  501

Query  247   STVSLQPQYGAPLLFRKL  194
             S V++QPQYGAPL+  KL
Sbjct  502   SLVTMQPQYGAPLILHKL  519



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/498 (63%), Positives = 391/498 (79%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VLNWAWFRP+K +K LRK GL GN YK ++GDLK+LT    EAKSKP++ S D+  RL
Sbjct  26    WKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELTNKLNEAKSKPISFSGDVPQRL  85

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             +PFF D+I +NG+NSF WLGP P+V I EP LI+ I  K+ +YHK   +NP  KLL +G+
Sbjct  86    IPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKKIFEKHYVYHKNKHSNPFAKLLVQGL  145

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              T EE KW+KHR+IINPAFH EKLKHMVPAFY SC EML   E+ +  +  AE+DVWPH 
Sbjct  146   VTLEEQKWAKHRKIINPAFHFEKLKHMVPAFYQSCSEMLRKWEEAVPKETSAELDVWPHF  205

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q + GD ISRTAFGS+YEEGR IFELQKEQA++  E + SIYIPG RFLP+ + +RM +I
Sbjct  206   QLMTGDVISRTAFGSSYEEGRIIFELQKEQAEYVMEQIFSIYIPGSRFLPSKKKKRMVEI  265

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSK--DDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             EK++Q  IR II+KR+  M+AGE S   +DLLGILLESN  EIE+HGNKDFG+T  EVI+
Sbjct  266   EKEIQTTIRRIIEKRLMTMKAGETSNNNEDLLGILLESNTKEIEQHGNKDFGMTITEVID  325

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQ+TTSVLLVWTM+LL +H EWQ RAREEV  +FG +KPD +GL+ +KIVTM
Sbjct  326   ECKLFYFAGQDTTSVLLVWTMILLCQHPEWQVRAREEVLNVFGNEKPDFEGLSRLKIVTM  385

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E+LRL+ P +   R NK+E +LG+L LP  VL+ IP IL H+++++WG+DAKEF P+
Sbjct  386   ILYETLRLFPPALLYGRTNKDEVKLGELSLPAEVLLIIPAILVHYNKELWGEDAKEFKPD  445

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGVSKAT GQ++F+PFG GPRIC+G NF M EAK+ IAMILQ++SFELSPSY HAP 
Sbjct  446   RFSEGVSKATNGQVSFIPFGWGPRICIGQNFVMTEAKMTIAMILQKFSFELSPSYTHAPV  505

Query  247   STVSLQPQYGAPLLFRKL  194
             + VS+ PQYGAPL  RKL
Sbjct  506   AVVSIHPQYGAPLHMRKL  523



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/496 (63%), Positives = 393/496 (79%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NWA+ RP++L+K LRKQGL GN Y+ ++GDLK++ K  ++ +SKP+NL  DI PR+
Sbjct  21    WRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLKMMEDGRSKPINLDDDIKPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT-NPLIKLLAEGI  1322
             L F    +Q+ G  SF+WLGP P V I +P L+++++ K  IY KP   NPL KLLA+G+
Sbjct  81    LHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNKYDIYQKPNNPNPLTKLLAQGV  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE DKW+KHR++INPAFHMEKLK M+PAFY+SC E+L   EK +  +G  EVDVWP+L
Sbjct  141   VSYEMDKWAKHRKLINPAFHMEKLKLMIPAFYLSCDEVLNKWEKSLSPEGSCEVDVWPYL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+Y+EG +IFELQ+EQA+H  +  +SIYIPGWRF+PT RN+RMK+I
Sbjct  201   QNLTSDAISRTAFGSSYQEGTRIFELQREQAEHVIKASQSIYIPGWRFVPTKRNKRMKEI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EK+VQ+ IR II +R+KAM+AGE S +DLLGILLESNF EI++HGNK FG+T  EV+EEC
Sbjct  261   EKEVQSSIRSIISRRIKAMKAGEASSEDLLGILLESNFQEIKQHGNKSFGMTIDEVVEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWT++LL R  +WQ RAREEV ++FG   PD D LNH+KIVTMIL
Sbjct  321   KLFYFAGQETTSVLLVWTLILLSRFPDWQKRAREEVLQVFGSQTPDFDSLNHLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY PV+ L RK  EET+LG L LP GV IS+P+IL HH  +IWGDDA +FNPERF
Sbjct  381   NEVLRLYPPVVGLGRKVTEETKLGKLTLPAGVQISLPIILLHHSREIWGDDAMDFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+KA K Q  F PFG GPRIC+G  FAM+EAK+ +AMILQR+SFELSPSY HAP + 
Sbjct  441   SEGVAKAQKRQGIFFPFGWGPRICIGQMFAMMEAKVALAMILQRFSFELSPSYTHAPQTI  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA LL  KL
Sbjct  501   ITLQPQHGAHLLLHKL  516



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/497 (63%), Positives = 389/497 (78%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMN-LSHDISPR  1502
             W+VLNWAWFRP+KL+K  R+QGL GN Y+ + GDLK+ +K+ KEA+SKP+N LS+DI+PR
Sbjct  22    WKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFSKSIKEAQSKPINNLSNDIAPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPF-TNPLIKLLAEG  1325
             ++P+FI  I + G+N FVW GP PM+LI E   IR+I  KN +Y KP  +NP+  LLA G
Sbjct  82    IIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFAKNYVYQKPHHSNPVANLLARG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             IA YEEDKW+KHR+I+ PAFHMEKLK M+PAFY+SC+EML   E+ +  +G  E+D+WP 
Sbjct  142   IANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEMLKEWEQIIPYEGSKELDIWPQ  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
              Q++  D ISRTAFGS+YEEGR+IFELQKEQA+   +   SIYIPG RFLPT  N++MK+
Sbjct  202   FQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQFNSIYIPGSRFLPTKSNKKMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
              EK+VQ  IR +ID R+KA EAG+   DDLLG LLESN NEIE+ G+K+FG+T  EVI E
Sbjct  262   TEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNSNEIEEQGSKEFGLTIDEVIRE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSV LVWTM+LL RHQ WQ +AREEV + FG D+P  D L+ +KIVTMI
Sbjct  322   CKLFYFAGQETTSVWLVWTMILLSRHQNWQAKAREEVLQAFGSDQPAFDELSRLKIVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY P+ +  R+  EET+LG++ LP G L+ IP IL HHD++IWG+DA+EF PER
Sbjct  382   LYESLRLYPPLATRIRRTNEETKLGNMYLPNGSLLFIPTILLHHDKEIWGEDAEEFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGV  ATKGQ+TF PFG GPRIC+G NFAMLEAK+ IA+ILQR+ FELSPSY H P  
Sbjct  442   FSEGVLNATKGQMTFFPFGAGPRICIGQNFAMLEAKMAIALILQRFEFELSPSYIHVPHC  501

Query  244   TVSLQPQYGAPLLFRKL  194
              V+LQP+YGAPLL +KL
Sbjct  502   IVALQPKYGAPLLLQKL  518



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 396/496 (80%), Gaps = 1/496 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W+ LNW W +P+K++K L+ +G KG+ YK +FGD+K++    +EAK+KPMN ++D   R
Sbjct  23    VWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKTKPMNFTNDYVAR  82

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP F   + + G+NSF+WLGP P + I +P LIR+IL+K+ IY K   NP+ KLLA+G+
Sbjct  83    VLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREILSKSYIYQKIQGNPITKLLAQGL  142

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE +KW+KHR+IINPAFH++KLKHM+P+FY+SC +ML   E     +G +E+DVWP L
Sbjct  143   VSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIASSEG-SEIDVWPFL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             + +  DAISRTAFGSNYE+GR+IFELQKEQA+   +  R +YIPGWRF+PT RN+RMK+I
Sbjct  202   ETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWRFVPTKRNKRMKQI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K+V++L+  II+KR++ M+AGE +KDDLLGILLESNF EI+ HGNK+FG+T  EVIEEC
Sbjct  262   AKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNKNFGMTIDEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWT++LL +H +WQ RAREEV ++FG +KPD D LN +K+VTMI 
Sbjct  322   KLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDYDALNQLKVVTMIF  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P I+++R   E+T+LG+L LP G+ + +P I  HHD +IWGDDAKEF PERF
Sbjct  382   NEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEIWGDDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+KATKG+  + PF  GPRIC+GLNFAMLEAK+ +A+ILQ Y+FELSPSYAHAP + 
Sbjct  442   SEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAFELSPSYAHAPHTI  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GAPL+ RKL
Sbjct  502   ITLQPQHGAPLILRKL  517



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/495 (61%), Positives = 389/495 (79%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNWAWF+P+K +KCLR+QGL+GN Y  + GD+K+  + T+EAKSKP+N ++DI  R+
Sbjct  21    WRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVRMTQEAKSKPINFTNDIVSRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    I+  GENS+ W GP P VL+ +P  I++++ K+  Y KP  NPL KLLA G+ 
Sbjct  81    MPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEVMNKSFNYLKPPGNPLSKLLATGLV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKWSKHR++INPAFH+EK+K M+PAF +SC EM+   E+ + ++G  E+DVWP LQ
Sbjct  141   SYETDKWSKHRKLINPAFHLEKVKLMLPAFRLSCFEMVSKWEQLISEKGSCELDVWPELQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGSNYEEG+KIFELQKEQA+      RS Y+PGWRF+PT RN+RMK I 
Sbjct  201   ALTSDVISRTAFGSNYEEGQKIFELQKEQAELILLAARSPYVPGWRFVPTKRNKRMKGIA  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V++L+  +I+ RVKAM+AGE   DDLL ILLESNF EI++H +K FG+T  EVIEECK
Sbjct  261   KEVRSLVMDMINNRVKAMKAGEAKNDDLLAILLESNFKEIQEHEDKKFGMTLDEVIEECK  320

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LLVWT++LL +HQ+WQ RAR+EV ++FG  KP+ + LNH+K++TMILN
Sbjct  321   LFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEVQQVFGSKKPEFEDLNHLKVITMILN  380

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV+ L R   E T+LG+L LP GV + +P IL HHD KIWGDDAKEF PERFS
Sbjct  381   EVLRLYPPVVMLGRMTPETTKLGELTLPAGVQLLLPAILLHHDSKIWGDDAKEFKPERFS  440

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EG+ KATKGQLT+ PFG GPRIC+G NFAM+E+KL +AMILQR+SFELSP YAHAP + +
Sbjct  441   EGILKATKGQLTYFPFGWGPRICIGQNFAMVESKLALAMILQRFSFELSPLYAHAPHTII  500

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+ RKL
Sbjct  501   TLQPQHGAQLILRKL  515



>ref|XP_011082965.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=514

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/495 (63%), Positives = 396/495 (80%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNWAWFRPRKL+K LR+QG KGN YK  FGD  ++   TKEAKSKPM+ SH+I PR+
Sbjct  21    WKILNWAWFRPRKLEKILRQQGFKGNSYKLFFGDFNEMKAMTKEAKSKPMSFSHEIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              P  I  ++  GE SF+W GP P V++ +P ++R+IL+K+ ++ KP  NP  ++LA GIA
Sbjct  81    APSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKSYVFQKPGGNPTSRMLARGIA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRR+INPAFH+EKLKHMVPAFY+SC +ML   EK +  +GL E+DVWP+LQ
Sbjct  141   SYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADMLSKWEKIVPREGLCELDVWPYLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEGR+IFELQKEQA+   E +R++YIPG RFLPT  N+RM KI 
Sbjct  201   TLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTVYIPGSRFLPTKNNKRMNKIV  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             ++V++ +  II+KR+KA++AGE + DDLLG+LLESN  EIE+HGNK FG++ +EVIEECK
Sbjct  261   REVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEIEQHGNK-FGMSLKEVIEECK  319

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LLVWTM+LL +H++WQ RAR+EV +LFG+DKPD   LNH+KIV+MI +
Sbjct  320   LFYFAGQETTSTLLVWTMILLSKHKDWQERARDEVLQLFGRDKPDYQELNHLKIVSMIFH  379

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P + L R   +E+ LG + LP GV + +P +L HHD KIWGDDA+EF PERFS
Sbjct  380   EVLRLYPPGVMLNRITMKESTLGKVTLPAGVQLLMPAVLLHHDRKIWGDDAEEFKPERFS  439

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKAT+GQL + PFG GPRIC+G +FAMLEAKL +AMILQ YSFELSPSY+HAP + +
Sbjct  440   EGVSKATQGQLVYFPFGWGPRICIGQSFAMLEAKLAMAMILQHYSFELSPSYSHAPATVI  499

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+ RKL
Sbjct  500   TLQPQHGAHLILRKL  514



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/497 (63%), Positives = 389/497 (78%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPM-NLSHDISPR  1502
             W+VLNWAWFRP+KL+K LR+QGL GN Y+ + GDLK+ +K+ KEA+SKP+ NLS+DI+PR
Sbjct  22    WKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFSKSIKEAQSKPIDNLSNDIAPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPF-TNPLIKLLAEG  1325
             ++P+FI  I + G+  FVW GP PM+LI E   IR+I  KN +Y KP  +NP+  LLA G
Sbjct  82    IIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFAKNYVYQKPHHSNPVANLLARG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             IA YEEDKW+KHR+I+ PAFHMEKLK M+PAFY+SC+EML   EK + D+   E+D+WP 
Sbjct  142   IANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEMLKEWEKIVPDERSKELDIWPQ  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
              Q++  D ISRTAFGS+YEEGR+IFELQKEQA+   +   SIYIPG RFLPT  N++MK+
Sbjct  202   FQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQFNSIYIPGSRFLPTKSNKKMKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
              EK+VQ  IR +ID R+KA EAG+   DDLLG LLESN NEIE+ G+K+FG+T  EVI E
Sbjct  262   TEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNSNEIEEQGSKEFGLTIDEVIRE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSV LVWTM+LL RHQ+WQ +AREEV + FG D+P  D L+ +KIVTMI
Sbjct  322   CKLFYFAGQETTSVWLVWTMILLSRHQDWQAKAREEVLQAFGSDQPAFDELSRLKIVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L ESLRLY P+ +  R+  EETRLG+L LP G LI IP IL HHD++IWG+DA+EF PER
Sbjct  382   LYESLRLYPPLATRIRRTNEETRLGNLYLPNGSLIFIPTILLHHDKEIWGEDAEEFKPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EGV KATKGQ+ F PFG GPRIC+G NFAMLEAK+ +A+ILQR+ FELSPSY H P  
Sbjct  442   FKEGVLKATKGQMIFFPFGAGPRICIGHNFAMLEAKMAVALILQRFVFELSPSYTHVPHC  501

Query  244   TVSLQPQYGAPLLFRKL  194
              V+LQP++GAPLL ++L
Sbjct  502   IVALQPKFGAPLLLQRL  518



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/496 (60%), Positives = 396/496 (80%), Gaps = 1/496 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W+ LNW W +P+K++K L+ +G KG+ YK +FGD+K++    +EAK+KPMN ++D   R
Sbjct  23    VWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKTKPMNFTNDYVAR  82

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP F   + + G+NSF+WLGP P + I +P LIR+IL+K+ IY +   NP+ KLLA+G+
Sbjct  83    VLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREILSKSYIYQEIQGNPITKLLAQGL  142

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE +KW+KHR+IINPAFH++KLKHM+P+FY+SC +ML   E     +G +E+DVWP L
Sbjct  143   VSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIASSEG-SEIDVWPFL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             + +  DAISRTAFGSNYE+GR+IFELQKEQA+   +  R +YIPGWRF+PT RN+RMK+I
Sbjct  202   ETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWRFVPTKRNKRMKQI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K+V++L+  II+KR++ M+AGE +KDDLLGILLESNF EI+ HGNK+FG+T  EVIEEC
Sbjct  262   AKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNKNFGMTIDEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWT++LL +H +WQ RAREEV ++FG +KPD D LN +K+VTMI 
Sbjct  322   KLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDYDALNQLKVVTMIF  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P I+++R   E+T+LG+L LP G+ + +P I  HHD +IWGDDAKEF PERF
Sbjct  382   NEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEIWGDDAKEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+KATKG+  + PF  GPRIC+GLNFAMLEAK+ +A+ILQ Y+FELSPSYAHAP + 
Sbjct  442   SEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAFELSPSYAHAPHTI  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GAPL+ RKL
Sbjct  502   ITLQPQHGAPLILRKL  517



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/495 (62%), Positives = 387/495 (78%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNWAWF+P+KL+KCLR+QGL+GN Y  +FGD+K+  + T+EAKSKPMN ++DI  R+
Sbjct  21    WRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVRMTQEAKSKPMNFTNDIVSRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    I+  GENS+ W GP P VL+  P  I++++ K+  Y KP  NPL KLLA G+A
Sbjct  81    MPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEVMNKSFNYLKPPGNPLTKLLATGLA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE DKWSKHR++I+PAFH+EK+K M+PAF  SC EM+   E+ + ++   E+DVWP LQ
Sbjct  141   NYETDKWSKHRKLISPAFHLEKVKFMLPAFRWSCFEMVSKWEQLVSEKESCELDVWPELQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGSNYEEG+KIFELQKEQA+      RS Y+PGWRF+PT RN+RMK I 
Sbjct  201   TLTSDVISRTAFGSNYEEGQKIFELQKEQAELILLAARSPYVPGWRFVPTKRNKRMKGIA  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V++L+  +I+ RVKAM+AGE   DDLL ILLESNF EI++HG+K FG+T  EVIEECK
Sbjct  261   KEVRSLVMDMINNRVKAMKAGEAKNDDLLDILLESNFKEIQQHGDKKFGMTLDEVIEECK  320

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LLVWT++LL +HQ+WQ RAR+EV ++FG  KP+ + LNH+K++TMILN
Sbjct  321   LFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEVQQVFGSKKPEFEDLNHLKVITMILN  380

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P + L R   E T+LG+L LP GV + +P IL HHD KIWGDDAKEF PERFS
Sbjct  381   EVLRLYPPGVMLGRMTTETTKLGELTLPAGVQLLLPAILLHHDSKIWGDDAKEFKPERFS  440

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EG+ KATKGQLT+ PFG GPRIC+G NFA +E+KL +AMILQR+SFELSP YAHAP + +
Sbjct  441   EGILKATKGQLTYFPFGWGPRICIGQNFATVESKLALAMILQRFSFELSPLYAHAPHTII  500

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+ RKL
Sbjct  501   TLQPQHGAQLILRKL  515



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/499 (61%), Positives = 394/499 (79%), Gaps = 4/499 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPM-NLSHDISPR  1502
             W +L W W +P+KL+ CLRKQGLKGN Y+  +GD+K+L+K+ KE  SKP+ NLS++++PR
Sbjct  23    WELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIINLSNEVAPR  82

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT-NPLIKLLAEG  1325
             ++P++++ IQ+ G+  FVW GP P +LI EP LI++I  KN ++ KP   NPL KLLA G
Sbjct  83    IIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNPLTKLLARG  142

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + +YEE+KW+KHR+I+NPAFHMEKLKHM+PAFY+SC EML   E+ +  +   E+D+WPH
Sbjct  143   VVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKESNELDIWPH  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISR AFGS+YEEGR+IFELQ+EQA++ T+   S+YIPG RF P   N+RMK+
Sbjct  203   LQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKE  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGS--KDDLLGILLESNFNEIEKHGNKDFGITTREVI  791
              EK+V+  I C+ID R+KA E G G    DDLLGILLESN  EIE+HGNK FG++  EVI
Sbjct  263   CEKEVRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKFGMSIPEVI  322

Query  790   EECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVT  611
             EECKLFYF GQETTSVLLVWT++LLGR+ EWQ RAREEVF+ FG DKP  D L  +KIVT
Sbjct  323   EECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVT  382

Query  610   MILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             MIL ESLRLY P+ + TR+  EET+LG+L LP G L+ IP IL H D++IWG+DA EFNP
Sbjct  383   MILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDKEIWGEDADEFNP  442

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERFSEGV+KATKG++T+ PFG GPR C+G NFA+LEAK+ IAMILQR+SFELSPSY H+P
Sbjct  443   ERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSP  502

Query  250   TSTVSLQPQYGAPLLFRKL  194
              + V+L+P+YGAPL+  +L
Sbjct  503   YTVVTLKPKYGAPLIMHRL  521



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/499 (61%), Positives = 392/499 (79%), Gaps = 4/499 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPM-NLSHDISPR  1502
             W +L W W +P+KL+ CLRKQGLKGN Y   +GD+K+L+K+ KE  SKP+ NLS++++PR
Sbjct  23    WELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEINSKPIINLSNEVAPR  82

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT-NPLIKLLAEG  1325
             ++P++++ IQ+ G+  FVW GP P +LI EP LI++I  KN ++ KP   NPL KLLA G
Sbjct  83    IIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNPLTKLLARG  142

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + +YEE+KW+KHR+I+NPAFHMEKLKHM+PAFY+SC EML   E+ +  +   E+D+WPH
Sbjct  143   VVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKESNELDIWPH  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISR AFGS+YEEGR+IFELQ+EQA++ T+   S+YIPG RF P   N+RMK+
Sbjct  203   LQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKE  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGS--KDDLLGILLESNFNEIEKHGNKDFGITTREVI  791
              EK+V+  I C+ID R+KA E G G    DDLLGILLESN  EIE+HGNK FG++  EVI
Sbjct  263   CEKEVRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKFGMSIPEVI  322

Query  790   EECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVT  611
             EECKLFYF GQETTSVLLVWT++LLGR+ EWQ RAREEVF+ FG DKP  D L  +KIVT
Sbjct  323   EECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVT  382

Query  610   MILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             MIL ESLRLY P+ + TR+  EET+LG+L LP G L+ IP IL H D +IWG+DA EFNP
Sbjct  383   MILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDREIWGEDADEFNP  442

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERFSEGV+KATKG++T+ PFG GPR C+G NFA+LEAK+ IAMILQR+SFELSPSY H+P
Sbjct  443   ERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSP  502

Query  250   TSTVSLQPQYGAPLLFRKL  194
              + V+L+P+YGAPL+  +L
Sbjct  503   YTVVTLKPKYGAPLIMHRL  521



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 395/496 (80%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W +LNW WF+P+KL+K LR+QGL G+ Y+ +FGD+K+  +  K+A SKP+N ++DI PR+
Sbjct  21    WIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQMVKQAYSKPINFTNDIVPRI  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF    I+ +G N+  W+GP+P +L+ +P L++++LTKN +Y KP  NPL KLLAEG A
Sbjct  81    LPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTKNYVYQKPRNNPLGKLLAEGFA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             TY+ DKW+K+RRII+PAFH+EKLKHMVPAF +SC EML   E      G  E+DVWP ++
Sbjct  141   TYDTDKWAKNRRIISPAFHLEKLKHMVPAFCLSCSEMLSKWENGALADGSLELDVWPDIR  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGSNYEEGRKIFELQ +Q++   + ++SIY+PGWRFLPT RN++MKKI 
Sbjct  201   TLAGDMISRTAFGSNYEEGRKIFELQMQQSELFEQAIQSIYVPGWRFLPTKRNKKMKKIF  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K V++LI  II+KRV+AM+ GE +  DLLG+LLESNF EI++HGN+ FG+T+ EVI+ECK
Sbjct  261   KDVRSLILGIINKRVRAMQEGEATHSDLLGLLLESNFKEIQEHGNERFGMTSEEVIQECK  320

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF G ETT++LLVWT++LL +H +WQ RAR+EV ++FG + PD + LN +KIVTMILN
Sbjct  321   LFYFAGHETTAILLVWTLILLSKHSDWQARARDEVLQVFGNNIPDFEELNRLKIVTMILN  380

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLYTP + ++R+  E+T+LG+L LP G+ + +P IL HHD  +WGDDAKEFNPERFS
Sbjct  381   EVLRLYTPGVMISRRVNEDTKLGELSLPSGMFVLMPSILLHHDPSLWGDDAKEFNPERFS  440

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGV+KATKGQ  FLPFGGGPRIC+G NFA+LEAK+ +A+ILQR+SFELSP Y HAP   +
Sbjct  441   EGVAKATKGQPCFLPFGGGPRICIGQNFALLEAKMALALILQRFSFELSPLYTHAPYLFL  500

Query  238   S-LQPQYGAPLLFRKL  194
             + LQPQYGA L+ +KL
Sbjct  501   TLLQPQYGAQLIMKKL  516



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 392/496 (79%), Gaps = 1/496 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W+ LNW W +P+K++K L+ +G KG+ YK + GD+K++    +EAK+KPMN ++D   R
Sbjct  22    VWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMKEINTMVEEAKTKPMNFTNDYVAR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP F   + + G+N F+WLGP P + I +P LIR+IL+K+ IY K   NP+ KLLA+G+
Sbjct  82    VLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREILSKSYIYQKIQGNPITKLLAQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A+YE +KW+KHRRIINPAFH++KLKHM+P+FY+SC +ML   E  +  +G +E+DVWP L
Sbjct  142   ASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIVSSEG-SEIDVWPFL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGSNYEEGR+IFELQKEQA+   +  R +YIPGWRF+PT RN+RMK+I
Sbjct  201   QTLTSDAISRTAFGSNYEEGRQIFELQKEQAELILQAARWLYIPGWRFVPTKRNKRMKQI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K+V++L+  II+KR++ M+AGE +KDDLLGILLESNF EI+ H NK+FG+T  EVIEEC
Sbjct  261   AKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHRNKNFGMTIDEVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWT++LL +H +WQ RAREEV ++FG +KPD + L  +K+VTMI 
Sbjct  321   KLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVRQVFGSNKPDYETLKQLKVVTMIF  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P I + R   EET+LG+L LP G+L+ +P I  HHD +IWGDDAKEF PERF
Sbjct  381   NEVLRLYPPGIMIGRTVHEETKLGNLSLPAGMLLMLPAIWLHHDNEIWGDDAKEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
              EGV+KATKG+  + PF  GPRIC+GLNFAMLEAK+ +AMILQ Y+FELSPSYAHAP + 
Sbjct  441   GEGVNKATKGKFAYFPFSWGPRICIGLNFAMLEAKMAVAMILQHYAFELSPSYAHAPHTI  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GAPL+ RKL
Sbjct  501   ITLQPQHGAPLILRKL  516



>gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/495 (62%), Positives = 394/495 (80%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNW WFRPRKL+K LR+QG KGN YK  FGD  +L   TKEAKSKPM+ SH+I PR+
Sbjct  21    WKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKAMTKEAKSKPMSFSHEIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              P  I  ++  GE SF+W GP P V++ +P ++R+IL+K+ ++  P  NP  ++LA GIA
Sbjct  81    APSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKSYVFQMPGGNPTSRMLARGIA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRR+INPAFH+EKLKHMVPAFY+SC +ML   EK +  +GL E+DVWP+LQ
Sbjct  141   SYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADMLSKWEKIVPREGLCELDVWPYLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEGR+IFELQKEQA+   E +R++ IPG RFLPT  N+RM KI 
Sbjct  201   TLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTVCIPGSRFLPTKNNKRMNKIV  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             ++V++ +  II+KR+KA++AGE + DDLLG+LLESN  EIE+HGNK FG++ +EVIEECK
Sbjct  261   REVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEIEQHGNK-FGMSLKEVIEECK  319

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LLVWTM+LL +H++WQ RAR+EV +LFG+DKPD   LNH+KIV+MI +
Sbjct  320   LFYFAGQETTSTLLVWTMILLSKHKDWQERARDEVLQLFGRDKPDYQELNHLKIVSMIFH  379

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P + L R + +E+ LG + LP GV + +P +L HHD KIWGDDA+EF PERFS
Sbjct  380   EVLRLYPPGVMLNRISMKESTLGKVTLPAGVQLLMPAVLLHHDRKIWGDDAEEFKPERFS  439

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKAT+GQL + PFG GPRIC+G +FAMLEAKL +AMILQ YSFELSPSY+HAP + +
Sbjct  440   EGVSKATQGQLVYFPFGWGPRICIGQSFAMLEAKLAMAMILQHYSFELSPSYSHAPATVI  499

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+ RKL
Sbjct  500   TLQPQHGAHLILRKL  514



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 379/495 (77%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR   WAW  P+KL+K L++QGL+GN YK ++GD K++    KEA SKP+N+S D  PR+
Sbjct  24    WRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKEIATHFKEAHSKPINVSEDFIPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P F  A+++ GEN+++W GP PMVLI  P  IR+I TK  I+ K   NPL KLLA G+ 
Sbjct  84    IPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREITTKLYIFQKAPANPLTKLLATGLV  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +Y+ DKW+KHR++I PAFH+EKLKHMVP+FY S  EML   E  +   G  E+DVWP +Q
Sbjct  144   SYDGDKWAKHRKLITPAFHVEKLKHMVPSFYASASEMLDKWEAIVSTNGSCELDVWPDIQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGSNY+EG++IFELQ+EQA+H  + + S+YIPGWRFLPT  NRRMK+I 
Sbjct  204   TLTSDAISRTAFGSNYQEGKRIFELQREQAEHFLKAVESVYIPGWRFLPTKLNRRMKQIA  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K VQ  IR II+ R+KAM+ GE   DDLLGILLESN  EI+ HGNKDFG+T  +VIEECK
Sbjct  264   KDVQESIREIINARLKAMKEGEACADDLLGILLESNSKEIDDHGNKDFGMTIGDVIEECK  323

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSV+LVWTMVLL RH  WQ RAREEV + FG +KPD  GLNH+K+VTMIL+
Sbjct  324   LFYFAGQETTSVMLVWTMVLLSRHPNWQARAREEVLQHFGNNKPDFKGLNHLKLVTMILH  383

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV ++ R+  E+ +LG+L LP  V +S+P IL H+D +IWGDD +EF PERF+
Sbjct  384   EVLRLYPPVPAIPRRTDEDIQLGNLTLPAQVQVSLPAILLHYDPEIWGDDVEEFKPERFA  443

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +GVS ATKGQ  + PFG GPRIC+G NFAMLEAKL +AM+LQR+SFELSPSY HAP + +
Sbjct  444   DGVSNATKGQTAYFPFGWGPRICIGQNFAMLEAKLAVAMLLQRFSFELSPSYTHAPRAVI  503

Query  238   SLQPQYGAPLLFRKL  194
             ++QPQYGA L+  KL
Sbjct  504   TIQPQYGARLILHKL  518



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/499 (61%), Positives = 393/499 (79%), Gaps = 4/499 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPM-NLSHDISPR  1502
             W +L W W +P+KL+ CLRKQGLKGN Y+  +GD+K+L+K+ KE  SKP+ NLS++++PR
Sbjct  33    WELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIINLSNEVAPR  92

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT-NPLIKLLAEG  1325
             ++P++++ IQ+ G+  FVW GP P +LI EP LI++I  KN ++ KP   NPL KLLA G
Sbjct  93    IIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNPLTKLLARG  152

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + +YEE+KW+KHR+I+NPAFHMEKLKHM+PAFY+SC EML   E+ +  +   E+D+WPH
Sbjct  153   VVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKESNELDIWPH  212

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ++  D ISR AFGS+YEEGR+IFELQ+EQA++ T+   S+YIPG RF P   N+RMK+
Sbjct  213   LQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKE  272

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGS--KDDLLGILLESNFNEIEKHGNKDFGITTREVI  791
              EK+V+  I  +ID R+KA E G G    DDLLGILLESN  EIE+HGNK FG++  EVI
Sbjct  273   CEKEVRETITRLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKFGMSIPEVI  332

Query  790   EECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVT  611
             EECKLFYF GQETTSVLLVWT++LLGR+ EWQ RAREEVF+ FG DKP  D L  +KIVT
Sbjct  333   EECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVT  392

Query  610   MILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             MIL ESLRLY P+ + TR+  EET+LG+L LP G L+ IP IL H D++IWG+DA EFNP
Sbjct  393   MILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLDKEIWGEDADEFNP  452

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERFSEGV+KATKG++T+ PFG GPR C+G NFA+LEAK+ IAMILQR+SFELSPSY H+P
Sbjct  453   ERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSP  512

Query  250   TSTVSLQPQYGAPLLFRKL  194
              + V+L+P+YGAPL+  +L
Sbjct  513   YTVVTLKPKYGAPLIMHRL  531



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/495 (61%), Positives = 391/495 (79%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAW RP+KL+K L++QGLKGN Y+ ++GD K+++   +EA+SKP+NLS DI PR+
Sbjct  22    WRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEISTLIREAQSKPINLSDDILPRI  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LP F DA+++ G++++VWLGP PMV I EP LIR+++ K  ++ KP  NPL  LL EG+ 
Sbjct  82    LPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQKIYLFQKPRLNPLSLLLIEGLV  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              Y+ DKW+K R++INPAFH+EKLKHM+P+FY S  ++L   ++ +   G +E+DVWP L+
Sbjct  142   NYDGDKWAKQRKLINPAFHVEKLKHMLPSFYTSASDILNKWKEVVAPNGSSELDVWPDLE  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGSNYEEGR+IFELQ+EQ+++  ++++S+ IPGWRF+PT RNRRMK+I 
Sbjct  202   TLTSDAISRTAFGSNYEEGRRIFELQREQSEYWLKVVQSVDIPGWRFVPTKRNRRMKQIA  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K VQ  I  II+ R+KA+  G+   DDLLGILLESNF EI  HG    G+T REVIEECK
Sbjct  262   KAVQDTILEIINSRIKAVREGKAYGDDLLGILLESNFKEINNHGQDGAGMTIREVIEECK  321

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTM+LL R+ +WQ RAREEV +LFG  KPD DGLN + +VTMIL+
Sbjct  322   LFYFAGQETTSVLLVWTMILLSRYPDWQARAREEVLQLFGTRKPDFDGLNRLNLVTMILH  381

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV +L+R+  EET+LG + LP  VL+S+PV++ HHD +IWGDDAKEF PERF+
Sbjct  382   EVLRLYAPVPALSRRVAEETKLGSMRLPADVLLSLPVMVLHHDTEIWGDDAKEFKPERFA  441

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGV  ATKGQ+ F PFG GPR+C+G +FAMLEAKLV+ MIL+ +SFELSPSY+HAP + +
Sbjct  442   EGVPHATKGQVAFFPFGWGPRVCIGQHFAMLEAKLVLVMILRSFSFELSPSYSHAPRAII  501

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+  KL
Sbjct  502   TLQPQHGAHLILHKL  516



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/495 (60%), Positives = 383/495 (77%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+V N  W  P+KL+K L++QG +GN YK ++GD K+++   KEA SKP+NL+ D  PR+
Sbjct  24    WKVFNQVWLTPKKLEKRLKEQGFRGNPYKLLYGDFKEISTLFKEALSKPINLTDDFVPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P F  A ++ G+++++W G    V+I +P  IR++  K  I+ +P +NPL+KLL +G+A
Sbjct  84    IPHFYAATKKYGKHTYLWQGTELTVVIMDPEHIREVTQKVYIFQRPHSNPLLKLLVQGLA  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +Y  DKW+KHR++INPAFH+EKLKHM+P+FY S  EM+   E  +   G +E+DVWP LQ
Sbjct  144   SYNGDKWTKHRKLINPAFHVEKLKHMLPSFYTSASEMMCKWEDIVSSNGSSELDVWPDLQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGSNY+EG +IFELQ+EQ +H  E  RS+YIPGWRF+PT RN RMK+I 
Sbjct  204   TLTCDAISRTAFGSNYKEGSRIFELQREQTEHFIEAARSLYIPGWRFIPTKRNTRMKQIA  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             + VQ  I+ II+ R+KAM+A +   DDLLGILLESN  EI+ HGNK+FG+T  EVIEECK
Sbjct  264   RDVQESIKDIINARLKAMKAAKACDDDLLGILLESNSKEIDHHGNKNFGMTVLEVIEECK  323

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTM+LL R+ EWQ RAREEV +LFG DKPD DGLNH+K++TMIL+
Sbjct  324   LFYFAGQETTSVLLVWTMILLSRYPEWQMRAREEVLQLFGTDKPDFDGLNHLKLITMILH  383

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV +L R+  EETRLG+L LP G+L+S+PV+L HHD +IWGDD KEF PERF+
Sbjct  384   EVLRLYPPVTALFRRAAEETRLGNLTLPAGLLVSLPVMLLHHDPEIWGDDVKEFKPERFA  443

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +GVSKATKGQ  F PF  GPRIC+G NFAMLEAKL + MILQR+SFELSPSY HAP +  
Sbjct  444   DGVSKATKGQFAFFPFSWGPRICIGQNFAMLEAKLAMTMILQRFSFELSPSYTHAPRAMA  503

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+  +L
Sbjct  504   TLQPQFGAQLILHRL  518



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/496 (63%), Positives = 390/496 (79%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNWA+ RP++L+K LRKQGL GN Y F++GDLK++      AKS P+NL  DI PR+
Sbjct  24    WRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKEMLNMINHAKSHPINLDDDIKPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKP-FTNPLIKLLAEGI  1322
             L F      + G+ SF+WLGP P V+I EP LI++++TK  +Y KP  +NPL KLLA+G+
Sbjct  84    LAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIKEVMTKINLYQKPKNSNPLTKLLAQGV  143

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
               YE DKW+KHR+IINPAFH EKLK M+PAFY+SC E+L   EK +  +G  EVDVWP+L
Sbjct  144   VAYEGDKWAKHRKIINPAFHFEKLKLMIPAFYLSCDEVLNKWEKSLSGKGSGEVDVWPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+Y+EGRK+FELQ+EQA++  +  ++IYIPGWRF+PT  N RMK+I
Sbjct  204   QNLSSDAISRTAFGSSYKEGRKVFELQREQAEYIIKASQTIYIPGWRFMPTKGNNRMKEI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EK+VQ+ IR +I+KRVKAM+AGE S +DLLG+LLESN+ EIE++GNK FG+T  EV+EEC
Sbjct  264   EKEVQSSIRGMINKRVKAMKAGEASNEDLLGLLLESNYKEIEQYGNKSFGMTIDEVVEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVW +VLL ++ EWQT+AREEV + FG   P+ DGLNH+KIV MIL
Sbjct  324   KLFYFAGQETTSVLLVWALVLLSQYPEWQTKAREEVLQSFGNQIPEFDGLNHLKIVNMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PV++L R   EET+LG L LP GV +S+P+I  HH+ +IWGDDA EF PERF
Sbjct  384   YEVLRLYPPVVALGRIVSEETKLGKLTLPAGVQVSLPIIFLHHNREIWGDDAMEFKPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA KGQ  F PFG GPRIC+G  FAMLEAK+ ++MILQR+SFELSPSYAHAP + 
Sbjct  444   SEGVSKAQKGQGIFFPFGWGPRICVGQTFAMLEAKVALSMILQRFSFELSPSYAHAPHTV  503

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA LL  KL
Sbjct  504   ITLQPQHGAHLLLHKL  519



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/497 (63%), Positives = 395/497 (79%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLN  W RP+KL+K LR  GL GN Y+ + GD K +    KEA SKP+NLS DI PR+
Sbjct  26    WRVLNCMWLRPKKLEKRLRNLGLNGNSYRLVCGDFKDIAVMLKEANSKPINLSDDIVPRV  85

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PFFI+ I++ G+NSFVWLG NP V+I +P L+R+IL KN I+ KP  +P++KLLA+G+ 
Sbjct  86    IPFFIEIIKKYGKNSFVWLGLNPSVVILDPVLMREILLKNYIFKKPRPHPIVKLLAQGVI  145

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E DKW+KHR+II+ AFH++KLKHM+PAFY S  EML   E+++  +G  E+DVWP+LQ
Sbjct  146   FSEGDKWAKHRKIISSAFHLQKLKHMLPAFYSSASEMLSKWEERVSPEGSCELDVWPYLQ  205

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +G D+ISRTAFGSNYEEGR+IFELQ EQAQ+     RS+Y PG RFLPT RN+RMK IE
Sbjct  206   TLGADSISRTAFGSNYEEGRRIFELQMEQAQYAVRATRSVYFPGLRFLPTRRNKRMKDIE  265

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K++QA IR II+KRVKA++AGE S DDLLGI+LESNF EI+ HG+K FG+T ++VI+ECK
Sbjct  266   KEIQAKIRDIINKRVKALKAGETSNDDLLGIMLESNFKEIDLHGDKSFGMTMQDVIDECK  325

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQE++S LLVWT+VLLGRH+EWQ++AR+EV ++FG++KP  +GLNH+KIVTMILN
Sbjct  326   LFYFAGQESSSTLLVWTLVLLGRHREWQSKARDEVSQVFGRNKPHFEGLNHLKIVTMILN  385

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P ++L R+  +ET++G L LP GV++ +PVIL HHD +IWGDD KEF PERFS
Sbjct  386   EVLRLYPPAVALNRRVHQETKVGKLSLPAGVMLWLPVILLHHDREIWGDDVKEFKPERFS  445

Query  418   EGVSKATKG--QLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             EGVSKA  G  Q  F PFG GPRICLG NFAMLEAKL ++MILQ +SF+LSPSY HAP +
Sbjct  446   EGVSKAANGQSQAPFFPFGWGPRICLGQNFAMLEAKLALSMILQHFSFQLSPSYVHAPYT  505

Query  244   TVSLQPQYGAPLLFRKL  194
               +LQPQ+GA L+  KL
Sbjct  506   VFTLQPQHGALLVLHKL  522



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/498 (59%), Positives = 389/498 (78%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+ LNW WFRP+KL+K L++Q  +GN YK + GD K+++    EA+SK +NLS DI PR+
Sbjct  27    WKALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMSTLYTEAQSKNLNLSDDIVPRV  86

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P ++ A+++ G+N+++W GP P ++I +P LI+ +  K  ++ KP  NPL +LLA+G+ 
Sbjct  87    IPQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQKVDVFQKPRVNPLGRLLAQGLV  146

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE +KW+K R+++NPAFH+EKLK M+PAFY S  EM+   E  +  +GLAEVDVWP+LQ
Sbjct  147   SYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVTKWENVVSPKGLAEVDVWPNLQ  206

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYI--PGWRFLPTWRNRRMKK  965
              +  DAISRTAFGSNYEEGR+IFELQ+EQ +H  +L RS+YI  PG+RFLPT RNRRMK+
Sbjct  207   ALTSDAISRTAFGSNYEEGRRIFELQREQTEHLMQLARSVYINIPGFRFLPTKRNRRMKQ  266

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I ++V   +R +I+ R KAM AGE   DDLLG++L+SN  EIEKHGNKD G+TT E+++E
Sbjct  267   IAREVNGSVREMINTRRKAMRAGEAGSDDLLGLMLQSNSQEIEKHGNKDSGMTTEEIVDE  326

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTMVLL R+ EWQ RAREEV + FG   PD DGLNH+KIVTMI
Sbjct  327   CKLFYFAGQETTSALLVWTMVLLCRYPEWQARAREEVLQQFGTKDPDFDGLNHLKIVTMI  386

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L+E LRLY PV +++R+  EET+LG+L LP GV +++P++L HHD  IWG+D KEF PER
Sbjct  387   LHEVLRLYPPVATMSRRTIEETKLGNLTLPAGVQLTLPILLMHHDPDIWGEDVKEFKPER  446

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP-T  248
             F+EGVS ATKG + + PFG GPRIC+G NFAMLEAKL ++MILQR+SFELSPSY HAP T
Sbjct  447   FAEGVSHATKGHVAYFPFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSYTHAPGT  506

Query  247   STVSLQPQYGAPLLFRKL  194
             +T  +QPQYGA L+ +K+
Sbjct  507   ATALVQPQYGAHLILQKI  524



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/496 (61%), Positives = 385/496 (78%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+ WA+ RP++++K LRKQG  G+ Y+ +  +LK+  K  KEAKS P+NL  DI PR+
Sbjct  21    WRVVKWAYMRPKRVEKLLRKQGFNGSSYRLVNRELKERLKMVKEAKSNPINLDDDIKPRI  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGI  1322
             LPF+   IQ  G  SF+WLG +P V+I +P LI++++TK  IY K    NPL +LLA+G+
Sbjct  81    LPFYTKTIQTYGTESFMWLGLSPTVIISDPELIKEVMTKTHIYKKIKNANPLTRLLAQGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +Y+ DKW+KH++IINPAFHMEKLK M+PAFY+SC E+L   EK +  +G  EVDVWP L
Sbjct  141   FSYDLDKWAKHKKIINPAFHMEKLKLMIPAFYLSCDEVLNKWEKSLSPEGSCEVDVWPFL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+Y+EGR+IFELQ+EQA H     RS+YIPGWRF+PT RN+RMK+I
Sbjct  201   QNLSSDAISRTAFGSSYQEGRRIFELQREQAGHFFIASRSMYIPGWRFVPTKRNKRMKEI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              ++VQ+LIR II +RV+AM+AGE + +DLLGILLESN  EIE+HGNK FG+T  EV+EEC
Sbjct  261   AEEVQSLIRGIISRRVEAMKAGEANNEDLLGILLESNAREIEQHGNKTFGMTIDEVVEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWT+VLL R+ +WQ RAREEV ++FG+  P  DGLN++KIVTMIL
Sbjct  321   KLFYFAGQETTSSLLVWTLVLLSRYPDWQKRAREEVLQVFGRQTPAFDGLNYLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LR Y PV++L R+  EET+LG+L LP GV IS+P+I  HH+  IWGDDA EF PERF
Sbjct  381   YEVLRFYPPVVTLGRRVTEETKLGNLTLPAGVQISLPLISLHHNRDIWGDDAMEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+GV+KA K Q  F PFG G RIC+G  FAM+EAK+V+AMILQR+SFELSPSY HAP   
Sbjct  441   SQGVAKAQKRQGIFFPFGWGSRICIGQVFAMMEAKVVLAMILQRFSFELSPSYQHAPQRV  500

Query  241   VSLQPQYGAPLLFRKL  194
             V+LQPQ+GA LL  KL
Sbjct  501   VALQPQHGAHLLLHKL  516



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/496 (59%), Positives = 388/496 (78%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QGL GN Y+ + GD +++++   EA S+P++ S DI  R+
Sbjct  20    WRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPISFSDDIVQRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   +IQ+ G+N+F+WLGP P+V I +P LIRD+L K+  + KP  +PL KLLA G+A
Sbjct  80    LPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAFQKPPRHPLGKLLASGVA  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             + E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EK++   G  E+D+WP+LQ
Sbjct  140   SLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDGSCELDIWPYLQ  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+Y+PGWRF PT  NRRM++I 
Sbjct  200   NLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVYVPGWRFFPTKTNRRMRQIS  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II+KR KAM+AGE + DDLLG+L+ESN+ E++++   K+ G++ ++VIEEC
Sbjct  260   SEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQENDERKNVGMSIKDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LL+WTMVLL +H  WQ RAREEV R+FG  KPD DGLNH+KIVTMI 
Sbjct  320   KLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVLRVFGNKKPDGDGLNHLKIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   LTR    ++++G L LP GV I++P++L HHD+KIWGDDAKEFNP RF
Sbjct  380   HEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGDDAKEFNPGRF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP S 
Sbjct  440   SEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISL  499

Query  241   VSLQPQYGAPLLFRKL  194
             +++QPQ+GA L+   L
Sbjct  500   LTMQPQHGAHLILHGL  515



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/527 (58%), Positives = 393/527 (75%), Gaps = 41/527 (8%)
 Frame = -1

Query  1654  FRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLLPFFIDAI  1475
              RP++L+KCLRKQGLKGN Y+F+FGDLK+     KEA+SKP+NLS DI+ R+ PF +  +
Sbjct  31    LRPKRLEKCLRKQGLKGNSYRFLFGDLKESISMYKEARSKPINLSDDITTRVFPFVLQTV  90

Query  1474  QR----------------------------------------NGENSFVWLGPNPMVLIK  1415
             Q+                                        +G++SF+W+GPNP V I 
Sbjct  91    QKYGMYLYSTQSGGQTVIFGTQGSQIDHKTLFNKRKAFSFPVSGKDSFMWIGPNPRVNIT  150

Query  1414  EPGLIRDILTKNTIYHKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVP  1235
              P  ++DI  K   + KP  NPL++LLA G+A+YE +KW+KHR+IINPAFH+EKLKHM+P
Sbjct  151   NPEHLKDIFNKIGDFPKPHNNPLVELLATGLASYEGEKWAKHRKIINPAFHVEKLKHMLP  210

Query  1234  AFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKE  1055
             AFY+SC EML   E  + ++G  E+DVWP+LQ + GD ISRTAFGS+YEEGR+IF+LQ+E
Sbjct  211   AFYLSCNEMLKKWESFLNNEGSCEIDVWPYLQNMTGDVISRTAFGSSYEEGRRIFQLQRE  270

Query  1054  QAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDL  875
             QA+   + ++++Y+PGWRF PT  N+RMK+++ +VQ L++ II KR KAM AGE   DDL
Sbjct  271   QAELAIKAIQTVYVPGWRFAPTTLNKRMKEVDHEVQGLLKDIIHKREKAMRAGEAPNDDL  330

Query  874   LGILLESNFNEIEKHGN-KDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEW  698
             LGIL+ESNF EI++HGN K+ GI+ R+VIEECKLFYF GQETTSVLLVWTMVLL R+ +W
Sbjct  331   LGILMESNFKEIQEHGNNKNMGISIRDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  390

Query  697   QTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLML  518
             Q RAREEV ++FG + PD DGL H+KIVTMIL E LR Y PVI LTR  +++T+LG+L L
Sbjct  391   QARAREEVLQVFGYNNPDFDGLGHLKIVTMILYEVLRFYPPVILLTRTVQKQTQLGNLSL  450

Query  517   PPGVLISIPVILNHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLN  338
             PPGV IS+PVIL H D  +WG+DAKEF PERF+EGVSKATKGQ++F PFG GPRIC+G N
Sbjct  451   PPGVQISLPVILVHRDTNLWGEDAKEFKPERFAEGVSKATKGQVSFFPFGWGPRICIGQN  510

Query  337   FAMLEAKLVIAMILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRK  197
             FAM+EAK+ +A+ILQR++FELSPSYAHAP + ++LQPQYGA +   K
Sbjct  511   FAMIEAKMALALILQRFTFELSPSYAHAPCTVITLQPQYGAHITLHK  557



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 385/496 (78%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LN  W +P+K+++ LR+QGL GN Y+ + GD +++++   EA S+P++LS DI  R+
Sbjct  20    WRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLSDDIVQRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   +I++ G+N F+W+GP P+V I EP LIRD+L K+  + KP  +PL KLLA G+ 
Sbjct  80    LPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGKLLATGVI  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E ++W+K R+IINPAFH+EKLKHMVPAF +SC EM+   EKK+   G  E+D+WP L+
Sbjct  140   ALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMVNKWEKKLSKDGSCELDIWPDLE  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQKEQA    ++ +SIYIPGWRF+PT  N+RM++I 
Sbjct  200   NLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWRFVPTKTNKRMRQIS  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II++R KAM+ GE + DDLLG+L+ESN+ E+++HG  K+ G++ ++VIEEC
Sbjct  260   NEVNALLKGIIERREKAMKVGETANDDLLGLLMESNYKEMQEHGERKNVGMSNKDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WTMVLL +H  WQ RAREEV ++FG  KPD DGLNH+KIVTMI 
Sbjct  320   KLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   L R    +T +G + LP GV +S+P++L HHD +IWGDDAK+FNPERF
Sbjct  380   HEVLRLYPPASMLIRSVYADTEVGGMYLPDGVQVSLPILLLHHDHEIWGDDAKDFNPERF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ  F PFG GPR+C+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP S 
Sbjct  440   SEGVSKATKGQFAFFPFGYGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISV  499

Query  241   VSLQPQYGAPLLFRKL  194
             +++QPQYGA L+   L
Sbjct  500   ITIQPQYGAHLILHGL  515



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/495 (60%), Positives = 382/495 (77%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP++L+ CLRKQGLKGN Y+   GDLK+ +   KEA SKP+NLS DI+ R+
Sbjct  23    WRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKESSLMIKEASSKPINLSEDITARI  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF +  +   G++SF+W+GP P V I  P  I+DI  K   + KP + PL+KLLA G+A
Sbjct  83    FPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIFNKLGDFPKPQSIPLVKLLATGVA  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             TYE +KW++HR+IINPAFHMEKLK +VPAFY+SC EML   E+ +  +G  E+DVW +LQ
Sbjct  143   TYEGEKWTRHRKIINPAFHMEKLKRLVPAFYLSCSEMLNKWERLLNSEGSCELDVWSYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQKEQ +   + ++++YIPGWRF+PT  NRRMKKI 
Sbjct  203   NMTGDVISRTAFGSSYEEGRRIFQLQKEQGELAIKSLQTVYIPGWRFVPTKLNRRMKKIY  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
              +++AL++ II KR  AM AGE   DDLLGIL+ESN  EI++HG NK+ GI+ R+VIEEC
Sbjct  263   NEIEALVKNIIHKREGAMRAGEAPNDDLLGILMESNLKEIQEHGNNKNMGISIRDVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVWTMVLL R   WQ RAREEV ++FG +KP  DGL  +K+VTMI 
Sbjct  323   KLFYIAGQETTSTLLVWTMVLLSRFPSWQDRAREEVLQIFGNNKPGFDGLTQLKVVTMIF  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P+I  TRK +++T+LG+L LP GV +SIP IL H D ++WG+DAK+F PERF
Sbjct  383   YEVLRLYPPLILFTRKVEKKTQLGNLSLPAGVEVSIPTILVHRDTELWGEDAKDFKPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EG+SK TKGQ++F PFG GPRIC+G NFAM+EAK+ +A+ILQR++FELSPSYAHAP + 
Sbjct  443   AEGMSKVTKGQVSFFPFGWGPRICVGQNFAMVEAKMALALILQRFTFELSPSYAHAPLTI  502

Query  241   VSLQPQYGAPLLFRK  197
             ++LQPQYGA ++  K
Sbjct  503   LTLQPQYGAHIILHK  517



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 391/498 (79%), Gaps = 2/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WR+LNW W RP++L++CLR+QGL GN Y+ + GD K++++  KEA S+P++LS DI  
Sbjct  19    CVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMMKEAYSRPISLSDDIVQ  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+LPF    I++ G+N F W+GP+P V I EP L+RD+L K+ I+ K  ++PL+KLL  G
Sbjct  79    RVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTPSHPLVKLLVSG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +   E ++W+K R+IINPAFH EKLK+M+ AF++SC +M+ N  KK+  +G  E+DVWP+
Sbjct  139   LVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMV-NKWKKLSVEGSCELDVWPY  197

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+ + GD ISRTAFGS+YEEG +IF+LQKEQ     ++  S+YIPGWRF PT  N+RMK+
Sbjct  198   LENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQ  257

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIE  788
             I K+V AL+  II+KR KAMEAGE +  DLLGIL+ESNF EI++H  N   G++ ++VI+
Sbjct  258   ISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREIQEHQNNTKIGMSAKDVID  317

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFY  GQETTSVLL+WTMVLL +H +WQ RAREEV ++FG +KP+ DGLNH+KIVTM
Sbjct  318   ECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVFGNNKPENDGLNHLKIVTM  377

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             I +E LRLY PV  LTR   ++T++GD+  P GV +S+P IL HHD +IWGDDAKEFNPE
Sbjct  378   IFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPE  437

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK Q++FLPFG GPR+C+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP 
Sbjct  438   RFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFELSPSYAHAPY  497

Query  247   STVSLQPQYGAPLLFRKL  194
             S +++QPQYGA L+ R L
Sbjct  498   SLITIQPQYGAHLILRGL  515



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/493 (60%), Positives = 387/493 (78%), Gaps = 1/493 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP++L++CL++QGL GN Y+ ++GD K+++   KEA S+P+++S DI  R+
Sbjct  23    WRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISISDDIVQRV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF   +I++ G++SF+W+GP P V I EP LIRD+L+ +T++ KP  + L+KLL  G+ 
Sbjct  83    APFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVKLLVSGLL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + +KW+KHR+IINPAF +EKLK+M+PAF++SC +M+   E K+  +G  E+DVWP+LQ
Sbjct  143   FLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEGKLSTEGSCELDVWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGSNYEEGR IFELQ+EQAQ   +   S +IPGWRFLPT  N+RMK+I 
Sbjct  203   NLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIR  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+V AL+  IIDKR KAM+AGE   DDLLGILLESNF EI++H N K+ G++ ++VIEEC
Sbjct  263   KEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEHENDKNVGMSIKDVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WTMVLL +H  WQ RAREEV  +FG +KP+ DGLNH+KIV MIL
Sbjct  323   KLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R   E+ ++GD+ LP GV +S+P IL HHD +IWG+DA+EFNPERF
Sbjct  383   HEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+GV KATK  ++F PFG G R+C+G NFA+LEAK+V+AMILQR+SF LSPSY+HAP S 
Sbjct  443   SQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSL  502

Query  241   VSLQPQYGAPLLF  203
             V+L+PQYGA L+ 
Sbjct  503   VTLKPQYGAHLIL  515



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 391/498 (79%), Gaps = 2/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C+WR+LNW W RP++L++CLR+QGL GN Y+ + GD K++++  KEA S+P++LS DI  
Sbjct  19    CVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMMKEAYSRPISLSDDIVQ  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+LPF    I++ G+N F W+GP+P V I EP L+RD+L K+ I+ K  ++PL+KLL  G
Sbjct  79    RVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTPSHPLVKLLVSG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +   E ++W+K R+IINPAFH EKLK+M+ AF++SC +M+ N  KK+  +G  E+DVWP+
Sbjct  139   LVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMV-NKWKKLSVEGSCELDVWPY  197

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+ + GD ISRTAFGS+YEEG +IF+LQKEQ     ++  S+YIPGWRF PT  N+RMK+
Sbjct  198   LENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQ  257

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIE  788
             I K+V AL+  II+KR KAMEAGE +  DLLGIL+ESNF EI++H  N   G++ ++VI+
Sbjct  258   ISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREIQEHQNNTKIGMSAKDVID  317

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFY  GQETTSVLL+WTMVLL +H +WQ RAREEV ++FG +KP+ DGLNH+KIVTM
Sbjct  318   ECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVFGNNKPENDGLNHLKIVTM  377

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             I +E LRLY PV  LTR   ++T++GD+  P GV +S+P IL HHD +IWGDDAKEFNPE
Sbjct  378   IFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPE  437

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK Q++FLPFG GPR+C+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP 
Sbjct  438   RFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFELSPSYAHAPY  497

Query  247   STVSLQPQYGAPLLFRKL  194
             S +++QPQYGA L+ R L
Sbjct  498   SLITIQPQYGAHLILRGL  515



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/497 (60%), Positives = 382/497 (77%), Gaps = 2/497 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             ++R+ NW WF+P+K++K LRKQGL G  YKF+FGDLK+L + + EAKSKPM+L+HDI+ R
Sbjct  20    IYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQMSNEAKSKPMSLNHDIANR  79

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT-NPLIKLLAEG  1325
             +LPF+ +A+  +G+  F WLG  P+V + EP +IR++L     Y KP   NPL KLLA G
Sbjct  80    VLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNNYNQYQKPRAGNPLTKLLARG  139

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A  E D+W KHR+IINPAFH+EKLKHMVPAFY+SC EML    + +  +   EVDVW +
Sbjct  140   VADAEADQWVKHRKIINPAFHVEKLKHMVPAFYVSCSEMLDKWGETVTKESSGEVDVWTY  199

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L     D ISRTAFGS+YEEGRKIFELQ+EQA    +  +S+YIPG RFLPT  N+RMK+
Sbjct  200   LSTFSADVISRTAFGSSYEEGRKIFELQREQAVLIIKASQSVYIPGLRFLPTKSNKRMKE  259

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+++++A I+ IIDKRV AM+A E S DDLLGILL+SN  EI++HG+K +G++  +VIEE
Sbjct  260   IDREIKASIKNIIDKRVVAMKAKETSNDDLLGILLDSNDKEIKQHGSK-YGLSIEDVIEE  318

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETT  +LVWTM+LLG H +WQ RAREEV  +FG   PDIDGL+H+K++ +I
Sbjct  319   CKLFYFAGQETTGTMLVWTMILLGHHTDWQRRAREEVLHVFGDKTPDIDGLSHLKVINII  378

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              +E LRLY P   L R   EET+LG+L LP G L+ + ++L+HHD+  WG+D  EFNPER
Sbjct  379   FHEVLRLYPPAQLLRRMIHEETKLGNLTLPAGTLVQLNILLSHHDKDTWGEDVHEFNPER  438

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGVSKATKG+ T+LPFGGGPRIC+G NFAMLEAK+ +AMILQR+SFE+SPSY HAP S
Sbjct  439   FSEGVSKATKGRATYLPFGGGPRICMGQNFAMLEAKMALAMILQRFSFEVSPSYTHAPHS  498

Query  244   TVSLQPQYGAPLLFRKL  194
               +LQPQ+GA L+  K+
Sbjct  499   IFTLQPQFGAHLILHKV  515



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/495 (59%), Positives = 385/495 (78%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR LNWAW  P+K++K LR+QGL+GN Y+F+FGD + + +  +EAKSKP++L+ DI PR+
Sbjct  21    WRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGRMLEEAKSKPISLTDDIFPRI  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P   + +Q  G+NSF WLGP P ++I +P  ++++ TKN  Y KP  NP+ KLLA G+A
Sbjct  81    MPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKNFTYQKPRANPISKLLALGLA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             + + +KW+KHRR++NPAFH+EKLK+MVPAFY+SC EML   E     +G  E+DVWP+LQ
Sbjct  141   SLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCNEMLSKWENLAPAEGSFELDVWPYLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                 D ISRTAFGSNYE+GR+IFELQ EQA +  ++M+SIY+PGW F+PT RN+RM+KI 
Sbjct  201   IFTSDVISRTAFGSNYEKGRRIFELQSEQALYFEQVMQSIYLPGWSFVPTKRNKRMQKIF  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V +L+  II++R+K ++ GE + DDLLGILLESN NEI +HGNK+ G++  EVIEECK
Sbjct  261   KEVNSLVMGIINERLKEIQTGEATSDDLLGILLESNLNEIRQHGNKN-GLSLEEVIEECK  319

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFY  GQETTS LLVWT++LL +H +WQ RAR+EV ++F  ++PDI  LNH+KIVTMILN
Sbjct  320   LFYLAGQETTSGLLVWTLILLSQHFDWQARARDEVLQVFDNNEPDISKLNHLKIVTMILN  379

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P  +  R N EET+LGDL LP G+ I +  IL   D+ +WGDDAKEF PERFS
Sbjct  380   EVLRLYPPAANFFRMNPEETKLGDLSLPEGMFIFVAPILLQQDKDLWGDDAKEFKPERFS  439

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATKG L+F PFG GPR C+G NFAMLEAK+ +A+IL+R+S+ELSPSYAHAP   +
Sbjct  440   EGVSKATKGNLSFFPFGWGPRTCIGQNFAMLEAKMALALILRRFSWELSPSYAHAPQVVL  499

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQYGA L+ +KL
Sbjct  500   TLQPQYGAQLILKKL  514



>ref|XP_006348902.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
Length=435

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/435 (67%), Positives = 357/435 (82%), Gaps = 0/435 (0%)
 Frame = -1

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PFF+D I + G+ SF+WLGP P+V I +P LI+++ TK  IY K  TNPL KLLA+G+ 
Sbjct  1     MPFFLDTINKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLV  60

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E DKW+KHR+IINPAFH+EKLKHM+PAF +SC EML   E  +  +   E+DVWPHLQ
Sbjct  61    REEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVSVERAYEIDVWPHLQ  120

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
             Q+  D ISRTAFGS+YEEGR+IFELQ EQAQ+  E +RS+YIPGW FLPT RNRRMK+IE
Sbjct  121   QLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIE  180

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             + VQA IR IIDKRVKAM+ GE + +DLLGILLESNF EIE+HG+K+FG++  EVIEECK
Sbjct  181   RHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFGLSIEEVIEECK  240

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LLVWT++LL RH +WQTRAREEV ++FG  KPD DGLNH+K+VTMIL 
Sbjct  241   LFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRKPDFDGLNHLKVVTMILY  300

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             ESLRLY PV+++TR+  E+T LGD+ LP GVL+S+P +L HHDE+IWG+DAK+FNPERF 
Sbjct  301   ESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIWGEDAKKFNPERFR  360

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVS ATKGQ+TF PF  GPRIC+G NFAMLEAK+V+AMILQR+SF+LS SYAHAP S +
Sbjct  361   EGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFDLSSSYAHAPHSVI  420

Query  238   SLQPQYGAPLLFRKL  194
             + QPQYGAPL+  +L
Sbjct  421   TTQPQYGAPLILHRL  435



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/497 (59%), Positives = 388/497 (78%), Gaps = 2/497 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W+ L+W W  P+K++K L+ +G KG+ YKF+ GD+K++    +EAKSKP+N ++D   R
Sbjct  22    IWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMKEMNSMVEEAKSKPINFTNDYISR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + P F   + + G+N ++WLGP P +LI EP  IR+IL+K+ IY K   NP+ KLLA+G+
Sbjct  82    VFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIREILSKSYIYQKIQGNPITKLLAQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A+YE +KW+KHRRIINPAFH++KLKHM+P+FY+SC +M+   +  +  +G +EVDVWP L
Sbjct  142   ASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKWDNIVSSKG-SEVDVWPFL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGSNYEEGR+IFELQKEQA    +  R IYIPGWRF+PT RN+R+K+I
Sbjct  201   QTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIPGWRFVPTKRNKRIKQI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIE-KHGNKDFGITTREVIEE  785
               +V++L+  II+ R+K M+ GE +KDDLLGILLESNF EI+  H NK+FG+T  EVIEE
Sbjct  261   ANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFKEIQIHHENKNFGMTIDEVIEE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT++LL +H +WQ RAR+EV ++FG +KPD D LN +K+VTMI
Sbjct  321   CKLFYFAGQETTSVLLVWTLILLSKHLDWQERARQEVHQVFGSNKPDYDMLNQLKVVTMI  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              NE LRLY P   + R+ ++ET+LG+L LP G+L+ +P I   HD +IWGDDAKEFNP+R
Sbjct  381   FNEVLRLYPPGAMIGRRVQKETKLGNLSLPAGMLLLLPTIYLQHDNEIWGDDAKEFNPKR  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGV+KATKG+  + PF  GPRIC+G NFAMLEAK+ +AMILQ Y+ ELSPSY+HAP +
Sbjct  441   FSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHYALELSPSYSHAPHT  500

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQ+GAPL+ RKL
Sbjct  501   IITLQPQHGAPLILRKL  517



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/497 (59%), Positives = 387/497 (78%), Gaps = 2/497 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W+ L+W W  P+KL+K L+ +GLKG+ YKF+ GD+K++    +EAKSKP+N ++D   R
Sbjct  22    IWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEINSMVEEAKSKPINFTNDYISR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + P F   + + G+N + WLGP P +LI EP  +R+IL+K+ IY K   NP+ KLLA+G+
Sbjct  82    VFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSKSYIYQKIQGNPITKLLAQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A+YE DKW+KHRRIINPAFH++KLKHM+P+FY+SC +M+  L+  +  +G +E+DVWP L
Sbjct  142   ASYETDKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKLDNIVSSKG-SEIDVWPFL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGSNYEEGR+IFELQKEQA    +  R IYIPGWRF+PT RN+R+K+I
Sbjct  201   QTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIPGWRFVPTKRNKRIKQI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIE-KHGNKDFGITTREVIEE  785
               +V++L+  II+ R+K M+ GE +KDDLLGILLESNF EI+  H NK+FG+T  EVIEE
Sbjct  261   ANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFKEIQIHHENKNFGMTIDEVIEE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT++LL +H +WQ +AR+EV ++FG +KP+ D LN +K+VTMI
Sbjct  321   CKLFYFAGQETTSVLLVWTLILLSKHLDWQEKARQEVHQVFGSNKPNYDMLNQLKVVTMI  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              NE LRLY P   + R+ ++ET+LG L LP G+L+ +P I   HD +IWGDDAKEFNP R
Sbjct  381   FNEVLRLYPPGTMIGRRVQKETKLGHLSLPAGMLLLLPTIYLQHDNEIWGDDAKEFNPMR  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGV+KATKG+  + PF  GPRIC+G NFAMLEAK+ +AMILQ Y+ ELSPSY+HAP +
Sbjct  441   FSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHYALELSPSYSHAPHT  500

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQ+GAPL+ RKL
Sbjct  501   IITLQPQHGAPLILRKL  517



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/493 (60%), Positives = 386/493 (78%), Gaps = 1/493 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP++L++CL++QGL GN Y+ + GDLK++    KEA S+P+++S DI  R+
Sbjct  23    WRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISISDDIVQRI  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF   +I++ G++SF+W+GP P V I EP LIRD+L+ +T++ KP  + L+KLL  G+ 
Sbjct  83    APFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVKLLVSGLL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + +KW+KHR+IINPAF +EKLK+M+PAF++SC +M+   E K+  +G  E+DVWP+LQ
Sbjct  143   FLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEGKLSTEGSCELDVWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGSNYEEGR IFELQ+EQAQ   +   S +IPGWRFLPT  N+RMK+I 
Sbjct  203   NLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIR  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+V AL+  IIDKR KAM+AGE   DDLLGILLESNF EI++H N K+ G++ ++VIEEC
Sbjct  263   KEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEHENDKNVGMSIKDVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WTMVLL +H  WQ RAREEV  +FG +KP+ DGLNH+KIV MIL
Sbjct  323   KLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R   E+ ++GD+ LP GV +S+P IL HHD +IWG+DA+EFNPERF
Sbjct  383   HEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+GV KATK  ++F PFG G R+C+G NFA+LEAK+V+AMILQR+SF LSPSY+HAP S 
Sbjct  443   SQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSL  502

Query  241   VSLQPQYGAPLLF  203
             V+L+PQYGA L+ 
Sbjct  503   VTLKPQYGAHLIL  515



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 383/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W +P+KL+K LR+QGLKGN Y+ + GD+K L K  KEA SKPMNLS DI PR+
Sbjct  21    WRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLKIRKEATSKPMNLSDDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               F    + ++G+NSF+W GP P V I +P  I+D++ K   + KP  NPL++LL  G+ 
Sbjct  81    YSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKDVINKIYDFQKPNVNPLVRLLGCGLV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E ++WSKHR+IINPAFH+EKLK ++P F+ SC +++   EK +   G  E+DVWP LQ
Sbjct  141   CLEGEQWSKHRKIINPAFHLEKLKIILPIFHKSCDDLISKWEKMLSSDGSCEMDVWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR AFGS+YEEG++IF+LQ EQA+  T+++  +YIPGWRFLPT   RRMK+IE
Sbjct  201   NLASDLISRAAFGSSYEEGKRIFQLQTEQAELTTKIIEKVYIPGWRFLPTTTPRRMKEIE  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIEEC  782
             + V+A +  +I+ R +A+ AGE +KDDLLGILLESN  E+E+H  NK+ G++  +VIEEC
Sbjct  261   RDVRASLTDMINTRERALMAGEATKDDLLGILLESNHKEMEEHDNNKNVGMSLDDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF G ETTSVLLVWT+VLL R+ +WQ RAREEV ++FG +KPD DGL+H+KIVTMIL
Sbjct  321   KLFYFAGAETTSVLLVWTIVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PVI L R   ++ +LG+L LP GV I++P++L HHD ++WGDDAK FNPERF
Sbjct  381   YEVLRLYPPVIELARSVHKDVKLGNLTLPAGVQITLPIVLVHHDSELWGDDAKVFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KAT G+ +F+PFGGGPRIC+G NF+MLEAK+ IAMILQR+SFELSPSYAHAPT+ 
Sbjct  441   SEGVLKATNGRNSFVPFGGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPTAL  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA ++ RK+
Sbjct  501   ITLQPQYGAHIILRKV  516



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/496 (58%), Positives = 383/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QGL GN Y+ + GD +++ +   EA S+ ++LS DI  R+
Sbjct  20    WRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISLSDDIVQRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   +I++ G+N F+W+GP P+V I +P LIRD+  K   + KP  +PL KLLA G+ 
Sbjct  80    LPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPPHPLGKLLATGLV  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             T E ++W+K R+IINPAFH+EKLKHMVPAF +SC +M+   EKK+   G  E+D+WP L+
Sbjct  140   TLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMVNKWEKKLSKDGSCELDIWPDLE  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+YIPGWRF+PT  N+RM++I 
Sbjct  200   NLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRMRQIS  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II++R KAM+ GE + DDLL +L+ESNF E+++H   K+ G++ ++VIEEC
Sbjct  260   NEVHALLKGIIERREKAMKVGETANDDLLSLLMESNFREMQEHDERKNVGMSIKDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LL+WTMVLL +H  WQ RAREEV ++FG  KPD DGLNH+KIVT+I 
Sbjct  320   KLFYFAGQETTSDLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTIIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R    ++++G    P G LI++P++L HHD +IWG+DAKEFNPERF
Sbjct  380   HEVLRLYPPVSMLIRTVVADSQVGGWYFPDGALITLPILLIHHDHEIWGEDAKEFNPERF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATKGQ  F PFG GPR+C+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP++ 
Sbjct  440   SEGVSKATKGQFAFYPFGYGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPSNI  499

Query  241   VSLQPQYGAPLLFRKL  194
             +++QPQYGA L+   L
Sbjct  500   ITIQPQYGAYLILHGL  515



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/496 (59%), Positives = 382/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QGL GN Y  ++GD K++++   EA S+P++ S DI  R+
Sbjct  20    WRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPISFSDDIVQRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   +IQ+ G+NSF WLGP P+V I EP LIRD+  K+  + K   +PL KLLA G+ 
Sbjct  80    LPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPLGKLLATGVV  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EKK+   G  E+DVWP+L+
Sbjct  140   ALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSLDGSCELDVWPYLE  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQ+EQA    ++ RSIY+PGWRF PT  NRRM++I 
Sbjct  200   NLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQIS  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II+KR KAM+ GE +  DLLG+L+ESN+ +++++   K+ G++ ++VIEEC
Sbjct  260   NEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQENDERKNVGMSIKDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTSVLL+WTMVLL +H  WQTRAREEV R+FG  KPD DGLNH+KIVTMI 
Sbjct  320   KLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVFGNKKPDGDGLNHLKIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R    ++++G L LP GV I++P++L HHD +IWG+DAKEFNP RF
Sbjct  380   HEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGRF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP S 
Sbjct  440   SEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISL  499

Query  241   VSLQPQYGAPLLFRKL  194
             +++QPQYGA L+   L
Sbjct  500   ITMQPQYGAHLILHGL  515



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 386/496 (78%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QGL GN Y+ + GD +++++   EA S+P++ S DI  R+
Sbjct  31    WRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPISFSDDIVQRV  90

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   +IQ+ G+N+F+WLGP P+V I +P LI D+L K+  + K   +PL KLLA GIA
Sbjct  91    LPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHNAFQKAPRHPLRKLLASGIA  150

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             + E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EK++   G  E+D+WP+LQ
Sbjct  151   SLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDGSCELDIWPYLQ  210

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+Y+PGWRF PT  NRRM++I 
Sbjct  211   NLTGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSVYVPGWRFFPTKTNRRMRQIS  270

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II+KR KAM+AGE + DDLLG+L+ESN+ E++++   K+ G++ ++VIEEC
Sbjct  271   SEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQENDERKNVGMSIKDVIEEC  330

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTSVLL+WTMVLL +H  WQ  AREEV R+FG  KPD D LNH+KIVTMI 
Sbjct  331   KLFYLAGQETTSVLLLWTMVLLSKHSNWQACAREEVLRVFGNKKPDGDDLNHLKIVTMIF  390

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  LTR    ++++G L LP GV I++P++L HHD+KIWG+DAKEFNP RF
Sbjct  391   HEVLRLYPPVPMLTRAVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGEDAKEFNPGRF  450

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP S 
Sbjct  451   SEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISL  510

Query  241   VSLQPQYGAPLLFRKL  194
             +++QPQ+GA L+   L
Sbjct  511   LTMQPQHGAHLILHGL  526



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/497 (59%), Positives = 382/497 (77%), Gaps = 4/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR LNW W  PRK++K LR+QG  GN Y+F+ GD K+++   +EA+SKP+N S+DI  R+
Sbjct  21    WRFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDSKEMSSMGEEAQSKPINFSNDIVHRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF   ++ + GEN F+W GP P  LI +P +I++I++KN ++ K  +NPL +LLA+G+A
Sbjct  81    MPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKEIMSKNYVFQK-ISNPLDQLLAKGVA  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKM-GDQGLAEVDVWPHL  1142
              YE DKW KHRR+INPAFH+EKLKHMVP+FY+SC +ML   ++K+   +G  EVDVWP+L
Sbjct  140   AYEADKWDKHRRLINPAFHLEKLKHMVPSFYLSCADMLSKWDEKIVAKEGSCEVDVWPYL  199

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRTAFGSNYEEGRKIFELQ+EQ +H  + ++++YIPGWRFLPT RNRRMK+I
Sbjct  200   QSMSSDVISRTAFGSNYEEGRKIFELQREQEEHLLQALQTLYIPGWRFLPTKRNRRMKEI  259

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K+V++ I  II KR++ +EAGE + DDLLGILLESNF EI+++G +  G++ +EVI+EC
Sbjct  260   VKEVESTILGIIKKRMQMIEAGESNSDDLLGILLESNFREIQQNGTQS-GMSMKEVIDEC  318

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFG-KDKPDIDGLNHMKIVTMI  605
             KLFY  GQETTS L+ WTM+LL +H  WQ RAR+EV ++ G   KPD   LN +KIV MI
Sbjct  319   KLFYIAGQETTSSLITWTMILLSKHSGWQARARDEVLQVLGTAGKPDFQHLNRLKIVNMI  378

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              +E +RLY P + L R   +ET LG++ LP G+ + +P +  HHD KIWGDDAKEF PER
Sbjct  379   FHEVMRLYPPAVMLGRAIHKETPLGNVTLPAGLQLLLPTVAVHHDPKIWGDDAKEFKPER  438

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS+GV+KAT  Q ++ PFGGGPRIC+G NFAMLEAK+ +AMILQRYSFELSPSYAHAP  
Sbjct  439   FSDGVAKATNVQFSYFPFGGGPRICIGQNFAMLEAKMALAMILQRYSFELSPSYAHAPNM  498

Query  244   TVSLQPQYGAPLLFRKL  194
              V+LQPQ+GA L+ RKL
Sbjct  499   IVTLQPQFGAHLILRKL  515



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/496 (58%), Positives = 381/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QGL GN Y+ + GD +++++   EA S+P++ S DI  R+
Sbjct  20    WRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMINEANSRPISFSDDIVQRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   +IQ+ G+NSF W GP P+V I EP LIRD+L K+ ++ KP  +PL KLLA G+ 
Sbjct  80    LPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVFQKPPPHPLSKLLATGVV  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EKK+   G  E+DVWP+L+
Sbjct  140   ALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSLDGSCELDVWPYLE  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQ+EQA    ++ RSIY+PGWRF PT  NRRM++I 
Sbjct  200   NLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQIS  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II+KR KAM+ GE +  DLLG+L+ESN+ +++++   K+ G++ ++VIEEC
Sbjct  260   NEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQENDERKNVGMSIKDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTSVLL+WTMVLL +H  WQT AREEV R+FG  KPD DGLNH+KIVTMI 
Sbjct  320   KLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVFGNKKPDGDGLNHLKIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R    ++++G L LP GV I++P++L HHD +IWG+DAKEFNP RF
Sbjct  380   HEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGRF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP S 
Sbjct  440   SEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISL  499

Query  241   VSLQPQYGAPLLFRKL  194
             ++  PQYGA L+   L
Sbjct  500   LTTHPQYGAHLILHGL  515



>ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/499 (58%), Positives = 386/499 (77%), Gaps = 5/499 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             W +L+W WF+P+KL++CLR+QG +GN Y+  +GD+K+     KEAKSKPMNLS  HDISP
Sbjct  24    WSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENAIMVKEAKSKPMNLSTSHDISP  83

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++P     ++  G+NSFVW+GP P V I  P  ++D+  K + + KP +NPLIKLL+ G
Sbjct  84    RVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLKDVFAKPSDFPKPVSNPLIKLLSTG  143

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWP  1148
             +A YE +KW+KHRRIINP FH EK+K M+PAFY SC +M+   E  +  +G + E+DVWP
Sbjct  144   LANYEGEKWAKHRRIINPTFHSEKVKRMLPAFYQSCNDMIKEWETVVSKEGSSCEIDVWP  203

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
              LQ +  D ISRTAFGS+Y+EG+KIFEL KEQA +  + ++ +YIPGWRF+PT  N+RMK
Sbjct  204   SLQNLTADVISRTAFGSSYQEGQKIFELLKEQAVYAMKTVQRVYIPGWRFVPTKMNKRMK  263

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG--NKDFGITTREV  794
             +I ++++ L+  II+KR +A++AGE +KDDLLG LLESN  +I+ HG  NK+ G++  +V
Sbjct  264   QIHEEIRGLVEGIINKREQAIKAGEATKDDLLGALLESNMKDIQDHGKNNKNVGMSIEDV  323

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTSVLLVWTMVLL ++Q WQ +AREEV ++FG +KPD DGL H+K V
Sbjct  324   IEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQDQAREEVLQVFGMNKPDFDGLTHLKAV  383

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TM+L E LRLY  ++ ++R  +++T+ G   LP GV + +P +L HHD+++WGDDAKEF 
Sbjct  384   TMVLLEVLRLYPALVVVSRTTRKKTQFGKFSLPAGVQVGLPALLIHHDKELWGDDAKEFK  443

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERFSEGVSKATKGQL+F PFG GPRIC+G NFAM EAKL +A+ILQ ++FELSPSYAHA
Sbjct  444   PERFSEGVSKATKGQLSFFPFGAGPRICIGQNFAMTEAKLALALILQHFTFELSPSYAHA  503

Query  253   PTSTVSLQPQYGAPLLFRK  197
             P++ ++LQPQYGAP++  K
Sbjct  504   PSALITLQPQYGAPVMLHK  522



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/496 (61%), Positives = 385/496 (78%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+ NW W RPRKL+K LR QG  GN Y+  FGD+K++    KEAKSKP+NL  DI PR+
Sbjct  22    WRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMIVMLKEAKSKPINLYDDIIPRI  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P     I   G+NSF+WLGP PMV I  P  I+D+L+K   + KP  NPL KLLA G+A
Sbjct  82    IPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSKFYQFQKPRHNPLTKLLATGVA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E D+W+KHR++INPAFH+EKLK+M+PA Y+S  E++   E+ +  +G  E+DV P+L+
Sbjct  142   DAEGDRWAKHRKLINPAFHLEKLKNMLPAIYLSSSEIVTKWEEMVSTKGQFELDVLPYLE  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YEEGRKIF+LQ+EQA+   +  ++IY+PG RFLPT RN+RMK+I 
Sbjct  202   TLTSDVISRTAFGSSYEEGRKIFQLQREQAELIIQASQTIYLPGMRFLPTKRNKRMKEIA  261

Query  958   KQVQALIRCIIDKRVKAMEAGE-GSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             K+V+  ++ II+KR+KAMEAGE  S DDLLGILLESN  EI++HGN +FG+T  EVIEEC
Sbjct  262   KEVKIALKSIINKRLKAMEAGERSSHDDLLGILLESNSKEIKQHGNTNFGLTVDEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLF+F GQETTS LLVWTM+LL +HQ+WQ RA+EEV R FG +KPD DGLNH+K+V MIL
Sbjct  322   KLFFFAGQETTSNLLVWTMILLSQHQDWQKRAKEEVLRTFGNNKPDFDGLNHLKVVNMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P++SL R   EE +LG++ LP GV++ +P+IL H+D++IWGDDAKEFNPERF
Sbjct  382   LEVLRLYPPILSLDRTIYEEIKLGEISLPAGVILLLPIILLHYDQEIWGDDAKEFNPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KATKG++T+ PF  GPRIC+G NFAMLEAK+ +AMILQR+SF LSPSYAHAP + 
Sbjct  442   SEGVLKATKGRVTYFPFSWGPRICIGQNFAMLEAKMAMAMILQRFSFVLSPSYAHAPHAI  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA L+   L
Sbjct  502   ITLQPQYGAHLILHSL  517



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/497 (59%), Positives = 385/497 (77%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+ LNW WFRPRKL+K L++QG +GN YK + GD+K+++   KEA+SK +NLS DI PR+
Sbjct  25    WKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHKEAQSKNLNLSDDIVPRV  84

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P ++ A+++ G+ +++WLGP P ++I +P  +++I  K  ++ KP  NPL ++L  GI 
Sbjct  85    IPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVFQKPHGNPLRRMLTPGIV  144

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE DKW++HR+++NPAFH+EKLK M+PAF+ S  E++   EK +  +G AEVDVWP+LQ
Sbjct  145   MYEGDKWTQHRKLLNPAFHIEKLKLMLPAFHKSASEVVNKWEKVVSPKGSAEVDVWPNLQ  204

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRS--IYIPGWRFLPTWRNRRMKK  965
              +  DAISRTAFGSNYEEGR+IFELQ+EQA+H  E   S  IYIPG+RFLPT R+RRMK+
Sbjct  205   ALTSDAISRTAFGSNYEEGRRIFELQREQAEHIVEAGGSVYIYIPGFRFLPTKRHRRMKQ  264

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I K+V   IR +ID R KAM AGE   D+LLG++L+SN  EIEKHGNKD+G+TT E+I+E
Sbjct  265   ITKEVNDSIREMIDTRKKAMRAGEARTDNLLGLMLQSNSQEIEKHGNKDYGMTTEEIIDE  324

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFY  GQETTS LLVWTM+ L R+ +WQ RAREEV + FG + P+ DGLN +KIV MI
Sbjct  325   CKLFYLAGQETTSALLVWTMIYLSRYPDWQARAREEVLQHFGANDPEFDGLNQLKIVNMI  384

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L+E LRL  P+ +  R+  EET+LG+L +P GVL+ +P++L HHD  IWG+D KEF PER
Sbjct  385   LHEVLRLCPPITATARRIAEETKLGNLTIPVGVLLVLPIMLMHHDPDIWGEDVKEFKPER  444

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F+EGVS ATKG+L F PFG GPRIC+G NFAMLEAKL ++MILQR+SFELSPSYAH+P  
Sbjct  445   FAEGVSHATKGRLAFWPFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSYAHSPRV  504

Query  244   TVSLQPQYGAPLLFRKL  194
              V+L+PQYGA L+ RK+
Sbjct  505   AVTLRPQYGAHLILRKV  521



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/497 (60%), Positives = 391/497 (79%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNWA+  P++L + LRKQG KGN YK ++GDLK+LT+ + EA+SKP+NL  DI  R+
Sbjct  21    WKLLNWAYITPKRLGEALRKQGFKGNAYKLVYGDLKELTQLSMEARSKPINLDDDIKNRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT-NPLIKLLAEGI  1322
              PF ++AI ++G  SFVWLGP P +++ +P L++++L+K+ +Y +P   NP+ KLL +G+
Sbjct  81    APFIVNAIHKHGNESFVWLGPRPSIILTDPELVKEVLSKSYLYLRPENRNPMTKLLLQGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A+YE+D+W+KHR+IINPAFH+EKLK M+PAFYMSC E+L   EK +  +G  EVDVWP+L
Sbjct  141   ASYEKDEWAKHRKIINPAFHLEKLKLMIPAFYMSCDEVLKTWEKNVSSEGSYEVDVWPYL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+Y+EGR+IFELQ+EQ +H  + +RSIY+PGWRF+PT RNRRMK+I
Sbjct  201   QNLTSDAISRTAFGSSYQEGRRIFELQREQVEHIIQALRSIYVPGWRFVPTKRNRRMKQI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKD-DLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             E++VQ+ IR +I KR++AM+ GE   D DLL ILL SNF EIEK GNK FG+T   V+EE
Sbjct  261   EREVQSTIRGLISKRIEAMKTGEARHDEDLLSILLASNFQEIEKGGNKSFGMTIDAVVEE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWT+VLL R+ +WQTRAREEV ++ G   PD D LN +KIVTMI
Sbjct  321   CKLFYFAGQETTSVLLVWTLVLLSRYPDWQTRAREEVMQVIGNRTPDFDSLNQLKIVTMI  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY PV++L R+  EET+LG   LP GV +S+ +I+ HHD KIWGDDA EFNP+R
Sbjct  381   LYEVLRLYPPVVALGRRASEETKLGKYTLPAGVQLSLSIIVLHHDTKIWGDDAMEFNPQR  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGV+KA KG   F PFG GPRIC+G  FAMLEAK+ +A++L+ +SFELSP+Y HAP +
Sbjct  441   FSEGVAKAQKGPGIFFPFGWGPRICIGQVFAMLEAKMAMAVLLRSFSFELSPAYTHAPLN  500

Query  244   TVSLQPQYGAPLLFRKL  194
              ++ QPQ+GA LL  KL
Sbjct  501   LITTQPQHGAHLLLHKL  517



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/428 (66%), Positives = 364/428 (85%), Gaps = 1/428 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W++L WAWFRPRKL++CLR+QGL GN YK IFGDLK+L+K+ +E KSKP+N+S D I PR
Sbjct  22    WKLLKWAWFRPRKLEQCLRQQGLIGNSYKLIFGDLKELSKSIEEVKSKPLNVSDDDIPPR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LP+FI+AI++ G+N FVWLGPNP+V ++EP +I+D+LT++ +Y KP + PL +LLA+GI
Sbjct  82    ILPYFIEAIKKYGKNCFVWLGPNPLVFVREPEVIKDVLTRHALYQKPKSTPLTRLLAQGI  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YEEDKW+KHR+I+NPAFHMEK+KHM+PAF++SC EM+   E+    +G  E+D+WP+L
Sbjct  142   VSYEEDKWAKHRKILNPAFHMEKIKHMLPAFHLSCSEMVSQWEEAASVKGSCELDIWPYL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q++  DAISRTAF SNYEEGRKIFELQKEQA+H   + R++YIPGWRF+PT RNRRMK+I
Sbjct  202   QRLSSDAISRTAFESNYEEGRKIFELQKEQAEHVIAISRTLYIPGWRFMPTKRNRRMKQI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             EK+VQA IR IIDKRVKAM+AGE + DDLLGILL+SNF EIE+HGNKDFG++T+EVIEEC
Sbjct  262   EKEVQATIRGIIDKRVKAMKAGEANADDLLGILLDSNFKEIEQHGNKDFGMSTQEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM LL RH +WQ RAREEV ++FG    + DGL+ +KIVTMIL
Sbjct  322   KLFYFAGQETTSVLLVWTMFLLSRHPDWQARAREEVLQVFGDGMLEFDGLSRLKIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +ESLRLY PV +L R+   +T+LG+L LP GV++S+P++L HHD++IWG+DAKEF P+RF
Sbjct  382   HESLRLYPPVGALGRRITTKTKLGELGLPAGVMLSLPILLVHHDKEIWGEDAKEFKPDRF  441

Query  421   SEGVSKAT  398
             SEGVSKAT
Sbjct  442   SEGVSKAT  449



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/496 (59%), Positives = 392/496 (79%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W +P+KL+K LR+QG KGN Y+ + GD++ L KT KEA SKPMNLS DI PR+
Sbjct  22    WRMLNWLWLKPKKLEKLLREQGFKGNSYRLLVGDVRDLLKTRKEATSKPMNLSDDIGPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               +   ++ + G+NSF+W GP P V I +P  I+D+L K   + KP +NPL++LLA G+ 
Sbjct  82    FSYVHHSVTKYGKNSFMWFGPIPRVNITDPEQIKDVLNKIYDFRKPNSNPLVRLLANGLV  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE +KW+KHR+IINPAFH+EKLK M+P F+ SC +++   EK +  +G  E+DVWP LQ
Sbjct  142   SYEGEKWNKHRKIINPAFHLEKLKIMLPIFFKSCDDLISKWEKMLSLEGSCEMDVWPFLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS++EEG++IF+LQ EQA+   ++M  +YIPGWRFLPT  ++RMK+I+
Sbjct  202   NLASDVISRTAFGSSFEEGKRIFQLQIEQAELTKQIMMKVYIPGWRFLPTTTHKRMKEID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             + ++A +  +I+KR KA++AGE +KDDLLGILLESN  E+E+HG NK+ G++  +VIEEC
Sbjct  262   RDIKASLTDMINKREKALKAGEATKDDLLGILLESNHREMEEHGNNKNVGMSLEDVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMV L R+ +WQ RAREEVF++FG  KPD DGL+H+KIVTMIL
Sbjct  322   KLFYFAGQETTSVLLVWTMVCLSRYPDWQARAREEVFQVFGNKKPDFDGLSHLKIVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY PVI+L R   ++ +LG++ LP GV +S+PV+L HHD ++WGDDAK FNPERF
Sbjct  382   NEVLRLYPPVIALARSVHKDVKLGNITLPAGVQVSLPVVLVHHDCELWGDDAKVFNPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KAT G+++F PFGGGPRIC+G NF+MLEAK+ +AMILQ +SFELSPSYAHAP + 
Sbjct  442   SEGVLKATNGKVSFFPFGGGPRICIGQNFSMLEAKMAMAMILQHFSFELSPSYAHAPATV  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA ++ RK+
Sbjct  502   ITLQPQYGAHIILRKV  517



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/493 (58%), Positives = 383/493 (78%), Gaps = 1/493 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP++L++CL++QGL GN Y+ + GD K++    KEA S+P+++S DI  R+
Sbjct  23    WRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISISDDIVQRI  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF   +I++ G++SF+W+GP P V I EP LIRD+L+ +T++ KP  + L+KLL  G+ 
Sbjct  83    APFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVKLLVSGLL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + +KW+KHR+IINPAF +EK+K+M+PAF++SC +M+   E K+  +G  E+DVWP+LQ
Sbjct  143   FLDGEKWAKHRKIINPAFRLEKVKNMLPAFHLSCSDMISKWEGKLSTEGSCELDVWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGSNYEEGR IFELQ+EQAQ   +   S +IPGWRFLPT  N+RMK+  
Sbjct  203   NLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQNR  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+V  L+  IIDKR KAM+AGE   DDLLGILLESNF EI++HGN K+ G++ ++VI+EC
Sbjct  263   KEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQEHGNDKNVGMSIKDVIDEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K+FYF GQETTSVLL+WTM+LL +H  WQ RAREEV  +FG +KP+ DGLNH+KIV MIL
Sbjct  323   KIFYFAGQETTSVLLLWTMILLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R   E+ ++GD+ LP GV +S+P IL HHD +IWG+DA+EFNPERF
Sbjct  383   HEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+G  KATK  ++F PFG G R+C+G NFA+LEAK+V+AMILQR+SF LSPSY+HAP S 
Sbjct  443   SQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSL  502

Query  241   VSLQPQYGAPLLF  203
             V+L+PQYGA L+ 
Sbjct  503   VTLKPQYGAHLIL  515



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/497 (61%), Positives = 378/497 (76%), Gaps = 5/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W++LN+ W +P++L+KC+R+QG KGN YKF+FGD+K++ K  +EA SKP+N SHD I PR
Sbjct  25    WKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSKPINFSHDMIWPR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PF    I   G+N FVW GP P VLI +P L++++LTKN +Y KP   PL KL A GI
Sbjct  85    VMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQKPPGTPLTKLAATGI  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+ HRR++NPAFH++KLKHM+PAF  +  EML  LEK +   G  E+DVWP+L
Sbjct  145   AGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKVVSPNG-TEIDVWPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEGRKIFELQKEQ     E+ R+IYIPGWRFLPT RN+RMK+I
Sbjct  204   QTLTSDAISRTAFGSSYEEGRKIFELQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEE  785
               +V+AL+  II KR+  +E GE + DDLLGILL SN  EI++HG NK FG++  EVIEE
Sbjct  264   FNEVRALVLGIIKKRLSMIENGE-APDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTM+LL +H  WQ +AREEV ++FG  + D D LN +KIVTMI
Sbjct  323   CKLFYFAGQETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSREVDYDKLNQLKIVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY    ++ R   +ET+LG+L LP GV + +P IL  HD +IWGDDA EFNPER
Sbjct  383   LNEVLRLYPAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHDTEIWGDDAMEFNPER  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS+G+SKATKG+L F PF  GPRIC+G NFAMLEAK+ +AMIL+ Y+FELSPSYAHAP  
Sbjct  443   FSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKNYAFELSPSYAHAPHP  502

Query  244   TVSLQPQYGAPLLFRKL  194
              + LQPQYGA L+  KL
Sbjct  503   LL-LQPQYGAQLILYKL  518



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/497 (61%), Positives = 378/497 (76%), Gaps = 5/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W++LN+ W +P++L+KC+R+QG KGN YKF+FGD+K++ K  +EA SKP+N SHD I PR
Sbjct  25    WKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSKPINFSHDMIWPR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PF    I   G+N FVW GP P VLI +P L++++LTKN +Y KP   PL KL A GI
Sbjct  85    VMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQKPPGTPLTKLAATGI  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+ HRR++NPAFH++KLKHM+PAF  +  EML  LEK +   G  E+DVWP+L
Sbjct  145   AGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKVVSPNG-TEIDVWPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEGRK+FELQKEQ     E+ R+IYIPGWRFLPT RN+RMK+I
Sbjct  204   QTLTSDAISRTAFGSSYEEGRKLFELQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEE  785
               +V+AL+  II KR+  +E GE + DDLLGILL SN  EI++HG NK FG++  EVIEE
Sbjct  264   FNEVRALVLGIIKKRLSMIENGE-APDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTM+LL +H  WQ +AREEV ++FG  + D D LN +KIVTMI
Sbjct  323   CKLFYFAGQETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSREVDYDKLNQLKIVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY    ++ R   +ET+LG+L LP GV + +P IL  HD +IWGDDA EFNPER
Sbjct  383   LNEVLRLYPAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHDTEIWGDDAMEFNPER  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS+G+SKATKG+L F PF  GPRIC+G NFAMLEAK+ +AMIL+ Y+FELSPSYAHAP  
Sbjct  443   FSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKNYAFELSPSYAHAPHP  502

Query  244   TVSLQPQYGAPLLFRKL  194
              + LQPQYGA L+  KL
Sbjct  503   LL-LQPQYGAQLILYKL  518



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/499 (58%), Positives = 378/499 (76%), Gaps = 5/499 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             W VL+W W +P+KL++CLRKQG KGN Y+ ++GD K+     K+AKSKPMNLS  HDI+P
Sbjct  24    WSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIMLKKAKSKPMNLSTSHDIAP  83

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+ P     ++  G+NS VW+GP P V I  P  ++D+ T+ + + KP +NPL+K LA G
Sbjct  84    RVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTELSDFQKPHSNPLVKFLATG  143

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWP  1148
             +  +E +KW+KHRRIINP FH EKLK M+PAFY SC EM+   E  +  +  + E+DVWP
Sbjct  144   LVIHEGEKWAKHRRIINPTFHFEKLKRMLPAFYQSCDEMIKEWETVVSKESSSHEIDVWP  203

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
              LQ +  D ISRTAFGS+Y+EGRKIFEL KEQA +  + ++S+YIPGWRF+PT  N+RMK
Sbjct  204   SLQNVTADVISRTAFGSSYQEGRKIFELLKEQAVYAMKSIQSVYIPGWRFVPTKMNKRMK  263

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG--NKDFGITTREV  794
             +I+K+++ ++  II KR +A+E GE  KDDLLG L+ESN  EI  HG  NKD G++  +V
Sbjct  264   QIDKEIRNVLMGIISKREQAIEVGEAIKDDLLGALMESNLKEIRDHGKNNKDVGMSIEDV  323

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTSVLLVWTMVLL ++Q WQ  AREEV ++FG +KP+ DGL H+K+V
Sbjct  324   IEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQHLAREEVLQVFGMNKPEFDGLTHLKVV  383

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY  V+ L+R   ++T+LG   LP GV + +P +L HHD+++WGDDAKEF 
Sbjct  384   TMILLEVLRLYPAVVVLSRTTHKKTQLGKFSLPAGVEVELPTLLIHHDKELWGDDAKEFR  443

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERFSEGVSKATKG L+F PFG GPRIC+G NFAM+EAKL +A+ILQ ++FELSPSY HA
Sbjct  444   PERFSEGVSKATKGHLSFFPFGAGPRICIGQNFAMMEAKLALALILQHFTFELSPSYTHA  503

Query  253   PTSTVSLQPQYGAPLLFRK  197
             P++ V+LQPQ+GAP++  K
Sbjct  504   PSNLVTLQPQFGAPIILHK  522



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/496 (61%), Positives = 378/496 (76%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+LNW WF+P+KL+KCLR+QG KGN YKF+FGD+K++ K  KEA SKP++ SHD I PR
Sbjct  27    WRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPIDFSHDMIWPR  86

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PFF   I   G+N F W GP P V+I +P LIR++LTKN IY KP  NPL +L A G+
Sbjct  87    VMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELIREVLTKNYIYQKPPGNPLTRLAANGL  146

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+KHRRI+NPAFH++KLKHM+PAF ++  E+L   ++ +  +G +E+DVWP+L
Sbjct  147   AGYEADKWAKHRRIVNPAFHLDKLKHMLPAFQLTSSELLKKWKEIISKEG-SEIDVWPYL  205

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEG+KIFELQKEQ     ++ RS+YIPGWRF+PT  NRRMK+I
Sbjct  206   QTLTSDAISRTAFGSSYEEGKKIFELQKEQMGLLLQVARSLYIPGWRFVPTKTNRRMKQI  265

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V ALI  II KR+K +E GE   DDLL ILL SN  EI++HG+K FG++  EVIEEC
Sbjct  266   FNEVGALILGIIKKRIKMIEDGE-IHDDLLSILLTSNLQEIQQHGHKKFGMSIDEVIEEC  324

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVWTM+LL ++  WQ RAREEV ++F  D+ D D LNH+K VTMIL
Sbjct  325   KLFYLAGQETTSALLVWTMILLSKYPIWQERAREEVLQVFESDEFDYDKLNHLKSVTMIL  384

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY     + R   ++T+LG++ LP GV + +  IL HHD +IWGDDA EFNPERF
Sbjct  385   NEVLRLYPSGYFINRVVTKDTKLGNVCLPSGVQLLLGTILLHHDTEIWGDDAMEFNPERF  444

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+GV+KATKGQL F PF  GPRIC+G NFAMLEAK+ IAMIL+ YSFELSPSYAHAP   
Sbjct  445   SDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKHYSFELSPSYAHAPHPL  504

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQYGA L+  KL
Sbjct  505   L-LQPQYGAHLILYKL  519



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/495 (59%), Positives = 382/495 (77%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP+KL++CLR+QGL GN Y+ + GD K+ +   KEAKSKPMNLSHDI+PR+
Sbjct  24    WRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHDITPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+N F+W+GP P V I  P  ++D+ T    + KP  NPL+KLLA G+ 
Sbjct  84    LPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKLLATGLP  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHR+IINPAFH+EKLK M+PAF++SC EM+   E+ +  +G  E+DVWP+L+
Sbjct  144   NYEGEKWAKHRKIINPAFHLEKLKRMLPAFHLSCSEMIEEWERLVSKEGSCELDVWPYLE  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR +FGS+Y+EGRKIF+L KEQA+     ++S+YIPGWRFLPT  N+RMK I+
Sbjct  204   SLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSVYIPGWRFLPTRSNKRMKAID  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+++  +R II  R +A+  GE +KDDLLGILLESN  EI ++GN K+ G++  +VIEEC
Sbjct  264   KEIKGSLRDIISTREEAIRMGEATKDDLLGILLESNLKEIRENGNTKNVGMSIEDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WT+VLL ++Q WQ RAR+EV ++FG +KPD DGLNH+K+VTMIL
Sbjct  324   KLFYFAGQETTSVLLLWTLVLLSQNQNWQARARDEVLQVFGSNKPDFDGLNHLKVVTMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY  V++L R    +T LG L LP GV +S+P++L HHD+++WG+DA  FNPERF
Sbjct  384   LEVLRLYPSVVALPRTTHNKTHLGKLSLPAGVEVSLPILLLHHDKELWGEDAIGFNPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA+K Q  + PFGGGPRIC+G NFAMLEAKL  +++LQR++FELSPSYAHAP+  
Sbjct  444   SEGVSKASKNQFAYFPFGGGPRICIGQNFAMLEAKLAFSLLLQRFTFELSPSYAHAPSLI  503

Query  241   VSLQPQYGAPLLFRK  197
             +SLQPQYGA ++  K
Sbjct  504   ISLQPQYGAHIILHK  518



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/496 (58%), Positives = 383/496 (77%), Gaps = 2/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLRKQGL GN Y+ + GD +++++   EA S P++ S DI  R+
Sbjct  20    WRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNNEANSGPISFSDDIVKRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPFF  +IQ+ G+NSF WLGP P+V I EP LIRD+L K+ ++ KP  +PL KLLA G+ 
Sbjct  80    LPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVFQKPPPHPLGKLLATGVV  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EKK+      E+D+WP+LQ
Sbjct  140   ALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSMDDSCELDIWPYLQ  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQKEQA    ++ +S+Y+PGWRF PT  NRRM++I 
Sbjct  200   ILTGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSVYVPGWRFFPTKINRRMRQIR  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              +V AL++ II+KR KAM+ GE +  DLLG+L+ESN+ E++++   K+ G++ ++VIEEC
Sbjct  260   NEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYREMQENDERKNVGMSIKDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WTMVLL +H  WQ RAREEV ++FG  KPD DGLNH+KIVTMI 
Sbjct  320   KLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   L R    ++++G L L  GVLI++P++L HH+ +IWG+DAKEFNP RF
Sbjct  380   HEVLRLYPPASMLIRTVFADSQVGGLYLSDGVLIALPILLIHHNHEIWGEDAKEFNPGRF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQR+SF+LSPSYAHAP+S 
Sbjct  440   SEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFDLSPSYAHAPSSL  499

Query  241   VSLQPQYGAPLLFRKL  194
             + +QPQ+GA L+   L
Sbjct  500   L-MQPQHGAHLILHGL  514



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/496 (61%), Positives = 379/496 (76%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDIS-PR  1502
             WR+LNW WF+P+ L+KCLR+QG KGN YKF+FGD+K++ K  KEA SKP++ SHD++ PR
Sbjct  29    WRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPIDFSHDMTWPR  88

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PFF   I   G+N F W GP P V+I +P LIR++L+KN IY KP  NPL +L A G+
Sbjct  89    VMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPPGNPLTRLAANGL  148

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+KHRRIINP FH++KLKHM+PAF ++  EML   ++ +  +G +E+DVWP+L
Sbjct  149   AGYEADKWAKHRRIINPGFHLDKLKHMLPAFQLTSSEMLNKWKEIISKEG-SEIDVWPYL  207

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEG+KIFELQKEQ +   ++ RS+YIPGWRF+PT  NRRMK+I
Sbjct  208   QTLTSDAISRTAFGSSYEEGKKIFELQKEQMELLLQVARSLYIPGWRFVPTKTNRRMKQI  267

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V ALI  II+KR+K +E GE   DDLL ILL SN  EI++HG+K FG++  EVIEEC
Sbjct  268   FNEVGALILGIINKRIKMIEDGE-IHDDLLSILLASNLQEIQQHGHKKFGMSIDEVIEEC  326

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVWTM+LL ++  WQ RAR+EV ++F  D+ D D LNH+K+VTMIL
Sbjct  327   KLFYLAGQETTSALLVWTMILLSKYPIWQQRARQEVLQVFESDEFDYDKLNHLKVVTMIL  386

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY     + R   ++T+LG+L LP GV + +  IL HHD +IWGDDA EFNPERF
Sbjct  387   NEVLRLYPSAYFINRVVTKDTKLGNLCLPSGVQLLLGTILLHHDTEIWGDDAMEFNPERF  446

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+GV+KATKGQL F PF  GPRIC+G NFAMLEAK+ IAMIL+ YSFELS SYAHAP   
Sbjct  447   SDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKHYSFELSSSYAHAPHPL  506

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQYGA L+  KL
Sbjct  507   L-LQPQYGAHLILYKL  521



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/496 (57%), Positives = 386/496 (78%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++ LR+QGL+GN Y+ I GDLK L K  KEAKSKPMNLS DI PR+
Sbjct  25    WRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKSKPMNLSDDILPRV  84

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              P+   ++ ++G+NSF+W GP P V + +P  I+D+L K   + K   + L+KLLA G+ 
Sbjct  85    FPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSDGDRLVKLLATGLV  144

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE +KWSKHRRIINPAF++EKLK M+P F+ SC +++   E  +   G  E+D+WP LQ
Sbjct  145   SYEGEKWSKHRRIINPAFNLEKLKIMLPIFFQSCNDLITKWEGMLSSDGSCEMDIWPFLQ  204

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D I+R AFGS+YEEGR+IF+LQKEQ +H   ++  +YIPGWRFLPT  +RRMKKI+
Sbjct  205   NLASDVIARAAFGSSYEEGRRIFQLQKEQVEHTMSVLVKVYIPGWRFLPTTTHRRMKKID  264

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             ++++A ++ +I+KR +A++AGE +K++LL ILLESN  E+E+HG N++ G++  +VIEEC
Sbjct  265   REIKASLKEMINKRERALKAGEATKNNLLDILLESNHKEVEEHGNNRNVGMSLEDVIEEC  324

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTMVLL R+ +WQ RAREEV ++FG  KPD DGL+H+KIVTMIL
Sbjct  325   KLFYFAGQETTSGLLVWTMVLLSRYPDWQARAREEVLQVFGNKKPDFDGLSHLKIVTMIL  384

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PVI+L R   ++ +LG+  LP GV + +P++L HHD ++WGDDA+ FNPERF
Sbjct  385   YEVLRLYPPVIALARTVHKDVKLGNRTLPAGVQLYLPIVLFHHDRELWGDDAEVFNPERF  444

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+YAHAPT+ 
Sbjct  445   SEGVLKATNGKVSFFPFGWGPRICVGQNFSLLEAKMAVSMILQHFSFELSPAYAHAPTTV  504

Query  241   VSLQPQYGAPLLFRKL  194
             ++L+PQYGA ++ RK+
Sbjct  505   ITLRPQYGAHIILRKV  520



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 378/502 (75%), Gaps = 7/502 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+V N AW  P++L+K L++QGL+GN YKF+ GD KQ++   KEA SK +NLS D+ PR+
Sbjct  24    WKVFNCAWLTPKRLEKRLKEQGLRGNPYKFLHGDFKQISTLLKEAHSKTINLSDDLFPRV  83

Query  1498  LPFFIDAIQRNGE-------NSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIK  1340
             +P   +A+++ G+       N+++WLGP   V+I  P  IR+I +K +I+ KP   P  K
Sbjct  84    IPHLHEAVKKYGKYYLLFNYNTYIWLGPKLRVVIMNPEHIREITSKLSIFQKPGGTPDTK  143

Query  1339  LLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEV  1160
             LL +G+A+Y+ DKW+KHR++I PAFH+EKLKHMVP+F     EML   EK +   G  E+
Sbjct  144   LLVQGLASYDGDKWAKHRKLITPAFHVEKLKHMVPSFCTCAGEMLSKWEKIVSTNGSCEL  203

Query  1159  DVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRN  980
             DVWP L+ +  DAISRTAFGSNY+EG +IFELQ EQAQ+  + ++S+Y PGWRFLPT RN
Sbjct  204   DVWPDLRTLTCDAISRTAFGSNYKEGTRIFELQTEQAQYHLKAVQSVYFPGWRFLPTKRN  263

Query  979   RRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTR  800
             RRMK+I K V   IR II+ R++AMEAG+   DDLL ILLESN  EI+ HGNK FG++ R
Sbjct  264   RRMKQIAKDVHESIRKIINARLEAMEAGDACADDLLSILLESNSKEIDYHGNKGFGMSIR  323

Query  799   EVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMK  620
             EVIEECKLFYF GQETTSVLLVWTM+LL R+  WQ RAREEV + FG +KPD+DGLNH+K
Sbjct  324   EVIEECKLFYFAGQETTSVLLVWTMILLSRYPNWQARAREEVLQHFGTNKPDLDGLNHLK  383

Query  619   IVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKE  440
             +VTMIL+E LRLY PV  L RK  EET+LG+L LP  V +S+P +L H+  +IWGDD KE
Sbjct  384   LVTMILHEVLRLYPPVPELARKAAEETQLGNLTLPSQVQVSLPAMLLHYAPEIWGDDVKE  443

Query  439   FNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYA  260
             F PERF++GVS AT G++ F PFG GPRIC+G NFAMLEAK+ +AMILQR+SFELSPSY 
Sbjct  444   FKPERFADGVSNATNGKVAFFPFGWGPRICVGQNFAMLEAKVALAMILQRFSFELSPSYR  503

Query  259   HAPTSTVSLQPQYGAPLLFRKL  194
             HAP   ++LQPQYGA L+  KL
Sbjct  504   HAPRVVLTLQPQYGAHLILHKL  525



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/500 (60%), Positives = 388/500 (78%), Gaps = 7/500 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMN-LSHDISPR  1502
             W+VLNW WFRPR L+K LR+ G +GN Y+ +FGD K+++   KEAKSKP++  S+DI  R
Sbjct  21    WKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSNDIVAR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P    A+   GE   +W GP P VL+ +  LIR+IL+K+ ++ K  +NPL + LA G+
Sbjct  81    VIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQKN-SNPLGRQLARGV  139

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             ATYE DKW+KHRR+INPAF  +K+K M+P+FY+SC +ML   E+K+  +G +EVDVWP+L
Sbjct  140   ATYETDKWAKHRRLINPAFQPDKIKQMLPSFYLSCCDMLSKWEEKLAKEGSSEVDVWPYL  199

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSI--YIPGWRFLPTWRNRRMK  968
             Q +  DAISRTAFGS+YEEGRKIFELQKEQA+   + ++SI   IPGWRFLPT  N RMK
Sbjct  200   QTLTSDAISRTAFGSSYEEGRKIFELQKEQAELIMQAVQSINFQIPGWRFLPTKMNIRMK  259

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGS--KDDLLGILLESNFNEIEKHGNKDFGITTREV  794
             +I K+V++ IR IIDKR+K MEA EGS   DDLLGILL+SNF EI+++GNK FG++  EV
Sbjct  260   QIVKEVESSIRGIIDKRMKEMEAREGSYSSDDLLGILLDSNFREIKQNGNK-FGMSLDEV  318

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTS LLVWTM+LL +H +WQ+RARE+V + FG  KPD   LNH+KIV
Sbjct  319   IEECKLFYFAGQETTSSLLVWTMILLSKHSDWQSRAREDVLQTFGTRKPDFQELNHLKIV  378

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL+E LRLY   ++L R  ++ET LG   LP GV + +PV+L HHD K+WGDDAKEF+
Sbjct  379   TMILHEVLRLYPAGVNLGRTTRKETPLGKSTLPAGVQLILPVLLLHHDSKMWGDDAKEFD  438

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             P RFSEGVSKAT G+L++ PFG GPRICLG +FA+LEAK+ +AMILQRYSF+LSPSY+HA
Sbjct  439   PNRFSEGVSKATNGKLSYFPFGWGPRICLGQSFAILEAKMALAMILQRYSFQLSPSYSHA  498

Query  253   PTSTVSLQPQYGAPLLFRKL  194
             P + ++LQPQ+GA L+  KL
Sbjct  499   PYTVITLQPQHGAHLILTKL  518



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 375/496 (76%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNW WF+P++L+KCLR+QG KGN Y+F+FGD+ ++ K  KEA SKP++ SH+I PR+
Sbjct  25    WKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVNEMMKMGKEALSKPIDFSHNIWPRV  84

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PFF   I   G+N   W GP P ++I +P LIR++LTKN I+ KP   PL KL A G+A
Sbjct  85    MPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREVLTKNYIFQKPPGTPLTKLAANGLA  144

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE DKW+KHRR+INPAFH++KLKHM+PAF ++  EML   EK +   G +E+DVWP+LQ
Sbjct  145   GYEADKWAKHRRLINPAFHLDKLKHMLPAFLLTASEMLSKWEKVVSTGG-SEIDVWPYLQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEGRKIFELQKEQ +   ++ RS+YIPGWRF+PT  NRRMK+I 
Sbjct  204   TLTSDAISRTAFGSSYEEGRKIFELQKEQMELLLQIARSLYIPGWRFIPTKTNRRMKQIF  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
              +V+ LI  II KR+  +E GE + DDLLG LL SN  EI++HG NK FG++  EVIEEC
Sbjct  264   NEVRVLILGIIKKRMSMIENGE-APDDLLGTLLASNLKEIQQHGNNKKFGMSIDEVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVWTM+LL ++  WQ +AREEV ++FG D  D D LN +KIVTMIL
Sbjct  323   KLFYLAGQETTSALLVWTMILLCKYPIWQEQAREEVLQVFGNDDLDYDKLNQLKIVTMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE +RLY     + R   +ET+LG+L LP GV + +  IL HHD +IWGDDA EFNPERF
Sbjct  383   NEVMRLYPSGYFINRMVIKETKLGNLYLPAGVQLLLATILLHHDTEIWGDDAMEFNPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+KATKGQL F PF  GPRIC+G NFAMLEAK+ IAMIL+ Y+FELSPSYAHAP   
Sbjct  443   SEGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMTIAMILKHYAFELSPSYAHAPHPL  502

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQYGA L+  KL
Sbjct  503   L-LQPQYGAHLILHKL  517



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/495 (58%), Positives = 389/495 (79%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP+KL++ LR+QGL GN Y+F+ GD+K+++ TT++A SKPM+LSHDI+PR+
Sbjct  21    WRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIAPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    +   G+NSFVW+G  P V+I  P  ++ ILTK  ++ +P  NPL+KLLA GIA
Sbjct  81    IPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATGIA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHRRIINP FH+EKLK M+PAFY SC EM+   E  +  +   E+DVWP+ Q
Sbjct  141   FYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKESSCELDVWPYFQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+Y+EGRKIF+L KEQ Q  T++++S+YIPGWRFLPT  N++MK I+
Sbjct  201   NLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYIPGWRFLPTKTNKKMKGID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             ++++AL+  II+KR  A++AG+ +KDDLLG+L+ESN  EI +HG NK  G++  +VIEEC
Sbjct  261   REIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTMVLLG++Q+WQ  AREEV  +FG +KPD DGL H+K+VTMIL
Sbjct  321   KLFYFAGQETTSGLLVWTMVLLGQYQDWQDHAREEVIEVFGSNKPDFDGLIHLKVVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY  +  +TR   ++T+L +  LP GV +++P +L HHD+++WGDDA+EF PERF
Sbjct  381   HEVLRLYPALSLMTRITSKKTQLANYSLPAGVEVALPTLLVHHDKQLWGDDAQEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KATK + T+ PFGGGPRIC+G NFAM+EAK+ +++ILQ ++FELSPSYAHAP+S 
Sbjct  441   SEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKVALSLILQHFTFELSPSYAHAPSSH  500

Query  241   VSLQPQYGAPLLFRK  197
             ++++PQ+GA ++  K
Sbjct  501   LTIRPQFGAHIILHK  515



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/496 (57%), Positives = 382/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNW W +P+KL+K LR+QGLKGN Y+ + GD++ L K  KE  SKPMNLS DI+PR+
Sbjct  21    WKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLKMRKETTSKPMNLSDDIAPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               +F  ++ + G+NSF+W GP P V I +P LI+ +L K   + KP  +PL++LLA G+ 
Sbjct  81    FSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNKIYDFQKPNASPLVRLLANGLV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E +KWSKHR++INPAF++EKLK M+P F+ SC +++   E+ +   G  E+DVWP LQ
Sbjct  141   NLEGEKWSKHRKLINPAFNIEKLKIMLPIFFKSCDDLITKWERMLSSDGSCELDVWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YEEG++IF+LQ EQA+   ++M  ++IPGWRFLPT  +RRMK+I+
Sbjct  201   NLASDVISRTAFGSSYEEGKRIFQLQIEQAELTKKVMIQVFIPGWRFLPTSTHRRMKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIEEC  782
             ++++A +  +I+KR  A++AGE +KDDLLGILLE N  E+E+H  NKD G++  +VIEEC
Sbjct  261   REIKASLTDMINKREIALKAGEATKDDLLGILLELNHKEMEEHDNNKDVGMSLDDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVW M+LL R+ +WQ RAREEV ++FG  KPD DGLN +KIVTMIL
Sbjct  321   KLFYFAGQETTSVLLVWAMMLLSRYPDWQARAREEVLQVFGNKKPDFDGLNQLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P I+ +R   ++ +LG+L LP GV I++P++L HHD ++WG+DAK FNPERF
Sbjct  381   YEVLRLYPPAIATSRSTHKDVKLGNLTLPAGVQITLPIVLVHHDSELWGEDAKVFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S G+SKAT G+ +F PFGGGPRIC+G NF+MLEAK+ +AMIL+++SFELSPSYAHAPT  
Sbjct  441   SGGISKATNGRFSFFPFGGGPRICIGQNFSMLEAKMAMAMILKKFSFELSPSYAHAPTQV  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQP+YG  L+ RK+
Sbjct  501   ITLQPKYGVHLILRKV  516



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/495 (58%), Positives = 382/495 (77%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP+KL++CLR+QGL GN Y+ + GD K+ +   KEAKSKPMNLSHDI+PR+
Sbjct  11    WRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHDITPRV  70

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+N F+W+GP P V I  P  ++D+ T    + KP  NPL+K LA G+ 
Sbjct  71    LPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFLATGLP  130

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHR+IINPAFH+EKLK M+PAF+ SC EM+   E+ +  +G  E+DVWP+L+
Sbjct  131   NYEGEKWAKHRKIINPAFHLEKLKRMLPAFHQSCSEMIEKWERLVSKEGSCELDVWPYLE  190

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR +FGS+Y+EGRKIF+L KEQA+     ++S YIPGWRFLPT  N+RMK I+
Sbjct  191   SLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSFYIPGWRFLPTRSNKRMKAID  250

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+++  +R II  R +A+  GE +KDDLLGIL+ESN  EI ++GN K+ G++  +VIEEC
Sbjct  251   KEIKGSLRDIISTREEAIRMGEAAKDDLLGILMESNLKEIRENGNTKNVGMSIEDVIEEC  310

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WT+VLL ++Q WQ RAR+EV ++FG +KPD DGL+H+K+VTMIL
Sbjct  311   KLFYFAGQETTSVLLLWTLVLLSQNQNWQARARDEVLQVFGSNKPDFDGLSHLKVVTMIL  370

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY  V++L R   ++T+LG L LP GV +S+P++L HHD+++WG+DA EFNPERF
Sbjct  371   LEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLLHHDKELWGEDAIEFNPERF  430

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKA+K Q  + PFGGGPRIC+G NFAMLEAKL  +++LQR++FELSPSYAHAP+  
Sbjct  431   SEGVSKASKNQFAYFPFGGGPRICIGQNFAMLEAKLAFSLLLQRFTFELSPSYAHAPSLI  490

Query  241   VSLQPQYGAPLLFRK  197
             +SLQPQYGA ++  K
Sbjct  491   ISLQPQYGAHIILHK  505



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/495 (57%), Positives = 388/495 (78%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP+KL++ LR+QGL GN Y+F+ GD+K+++ TT++A SKPM+LSHDI+PR+
Sbjct  21    WRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIAPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    +   G+NSFVW+G  P V+I  P  ++ ILTK  ++ +P  NPL+KLLA GIA
Sbjct  81    IPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATGIA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHRRIINP FH+EKLK M+PAFY SC EM+   E  +  +   E+DVWP+ Q
Sbjct  141   FYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKESSCELDVWPYFQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+Y+EGRKIF+L KEQ Q  T++++S+Y PGWRFLPT  N++MK I+
Sbjct  201   NLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYTPGWRFLPTKTNKKMKGID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             ++++AL+  II+KR  A++AG+ +KDDLLG+L+ESN  EI +HG NK  G++  +VIEEC
Sbjct  261   REIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTMVLLG++Q+WQ  AREEV  +FG +KPD DGL H+K+VTMIL
Sbjct  321   KLFYFAGQETTSGLLVWTMVLLGQYQDWQDHAREEVIEVFGSNKPDFDGLIHLKVVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY  +  +TR   ++T+L +  LP GV +++P +L HHD+++WGDDA+EF PERF
Sbjct  381   HEVLRLYPALSLMTRITSKKTQLANYSLPAGVEVALPTLLVHHDKQLWGDDAQEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KATK + T+ PFGGGPRIC+G NFAM+EAK+ +++ILQ ++FELSPSYAHAP+S 
Sbjct  441   SEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKVALSLILQHFTFELSPSYAHAPSSH  500

Query  241   VSLQPQYGAPLLFRK  197
             ++++PQ+GA ++  K
Sbjct  501   LTIRPQFGAHIILHK  515



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 381/496 (77%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+LN+ W +P+ L+K LRKQG KG+ YKF+FGD+K+++K  +EA SKP+N SHD I PR
Sbjct  24    WRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEAWSKPVNFSHDTIWPR  83

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + PF    I   G+N FVW GP P V+I +P +I++++ KN ++ KP  NPL KLLA GI
Sbjct  84    VNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYVFQKPGGNPLTKLLATGI  143

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+ HRR++NPAFH++KLKHM+PAF ++  EML   EK +  +G +E+DV P+L
Sbjct  144   ADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTGNEMLSKWEKIVSREG-SEIDVLPYL  202

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEG KIFELQKEQ Q   E+ R+IYIPGWRFLPT RN+RMK+I
Sbjct  203   QTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILEVSRTIYIPGWRFLPTKRNKRMKQI  262

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V+ LI  II+KR++ +EAGE S DDLLGILL SN  EI++HGNK FG++  EVIEEC
Sbjct  263   FNEVRTLILEIINKRMRMIEAGE-SHDDLLGILLSSNLKEIQQHGNKKFGMSIDEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTM+LL +H  WQ RAREEV ++FG ++ D D LN +K+VTMIL
Sbjct  322   KLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVLQVFGSNEVDYDKLNQLKVVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY     +TR  K +T+LG+L LP GV + +P IL  HD KIWGDDA EFNPERF
Sbjct  382   NEVLRLYPAGYMMTRMVKTKTKLGNLCLPGGVQLLLPTILLQHDTKIWGDDAMEFNPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+G+ KATKGQL F PFG GPRIC+G NFAMLEAK+ +AMIL+ Y+FELS SY+HAP   
Sbjct  442   SDGILKATKGQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHYAFELSSSYSHAP-HP  500

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQ+GAPL+  KL
Sbjct  501   LMLQPQFGAPLILYKL  516



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/497 (57%), Positives = 382/497 (77%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QG+ GN Y+ + GD++++ +   EA S+P++LS +I  R+
Sbjct  20    WRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMISEANSRPISLSDEIVQRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++++ G+N F+W+GP P+V I +P LIRD+  +   +HKP  +PL KLLA G+ 
Sbjct  80    LPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAFHKPAPHPLGKLLATGLV  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             T E ++W+KHR+IINPAFH+EKLKHMVPAF +SC +M+   EKK+   G  E+D+WP L+
Sbjct  140   TLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNKWEKKLSKDGSCELDIWPDLE  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+YIPGWRF+PT  N+R+++I 
Sbjct  200   NLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIR  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              ++ AL++ II+KR KAM  GE + DDLL +L+ESNF E+++H   K+ G++  +VIEEC
Sbjct  260   NELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREMQEHDERKNVGMSIDDVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LL+WTM+LL +H  WQ RAREE+ ++FG  KPD +GLNH+KIVTMI 
Sbjct  320   KLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGNKKPDGNGLNHLKIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R    ++++G    P G  +++P++L HHD +IWG+DAKEFNPERF
Sbjct  380   HEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIHHDHEIWGEDAKEFNPERF  439

Query  421   SEGVSKATK-GQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             SEGVSKATK GQ  F PFG GPR C+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP +
Sbjct  440   SEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPFN  499

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGA L+   L
Sbjct  500   VITVQPQYGAHLILHGL  516



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/493 (59%), Positives = 379/493 (77%), Gaps = 1/493 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP++L++CL++QGL GN Y+ ++GD K+++   KEA S+P++ S DI  R+
Sbjct  23    WRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISFSDDILQRV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF   +I++ G++SF+W+G  P V I EP LIRD+L+ +T++ KP  + L K  A G+ 
Sbjct  83    APFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVFRKPRVHALGKQPASGLF  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E +KW+KHR+IINPAF +EKLK+M+PAF++SC +M+   E K+   G  E DVWP+LQ
Sbjct  143   FLEGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEXKLSTXGSCEXDVWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGSNYEEGR IFELQ+EQAQ   +  +S  IPGWRFLPT  N+RMK+  
Sbjct  203   NLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSQSACIPGWRFLPTKSNKRMKQNR  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+V  L+  IIDKR KAM+AGE   DDLLGILLESNF EI++HGN K+ G++ ++VI+EC
Sbjct  263   KEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQEHGNDKNVGMSIKDVIDEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K+FYF GQETTSVLL+WTMVLL +H  WQ RAREEV  +FG +KP+ DGLNH+KIV MIL
Sbjct  323   KIFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R   E+ ++GD+ LP GV +S+P IL HHD +IWG+DA+EFNPERF
Sbjct  383   HEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+G  KATK  ++F PFG G R+C+G NFA+LEAK+V+AMILQR+SF LSPSY+HAP S 
Sbjct  443   SQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSL  502

Query  241   VSLQPQYGAPLLF  203
             V+L+PQYGA L+ 
Sbjct  503   VTLKPQYGAHLIL  515



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/497 (57%), Positives = 382/497 (77%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++CLR+QG+ GN Y+ + GD++++ +   EA S+P++LS +I  R+
Sbjct  33    WRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMISEANSRPISLSDEIVQRV  92

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++++ G+N F+W+GP P+V I +P LIRD+  +   +HKP  +PL KLLA G+ 
Sbjct  93    LPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAFHKPAPHPLGKLLATGLV  152

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             T E ++W+KHR+IINPAFH+EKLKHMVPAF +SC +M+   EKK+   G  E+D+WP L+
Sbjct  153   TLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNKWEKKLSKDGSCELDIWPDLE  212

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+YIPGWRF+PT  N+R+++I 
Sbjct  213   NLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIR  272

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
              ++ AL++ II+KR KAM  GE + DDLL +L+ESNF E+++H   K+ G++  +VIEEC
Sbjct  273   NELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREMQEHDERKNVGMSIDDVIEEC  332

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LL+WTM+LL +H  WQ RAREE+ ++FG  KPD +GLNH+KIVTMI 
Sbjct  333   KLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGNKKPDGNGLNHLKIVTMIF  392

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R    ++++G    P G  +++P++L HHD +IWG+DAKEFNPERF
Sbjct  393   HEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIHHDHEIWGEDAKEFNPERF  452

Query  421   SEGVSKATK-GQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             SEGVSKATK GQ  F PFG GPR C+G NFAM+EAK+ +AMILQR+SFELSPSYAHAP +
Sbjct  453   SEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPFN  512

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGA L+   L
Sbjct  513   VITVQPQYGAHLILHGL  529



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 384/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W +P+KL+K LR+QGLKGN Y+ + GD+K L K  KEA +KPMNLS DI PR+
Sbjct  21    WRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDIKDLLKIRKEATTKPMNLSDDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               F   ++ ++G+NSF+W GP P V I +P  I+D+L K   + KP  NPL++LLA G+ 
Sbjct  81    YSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLANGLV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             + E ++WSKHR+IINPAFH+EKLK M+P F+ SC +M+   EK +   G  E+DVWP LQ
Sbjct  141   SLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDMISKWEKMLSSDGSCEMDVWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                 D ISR AFGS+YEEG++IF+LQ EQA+  T++M  +YIPGWRFLPT   RRMK+I+
Sbjct  201   NFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             + ++A +  +I+ R +A++AGE +KDDLLGILLESN  E+E+HG NKD G++  +VIEEC
Sbjct  261   RDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMVLL R+ +WQ RAREEV ++FG +KPD DGL+H+KIVTMIL
Sbjct  321   KLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PVI+L R+  ++ +LG+L LP GV + + +I+ HHD ++WG+DAK FNPERF
Sbjct  381   YEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KAT G+ +F PF GGPRIC+G NF+MLEAK+ IAMILQR+SFELSPSYAHAP + 
Sbjct  441   SEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPATV  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA ++  KL
Sbjct  501   ITLQPQYGAHIILHKL  516



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/497 (60%), Positives = 376/497 (76%), Gaps = 5/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W++LN+ W +P++L+K LR+QG KGN YKF+FGD+K++ K  +EA SKP+N SHD I PR
Sbjct  25    WKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKEMKKMGEEAMSKPINFSHDMIWPR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PF    I   G+N  VW GP P VLI +P L++++LTKN +Y KP  NPL KL A GI
Sbjct  85    VMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLGNPLTKLAATGI  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+ HRR++NPAFH++KLKHM+PAF  +  EML  LEK +   G  E+DVWP+L
Sbjct  145   AGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSPNG-TEIDVWPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEGRKIF+LQKEQ     E+ R+IYIPGWRFLPT RN+RMK+I
Sbjct  204   QTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEE  785
               +V+AL+  II KR+  +E GE + DDLLGILL SN  EI++HG NK FG++  EVIEE
Sbjct  264   FNEVRALVFGIIKKRMSMIENGE-APDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTM+LL ++  WQ +AREEV ++FG  + D D LN +KIVTMI
Sbjct  323   CKLFYFAGQETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYDKLNQLKIVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY     + R   +ET+LG+L LP GV + +P +L  HD +IWGDDA EFNPER
Sbjct  383   LNEVLRLYPAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIWGDDAMEFNPER  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS+G+SKATKG+L F PF  GPRIC+G NFAMLEAK+ +AMIL+ Y+FELSPSYAHAP  
Sbjct  443   FSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFELSPSYAHAPHP  502

Query  244   TVSLQPQYGAPLLFRKL  194
              + LQPQYGA L+  KL
Sbjct  503   LL-LQPQYGAQLILYKL  518



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/496 (57%), Positives = 379/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP++L++ LR+QGL+GN Y+ + GDLK++    KE  SKPMNLSHDI PR+
Sbjct  21    WRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQKEVTSKPMNLSHDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               F    +  +G+NSF+W G  P V+I EP LI+D+L K   + KP T+PL+KLLA G+ 
Sbjct  81    FSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNKMHDFPKPDTSPLVKLLATGLL  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E +KW+KHRRII+PAF++EKLK+M+P FY SC +++   E+ +   G  E+DVWP LQ
Sbjct  141   NHEGEKWNKHRRIISPAFNLEKLKNMLPIFYKSCNDLIIKWEEMLSSDGSCEIDVWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAI+RTAFGS+YEEGRKIF+L KEQA+   + +  +YIPGWRFLPT  +RRMK+I+
Sbjct  201   NLSSDAIARTAFGSSYEEGRKIFQLLKEQAELAMKAIMKLYIPGWRFLPTANHRRMKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             ++++A +  +I  R KA++AGE +++DLLGILLESN  E E+HGN K+ G++  +VIEEC
Sbjct  261   REIKASLTDMISNREKALKAGEATENDLLGILLESNHKETEEHGNSKNVGMSLEDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTMVLL R+ +WQ RAREEV ++FGK KP+ DGL+H+KIV+MIL
Sbjct  321   KLFYFAGQETTSALLVWTMVLLSRYPDWQARAREEVLQVFGKQKPNFDGLSHLKIVSMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P + L R    + +LG+L LP GV +S+P  + HHD ++WGDD  EF PERF
Sbjct  381   NEVLRLYPPAVGLNRNVDRDMKLGNLSLPAGVQVSLPTTMVHHDRELWGDDVNEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KAT G+++F PFG GPRIC+G NF++LEAK+ ++ ILQ +SFELSP+YAHAP + 
Sbjct  441   SEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSTILQHFSFELSPAYAHAPVTV  500

Query  241   VSLQPQYGAPLLFRKL  194
              +LQPQYGA ++ RK+
Sbjct  501   FTLQPQYGAHVILRKV  516



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/496 (60%), Positives = 379/496 (76%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+LN+ WF+P+KL+K LR+QG KGN YK ++GD+K++ K  +EA SKP++ SHD I PR
Sbjct  25    WRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSKPIDFSHDLIWPR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + PF    I   G+N FVW GP P VLI EP LI+++LTKN +Y K   +PL+KL   G+
Sbjct  85    INPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKEVLTKNYVYQKARGSPLLKLAISGL  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A +E+DKW+ HRRI+NPAFH++KLKHM+PAF ++  EML N+ K++  +   E+DVWP+L
Sbjct  145   AAHEKDKWATHRRILNPAFHIDKLKHMLPAFKLTVNEML-NIWKEVISKDGTEIDVWPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGSNYEEG+K FELQKEQ +  +++  SIYIPGWRF+PT +N+RM +I
Sbjct  204   QTLTSDAISRTAFGSNYEEGKKNFELQKEQIELISKMTHSIYIPGWRFVPTKKNKRMMQI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V+ALI  II+KR++ +EAGE S DDLL ILL SN  EI++HGNK FG++  EVIEEC
Sbjct  264   FYEVKALILGIINKRMRMIEAGE-SHDDLLSILLTSNLKEIQQHGNKKFGMSIDEVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTM+LL ++  WQ RAREEV ++F  D+ D D LN +K+VTMIL
Sbjct  323   KLFYFAGQETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELDYDKLNQLKVVTMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLYT V ++ R    ET+LGDL LP GV + +  +L HHD +IWGDDA EF PERF
Sbjct  383   NEVLRLYTSVYAINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGDDAMEFKPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+SKATKGQ+ F PF  GPRIC+G NFAMLEAK+ + MIL+ Y+FELSPSYAHAP   
Sbjct  443   SEGISKATKGQVVFFPFNWGPRICIGQNFAMLEAKMAMVMILKHYAFELSPSYAHAPHPL  502

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQYGA L+  KL
Sbjct  503   L-LQPQYGAQLIMHKL  517



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 383/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W +P+KL+K LR+QGLKGN Y+ + GD+  L K  KEA SKPMNLS DI PR+
Sbjct  21    WRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDMNDLLKMRKEATSKPMNLSDDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               F   ++ ++G+NSF+W GP P V I +P  I+D+L K   + KP  NPL++LLA G+ 
Sbjct  81    YSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLANGLV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             + E ++WSKHR+IINPAFH+EKLK M+P F+ SC +++   EK +   G  E+DVWP LQ
Sbjct  141   SLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDLISKWEKMLSSDGSCEMDVWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                 D ISR AFGS+YEEG++IF+LQ EQA+  T++M  +YIPGWRFLPT   RRMK+I+
Sbjct  201   NFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             + ++A +  +I+ R +A++AGE +KDDLLGILLESN  E+E+HG NKD G++  +VIEEC
Sbjct  261   RDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMVLL R+ +WQ RAREEV ++FG +KPD DGL+H+KIVTMIL
Sbjct  321   KLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PVI+L R+  ++ +LG+L LP GV + + +I+ HHD ++WG+DAK FNPERF
Sbjct  381   YEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KAT G+ +F PF GGPRIC+G NF+MLEAK+ IAMILQR+SFELSPSYAHAP + 
Sbjct  441   SEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPATV  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA ++  KL
Sbjct  501   ITLQPQYGAHIILHKL  516



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/496 (57%), Positives = 383/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP++L++ LR+QGL+GN Y+ + GDLK++ K   EA+SKPMNLSHDI PR+
Sbjct  26    WRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRV  85

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
                   ++ ++G+NSF+W GP P V + +P LI+D+L K + + KP  NPL KLLA G+ 
Sbjct  86    FAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLV  145

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              Y+ +KW+KHRR+INPAF +EKLK M+P F+ SC +++   E  +   G  E+DVWP LQ
Sbjct  146   NYDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEGMLSYDGSCEMDVWPFLQ  205

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D I+RTAFGS++EEG++IF+LQKE A+   +++  +YIPGWRF+PT  NRRMK+I+
Sbjct  206   NLASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEID  265

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIEEC  782
             + ++A +  +I KR KA + GE ++DDLLGILLESN  EI++H  N++ G+   +VIEEC
Sbjct  266   RYIKASLTDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEHRNNENVGMNLNDVIEEC  325

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMVLL R+ +WQ+RAREEV ++FGK  P+ DGL+H+KIVTMIL
Sbjct  326   KLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMIL  385

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P I LTR    + +LG+L LP GV +S+P+I+ HHD ++WGDDAKEFNPERF
Sbjct  386   YEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPERF  445

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+Y HAP + 
Sbjct  446   SEGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPFTV  505

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA ++ RK+
Sbjct  506   ITLQPQYGAHVILRKV  521



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/496 (59%), Positives = 376/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP KL+K LR+QGLKGN Y+ +FGDLK+ +   KEAK++P++L  DI+ R+
Sbjct  22    WRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSLDDDIAIRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF    +   G+NSF+W GP P V I  P  I+ I TK   + K  + PL +LL  G+A
Sbjct  82    NPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSIPLARLLIVGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             T E +KW+KHR++INPAFH EKLK M+PAFY+SC+E++   EK+M  +G +E+DVWP+L 
Sbjct  142   TLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEGSSELDVWPYLA  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YEEGR+IF+LQ E A+   ++ RS++IPGWRFLPT RNRRMK+I+
Sbjct  202   NLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRFLPTKRNRRMKEID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K+++A +  II  R KAM AGE + DDLLGIL+E++F EIE+HG NK+ G +  +VIEEC
Sbjct  262   KEIRASLMGIIKNREKAMRAGEAANDDLLGILMETSFREIEEHGNNKNVGFSMNDVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL WTMVLL +HQ+WQ RAR+EV ++FG +KPD DGLNH+KIV MIL
Sbjct  322   KLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PV  L+R   +ET+LG+L LP GV I +P+IL H D ++WGDDA EF PERF
Sbjct  382   YEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPELWGDDAVEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EG+SKA K Q+++ PF  GPRIC+G NFA++EAK+  AMILQ YSFELSPSY HAPT+ 
Sbjct  442   AEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSFELSPSYVHAPTAV  501

Query  241   VSLQPQYGAPLLFRKL  194
              +L P+ G  L+ RKL
Sbjct  502   PTLHPELGTQLILRKL  517



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/497 (60%), Positives = 375/497 (75%), Gaps = 5/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W++LN+ W +P++L+K LR+QG KGN YKF+FGD+K+  K  +EA SKP+N SHD I PR
Sbjct  25    WKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKETKKMGEEAMSKPINFSHDMIWPR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PF    I   G+N  VW GP P VLI +P L++++LTKN +Y KP  NPL KL A GI
Sbjct  85    VMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLGNPLTKLAATGI  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+ HRR++NPAFH++KLKHM+PAF  +  EML  LEK +   G  E+DVWP+L
Sbjct  145   AGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSPNG-TEIDVWPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEGRKIF+LQKEQ     E+ R+IYIPGWRFLPT RN+RMK+I
Sbjct  204   QTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEE  785
               +V+AL+  II KR+  +E GE + DDLLGILL SN  EI++HG NK FG++  EVIEE
Sbjct  264   FNEVRALVFGIIKKRMSMIENGE-APDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTM+LL ++  WQ +AREEV ++FG  + D D LN +KIVTMI
Sbjct  323   CKLFYFAGQETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYDKLNQLKIVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY     + R   +ET+LG+L LP GV + +P +L  HD +IWGDDA EFNPER
Sbjct  383   LNEVLRLYPAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIWGDDAMEFNPER  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS+G+SKATKG+L F PF  GPRIC+G NFAMLEAK+ +AMIL+ Y+FELSPSYAHAP  
Sbjct  443   FSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFELSPSYAHAPHP  502

Query  244   TVSLQPQYGAPLLFRKL  194
              + LQPQYGA L+  KL
Sbjct  503   LL-LQPQYGAQLILYKL  518



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 379/496 (76%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+LN+ W +P+ L+K LR++G KGN YKF+FGD+K+++K  +EA SKP+N SHD I PR
Sbjct  24    WRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKEMSKMGEEALSKPVNFSHDMIWPR  83

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + PF    I   G+NSFVW GP P V+I +P +I++++ KN ++ KP  NPL KLLA GI
Sbjct  84    VNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEVMMKNYVFQKPGGNPLTKLLATGI  143

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+ HRR++NPAFH++KLKHM+PAF ++  EMLG  EK +   G +E+DV  +L
Sbjct  144   ADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTASEMLGKWEKIVSRDG-SEIDVLSYL  202

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEG KIFELQKEQ Q   ++ R++YIPGWRFLPT RN+RMK+I
Sbjct  203   QTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILQVSRTVYIPGWRFLPTKRNKRMKQI  262

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V+ LI  II+KR++ +EAGE S DDLLGILL SN  EI++HGNK F ++  EVIEEC
Sbjct  263   FNEVRTLIFEIINKRMRMIEAGE-SHDDLLGILLSSNLKEIQQHGNKKFSMSIDEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTM+LL +H  WQ RAREEV ++FG ++ D D LN +K+VTMIL
Sbjct  322   KLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVLQVFGSNEVDYDKLNQLKVVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY     +TR  + +T LG+L LP GV + +P IL  HD +IWGDDA EFNPERF
Sbjct  382   NEVLRLYPAGYMMTRMVQTKTNLGNLCLPGGVQLLLPTILLQHDTEIWGDDAMEFNPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+G+ KATKGQL F PFG GPRIC+G NFAMLEAK+ +AMIL+ Y+FELS SY+HAP   
Sbjct  442   SDGILKATKGQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHYAFELSSSYSHAP-HP  500

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQYGAPL+  KL
Sbjct  501   LMLQPQYGAPLILYKL  516



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 377/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP+KL+K LR+QGLKGN Y+ +FGDLK+ +   KEAK++P++L  DI+ R+
Sbjct  22    WRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSLDDDIAIRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF    +   G+NSF+W GP P V I  P  I+ I TK   + K  + PL +LL  G+A
Sbjct  82    NPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSIPLARLLIVGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             T E +KW+KHR++INPAFH EKLK M+PAFY+SC+E++   EK+M  +G +E+DVWP+L 
Sbjct  142   TLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEGSSELDVWPYLA  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YEEGR+IF+LQ E A+   ++ RS++IPGWRFLPT RNRRMK+I+
Sbjct  202   NLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRFLPTKRNRRMKEID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K+++A +  II  R KAM AGE + +DLLGIL+E++F EIE+HG NK+ G +  +VIEEC
Sbjct  262   KEIRASLMGIIKNREKAMRAGEAANNDLLGILMETSFREIEEHGNNKNVGFSMNDVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL WTMVLL +HQ+WQ RAR+EV ++FG +KPD DGLNH+KIV MIL
Sbjct  322   KLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PV  L+R   +ET+LG+L LP GV I +P+IL H D ++WGDDA EF PERF
Sbjct  382   YEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPELWGDDAVEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EG+SKA K Q+++ PF  GPRIC+G NFA++EAK+  AMILQ YSFELSPSY HAPT+ 
Sbjct  442   AEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSFELSPSYVHAPTAV  501

Query  241   VSLQPQYGAPLLFRKL  194
              +L P+ G  L+ RKL
Sbjct  502   PTLHPELGTQLILRKL  517



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/500 (58%), Positives = 384/500 (77%), Gaps = 3/500 (1%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C W+VL W W RP++L+K LR+QGL+GN Y    GD K+  K  KEA SKPMNLS DI P
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIP  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+  +   ++ ++G+NSF+WLGP P V I +P  I+D+  K   + KP  NPL+KLLA G
Sbjct  79    RVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YE +KWSKHRRIINPAF++EKLK M+P F+ SC +++   E  +  +G  E+D WP 
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D I+R+AFGS+YEEGR+IF+LQ+EQA+   +++  I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG---NKDFGITTREV  794
             I++ ++A ++ +I+KR KA++AGE +K+DLLGILLESN  EI++HG   NK+ G++  EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLESNHKEIQEHGNRNNKNVGMSLEEV  318

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTSVLLVWTMVLL R+ +WQ RAREEVF++FG  KPD DGL+ +KIV
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQKPDFDGLSRLKIV  378

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY PV  +TR  +++ +LG L LP GV + +P IL HHD K WG+DAK+FN
Sbjct  379   TMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHDRKFWGEDAKQFN  438

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERFSEGV KAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+YAHA
Sbjct  439   PERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHA  498

Query  253   PTSTVSLQPQYGAPLLFRKL  194
             PT+ +++QPQYGA ++ RK+
Sbjct  499   PTALITIQPQYGAHIILRKV  518



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/498 (58%), Positives = 385/498 (77%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WRVLNW W RP+ L+KCLR+QGL GN Y+   GDL++ +   KEA SKPMNLSHD +P
Sbjct  22    CAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNLSHDTAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+LPF   ++   G+NSF+W+GP P V I  P  ++DI TK+  + KP  NPL+KLLA G
Sbjct  82    RVLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLATG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YE DKW+KHRRI+NPAFH EKLK M+P+FY SC EM+   E  +      E+DVWP+
Sbjct  142   LANYEGDKWAKHRRIVNPAFHSEKLKRMLPSFYQSCSEMIEEWESLVSKDSSCELDVWPY  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRT+FGS+Y+EGR+IF+L K Q +   + ++S+YIPGWRFLPT  N+ MK 
Sbjct  202   LQNVTADVISRTSFGSSYKEGREIFQLLKVQTELAIKTIQSVYIPGWRFLPTKMNKSMKG  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK-DFGITTREVIE  788
             ++K+++ L+  II+KR +A++AG+ +KDDLLG+LL+SNF EI++HGNK   G++T++V+E
Sbjct  262   VDKKIRELLMGIINKREEAIKAGKATKDDLLGLLLDSNFKEIKEHGNKRKVGMSTQDVLE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWTMVLL  +Q WQ RAREEV ++FG +KPD DGLNH+K+VTM
Sbjct  322   ECKLFYFAGQETTSVLLVWTMVLLSENQNWQDRAREEVLQVFGGNKPDFDGLNHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E+LRLY PV+ LTR   ++T+  +  LP GV IS+P +L HHD+++W DDA +F PE
Sbjct  382   ILLEALRLYPPVVMLTRMIHKKTQFVEFSLPAGVEISLPTVLVHHDKELWCDDATQFKPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFS+GVSKATK +L + PFGGG RIC+G NFAM+EAKL +A+ILQ ++FELSPSYAHAP+
Sbjct  442   RFSDGVSKATKNKLIYFPFGGGARICIGQNFAMMEAKLALALILQHFTFELSPSYAHAPS  501

Query  247   STVSLQPQYGAPLLFRKL  194
               ++LQPQ+GA ++  KL
Sbjct  502   RKLTLQPQFGAHIILHKL  519



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/494 (57%), Positives = 381/494 (77%), Gaps = 1/494 (0%)
 Frame = -1

Query  1672  VLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLLP  1493
             +LNW W RP++L++ LR+QGL+GN Y+ + GDLK++ K   EA+SKPMNLSHDI PR+  
Sbjct  1     MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFA  60

Query  1492  FFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIATY  1313
                 ++ ++G+NSF+W GP P V + +P LI+D+L K + + KP  NPL KLLA G+  Y
Sbjct  61    HLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVNY  120

Query  1312  EEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQI  1133
             + +KW+KHRR+INPAF +EKLK M+P F+ SC +++   E  +   G  E+DVWP LQ +
Sbjct  121   DGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEGMLSSDGSCEMDVWPFLQNL  180

Query  1132  GGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEKQ  953
               D I+RTAFGS++EEG++IF+LQKE A+   +++  +YIPGWRF+PT  NRRMK+I++ 
Sbjct  181   ASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDRY  240

Query  952   VQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIEECKL  776
             ++A +  +I KR KA + GE ++DDLLGILLESN  EI++H  NK+ G+   +VIEECKL
Sbjct  241   IKASLMDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEHRNNKNVGMNLNDVIEECKL  300

Query  775   FYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNE  596
             FYF GQETTSVLLVWTMVLL R+ +WQ+RAREEV ++FGK  P+ DGL+H+KIVTMIL E
Sbjct  301   FYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMILYE  360

Query  595   SLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFSE  416
              LRLY P I LTR    + +LG+L LP GV +S+P+I+ HHD ++WGDDAKEFNPERFSE
Sbjct  361   VLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPERFSE  420

Query  415   GVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTVS  236
             GVSKAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+Y HAP + ++
Sbjct  421   GVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPFTVIT  480

Query  235   LQPQYGAPLLFRKL  194
             LQPQYGA ++ RK+
Sbjct  481   LQPQYGAHVILRKV  494



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/500 (56%), Positives = 383/500 (77%), Gaps = 3/500 (1%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C W+VLNW W RP++L+K LR+QG +GN Y   FGD K+  K  KEA SKPM LS DI P
Sbjct  19    CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVP  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+  +   ++ ++G+NSF+W GP P V I +P  I+D+  KN  + KP  NPL+KLLA G
Sbjct  79    RVSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YE +KWSKHRRIINPAF++EKLK M+P F  SC +++   E  +  +G  E+D WP 
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D I+R+AFGS+YEEGR+IF+LQ+EQ +H  +++  I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLTSDVIARSAFGSSYEEGRRIFQLQREQTEHLMKVILKIQIPGWRFLPTKTHRRMKE  258

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN---KDFGITTREV  794
             I+++++A ++ +I+KR KA+++GE +K+DLLGILLESN  EI++HGN   K+ G++  +V
Sbjct  259   IDREIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLEDV  318

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTSVLLVWTMVLL R+ +WQ RAREE F++FG  KPD DGL+ +KIV
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQKPDFDGLSRLKIV  378

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY P+I + R  +++ +LG+L LP GV + +P +L HHD ++WG+DAK+FN
Sbjct  379   TMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHDSELWGEDAKQFN  438

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERFSEGV KAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ + FELSP+YAHA
Sbjct  439   PERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQNFLFELSPAYAHA  498

Query  253   PTSTVSLQPQYGAPLLFRKL  194
             PT +++ QPQYGA ++ RK+
Sbjct  499   PTMSITTQPQYGAHIILRKV  518



>gb|AJD25170.1| cytochrome P450 CYP72A329 [Salvia miltiorrhiza]
Length=512

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/496 (58%), Positives = 369/496 (74%), Gaps = 3/496 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             LW++LNW WF P+KL+K LR+QG  GN YK  +GD K++    KEA SKPMN S+DI+PR
Sbjct  20    LWKLLNWVWFTPKKLEKILRQQGFNGNSYKLFYGDFKEIRSIAKEAVSKPMNFSNDIAPR  79

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
              +P +    +R GE SF W GP P + I EP +IR+I +KN ++ KP  NP  K+LA+G+
Sbjct  80    AIPIYHQTCKRYGEKSFTWFGPKPAINITEPEMIREITSKNYVFLKPTGNPFGKMLAKGV  139

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE DKW+KHR++INPAFH++KLKHMVPAF++S  +ML   ++ + D G  EVDVWP L
Sbjct  140   ALYETDKWAKHRKLINPAFHVQKLKHMVPAFHVSTADMLKKWDELVPDGGSCEVDVWPGL  199

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRTAFGS+YEEG KIF+LQ+EQ +   E  R + +PGW  LPT  NRR+K+I
Sbjct  200   QTMTSDVISRTAFGSSYEEGTKIFQLQREQVERIIEAGRHMPVPGW--LPTKNNRRLKEI  257

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V++ +  II+KR+KAMEAGE S DDLLGILLESN  E+ +HGN   G+T  EV+EEC
Sbjct  258   VAEVESRVLGIINKRMKAMEAGEPSMDDLLGILLESNAKEMREHGNAS-GMTIEEVMEEC  316

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K+FYF GQET++ LLVWTM+LL +HQ+WQ RAR+EV ++FGK KPD   LN +KI+ MIL
Sbjct  317   KVFYFAGQETSASLLVWTMILLSKHQDWQDRARDEVLQVFGKGKPDYQELNQLKIMNMIL  376

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NESLR+YTP  +L R    E   G   +P GV + +PV+  HHD ++WGDDA  F PERF
Sbjct  377   NESLRVYTPGATLGRFTHSEANFGKYKIPAGVQLVLPVLAVHHDTRLWGDDATSFKPERF  436

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EGVSKAT+GQ  F+PFG GPRIC+G NFAMLEAKL + MILQ YSF+LSPSYAHAP + 
Sbjct  437   AEGVSKATQGQPKFIPFGSGPRICIGQNFAMLEAKLAMVMILQNYSFKLSPSYAHAPHAL  496

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA L+  KL
Sbjct  497   ITLQPQYGAHLILTKL  512



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/497 (58%), Positives = 379/497 (76%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W +LNW WF P++L++ LR+QGL+GN Y  + GD K   K  KEA SKPMNL SHDI PR
Sbjct  25    WMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSHDIVPR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +  FF  +I  +G+ SF+W GP P V I +P LI+D+L K   + K   NP ++LLA G+
Sbjct  85    VFSFFHHSINTHGKKSFMWFGPAPRVTITDPELIKDVLNKTYDFEKINMNPQVRLLAPGL  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E +KWSKHR+IINPAF++EKLK M+P F   C +++GN EK     G +E+DVWP L
Sbjct  145   VSHEGEKWSKHRKIINPAFNLEKLKDMLPLFVKCCDDLIGNWEKMSSSDGSSEMDVWPFL  204

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS++EEGR+IF+L KEQ +   +LM  +YIPGWRF+PT  +RRMK I
Sbjct  205   QNLARDAISRTAFGSSFEEGRRIFQLLKEQTELTVQLMLKVYIPGWRFVPTPTHRRMKAI  264

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +K+++A +  II+ + KA++AGE +K+DLLGILLESN  EI++HGN K+ G+   +VI E
Sbjct  265   DKEIKASLMDIINNKEKALKAGEATKNDLLGILLESNHKEIQEHGNNKNVGMNIEDVIGE  324

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTM+LL  + +WQTRAREEV ++FG  KPD DGLNH+KIVTMI
Sbjct  325   CKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPDFDGLNHLKIVTMI  384

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE  RLY PVI L RK  ++ +LG+L L  G+ +SIP+IL HHD ++WGDDAKEF PER
Sbjct  385   LNEVFRLYPPVIGLARKVSKDVKLGNLSLVAGMQVSIPIILVHHDCELWGDDAKEFKPER  444

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F+EGV KATKG+ + +PFGGGPRIC+G NF+++EAK+ ++MILQR+SFELS +Y HAPT 
Sbjct  445   FAEGVLKATKGRASLIPFGGGPRICIGQNFSLMEAKIALSMILQRFSFELSSTYTHAPTP  504

Query  244   TVSLQPQYGAPLLFRKL  194
              +++QPQYGA L+ RK+
Sbjct  505   VITIQPQYGANLILRKV  521



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 374/496 (75%), Gaps = 5/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR LNWAWF+P+KLQK L++QG KGN YK I+GD KQ++   +EA SKP++LS DI PR+
Sbjct  24    WRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQISSLFQEANSKPISLSDDIVPRI  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P F++A+ + G+N+++W GP PM+LI +P LIR +  K  I+ K    P  +LL  GI 
Sbjct  84    VPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVTHKMDIFQKVRFRPQARLLIGGIL  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEV-DVWPHL  1142
              YE +KW+K R+++N AFH EKLK MVPAFY S  EML   E+ +  +G  EV DVWP++
Sbjct  144   VYEGEKWAKQRKLLNQAFHTEKLKLMVPAFYKSASEMLSKWEEMISVKGSFEVVDVWPNI  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS YEEGRKIFELQ+EQA+H  E  RSIYIPG RFLPT RNRRMK+I
Sbjct  204   QTMTSDAISRTAFGSRYEEGRKIFELQREQARHLVEATRSIYIPGSRFLPTKRNRRMKQI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K+V+  IR II+ R+KA+ AGE    D+LGILLES   E +       G+TT E+I+EC
Sbjct  264   AKEVEGSIREIINARLKALRAGEAIDADMLGILLESTSQETDGES----GMTTGEIIQEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETT+VLLVWTM+LL  H +WQ RAREEV + FG D P+ DGLN +KIVTMIL
Sbjct  320   KLFYFAGQETTAVLLVWTMILLSMHPDWQERAREEVLQHFGTDMPNFDGLNQLKIVTMIL  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P  ++ R   EET++G+L +P G L+++P+IL HHD +IWG D KEF PERF
Sbjct  380   HEVLRLYPPFPNIGRSVAEETKIGNLTIPAGQLLTLPMILLHHDPEIWGQDVKEFKPERF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             ++GVS ATKGQ+ + PFG GPRIC+G NFAMLEAKL +AMILQR+SFELSPSY+HAP  T
Sbjct  440   ADGVSSATKGQIVYFPFGWGPRICIGQNFAMLEAKLALAMILQRFSFELSPSYSHAPHLT  499

Query  241   VSLQPQYGAPLLFRKL  194
             +++QPQ+GA L+  KL
Sbjct  500   IAIQPQFGAHLMLHKL  515



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/498 (57%), Positives = 379/498 (76%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WRVLNW W RP+KL+KCLR+QGL GN Y+   GDLK+++   KEA SKPMNLSHD +P
Sbjct  22    CAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNLSHDTAP  81

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++P+   ++   G+NSF+W+GP P V I  P  +++I TK+  + KP  +PL+KLL  G
Sbjct  82    RVVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLLTG  141

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A Y  +KW+KHR+II PAFH EKLK M+PA Y SC EM+   E  +  +   E+DVWP+
Sbjct  142   LANYGGEKWAKHRKIIKPAFHSEKLKRMLPAIYQSCSEMIEEWESLVSKESSYELDVWPY  201

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRT+FGS+Y+EGR+IF+L K Q +   ++  S+YIPGWRFLPT  N+R+K+
Sbjct  202   LQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTVKMKHSVYIPGWRFLPTKTNKRLKE  261

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             ++K+++ L   II+KR +A++AGE +KDDLLG+LLESN  EI++HGN K  G++ ++V+ 
Sbjct  262   VDKEIRELFMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKKVGMSIQDVLG  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTS+LLVWTMVLL  +Q WQ RAREEV ++FG +KPD DGLNH+K+VTM
Sbjct  322   ECKLFYFAGQETTSILLVWTMVLLSENQNWQDRAREEVLQVFGGNKPDFDGLNHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E+LRLY    +L+R   ++T+  +  LP GV IS+P IL HHD+++WGDDA +F PE
Sbjct  382   ILLEALRLYPSSFTLSRMIHKKTQFAEFSLPAGVGISLPTILIHHDKELWGDDATQFKPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK +LT+ PFGGG RIC+G NFAM+EAKL +A+ILQ ++F+LSPSYAHAP+
Sbjct  442   RFAEGVSKATKNKLTYFPFGGGARICIGQNFAMMEAKLAVALILQHFTFKLSPSYAHAPS  501

Query  247   STVSLQPQYGAPLLFRKL  194
                 LQPQ+GA ++  KL
Sbjct  502   GITLLQPQFGAHIVLHKL  519



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/499 (56%), Positives = 384/499 (77%), Gaps = 2/499 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C W++LNWAW  P+KL+KCLR+QG  GN Y+ +FG++K++   T++A+S+PM+L+ DI+P
Sbjct  23    CGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPMSLTDDIAP  82

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
              ++P++   +   G+NS  W GP+P V I +P LIR+I  K   + KP  NPLI LL  G
Sbjct  83    YVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRINPLITLLFSG  142

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             I T E ++W+KHR+II P+FH++KLK+M+PAFY  C EM+   E+ +   G +EVDVWP 
Sbjct  143   ILTLEGERWAKHRKIITPSFHLDKLKNMLPAFYECCTEMIEKWEEAVSVNGSSEVDVWPC  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L  +  D ISR AFGS+YEEGR+IF L  EQ    TE ++S+Y+PGWRFLPT  N+++K 
Sbjct  203   LVNLTRDVISRAAFGSSYEEGRRIFLLLDEQTNLLTETVQSLYVPGWRFLPTKTNKKLKL  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             ++K+++  +R ++  R KA++AGE   DDLLGIL+ESNF EIE+HG+ K+ G++ ++V++
Sbjct  263   MDKEIKDSLRELVKNREKAVKAGEVKNDDLLGILVESNFKEIEEHGDRKNMGMSIQDVVD  322

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFY  GQETTSVLLVWTMVLL R+ +WQT+AREEVF++F   KPD DGL+H+K++TM
Sbjct  323   ECKLFYIAGQETTSVLLVWTMVLLARNPDWQTKAREEVFQVFSDGKPDPDGLSHLKVMTM  382

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             ILNE LRLY PV+ L R   ++ +LG L+LP G +ISIPV+L HHD++IWGDDA EF PE
Sbjct  383   ILNEVLRLYPPVVMLGRSMAKDMKLGKLLLPAGAVISIPVLLIHHDQEIWGDDAHEFRPE  442

Query  427   RFSEGVSKATKG-QLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             RF+EGVSKATK  QL F PFGGGPRIC+G NFA++EAK+V+AMIL+R+ FELSPSYAH+P
Sbjct  443   RFAEGVSKATKSNQLAFFPFGGGPRICIGQNFALMEAKMVLAMILKRFRFELSPSYAHSP  502

Query  250   TSTVSLQPQYGAPLLFRKL  194
              + ++L+PQ+GA L+  KL
Sbjct  503   ITVITLRPQHGAHLILHKL  521



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/497 (57%), Positives = 379/497 (76%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             WRVLNW W RP+KL+KCLR+QGL GN Y+ +FGD K L+K  ++ +SKP+ LS  HDI+P
Sbjct  24    WRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLSTSHDIAP  83

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
              + PFF   +   G+NSFVW+GP P V I  P  ++D   ++  +HK   NP++K L +G
Sbjct  84    HVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVVKNPIMKSLPQG  143

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             I   E ++W+KHR+IINPAFH+EKLK MVP FY SC EM+   E  +  +   E+DVWP+
Sbjct  144   IVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWESLVSKESSCELDVWPY  203

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+    D ISR AFGS+YEEGRKIF+L +E+A+  T  MRS+YIPGWRFLPT +N++ K+
Sbjct  204   LENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKE  263

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I  +++ L++ II+KR +AM+AGE +KDDLLGIL+ESNF EI++HGN K+ G++  +VI 
Sbjct  264   IHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFREIQEHGNNKNAGMSIEDVIG  323

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWTMVLL ++Q+WQ RAREEV ++FG + P  + L+ +K+VTM
Sbjct  324   ECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQLKVVTM  383

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY  V++L R   ++T+LG L LP GV +S+P++L HHD+++WG+DA EF PE
Sbjct  384   ILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPE  443

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGVSKATK Q T+ PFGGGPRIC+G NFAM+EAKL +++IL+ ++ ELSP YAHAP+
Sbjct  444   RFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPLYAHAPS  503

Query  247   STVSLQPQYGAPLLFRK  197
              T++LQPQYGA ++  K
Sbjct  504   VTITLQPQYGAHIILHK  520



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/497 (57%), Positives = 379/497 (76%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             WRVLNW W RP+KL+KCLR+QGL GN Y+ +FGD K L+K  ++ +SKP+ LS  HDI+P
Sbjct  21    WRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLSTSHDIAP  80

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
              + PFF   +   G+NSFVW+GP P V I  P  ++D   ++  +HK   NP++K L +G
Sbjct  81    HVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVVKNPIMKSLPQG  140

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             I   E ++W+KHR+IINPAFH+EKLK MVP FY SC EM+   E  +  +   E+DVWP+
Sbjct  141   IVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWESLVSKESSCELDVWPY  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+    D ISR AFGS+YEEGRKIF+L +E+A+  T  MRS+YIPGWRFLPT +N++ K+
Sbjct  201   LENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKE  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I  +++ L++ II+KR +AM+AGE +KDDLLGIL+ESNF EI++HGN K+ G++  +VI 
Sbjct  261   IHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFREIQEHGNNKNAGMSIEDVIG  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWTMVLL ++Q+WQ RAREEV ++FG + P  + L+ +K+VTM
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQLKVVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY  V++L R   ++T+LG L LP GV +S+P++L HHD+++WG+DA EF PE
Sbjct  381   ILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPE  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGVSKATK Q T+ PFGGGPRIC+G NFAM+EAKL +++IL+ ++ ELSP YAHAP+
Sbjct  441   RFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPLYAHAPS  500

Query  247   STVSLQPQYGAPLLFRK  197
              T++LQPQYGA ++  K
Sbjct  501   VTITLQPQYGAHIILHK  517



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 382/500 (76%), Gaps = 3/500 (1%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C W+VL W W RP++L+K LR+QGL+GN Y    GD K+  K  KEA SKPMNLS DI P
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIP  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+  +   ++ ++G+NSF+WLGP P V I +P  I+D+  K   + KP  NPL+KLLA G
Sbjct  79    RVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YE +KWSKHRRIINPAF++EKLK M+P F+ SC +++   E  +  +G  E+D WP 
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D I+R+AFGS+YEEGR+IF+LQ+EQA+   +++  I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG---NKDFGITTREV  794
             I++ ++A ++ +I+KR KA++AGE +K+DLLGILL SN  EI++HG   NK+ G++  EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLASNHKEIQEHGNRNNKNVGMSLEEV  318

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTSVLLVWTMVLL R+ +WQ RAREEVF++FG  KPD DGL+ +KIV
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQKPDFDGLSRLKIV  378

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY PV  +TR  +++ +LG L LP GV + +P IL HHD K WG+DAK+FN
Sbjct  379   TMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHDRKFWGEDAKQFN  438

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERFSEGV KAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+YAHA
Sbjct  439   PERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHA  498

Query  253   PTSTVSLQPQYGAPLLFRKL  194
             P + +++QPQYGA ++ RK+
Sbjct  499   PIALITIQPQYGAHIILRKV  518



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/496 (58%), Positives = 379/496 (76%), Gaps = 3/496 (1%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             ++LNW WFRPR L+K LR+QG  GN Y+ ++GDLK +   +KEA SKP++ SHD   R++
Sbjct  21    KILNWVWFRPRNLEKRLRRQGFTGNSYRVLYGDLKDMRLMSKEASSKPLDFSHDFVHRIM  80

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P F  A+++ GEN FVW GP+P +L+  P  +R++++K+ ++ KP   P I+L+++G+ T
Sbjct  81    PIFHFALKKYGENCFVWFGPSPAILVMNPESVREVVSKSNVFQKPPGRPFIRLMSKGLVT  140

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQ  1136
              E DKW+KHRR+INPAFH+ KL+HMVP+FY+SC EML   +K +G++G  EVDVWP+LQ 
Sbjct  141   LETDKWAKHRRLINPAFHVHKLEHMVPSFYLSCDEMLSKWDKIVGNEGCCEVDVWPYLQT  200

Query  1135  IGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEK  956
             +  D ISRTAFGS+Y EGRKIFELQ+E AQH  E  RS+YIPG+RFLPT  NRR+K+I K
Sbjct  201   LTSDVISRTAFGSSYLEGRKIFELQRELAQHVMEGNRSVYIPGYRFLPTKVNRRVKEITK  260

Query  955   QVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECKL  776
             +V++ +  II+ R KAMEAGE SK+DLLGILLESN  EIE+HG+K  G++  EVIEECKL
Sbjct  261   EVRSSMLGIINTRSKAMEAGEASKEDLLGILLESNSKEIEQHGSKH-GMSMDEVIEECKL  319

Query  775   FYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNE  596
             FYF G ETT+ LLVWTM+LL +H++WQ+RAR+EV ++F + + D   LN++KI+ MIL+E
Sbjct  320   FYFAGXETTASLLVWTMILLSKHEDWQSRARDEVLQVFKRGESDYQELNNLKILGMILHE  379

Query  595   SLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFSE  416
              LRLY P + L R    E RLG++ LP GV + +P+IL HHD KIWGDDA+EF PERF +
Sbjct  380   VLRLYPPGLVLLRFTPNECRLGNVNLPAGVQLMLPLILLHHDPKIWGDDAEEFRPERFRD  439

Query  415   GVSKATK--GQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             GV KA +  GQL + PFG GPR C+  NFAMLEAK+ +AMILQRYSF+LSPSY HAP   
Sbjct  440   GVPKAAQGAGQLAYFPFGWGPRXCIAQNFAMLEAKMAMAMILQRYSFQLSPSYTHAPYKV  499

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA L+  KL
Sbjct  500   ITLQPQHGAHLILTKL  515



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/495 (58%), Positives = 379/495 (77%), Gaps = 2/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+++N  WFRPRK++K LR+QG  G  Y+F+ GDL ++    +EA SKP++ S D  PR 
Sbjct  21    WKIMNLVWFRPRKMEKILRQQGFGGKSYRFLIGDLNEMKNMGEEALSKPIDFSDDFVPRT  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             + F    +  +GENSFVWLGP   V+I +P  +R++L+K+ ++ KP+ NPL KL+A+G+A
Sbjct  81    ISFIHKTVTNHGENSFVWLGPYAAVIISDPENVREVLSKSYVFQKPY-NPLGKLVAQGLA  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRR+INPAFH++K+KHM+P+F+ SC EML   EK +  +G  E+DVWP+LQ
Sbjct  140   SYETDKWAKHRRLINPAFHLDKVKHMLPSFHKSCAEMLSKWEKIVPSEGCFELDVWPYLQ  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAIS TAFGS+YE+G KIFELQKEQA    + + S +IPGWRFLPT  NRRMK I 
Sbjct  200   TMTSDAISLTAFGSSYEQGIKIFELQKEQAALLIKAILSAFIPGWRFLPTKTNRRMKHII  259

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
              +V++L+  IIDKR KA+EAGE + +DLL ILLESN  EI+++G+K FG++ ++VIEECK
Sbjct  260   TEVESLLLAIIDKRTKAIEAGEATSNDLLDILLESNSKEIKQNGHK-FGMSLQDVIEECK  318

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFY  GQETTS LLVWTM+LL +H +WQ RAREEV  +F    PD   L+ +KIV+MI  
Sbjct  319   LFYLAGQETTSSLLVWTMILLSKHLDWQARAREEVLHVFRSGTPDFQDLSRLKIVSMIFQ  378

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P + ++R   +ET LG+++LP GV + +PVIL HHD KIWG+DAK+FNPERFS
Sbjct  379   EVLRLYPPGLLISRAVHKETALGNIVLPAGVQLLLPVILLHHDCKIWGEDAKDFNPERFS  438

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVS+AT G L++ PFG GPRIC+G NFAMLEAK+ +AMILQ YSFELSPSY+HAP + +
Sbjct  439   EGVSEATGGSLSYFPFGWGPRICIGQNFAMLEAKMALAMILQHYSFELSPSYSHAPHTVL  498

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+ RKL
Sbjct  499   TLQPQHGAHLILRKL  513



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/500 (56%), Positives = 382/500 (76%), Gaps = 3/500 (1%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C W+VLNW W RP++L+K LR+QG +GN Y   FGD K+  K  KEA SKPM LS DI P
Sbjct  19    CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVP  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+  +   ++ ++G+NSF+W GP P V I +P  I+D+  KN  + KP  NPL+KLLA G
Sbjct  79    RVSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YE +KWSKHRRIINPAF++EKLK M+P F  SC +++   E  +  +G  E+D WP 
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D I+R+AFGS+YEEGR+IF+LQ+EQ +   +++  I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLTSDVIARSAFGSSYEEGRRIFQLQREQTELLMKVILKIQIPGWRFLPTKTHRRMKE  258

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN---KDFGITTREV  794
             I+++++A ++ +I+KR KA+++GE +K+DLLGILLESN  EI++HGN   K+ G++  +V
Sbjct  259   IDREIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLEDV  318

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IEECKLFYF GQETTSVLLVWTMVLL R+ +WQ RAREE F++FG  KPD DGL+ +KIV
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQKPDFDGLSRLKIV  378

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY P+I + R  +++ +LG+L LP GV + +P +L HHD ++WG+DAK+FN
Sbjct  379   TMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHDSELWGEDAKQFN  438

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERFSEGV KAT G+++F PFG GPRIC+G NF++LEAK+ ++MILQ + FELSP+YAHA
Sbjct  439   PERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQNFLFELSPAYAHA  498

Query  253   PTSTVSLQPQYGAPLLFRKL  194
             PT +++ QPQYGA ++ RK+
Sbjct  499   PTMSITTQPQYGAHIILRKV  518



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/496 (56%), Positives = 384/496 (77%), Gaps = 2/496 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             ++LNWA+ RP++L+K LRKQGL GN Y+ + GDL+   K T+EAK+KP+NL  DI  R++
Sbjct  23    KLLNWAYLRPKRLEKALRKQGLNGNSYRLLIGDLRDFMKATEEAKTKPINLDDDIKTRVV  82

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKP-FTNPLIKLLAEGIA  1319
             PFF++ + + G++SF W GP+P +++ +P L ++IL K+ ++ K   +NPL +LL +G+ 
Sbjct  83    PFFVNTLSKFGKDSFFWFGPHPTLIVTDPDLAKEILGKSDLFSKARSSNPLSRLLVQGVL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             ++E++KW+KHR+IINPAFH++KLK M+PAF +SC +++   EK +  +G  EVDVWP+LQ
Sbjct  143   SHEKEKWAKHRKIINPAFHLDKLKLMIPAFCLSCDQVVSEWEKSLSPEGCCEVDVWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
             ++  DAISRTAFGS+Y++GR+IFELQ EQA +    +RS+YIPGWR++PT RN+RMK+I 
Sbjct  203   KVTSDAISRTAFGSSYQQGRRIFELQSEQAGYAIHALRSVYIPGWRYVPTKRNKRMKEIA  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+++I+ +ID+RV+AM   EG  +DLL +LLESN  EIE+HG+K FG++  +V+EECK
Sbjct  263   KEVRSIIQQLIDRRVEAMGREEGKHEDLLSMLLESNSQEIEEHGSKSFGMSMDDVVEECK  322

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETT+ LLVW +VLL +H  WQTRAREEV ++FG   P  DGLN +KIVTMIL 
Sbjct  323   LFYFAGQETTASLLVWALVLLSKHPHWQTRAREEVLQVFGHQTPHFDGLNQLKIVTMILY  382

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY+P+++  R+  ++T++G+L LP GV   +P IL HHD +IWGDDA EFNP RF 
Sbjct  383   EVLRLYSPIVAQRRRLSKDTKVGELALPAGVEFILPSILLHHDREIWGDDALEFNPGRFE  442

Query  418   EGVSKAT-KGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             EGV KA  K Q  F PFG GPRIC+G  FAMLEAK+V+A+ILQR+ FELSPSY HAP + 
Sbjct  443   EGVVKAQRKKQGVFFPFGWGPRICIGQTFAMLEAKVVLAVILQRFYFELSPSYTHAPVTV  502

Query  241   VSLQPQYGAPLLFRKL  194
             V++QPQ+GA LL  KL
Sbjct  503   VTIQPQHGAHLLLHKL  518



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/497 (58%), Positives = 379/497 (76%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W VL   W+RP KL+KC R+QG++G    ++ G+LK   +   EA SKPMNLSHDI+PR+
Sbjct  21    WSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPMNLSHDIAPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGI  1322
             +PF    I++ G  S  W G  P + + +P LI+DIL+ K   + KP +NPLI+L  +G+
Sbjct  81    VPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIRLFVDGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E +KW+KHRRIINPAFH+EKLK M+PAFY SC EM+   EK +  +G  E+D+WP L
Sbjct  141   VSHEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMITKWEKLVALEGSCELDIWPEL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q + GD ISRTAFGS+Y+EGR+IF+LQ EQA+   ++  SIYIPG+R LPT RN RMK+I
Sbjct  201   QNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYRLLPTKRNNRMKEI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +++V+ L+R I++KR KA++ GE SKDDLLG+LLESNF EI +HGN K+ G+   EVIEE
Sbjct  261   DREVRGLLRRIVNKREKAIKLGEASKDDLLGLLLESNFKEIREHGNEKNIGMNVDEVIEE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTMV+L  H EWQ RAREEV + FGKDKPD DG+NH+K+V+MI
Sbjct  321   CKLFYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQSFGKDKPDFDGINHLKVVSMI  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY P ++LTR+  ++ +LGD+ LPP V +S+P IL HH  ++WG+DA+EF PER
Sbjct  381   LYEVLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTILIHHSRELWGEDAQEFKPER  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F  GVSKA   Q++F+PFG GPRIC+G NFAM+EAK+ +A+ILQ +SFELSPSYAHAP +
Sbjct  441   FLGGVSKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALALILQHFSFELSPSYAHAPCT  500

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGA ++  KL
Sbjct  501   IITLQPQYGAQIILHKL  517



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 379/498 (76%), Gaps = 4/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW WFRP+K+++CLR+QG  G  Y+ +FGD K+ +   KEA++KP+ LS  + PR+
Sbjct  46    WRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENSDMLKEARTKPLGLSDALLPRV  105

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    ++  G+NSF+W+GP P V I  P  IRD+  K   Y KP ++PL+K LA G+A
Sbjct  106   VPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDVFMKINEYQKP-SHPLLKPLACGLA  164

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMG-DQGLAEVDVWPHL  1142
             ++E +KW+KHR+IINPAFH EKLK M+PAF  SC  M+   EK +  D+G  E+DVWP L
Sbjct  165   SHEGEKWAKHRKIINPAFHQEKLKLMIPAFCESCSGMINKWEKLVSVDEGSCELDVWPDL  224

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTE-LMRSIYIPGWRFLPTWRNRRMKK  965
             Q +  DAISRT+FGSNYEEG++IF+L KE        +++++ IPG+RFLP   NRR+K 
Sbjct  225   QGLACDAISRTSFGSNYEEGKRIFDLLKELTDLTVNVIIKAVVIPGYRFLPIPSNRRLKA  284

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I+K+++A +  +I+KR KAM AGE +K+DLL +LLESNF EI++HGN K  G++  +VI+
Sbjct  285   IDKEIKASLNALINKREKAMSAGEDAKNDLLDLLLESNFREIQEHGNSKSAGMSIEDVID  344

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECK+FYF GQETTSVLL WTMVLL ++  WQ RAREEV ++FG  KPD DGLNH+K+VTM
Sbjct  345   ECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTM  404

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY PVI L R   EE +LG+L++P GV IS+P IL H D ++WGDDA EF PE
Sbjct  405   ILYEVLRLYPPVIMLNRDVHEEIKLGNLLVPAGVQISVPTILLHQDRELWGDDASEFKPE  464

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK Q++FLPFG GPRIC+G NFAM+EAK+ +AMILQR SFELSPSY HAP 
Sbjct  465   RFAEGVSKATKSQVSFLPFGWGPRICVGQNFAMIEAKMALAMILQRCSFELSPSYIHAPR  524

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQ+GAP++ RKL
Sbjct  525   TVITLQPQHGAPMILRKL  542



>ref|XP_009790240.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/496 (58%), Positives = 379/496 (76%), Gaps = 5/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR +NW W +P+ L+KCLR+ G +GN YK ++GD+K++    +EAKSKP+  SHDI PR+
Sbjct  21    WRFMNWLWLQPKCLEKCLRELGFRGNSYKLLYGDMKEVVMMDEEAKSKPIKFSHDIVPRI  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    I   G+ SF+WLGP P +LI +P LIR+IL+K+ I+ KP      KLLAEGI 
Sbjct  81    MPFIQKTIIDYGKKSFIWLGPTPALLIMDPELIREILSKSNIFQKPPPTAQTKLLAEGIL  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRRIIN AFH++KLKHMVP+F++   EML   EK +  +G +EVDVWP+LQ
Sbjct  141   SYEADKWAKHRRIINHAFHLDKLKHMVPSFHLCTCEMLSKWEKIVSAEG-SEVDVWPYLQ  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFG++YEEGRK+FELQ+E A+   ++  S YI   +FLP   +RRMK+I 
Sbjct  200   SLTSDAISRTAFGNSYEEGRKMFELQQELAKIILKVTESSYI---KFLPNKEDRRMKQIY  256

Query  958   KQVQALIRCIIDKRVKAMEAGEGSK-DDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             ++V++L+  II+KR+ A+EAGE S  DDLLGILLESN  EI++H NK FG++  EVIEEC
Sbjct  257   QEVRSLVLGIINKRMNAIEAGEASNNDDLLGILLESNLKEIQEHRNKKFGMSMDEVIEEC  316

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LL W+M++L +H EWQ RAREEV ++FG +KPD D LN +K+VTMI+
Sbjct  317   KLFYFAGQETTSALLTWSMIVLSKHSEWQARAREEVLQVFGNNKPDYDMLNQLKVVTMII  376

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P++ + R+   ET+LG+L LP GV + +P I+ +HD++IWG+D KEFNPERF
Sbjct  377   QEVLRLYPPLLLMGREVHTETKLGNLSLPSGVQLLLPTIMLYHDQEIWGEDIKEFNPERF  436

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+KATKG+  + PF  GPRIC+G NFAMLEAK+ +AMILQ Y+F++SPSYAH P S 
Sbjct  437   SEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHYAFDVSPSYAHVPYSV  496

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA L+  KL
Sbjct  497   LTLQPQHGAQLILHKL  512



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 380/498 (76%), Gaps = 1/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WRVLNW W RP+KL+KCLR+QGL GN Y+   GDLK+++   KEA SKPMN SHD +P
Sbjct  35    CAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNHSHDTAP  94

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+LP+   ++   G+NSF+W+GP P V I  P  +++I TK+  + K   NPL+KLL  G
Sbjct  95    RVLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLLTG  154

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A Y  +KW+KHR+IINPAFH EKLK M+PA Y SC EM+   E  +  +   E+DVWP+
Sbjct  155   LANYGGEKWAKHRKIINPAFHSEKLKRMLPAIYQSCSEMIEEWESLVSKESSYELDVWPY  214

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRT+FGS+Y+EGR+IF+L K Q +   +  +S+YIPGWRFLPT  N+R+K 
Sbjct  215   LQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTMKTKQSVYIPGWRFLPTKMNKRLKG  274

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             ++K+++ L+  II+KR +A++AGE +KDDLLG+LLESN  EI++HGN K+ G++ ++++ 
Sbjct  275   VDKEIRELLMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKEVGMSIQDILG  334

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTS LLVWTMVLL  +Q WQ RAREEV ++FG +KPD+DGLNH+K+VT 
Sbjct  335   ECKLFYFAGQETTSTLLVWTMVLLSENQNWQDRAREEVLQVFGGEKPDVDGLNHLKVVTT  394

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E+LRLY  +++L+R   ++T+  +  LP GV IS+P +L HHD+++WGDDA +F P 
Sbjct  395   ILLEALRLYPSIVTLSRMIHKKTQFTEFSLPAGVEISLPTVLIHHDKELWGDDATQFKPM  454

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK +LT+ PFGGG RIC+G NFAM+EAKL +A+ILQ ++F+LSPSYAHAP+
Sbjct  455   RFAEGVSKATKNKLTYFPFGGGARICIGQNFAMMEAKLAVALILQHFTFKLSPSYAHAPS  514

Query  247   STVSLQPQYGAPLLFRKL  194
                +LQPQ+GA ++  KL
Sbjct  515   GITTLQPQFGAHIVLHKL  532



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/497 (58%), Positives = 374/497 (75%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR L W W+RP++L++ LR QGL+G+ Y+F+ GDLK+  +  KEA+SKPM  SHDI PR+
Sbjct  31    WRGLEWVWWRPKRLERALRGQGLRGSRYRFLHGDLKETARLNKEARSKPMPFSHDIIPRV  90

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGI  1322
              P F  AI+ NG+ S  WLGP P V I  P L+R++L+ K   + KP  NPL +LLA G+
Sbjct  91    SPIFHRAIKENGKISITWLGPVPRVTIMNPELVREVLSNKFGHFTKPKLNPLGQLLARGL  150

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE ++W+KHRRI+NPAFH+EKLK M+PAF   C E++   EK +G  G  E+DVWP L
Sbjct  151   ADYEGEQWAKHRRILNPAFHLEKLKRMLPAFSACCGELVSRWEKSIGSLGYYELDVWPEL  210

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q   GD ISRTAFGS+Y EGR+IF+LQ EQA+   + ++++YIPG+RFLPT  N R K+I
Sbjct  211   QTFTGDVISRTAFGSSYAEGRRIFQLQAEQAELVIKAVQTVYIPGYRFLPTPINNRRKEI  270

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
              ++V+AL+R II+KR KA++ GE S DDLLG+++E N    ++HGN K+ G+TT EVIEE
Sbjct  271   YREVRALLRGIIEKREKAIKLGEASNDDLLGVMIEYNLKHFQEHGNSKNTGMTTEEVIEE  330

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLL WTM++L  H  WQ RAREEV  LFGK++PD DGLN +KIVTMI
Sbjct  331   CKLFYFAGQETTSVLLTWTMIVLSMHPSWQVRAREEVLELFGKNRPDYDGLNRLKIVTMI  390

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY PVI L R   +  +LGD+  P GVL+++PVI  HHD +IWG DA EFNPER
Sbjct  391   LYEVLRLYPPVILLNRITYKTMKLGDITYPAGVLLTLPVIFIHHDPEIWGKDASEFNPER  450

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F+EG+SKA+KGQL F PFG GPR C+G +FA+LEAK+ ++MILQ YSFELSPSY HAP +
Sbjct  451   FAEGISKASKGQLAFFPFGWGPRTCIGQSFALLEAKMGLSMILQHYSFELSPSYVHAPYA  510

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQ+GA +  R++
Sbjct  511   AITLQPQHGAQIRLRRV  527



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 376/498 (76%), Gaps = 4/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW WFRP+K+++CLR+QG  G  Y+ + GD K+ +   KEA++KP+ LS  + PR+
Sbjct  51    WRVLNWVWFRPKKVERCLRQQGFAGKPYRLLLGDWKESSDMLKEARTKPLGLSEALLPRV  110

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    ++  G+NSF+W+GP P V I  P  IRD+  K   Y K  ++PL+K LA G+A
Sbjct  111   MPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDVFMKINEYQKA-SHPLLKALACGLA  169

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKM-GDQGLAEVDVWPHL  1142
             ++E +KW+KHR+IINPAFH EKLK M+PAFY SC  M+   EK +  D+G  E+DVWP L
Sbjct  170   SHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCSGMINKWEKLVSADEGSCELDVWPDL  229

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTE-LMRSIYIPGWRFLPTWRNRRMKK  965
             + +  DAISRT+FGSNYEEG++IF+L KE        +M++I IPG+RFLP   NRR+K 
Sbjct  230   RGLTCDAISRTSFGSNYEEGKRIFDLLKEFTDLTVHVIMKAIVIPGYRFLPIPSNRRLKA  289

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I+K+++A +  +I KR KAM AGE +K+DLL +LLESNF EI++HGN K  G++  +VI+
Sbjct  290   IDKEIKASLNALISKREKAMSAGEDAKNDLLDLLLESNFREIQEHGNTKSVGMSIEDVID  349

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECK+FYF GQETTSVLL WTMVLL ++  WQ R REEV ++FG  KPD DGLNH+K+VTM
Sbjct  350   ECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARGREEVVQVFGNKKPDFDGLNHLKVVTM  409

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY PVI L R   EE +LG+L+LP GV IS+P IL H D ++WGDDA EF PE
Sbjct  410   ILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQISVPTILLHQDRELWGDDASEFKPE  469

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK Q++FLPFG GPRIC+G NFAM+EAK+ +AMILQR SFELSPSY HAP 
Sbjct  470   RFAEGVSKATKSQVSFLPFGWGPRICVGQNFAMIEAKMALAMILQRCSFELSPSYVHAPH  529

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQ+GAP++ RKL
Sbjct  530   TVITLQPQHGAPMILRKL  547



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/496 (57%), Positives = 375/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W VLNW W RP+KL+K LR+QGLKGN Y+ +FGDLK+ +   K+AK++P++L  D + R+
Sbjct  22    WMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESSIMLKKAKARPLSLDDDAAVRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF     +  G+NSF+W GP P V I  P  I++I TK   + K  +NPL ++L  G+ 
Sbjct  82    NPFLPKLFKDYGKNSFMWFGPTPRVNITNPDQIKEIFTKINDFPKINSNPLARILGVGLV  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE ++W+KHR+IINPAF  EKLK M+PAF  S  +++   EK M  +G  E+DVWP+L 
Sbjct  142   NYEGEQWAKHRKIINPAFRQEKLKLMLPAFCQSSSDIITEWEKLMSTEGSCELDVWPYLA  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGSNYEEGR+IF+LQ E A+   +++RS+YIPGWRFLPT RN+RMK+++
Sbjct  202   NLTGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIRSVYIPGWRFLPTKRNKRMKELD  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K++   +  II  R KAM+AGE + DDLLGIL+++NF EIE+HG NK+ G++  +V+EEC
Sbjct  262   KEISTALMGIIKNREKAMKAGEAANDDLLGILMDTNFREIEEHGNNKNVGMSFNDVMEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL WTMVLL +HQ+WQ RAR+EV ++FG +KPD DGLNH+KIV MI 
Sbjct  322   KLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMIF  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P + L R   +ET+LG+L+L  GV IS+PVI+ HHD ++WGDDA EF PERF
Sbjct  382   NEVLRLYPPAVMLARAVNKETKLGNLILLAGVQISLPVIMVHHDPELWGDDAIEFKPERF  441

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+SK  + Q+++ PF  GPRIC+GLNFA++EAK+ +AMILQ +SFELSPSY HAPT+ 
Sbjct  442   SEGISKVNRNQVSYFPFAWGPRICIGLNFALVEAKIALAMILQNFSFELSPSYVHAPTAV  501

Query  241   VSLQPQYGAPLLFRKL  194
             ++L P++G  L+ RKL
Sbjct  502   LTLHPEFGTHLILRKL  517



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/496 (58%), Positives = 377/496 (76%), Gaps = 6/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W +PR L+KCLR+ G +GN Y+ + GD+ ++ K  +EAKSKP+  SHDI PRL
Sbjct  20    WRLLNWLWLQPRPLEKCLRELGFRGNSYRLLVGDMNEVVKMDEEAKSKPIKFSHDIVPRL  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    I   G+NSF+WLGPNP +LI EP  IR+IL+K+ I+ KP    L KLLAEGI 
Sbjct  80    MPFIHKTIIDYGKNSFIWLGPNPAMLIMEPEHIREILSKSNIFQKP-PPALTKLLAEGIL  138

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRRIINPAFH++KLKHMVP+F+++  EML   EK +  +G +EVDVWP+LQ
Sbjct  139   SYEADKWAKHRRIINPAFHLDKLKHMVPSFHLTTCEMLSKWEKIVSTEG-SEVDVWPYLQ  197

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEGRKI ELQ+E A+   +   + YI   RFLPT   RRM ++ 
Sbjct  198   TLTSDAISRTAFGSSYEEGRKIHELQQELAKIIVKETEASYI---RFLPTKEKRRMNRLH  254

Query  958   KQVQALIRCIIDKRVKAMEAGEGS-KDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             ++V++L+  II+KR+  +EAGE S  DDLLGILLESN  EI++HGNK FG++  EVIEEC
Sbjct  255   QEVRSLVLRIINKRMNEIEAGETSNSDDLLGILLESNLKEIQEHGNKKFGMSIDEVIEEC  314

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVW+M+LL +H +WQ RAREEV ++FG + PD D L+ +K+VTMI+
Sbjct  315   KLFYLAGQETTSALLVWSMILLSKHSDWQARAREEVLQVFGNNIPDYDKLSQLKVVTMIM  374

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P+  + R+  +ET+LG+L +P GV + +P IL HHD++IWG+D KEFNPERF
Sbjct  375   QEVLRLYPPIFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQEIWGEDVKEFNPERF  434

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV++ATKG+  + PF  GPR C+G NFAMLEAK+ +AMILQ+++FE+SPSYAH P S 
Sbjct  435   SEGVNRATKGKFAYFPFSWGPRNCIGQNFAMLEAKMALAMILQQFAFEVSPSYAHVPYSV  494

Query  241   VSLQPQYGAPLLFRKL  194
              +L PQYGA L+  KL
Sbjct  495   FTLLPQYGAQLILNKL  510



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/496 (57%), Positives = 380/496 (77%), Gaps = 5/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR +NW W +P+ L+KCL++ G +GN YK ++GD+K++    +EAKSKP+  SHDI PR+
Sbjct  22    WRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKSKPIKFSHDIVPRI  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    I   G+NSF+WL P P +LI +P LIR+IL+K+ I+ KP      KLL EGI 
Sbjct  82    MPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPPPTAHTKLLVEGIL  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRRIINPAFH++KLKHM+P+F++S  EML   EK    +G +EVDVWP+LQ
Sbjct  142   SYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCEMLSEWEKVASAEG-SEVDVWPYLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEGRKIFELQ+E A+   ++  S YI    FLPT  NRRMK+I 
Sbjct  201   SLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSYI---MFLPTKENRRMKQIY  257

Query  958   KQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             ++V++L+  II+KR+ A+EA E  + DDLLGILL+SN  EI++HGNK FG++  EVIEEC
Sbjct  258   QEVRSLVLGIINKRMDAIEAREAFNNDDLLGILLDSNLKEIKEHGNKKFGMSLDEVIEEC  317

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LL W+M++L +H +WQ RAREEV ++FG ++PD D LN +K+VTMI+
Sbjct  318   KLFYFAGQETTSALLTWSMIVLSKHSDWQARAREEVLQVFGNNRPDYDMLNQLKVVTMII  377

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P++ + R+  +ET+LG+L LP GV + +P I+ HHD++IWG+D KEFNPERF
Sbjct  378   QEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQLLLPTIMLHHDQEIWGEDVKEFNPERF  437

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+KATKG+  + PF  GPRIC+G +FAML+AK+ +AMILQ Y+F++SPSYAH P S 
Sbjct  438   SEGVNKATKGKFAYFPFSWGPRICIGQHFAMLQAKMALAMILQHYAFDVSPSYAHVPYSV  497

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA L+  KL
Sbjct  498   LTLQPQHGAQLILHKL  513



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/496 (56%), Positives = 375/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPM-NLSHDISPR  1502
             + VLNW WF+P+K++K L++QGLKGN Y+ ++GDLK++ KT K+A S+P+   SH   PR
Sbjct  24    YEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKEMQKTLKKACSQPVKGFSHAFEPR  83

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P + D + + G+N + W GP   V++ +P  I+++  K  +++KP +NPL KLL  G+
Sbjct  84    VIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEVTLKYDVFNKPHSNPLSKLLLRGV  143

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE DKW KHR+IINPAFH +KLKHM+P+F+ S +E +   +  + ++G  EVDV P+L
Sbjct  144   VSYEGDKWVKHRKIINPAFHQDKLKHMLPSFHTSAMETVSIWDAMVAEKGSTEVDVLPYL  203

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGSNYEEG++IFELQ+EQA+     +RS+YIPGWRFLPT  NRRMK I
Sbjct  204   QTLTSDAISRTAFGSNYEEGKRIFELQREQAELVVIALRSLYIPGWRFLPTKMNRRMKSI  263

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K V   I  I+ +R+KAMEAG   +DDLLG LLESNF E+++HG K+ G++ ++VIEEC
Sbjct  264   SKVVNNSIGIIVSERIKAMEAGVACEDDLLGTLLESNFKEMDEHGKKEVGLSIQDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTMVLL ++  WQT AREEV + FG  KPD DGL+H+K V+MIL
Sbjct  324   KLFYFAGQETTSTLLVWTMVLLSKYSHWQTLAREEVLQHFGTKKPDYDGLHHLKTVSMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PV  + R++ +E +LG + LP G L+S+P++L H D ++WG+DA EF PERF
Sbjct  384   YEVLRLYPPVPVIARRSTQEIKLGKMTLPAGGLLSLPIMLLHRDTELWGEDALEFKPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             ++GVS ATKGQ+ F PFG GPRIC+  NFA+LEAK+ +A+ILQR+SFELSPSY HAP S 
Sbjct  444   ADGVSHATKGQVIFFPFGWGPRICIAQNFALLEAKMAMALILQRFSFELSPSYTHAPISI  503

Query  241   VSLQPQYGAPLLFRKL  194
             ++L+PQYGA L+  K+
Sbjct  504   ITLRPQYGAHLILHKI  519



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 375/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W++LNW W RP++L++ LR+QGL+GN Y    GDLK+  K   EA SKPMNL SHDI+PR
Sbjct  40    WKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIAPR  99

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +L F    + ++G+NSF+W GP P V + +P  I+D+L K   + KP  NP ++LLA G+
Sbjct  100   VLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPGL  159

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E +KWSKHR+IINPAF++EKLK+M+P F   C +++   E  +   G +E D+WP  
Sbjct  160   VSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTSETDIWPFF  219

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRTAFGS+YEEGR+IF+L KEQ +   +    + IPGWRF+PT  +RRMK+I
Sbjct  220   QNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKEI  279

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K ++A +  +I+KR  A++AGE +K++LL ILLESN  EI++ GNK+ G+   EVIEEC
Sbjct  280   NKDIEASLMDMINKRETALKAGEATKNNLLDILLESNHKEIQEQGNKNVGMNLEEVIEEC  339

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  + +WQTRAREEV ++FG  KP+ +GLNH+KIVTMIL
Sbjct  340   KLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPNFEGLNHLKIVTMIL  399

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY PV+ L RK  E+ +LG+L LP GV IS+P++L HHD ++WGDDAKEF PERF
Sbjct  400   NEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPERF  459

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+ KAT G+++F  FGGGPRIC+G NF+ LEAK+ ++MILQR+SFELSP+Y HAPTS 
Sbjct  460   SEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFSFELSPTYTHAPTSV  519

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA L+  K+
Sbjct  520   ITLQPQHGAHLILHKV  535



>ref|XP_010324391.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Solanum 
lycopersicum]
Length=472

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 374/498 (75%), Gaps = 44/498 (9%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             CLW+VLNW WFRP+KL+K LRKQGL GN Y+ ++GD+K  +K  KEA SKPMNLS+DI+P
Sbjct  18    CLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSKMIKEANSKPMNLSNDITP  77

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PFF++ I++                                           LL +G
Sbjct  78    RLVPFFLETIKKYA-----------------------------------------LLVQG  96

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YEEDKW+KHR+IINPAFH+EKLKHM+PAF++SC EML   E  +  +G  E+DVWPH
Sbjct  97    LAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEMLSKWEDAV--EGSCEIDVWPH  154

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQQ+  D ISRTAFGS+YEEGRKIFELQ+EQAQH  + +RS+ IP WRFLPT RNRRMK+
Sbjct  155   LQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDTVRSVNIPRWRFLPTKRNRRMKE  214

Query  964   IEKQVQALIRCIIDKRVKAMEAG-EGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             I+ +V+  ++ IIDKR+KAM+AG +   +DLLG+LLESNF EIE+HGNKDFG++  EVIE
Sbjct  215   IKNEVRTSMKGIIDKRMKAMKAGHDADNEDLLGVLLESNFKEIEQHGNKDFGMSIEEVIE  274

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQET +VLLVWT+VLL R+Q+WQT+AREEV ++FG  KPD DGLNH+K+VTM
Sbjct  275   ECKLFYFAGQETIAVLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPDFDGLNHLKVVTM  334

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL ESLRLY+P+ +  R+  E+T L +L LP  VL+S+P I+ HHD+ IWG+DA +FNPE
Sbjct  335   ILYESLRLYSPLFTHNRQASEDTVLVELCLPADVLVSLPTIILHHDKDIWGEDANKFNPE  394

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EG+S AT G++T+ PF  GPRIC+G NFAMLEAK+ + MILQ +SFELSPSY HAP 
Sbjct  395   RFREGISSATMGKVTYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQ  454

Query  247   STVSLQPQYGAPLLFRKL  194
               +++ PQYGAPL+F KL
Sbjct  455   PLLTIHPQYGAPLIFHKL  472



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 375/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W++LNW W RP++L++ LR+QGL+GN Y    GDLK+  K   EA SKPMNL SHDI+PR
Sbjct  40    WKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIAPR  99

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +L F    + ++G+NSF+W GP P V + +P  I+D+L K   + KP  NP ++LLA G+
Sbjct  100   VLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPGL  159

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E +KWSKHR+IINPAF++EKLK+M+P F   C +++   E  +   G +E D+WP  
Sbjct  160   VSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTSETDIWPFF  219

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRTAFGS+YEEGR+IF+L KEQ +   +    + IPGWRF+PT  +RRMK+I
Sbjct  220   QNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKEI  279

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              K ++A +  +I+KR  A++AGE +K++LL ILLESN  EI++ GNK+ G+   EVIEEC
Sbjct  280   NKDIEASLMDMINKRETALKAGEATKNNLLDILLESNHKEIQEQGNKNVGMNLEEVIEEC  339

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL  + +WQTRAREEV ++FG  KP+ +GLNH+KIVTMIL
Sbjct  340   KLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRKPNFEGLNHLKIVTMIL  399

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY PV+ L RK  E+ +LG+L LP GV IS+P++L HHD ++WGDDAKEF PERF
Sbjct  400   NEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPERF  459

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+ KAT G+++F  FGGGPRIC+G NF+ LEAK+ ++MILQR+SFELSP+Y HAPTS 
Sbjct  460   SEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFSFELSPTYTHAPTSV  519

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA L+  K+
Sbjct  520   ITLQPQHGAHLILHKV  535



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 373/496 (75%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             WR+LN+ WF+P+KL+K LR+QG KGN YK ++GD+K++ K  +EA SKP++ SHD I PR
Sbjct  44    WRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSKPIDFSHDLIWPR  103

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + PF    I   G+N FVW+GP P VLI EP LIR++LTKN +YHK   +PL KL+  G+
Sbjct  104   INPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIREVLTKNYVYHKARGSPLSKLVISGL  163

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A +E+DKW+ HRRI+NPAFH++KLKHM+PAF ++  EML   +K +   G  E+DVWP+L
Sbjct  164   AGHEKDKWATHRRILNPAFHLDKLKHMLPAFKLTVNEMLNTWKKVVSKDG-TEIDVWPYL  222

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGSNYEEG+K FELQKEQ +    ++  I I  +RF+PT +N+RM +I
Sbjct  223   QTLTSDAISRTAFGSNYEEGKKNFELQKEQIELILTIINVIMIMNYRFVPTKKNKRMMQI  282

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               +V+ALI  II+KR++ +EAGE S DDLL ILL SN  EI++HGNK FG++  EVIEEC
Sbjct  283   FYEVKALILGIINKRMRMIEAGE-SHDDLLSILLTSNLKEIQQHGNKKFGMSIDEVIEEC  341

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS LLVWTM+LL ++  WQ RAREEV ++F  D+ D D LN +K+VTMIL
Sbjct  342   KLFYFAGQETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELDYDKLNQLKVVTMIL  401

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLYT   ++ R    ET+LGDL LP GV + +  +L HHD +IWGDDA EF PERF
Sbjct  402   NEVLRLYTSAYTINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGDDAMEFKPERF  461

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+SKATKGQ+ F PF  GPRIC+G NFAMLEAK+ + MIL+ Y+FELSPSYAHAP   
Sbjct  462   SEGISKATKGQVVFFPFSWGPRICIGQNFAMLEAKMAMVMILKYYAFELSPSYAHAPHPL  521

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQYGA L+  KL
Sbjct  522   L-LQPQYGAQLIMHKL  536



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/495 (58%), Positives = 381/495 (77%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP+KL++CLR+QGL GN Y+ + GD K+ +   KE KSKPM+L HD++PR+
Sbjct  24    WRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVKETKSKPMDLCHDLAPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+N F+W+GP P V I  P  ++DI  K   + KP TNPL+ LLA G++
Sbjct  84    LPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFAKYEDFQKPATNPLVNLLATGLS  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE +KW+KHR+IINPAFH EKLK M+PAF+ SC EM+   E     +G  E+DVWP+LQ
Sbjct  144   SYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSEMIEKWESLASKEGSCELDVWPYLQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YEEGRKIF+L K+Q Q   + ++S+YIPGW FLPT  N+RMK+I+
Sbjct  204   NLTADVISRTAFGSSYEEGRKIFQLLKDQGQLTMKTIQSVYIPGWWFLPTRMNKRMKEID  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+++  +  II+KR +A+  GE +KDDLLGIL+ SN  EI ++GN K+FG++  +VIEEC
Sbjct  264   KEIKGSLMGIINKREEAIRVGEATKDDLLGILMASNLKEIRENGNTKNFGMSIEDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWT+VLL ++Q+WQ RAR+EV ++FG +KPD DGL+H+K+VTMIL
Sbjct  324   KLFYFAGQETTSVLLVWTLVLLSQNQDWQARARDEVLQVFGSNKPDFDGLSHVKVVTMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY  V+ L+R   + T+LG L LP GV +S+  +L HHD+++WG+DA EF PERF
Sbjct  384   LEVLRLYPAVVVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVHHDKELWGEDANEFKPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATK +  + PFGGGPRIC+G NFAM+EAKL +A+ILQ ++FELSPSYAHAP++ 
Sbjct  444   SEGVSKATKNKFAYFPFGGGPRICIGQNFAMVEAKLALALILQHFAFELSPSYAHAPSAE  503

Query  241   VSLQPQYGAPLLFRK  197
             ++LQPQ+GA ++  K
Sbjct  504   ITLQPQFGAHIILHK  518



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/495 (58%), Positives = 382/495 (77%), Gaps = 1/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNW W RP+KL++CLR+QGL GN Y+ + GD K+ +   KEAKSKPM+L HD++PR+
Sbjct  24    WRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHDLAPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+NSF+W+GP P V I  P  ++DI  K   + KP  NPL+KLLA G+A
Sbjct  84    LPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLLATGLA  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHR+IINPAFH EKLK M+PAF+ SC E++   E     +G  E+DVWP+LQ
Sbjct  144   NYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSELIEEWESLASKEGSCELDVWPYLQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YEEGRKIF+L K+QAQ   + ++S+YIPGWRFLPT  N+RMK+I+
Sbjct  204   NLTADVISRTAFGSSYEEGRKIFQLLKDQAQLTIKAIQSVYIPGWRFLPTRMNKRMKEID  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+++  +  II+KR +A+   E ++DDLLGIL++SN  EI ++GN K+ G++  +VIEEC
Sbjct  264   KEIKGSLMGIINKREEAIRVREATRDDLLGILMDSNLKEIRENGNTKNVGMSIEDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWT+VLL ++Q+WQ RAR+EV ++FG +KPD DGL+H+K+VTMIL
Sbjct  324   KLFYFAGQETTSVLLVWTLVLLSQNQDWQARARDEVLQVFGSNKPDFDGLSHLKVVTMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY  V+ L+R   + T+LG L LP GV +S+  +L HHD+++WG+DA EF PERF
Sbjct  384   LEVLRLYPAVVVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVHHDKELWGEDANEFKPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S GVSKATK +  + PFGGGPRIC+G NFAM+EAKL +A+ILQ ++FELSPSYAHAP++ 
Sbjct  444   SSGVSKATKNKFAYFPFGGGPRICIGQNFAMVEAKLALALILQHFAFELSPSYAHAPSAD  503

Query  241   VSLQPQYGAPLLFRK  197
             ++LQPQ+GA ++  K
Sbjct  504   ITLQPQFGAHIILHK  518



>emb|CDP15979.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/495 (57%), Positives = 365/495 (74%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++  W W  P+KL+K LR+QG +GN Y  + GD+  ++   K+A SKP+NLS DI PR+
Sbjct  29    WKLFKWVWLNPKKLEKLLRQQGFRGNSYIPVLGDVIAMSTLLKQAHSKPINLSDDIVPRI  88

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P ++D ++++G+N+++W GP P V I++P LIR+      ++HKP  N L +LLA G+ 
Sbjct  89    IPEYLDLVKKHGKNTYIWYGPEPSVCIQDPELIREASQNINLFHKPVVNQLTRLLAPGLI  148

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +Y  DKW+KHR++INPAFH EKLK M+P+F  S   ML   E+ +   G  E+DVWP L+
Sbjct  149   SYNGDKWAKHRKLINPAFHGEKLKLMLPSFCTSATAMLRKWEEIISPTGFCELDVWPSLR  208

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGSNYEEGR IFELQ EQ +   + + S+ IPGWRFLPT RNRRM +I 
Sbjct  209   SLSSDAISRTAFGSNYEEGRVIFELQGEQCELCIKALWSMLIPGWRFLPTKRNRRMGQIF  268

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K V   IR II+ R+  + AGE   DD LG+LL+SN  EI++HGNKDFG+T  EVIEEC+
Sbjct  269   KDVTDSIREIINSRLNEIRAGEFGDDDFLGLLLQSNSQEIDRHGNKDFGMTIEEVIEECR  328

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFY  GQETTSVLLVWT++LL  HQEWQTRAR+EV ++FG   PD DGLNH+K+VTM+L 
Sbjct  329   LFYVAGQETTSVLLVWTLILLSVHQEWQTRARDEVLQVFGTRIPDFDGLNHLKLVTMVLY  388

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P+    R    ET+LG+L LP GVL+ I  +L HHD+ IWG+DAKEF PERFS
Sbjct  389   EVLRLYPPIPVNGRITAAETKLGNLSLPSGVLVLIQTLLVHHDQAIWGEDAKEFKPERFS  448

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +G S ATKG + F PFG GPR C+G ++AMLEAKLV+AMILQR+ F+LSPSY+HAP S V
Sbjct  449   QGASHATKGNIAFFPFGWGPRSCIGQSYAMLEAKLVLAMILQRFWFKLSPSYSHAPISLV  508

Query  238   SLQPQYGAPLLFRKL  194
             +L+PQYGAPL+  KL
Sbjct  509   TLKPQYGAPLILHKL  523



>ref|XP_010323670.1| PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Solanum lycopersicum]
Length=431

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/430 (65%), Positives = 350/430 (81%), Gaps = 1/430 (0%)
 Frame = -1

Query  1480  AIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHK-PFTNPLIKLLAEGIATYEED  1304
             ++   G++SF+WLGP P+VLI +P  +++I TKN +Y K    NP  KLLA+G+ + EED
Sbjct  2     SVSIKGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKLLAKGLVSLEED  61

Query  1303  KWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQIGGD  1124
             KW+KHR+IINP FH+EKLKHM+PAFY+ C EM+   E+ +      E+DVWP L+++  +
Sbjct  62    KWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMISKWEEIVPKGTSTEIDVWPDLEKMTSE  121

Query  1123  AISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEKQVQA  944
              ISRTAFGS+YEEGR +FELQKEQA+H  E+ RSIYIPG RFLPT RN+RM +IEK++Q 
Sbjct  122   VISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRNKRMLEIEKEIQT  181

Query  943   LIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECKLFYFV  764
              IR IIDKR++AME GE SKDDLLGILLESN  EIE+HG+KDFG+TT EVIEECKLFYF 
Sbjct  182   TIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTVEVIEECKLFYFA  241

Query  763   GQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNESLRL  584
             GQETTSVLLVWTM+LL  H EWQ RAREEV ++FG DKPD++GL  +KIVTMIL E+LRL
Sbjct  242   GQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLKIVTMILYETLRL  301

Query  583   YTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFSEGVSK  404
             + P+ +  R NKEE +LG+L LP GV++ +P IL H+D++IWG+DAKEF PERFSEGVSK
Sbjct  302   FPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKEFKPERFSEGVSK  361

Query  403   ATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTVSLQPQ  224
             ATKGQ +F+PFGGGPRIC+G NFAM+EAK+ +AMILQR+SFELSPSY HAP + V++ PQ
Sbjct  362   ATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQRFSFELSPSYTHAPFAVVTIHPQ  421

Query  223   YGAPLLFRKL  194
             YGAPLL RKL
Sbjct  422   YGAPLLMRKL  431



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/495 (56%), Positives = 374/495 (76%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             RVLNWAW+RPR+L++ LR QGL G  Y+F +GD+K++ +  KEA++KPM L+H+I PRLL
Sbjct  28    RVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMPLAHNIIPRLL  87

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PFF  A+   G+ SF W GP P V I +P L+R++L+ K  I+ KP  NPL +  ++G+ 
Sbjct  88    PFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPLSRFFSKGLF  147

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW KHRRI+NPAFH EKLK M+PAF   C +++   E   G +   E+DVWP LQ
Sbjct  148   VYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACYELDVWPELQ  207

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISRTAFGS+YEEGR+IF+LQ EQA+   ++++++Y+PG+RFLPT +N+R+K I+
Sbjct  208   SFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNKRIKAID  267

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             +++++++R II KR + ++ G+ S DDLLG+L+ESN   +++ GNK+ G+TT +VIEECK
Sbjct  268   REIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMTTEDVIEECK  327

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LL WTM+ L  H  WQ RAREEV R+FG++KPD DGL+H+KIVTMIL 
Sbjct  328   LFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKIVTMILY  387

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P I + R+  +  ++GD++ PPGVL+ +  I  HHD  +WG DA EFNPERF+
Sbjct  388   EVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEFNPERFA  447

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKA+K Q+ F PFGGGPRIC+G NFA+LEAK+ ++MILQ +SF+LSPSYAHAP +  
Sbjct  448   EGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAHAPHTVF  507

Query  238   SLQPQYGAPLLFRKL  194
             +L PQ+GA +  RKL
Sbjct  508   TLHPQHGAQIRLRKL  522



>ref|XP_006348305.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006348306.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X3 [Solanum 
tuberosum]
Length=417

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/417 (66%), Positives = 339/417 (81%), Gaps = 0/417 (0%)
 Frame = -1

Query  1444  LGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAF  1265
             +GP P +LI +P LI+++L+KN +Y KP  NPL  L  +G+ +YE+DKW+KHR+IINPAF
Sbjct  1     MGPRPQILIMDPELIKEVLSKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAF  60

Query  1264  HMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEE  1085
             H+EKLKHM+PAFY+SC EML   E  +  +G  E+DVWPHLQQ+  D ISRTAFGS+YEE
Sbjct  61    HLEKLKHMLPAFYLSCSEMLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEE  120

Query  1084  GRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAM  905
             GRKIFELQ+EQAQH  E++RS+YIPGWRFLPT RNRRMK+I+K V++ IR IIDKR+KAM
Sbjct  121   GRKIFELQQEQAQHFLEVIRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAM  180

Query  904   EAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECKLFYFVGQETTSVLLVWTM  725
             EAG    +DLLGILLESNF EIE HGNKDFG++  EVIEECKLFYF G ETTSV ++WT+
Sbjct  181   EAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTL  240

Query  724   VLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKE  545
             VLL R+ +WQ RAREEV ++FG  KPD DGLNH+K+VTMIL ESLRLY+P+  L R+  E
Sbjct  241   VLLSRYPDWQARAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLARRIYE  300

Query  544   ETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGG  365
             +  LG++ LP GVL+S+P+IL HHD+ IWG+DA +FNPERF EG+S ATKGQ+T+ PF  
Sbjct  301   DITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKFNPERFREGISSATKGQVTYFPFAW  360

Query  364   GPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             GPRIC+G NFAMLEAK+ + MILQ + FELSPSY HAP S V+ QPQYGAPL+F KL
Sbjct  361   GPRICIGQNFAMLEAKMTVCMILQSFFFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  417



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/495 (58%), Positives = 372/495 (75%), Gaps = 4/495 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VL+W WF+PRKL+K L++QG KGN YK  +GD K++    +EA SKP++LS DI PR+
Sbjct  23    WKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFKEIGTLFQEAYSKPISLSDDIVPRV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P F+  + + G+N+++W GP P +LI +P L R +  K  I+ KP  +PL KLLA+G  
Sbjct  83    IPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRKVTQKMEIFQKPQFHPLSKLLAQGTL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE DKW+KHR+++N AFHMEKLK MVPAFY S  EML   E+ +  +G  E+DVWPHLQ
Sbjct  143   VYEGDKWAKHRKLLNQAFHMEKLKLMVPAFYTSASEMLSKWEEGISAKGSIELDVWPHLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGS YE+GR+IFELQ EQAQH  + ++S+YIPG RFLPT RNRRMK+I 
Sbjct  203   TMTGDAISRTAFGSKYEKGRRIFELQTEQAQHLVKAVQSMYIPGLRFLPTKRNRRMKQIA  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
              +V   I  II  R+ A+  GE S DD+L +LLES+  E     +K+FG+TT+E++EECK
Sbjct  263   TEVNDSIGEIIRTRLNALRTGEASDDDMLSLLLESSSQET----DKEFGMTTKEIVEECK  318

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETT+VLLVWTM+LL  + +WQ  AREEV + FG + PD DGLN ++IVTMIL+
Sbjct  319   LFYFAGQETTAVLLVWTMILLSMYPDWQEHAREEVLQHFGTNIPDFDGLNRLRIVTMILH  378

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P   L +   EET+LG+L  P G L+++P IL HHD +IWG+D KEF PERF+
Sbjct  379   EVLRLYPPFPILGQTVAEETKLGNLTFPSGQLLTVPTILLHHDPEIWGEDVKEFKPERFA  438

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +GVS ATKGQ+ F PFG GPRIC+G NFAMLEAKLV+AM LQR+SFELSPSY+HAP S V
Sbjct  439   DGVSHATKGQVVFFPFGWGPRICIGQNFAMLEAKLVLAMALQRFSFELSPSYSHAPYSAV  498

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GA L+  K+
Sbjct  499   TLQPQFGAHLILHKM  513



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/494 (58%), Positives = 380/494 (77%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL G  Y F+FGDLK+ ++   EA SKP+++S DI PRL
Sbjct  22    WRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPISVSDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF+W+GP P V I  P  +++I +K   Y +P +NPL+KLLA+G+A
Sbjct  82    LPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             ++E +KW++HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +      E+D W  LQ
Sbjct  142   SHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVDRSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  + ISRTAFGS++EEG++IFELQ EQAQ     ++S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKSID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  II +R KA+  GE + DDLLG+LLESN  E       + G++  +VIEECK
Sbjct  262   KEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV ++FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV  L RK   ET+LG L +PPGV +S+P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDQELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++FELSPSYAHAP++ +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQP+YG  ++ RK
Sbjct  495   TLQPRYGVQVILRK  508



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/498 (56%), Positives = 377/498 (76%), Gaps = 4/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW WFRP+K+++CLR+QG  G  Y+ +FGD K+ +   KEA++KP+ LS  + PR+
Sbjct  22    WRLLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESSDMLKEARTKPIGLSDALLPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    ++  G+NSF+W+GP P V I  P  I+D+  K   Y KP ++PL+K +A G+ 
Sbjct  82    MPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIKDVFMKINEYQKP-SHPLLKAIACGLP  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMG-DQGLAEVDVWPHL  1142
             ++E +KWS HR+IINPAFH EK+K M+PAFY SC  M+   EK +  D+G  E+DVWP L
Sbjct  141   SHEGEKWSNHRKIINPAFHQEKIKLMIPAFYESCSGMINKWEKLVSIDEGSCELDVWPDL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTE-LMRSIYIPGWRFLPTWRNRRMKK  965
             Q +  DAISRT+FGSNYEEG++IF+L KE        ++++I IPG+RFLP   NRR+K 
Sbjct  201   QGLTCDAISRTSFGSNYEEGKRIFDLLKELTDLTVHVIIKAIVIPGYRFLPIPSNRRLKA  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I+K+++A +  +I+KR +AM AGE +K+DLLG+LLESNF EI++HGN K  G++  +VI+
Sbjct  261   IDKEIKASLNALINKREQAMSAGEDAKNDLLGLLLESNFREIQEHGNTKSVGMSIEDVID  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             EC++FYF GQETT+VLL WTMVLL ++  WQ RAREEV ++FG  KPD DGLNH+K+VTM
Sbjct  321   ECRIFYFAGQETTTVLLTWTMVLLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             I  E LRLY PVI L R   EE +LG+L+LP GV +S+P IL H D ++WGDDA EF P 
Sbjct  381   IFYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVSVPTILLHQDHELWGDDASEFKPG  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+EGVSKATK Q++FLPFG GPRIC+G NFA++EAK+ +AMILQR SFELSPSY HAP 
Sbjct  441   RFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAMILQRCSFELSPSYIHAPR  500

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQ+GAP++ RKL
Sbjct  501   TVITLQPQHGAPMILRKL  518



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 377/498 (76%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNW WF P++L+K LR+QG +GN YK + GD K+  K  KEA SKPM+LS DI PR+
Sbjct  21    WKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               +   +++ +G+NSF+WLGP P V I +P  I+DI  K   + KP  NPL+KLLA G+A
Sbjct  81    SSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATGLA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KWSKHRR+INPAF++EKLK M+P F+ SC +++   E+ +   G  E+D WP LQ
Sbjct  141   DYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERMLSSDGSCEIDAWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D I+R+AFGS++EEGR+IF+LQ+EQA+   +++  I IPGWRFLPT  +RRMK+I+
Sbjct  201   NMTSDVIARSAFGSSFEEGRRIFQLQREQAKLALQVILKIQIPGWRFLPTKSHRRMKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG---NKDFGITTREVIE  788
             + ++A ++ +I KR KA++ GE   DDLLGILLESN  EI++H    NK+ G++  +VIE
Sbjct  261   RDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLEDVIE  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWTMVLL R+ +WQ RAREEV ++FG  KP  DGLN +KIVTM
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNQKPSFDGLNRLKIVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             ILNE LRLY P + + R  K + +LG+++LP GV I +P +L HH+ + WG+DAK+FNPE
Sbjct  381   ILNEVLRLYPPALGMNRLAKRDLKLGNIILPAGVQIFLPTVLVHHNCEFWGEDAKQFNPE  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGV KATKG+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+YAHAP 
Sbjct  441   RFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHAPA  500

Query  247   STVSLQPQYGAPLLFRKL  194
               ++LQPQYGA ++  K+
Sbjct  501   MLITLQPQYGAHIILHKV  518



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/496 (56%), Positives = 379/496 (76%), Gaps = 2/496 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             ++LNWAW +P+KL+K LR+QG +GN Y+F+FGD+K+    +++AKSKP++L  DI+PR++
Sbjct  23    KILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHGILSRQAKSKPISLDDDIAPRVV  82

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P +    +  G+N++ W+GP PM+ I +P  I+++ T    + KP TNPL K+L  G+A 
Sbjct  83    PLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTGLAI  142

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKM-GDQGLAEVDVWPHLQ  1139
              E +KW+KHR+IINPAFH EKLK M+PAFY SC E++   EK M GDQG  E+DVWP+L 
Sbjct  143   REGEKWAKHRKIINPAFHQEKLKLMLPAFYQSCTEIISKWEKLMIGDQGSCELDVWPYLV  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
             ++  D ISRTAFGSNYEEG +IF+LQ E A    + ++S+YIPGWR++PT RNRRMK+++
Sbjct  203   KLTSDVISRTAFGSNYEEGIRIFQLQTELADIALQALQSVYIPGWRYVPTKRNRRMKELD  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDF-GITTREVIEEC  782
             K+++  +  II KR  AM+ GE +KDDLLG+L+ESN  EI++HGN    GI+  +VI+EC
Sbjct  263   KEIRVSLADIIRKREIAMKTGEAAKDDLLGLLMESNLKEIKEHGNNKLKGISRDDVIDEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WTMVLL +HQ+WQ  AREEV ++ G  KPD DGLN +KIV MI 
Sbjct  323   KLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVLGDKKPDFDGLNRLKIVQMIF  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P+  L+R  ++ET++GDL+LP   +I++  +L HHD+K+WGDDAKEF PERF
Sbjct  383   YEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHHDKKLWGDDAKEFKPERF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+SKATK Q+++ PF  GPRIC+G NFA++EAK+ +AMILQ +SFELSPSY HAP + 
Sbjct  443   SEGISKATKNQVSYFPFSWGPRICIGQNFALVEAKMAMAMILQNFSFELSPSYVHAPHAF  502

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQ+G  L+ RKL
Sbjct  503   IFLQPQHGVYLILRKL  518



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/500 (58%), Positives = 384/500 (77%), Gaps = 6/500 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNWAW +P+KL+K LR+ GLKGN Y+ + GDL + ++  KEAKSKP+N ++ I PR+
Sbjct  38    WKMLNWAWIKPKKLEKRLRQLGLKGNSYRLLIGDLGETSQMDKEAKSKPINFTNHIIPRI  97

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    IQ +G+N F+W GPNP V+I +P LI+++LTKN  Y KP ++ L KL+++G+A
Sbjct  98    MPFLHKIIQSHGKNPFIWQGPNPAVIITDPELIKEVLTKNYTYQKPPSDDLGKLISQGVA  157

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEK--KMGDQGLAEVDVWPH  1145
              Y++DKW+KHRR++NPAFH+EKLKHM+PAF++SC EML   EK      +G  E+DVWP+
Sbjct  158   AYDKDKWAKHRRLLNPAFHIEKLKHMLPAFHLSCSEMLKKWEKLASASAEGSFELDVWPY  217

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRTAFGSN EEG+ IF+LQKE  +H  ++++S Y PG  +LPT R RRMKK
Sbjct  218   LQDMTSDVISRTAFGSNLEEGKNIFKLQKEILEHILQILQSFYFPGMLYLPTKRIRRMKK  277

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDF----GITTRE  797
             I K+V + +  II KRV+AM+AGE S DDLLGILL+SNF EIE     +     G++  E
Sbjct  278   ISKEVHSSVLNIIMKRVEAMKAGEPSNDDLLGILLDSNFKEIENDNGNNSNKNCGMSFEE  337

Query  796   VIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKI  617
             VIEECKLFYF GQETT+VLLVWT++LL +H EWQ RAR+EV ++FG  +PD D LNH+K+
Sbjct  338   VIEECKLFYFAGQETTAVLLVWTLLLLSKHPEWQMRARDEVLQIFGNSEPDFDALNHLKV  397

Query  616   VTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEF  437
             +TM++NE LRLY P   ++R   E+T+LG L LP G+ I +P I+ HHDE++WGDDAKEF
Sbjct  398   ITMVINEVLRLYPPGFMMSRVIHEDTKLGSLSLPGGISIFLPTIMLHHDEELWGDDAKEF  457

Query  436   NPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAH  257
              PERFSEG+SKATKGQ  + PF GGPRIC+G NFAMLEAK+ +A+ILQR++FE+SPSY H
Sbjct  458   KPERFSEGISKATKGQFIYFPFSGGPRICIGNNFAMLEAKMALALILQRFTFEISPSYTH  517

Query  256   APTSTVSLQPQYGAPLLFRK  197
             AP + V+LQPQYGA L+  K
Sbjct  518   APHTLVTLQPQYGAQLILYK  537



>ref|XP_004248201.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=510

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/496 (58%), Positives = 376/496 (76%), Gaps = 6/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR++NW W +PR L+KCLR+ G +GN YKF+ GD+ ++ K  +EAKSKP+  SHDI  RL
Sbjct  20    WRLMNWLWLQPRCLEKCLRELGFRGNSYKFLVGDMNEVVKMDEEAKSKPIKFSHDIVKRL  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    I   G+NSF+WLGPNP +LI +P  IR+IL+K+ I+ KP    L KLLAEGI 
Sbjct  80    MPFIHKTIIDYGKNSFIWLGPNPAMLIMDPEHIREILSKSNIFQKP-PPALTKLLAEGIL  138

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRRIINPAFH++KLKHMVP+F+++  EML   EK +  +G +EVDVWP+LQ
Sbjct  139   SYEGDKWAKHRRIINPAFHLDKLKHMVPSFHLTTCEMLSKWEKIVSTEG-SEVDVWPYLQ  197

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEGR+I ELQ+E A+   +   + YI   RFLPT   RRM +I 
Sbjct  198   TLTSDAISRTAFGSSYEEGRQIHELQQELAKIILKETEASYI---RFLPTKEKRRMNRIH  254

Query  958   KQVQALIRCIIDKRVKAMEAGEGS-KDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             ++V++L+  II+KR+  +EAG+ S  DDLLGILLESN  EI++HGNK FG++  EVIEEC
Sbjct  255   QEVRSLVLRIINKRMNKIEAGDTSNSDDLLGILLESNMKEIQEHGNKKFGMSIDEVIEEC  314

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVW+M+LL +H +WQ RAREEV ++FG + PD D LN +K+VTMI+
Sbjct  315   KLFYLAGQETTSALLVWSMILLSKHSDWQARAREEVSQVFGNNVPDYDKLNQLKVVTMII  374

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P   + R+  +ET+LG+L +P GV + +P IL HHD++IWG+D +EFNPERF
Sbjct  375   QEVLRLYPPNFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQEIWGEDVEEFNPERF  434

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV++ATKG+  + PF  GPR C+G NFAMLEAK+ +AMILQ+++FE+SPSYAH P S 
Sbjct  435   SEGVNRATKGKFAYFPFSWGPRNCIGQNFAMLEAKMALAMILQQFAFEVSPSYAHVPYSV  494

Query  241   VSLQPQYGAPLLFRKL  194
              +L PQYGA L+  KL
Sbjct  495   FTLLPQYGAQLILHKL  510



>ref|XP_004307203.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=543

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/498 (55%), Positives = 373/498 (75%), Gaps = 2/498 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WRVLNW W +P+KL+KCLR+QGL GN Y+ + GD+K+  +  KEA SKPMNLS D +P
Sbjct  45    CAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEACSKPMNLSDDAAP  104

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R+LPF    I ++G+NSF W G  P V I  P  + +ILTK   + +P T P++KLL+ G
Sbjct  105   RVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRRPHTAPVVKLLSYG  164

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A  E +KW K R+IINPAFH+EKLK+M+PA Y SC +M+   E  +  +G  E+D+WP 
Sbjct  165   LANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCTDMITKWEIMVSKEGSCELDIWPF  224

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ + GD ISRTAFGS+YEEGR IFELQKEQ +   + + S YIPG+RFLPT  NRRMK 
Sbjct  225   LQNLSGDVISRTAFGSSYEEGRTIFELQKEQTELLIKALFSAYIPGFRFLPTKLNRRMKA  284

Query  964   IEKQVQALIRCIIDKRVKAMEAG-EGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVI  791
             I K+V+A ++ II  +V+A+ AG E +K+DLLGILLESN+ EI ++ GNK+ G++  EVI
Sbjct  285   ISKEVEATMKRIISNKVEAIRAGDEDAKNDLLGILLESNWKEIRQYGGNKNLGMSIEEVI  344

Query  790   EECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVT  611
              ECKLFY  G ETTS+LL WTM+LL R+  WQ RAR+EV ++FG +KPD DGL H+K+VT
Sbjct  345   GECKLFYLAGAETTSILLTWTMILLCRYPNWQARARQEVLQVFGSNKPDFDGLIHLKVVT  404

Query  610   MILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             MI+ E LRLY PV  +TR  ++ET+LG+L+LP GV +S+P+ L   D+ +WG+DA EFNP
Sbjct  405   MIIYEVLRLYPPVPMMTRAVQKETQLGNLLLPSGVQLSLPIFLIQRDQTLWGEDANEFNP  464

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             +RFSEG+SKATKGQ++++PFG GPRIC+G NF ++EAK+ ++++L  ++FELSPSY H P
Sbjct  465   QRFSEGISKATKGQVSYIPFGWGPRICIGQNFGLMEAKMALSLMLHSFTFELSPSYIHGP  524

Query  250   TSTVSLQPQYGAPLLFRK  197
              + ++ QPQYGA ++  K
Sbjct  525   MTIITTQPQYGAHIILHK  542



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/496 (55%), Positives = 380/496 (77%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+L+W W RP++L++CLRKQGL GN Y+F+ GD+K+    +++A+SKPM LS DI+  +
Sbjct  23    WRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSRQARSKPMPLSDDITQYV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF    ++ +G++SF W+GP P V I EP  IR+I TK   + KP +NPL+ LL  G+ 
Sbjct  83    GPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDFQKPHSNPLVSLLVSGLV  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + ++W+KHR+IINPAFH +KLK+M+PAFY SC+EM+   EK +  +G +E+DVWP+L 
Sbjct  143   NLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEKLVFLEGSSELDVWPYLV  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
             ++  D ISR AFGS+YEEGR+IF+L ++Q     ++++S YIPGWR+LPT  NR+MK I 
Sbjct  203   KLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYIPGWRYLPTKTNRKMKVIA  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K ++  ++ +I KR +A +A E S DDLLGIL+ESN  EI++ G+ K+ G++  +VIEEC
Sbjct  263   KDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEQGDHKNMGMSIEDVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL RH  WQT+AREEV  +FG  KPD DGLN +K+VTMIL
Sbjct  323   KLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVFGDSKPDSDGLNRLKVVTMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY  V++L R   ++TRLG L+LP G  I++PV+L HHD+++WGDDA EFNP+RF
Sbjct  383   HEVLRLYPAVVALGRSVPKDTRLGKLLLPAGAEITLPVLLIHHDQELWGDDAHEFNPDRF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATK Q+ + PFG GPRIC+G NFA++EAK+ +AMIL+++ FELSPSYAH+P + 
Sbjct  443   SEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPSYAHSPCTN  502

Query  241   VSLQPQYGAPLLFRKL  194
             ++L+PQ+GA ++  KL
Sbjct  503   ITLRPQHGAHIILHKL  518



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/496 (56%), Positives = 376/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL++ LR+QGL GN Y+F  GD+K+++   K+A SKP++LSHDI+PR+
Sbjct  24    WRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIKQAYSKPVSLSHDIAPRV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    +   G+N FVW+GP P V I +P  ++ ILTK   + KP  NPL KLL  GIA
Sbjct  84    IPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKMDDFPKPXANPLXKLLXTGIA  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E +KW+KHRRIINP FH+EKLK M+P FY SC EM+   E  +  +G  E+DVWP+ +
Sbjct  144   LCEGEKWAKHRRIINPVFHIEKLKRMLPEFYQSCSEMIVEWESLVLKEGSCELDVWPYFE  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+Y+EGRKIF+L KEQA+   ++++S+YIPG RFLPT  N +MK+I+
Sbjct  204   NMTADVISRTAFGSSYKEGRKIFQLLKEQAKLAIKVVQSVYIPGARFLPTKINMKMKEID  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             ++++AL+  II+ R  A+ AGE +KDDLLG+L+ESN NEI++HG NK  G++  +VIEEC
Sbjct  264   REIRALLMGIINXREDAIRAGEATKDDLLGVLMESNLNEIKEHGNNKKVGMSMHDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMVLLG++Q WQ RAREEV ++FG +KP+  G+ H+K+VTMIL
Sbjct  324   KLFYFAGQETTSVLLVWTMVLLGQYQNWQDRAREEVLQVFGSNKPEFXGIIHLKVVTMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY  +  +TR   ++T+L    LP GV +++  +L HHD+++WGDDA EF PERF
Sbjct  384   HEVLRLYPALTVMTRTTNKKTQLSKYSLPAGVEVALSTLLVHHDKQLWGDDAHEFKPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+ KATK +  + PFGGGPR C+G NFAM+EAKL +++ILQ ++FELS SYAHAP+S 
Sbjct  444   SEGIXKATKNKFMYFPFGGGPRNCIGQNFAMVEAKLALSLILQHFTFELSASYAHAPSSN  503

Query  241   VSLQPQYGAPLLFRKL  194
             + +QPQ+GA ++  KL
Sbjct  504   LIIQPQFGAHIILHKL  519



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/497 (58%), Positives = 369/497 (74%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+   W W  PRKL+KCLR+QG+KG  YKF+ G+LK +   T+EA++KPM LSH I PR+
Sbjct  23    WKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSATQEARAKPMELSHKIVPRV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGI  1322
             +PF    +++ G+ SF+W GP   V I +P +IRDIL+ K   + K  TNPL KLL  G+
Sbjct  83    MPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKFGHFEKIRTNPLGKLLISGV  142

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE +KW KHRRI+NPAFH+EKLK M+PA Y SC EM+   E  M  Q   E+DVWPHL
Sbjct  143   VSYEGEKWVKHRRILNPAFHLEKLKMMLPAIYTSCSEMVNKWEM-MVSQDSCELDVWPHL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRTAFGS+YEEGR+IF+LQ EQA    + ++SIYIPG RFLPT RN RMK+I
Sbjct  202   QNLTADVISRTAFGSSYEEGRRIFQLQSEQAGLVIKALQSIYIPGLRFLPTKRNNRMKEI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
               + + L+R I++KR KAM+ GE   DDLLG+L+ESNF EI  + N K+FG+T  EVI+E
Sbjct  262   YGEARVLLRDIVNKREKAMKIGEAHNDDLLGLLMESNFKEITDNVNSKNFGMTIDEVIDE  321

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTMV+L  H +WQ +AREEV ++FG   PD DGLNH+KIVTMI
Sbjct  322   CKLFYFAGQETTSTLLVWTMVVLSMHPDWQEKAREEVLQVFGGKDPDFDGLNHLKIVTMI  381

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY P + + R   +  +LG++ LP GV +++P +L HHD ++WG+DA++FNPER
Sbjct  382   LYEVLRLYPPAVLMARGTYKTMKLGEITLPAGVHLAMPTLLVHHDRELWGEDAEDFNPER  441

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS GVSKATK Q++F PF  GPRIC+G NFA+LE+K+ IAMILQR+SFELS +Y HAP +
Sbjct  442   FSGGVSKATKNQVSFFPFSWGPRICIGQNFALLESKMAIAMILQRFSFELSSTYVHAPYT  501

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQ+GA L+  KL
Sbjct  502   VITLQPQHGAQLILHKL  518



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/495 (56%), Positives = 372/495 (75%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             RVLNWAW+RPR+L++ LR QGLKG  Y+F +GDLK+  + +KEA++K M L+H+I PRLL
Sbjct  28    RVLNWAWWRPRRLERALRAQGLKGTAYRFPYGDLKENARFSKEARAKSMPLAHNIIPRLL  87

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PF+  A+   G+ SF W GP P V I +P L+R++L+ K   + KP  NPL +  A G+A
Sbjct  88    PFYHRAMDEYGKISFTWSGPVPQVAITDPELVREVLSNKFGHFGKPNQNPLARFFARGLA  147

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW KHRRI+NPAFH EKLK M+PAF   C +++   E   G +   E+DVWP LQ
Sbjct  148   VYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACYELDVWPELQ  207

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISRTAFGS+++EGR IF+LQ EQA+   ++++++Y+PG+RFLPT +N+R++ I+
Sbjct  208   SFTGDVISRTAFGSSHKEGRPIFQLQAEQAELLIQVVQNLYVPGYRFLPTPKNKRIRAID  267

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             +++++++R II KR + ++ G+ S DDLLG+L+ESN   +++ GNK+ G+TT +VIEECK
Sbjct  268   REIRSILRGIIKKREQDIKTGKASNDDLLGLLMESNMKHLQEDGNKNAGMTTEDVIEECK  327

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLL WTM+ L  H  WQ RAREEV R+FG DKPD DGLNH+KIVTMIL 
Sbjct  328   LFYFAGQETTSVLLTWTMICLSMHPTWQIRAREEVLRVFGDDKPDFDGLNHLKIVTMILY  387

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P I L R+  +  +LGD++ PPGVL+ + VI  HHD  +WG D  EFNPERF+
Sbjct  388   EVLRLYPPFILLRRQTYKPMKLGDVVYPPGVLLLLHVIFVHHDPNLWGKDVSEFNPERFA  447

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKA+K Q+ F PFGGGPRIC+G NFA+LEAK+ ++MILQ +SF+LSPSYAHAP +  
Sbjct  448   EGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAHAPHAVF  507

Query  238   SLQPQYGAPLLFRKL  194
             +L PQ+GA +  RKL
Sbjct  508   TLHPQHGAQIRLRKL  522



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/494 (58%), Positives = 380/494 (77%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL G  Y F+FGDLK+ ++   EA SKP+ +S DI PRL
Sbjct  22    WRVVNWVWLRPQRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAVSDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF+W+GP P V I  P  +++I +K   Y +P +NPL+KLLA+G+ 
Sbjct  82    LPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADGLT  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             ++E +KW++HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +  +   E+D W  LQ
Sbjct  142   SHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + G+ ISRTAFGS++EEG++IFELQ EQAQ     ++S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKSID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  I+ +R KA+  GE + DDLLG+LLESN  E       + G++  +VIEECK
Sbjct  262   KEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV ++FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV  L RK   ET+LG L +PPGV +S+P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++F+LSPSYAHAP++ +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFDLSPSYAHAPSNVI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQP+YG  ++ RK
Sbjct  495   TLQPRYGVQVILRK  508



>ref|XP_010694547.1| PREDICTED: cytochrome P450 72A15-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/499 (55%), Positives = 373/499 (75%), Gaps = 3/499 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W++LNW WFRP+KL+K LRKQGLKGN YK++ GD+K+  +   EA+ KP+  ++D   R
Sbjct  19    VWKILNWVWFRPKKLEKQLRKQGLKGNSYKWLVGDMKETFRMRAEARGKPIPFTNDYYSR  78

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LPF    + + GEN + W GP P + I EP LIR+  T+   + K   NPLI LL  G+
Sbjct  79    VLPFLDQHVNKYGENCWTWFGPVPAINIAEPELIREAFTRMNEFQKTRLNPLIGLLVPGL  138

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
               YE +KW+KHR+++NPAFHMEKLK M+PAF  S  E++   EK + + G +E+DVWP+L
Sbjct  139   VGYEGEKWAKHRKLVNPAFHMEKLKLMIPAFGASVTEIINKWEKIVPESGSSEIDVWPYL  198

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
               +  D ISR AFGS+YEEG++IFEL KEQ Q    L +S+YIPGWR++PT  NR+MK+I
Sbjct  199   MSLSADVISRAAFGSSYEEGKRIFELLKEQTQITLRLFQSVYIPGWRYVPTKTNRKMKEI  258

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKD--FGITTREVIE  788
               Q+Q L+  +I+KR KAMEAGE +KDDLLGIL++SNF   +  G+      ++ +++I+
Sbjct  259   NSQIQNLLTGLINKRKKAMEAGEVAKDDLLGILMDSNFKASQNVGSHKQLLAMSFQDMID  318

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTS LLVWTM+LLG+HQ+WQTRAREEV   FG ++PD DGLNH+K V M
Sbjct  319   ECKLFYFAGQETTSTLLVWTMILLGKHQDWQTRAREEVLATFGNNQPDFDGLNHLKTVAM  378

Query  607   ILNESLRLYTPVISLTRK-NKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             I+ E LRLY  V+S +R  +  ET+LG+L++P G ++S+ ++  H D ++WGDDAKEF P
Sbjct  379   IIYEVLRLYPAVVSASRMVHNRETKLGNLLVPRGAMVSLSILHVHQDPRLWGDDAKEFKP  438

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERFSEG++KATKG ++F PFG GPRIC+G NFA+ EAK+ ++MILQR+SFELSPSY HAP
Sbjct  439   ERFSEGIAKATKGNISFFPFGWGPRICIGQNFAIAEAKMALSMILQRFSFELSPSYTHAP  498

Query  250   TSTVSLQPQYGAPLLFRKL  194
             T+ ++LQPQYGA L+ +++
Sbjct  499   TTVITLQPQYGAHLILQRV  517



>emb|CDP15980.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/495 (57%), Positives = 374/495 (76%), Gaps = 0/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++ NW W +P+KL+K L++QG KGN Y+ +FGDLK ++ + +EA+SKP++LS DI PR+
Sbjct  23    WKLFNWIWLKPKKLEKLLKQQGFKGNPYRLLFGDLKDISNSAREARSKPISLSDDIIPRI  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P F   +Q+ G  +++W GP P + I++P L+R+     T++HKP      +LL  G+A
Sbjct  83    IPEFHKLVQKYGTKTYIWYGPEPAIFIQDPELLREAAQAITVFHKPDAGQFTRLLTPGLA  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +Y  DKW+KHR++INP F+ EKLK M+PAF  S  EM+   E+ +  +G  E+D+WP+LQ
Sbjct  143   SYNGDKWAKHRKLINPVFNGEKLKTMLPAFQTSASEMMRKWEEIVLPKGSCELDIWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
             ++  DAISRTAFGSNYEE RKIFELQ EQ +H  + + S++IPGWRFLPT RNRRM++IE
Sbjct  203   RVTCDAISRTAFGSNYEEARKIFELQGEQLEHCVKAVWSMFIPGWRFLPTKRNRRMRQIE  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V   IR I++ R+KAM AGE   DD LG LLESN  EI KHG+K  G++T+EV+EECK
Sbjct  263   KEVDDSIRRIVNSRLKAMRAGESCDDDFLGRLLESNSQEIHKHGSKGVGMSTQEVVEECK  322

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLL+WTM+LL R+Q WQ RAREEV +LFG +KPD DGLN +K+VTMIL 
Sbjct  323   LFYFAGQETTSVLLLWTMILLSRYQNWQKRAREEVLQLFGTNKPDYDGLNRLKVVTMILY  382

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P+   +R+  EE RLG+L +P G+LI   + L HHD ++WGDD KEF PERFS
Sbjct  383   EVLRLYPPLPVNSRRTAEEARLGNLSIPAGILILKHIALIHHDPELWGDDVKEFKPERFS  442

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +GVS A KGQ  F PFG GPRIC G NF+MLEAK+V+ MILQR+SFE SPSY+HAP S +
Sbjct  443   DGVSNAAKGQAAFFPFGWGPRICTGQNFSMLEAKIVMVMILQRFSFEFSPSYSHAPYSLI  502

Query  238   SLQPQYGAPLLFRKL  194
             +L+PQ+GA L+ +KL
Sbjct  503   TLKPQHGAHLILQKL  517



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/498 (56%), Positives = 374/498 (75%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNW WF P++L+K LR+QG +GN YK + GD K+  K  KEA SKPM+LS DI PR+
Sbjct  21    WKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
               +   +++ +G+NSF+WLGP P V I +P  I+DI  K   + KP  NPL KLLA G+A
Sbjct  81    SSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATGLA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KWSKHRR+INPAF++EKLK M+P F+ SC +++   E+ +   G  E+D WP LQ
Sbjct  141   GYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERMLSSDGSCEIDAWPFLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D I+R+AFGS++EEGR+IF+LQ+EQ +   +++  + IPGWRFLPT  +RRMK+I+
Sbjct  201   NMTSDVIARSAFGSSFEEGRRIFQLQREQTKLALQVILKVQIPGWRFLPTKSHRRMKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG---NKDFGITTREVIE  788
             + ++A ++ +I KR KA++ GE   DDLLGILLESN  EI++H    NK+ G++  +VIE
Sbjct  261   RDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLEDVIE  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWTMVLL R+ +WQ RAREEV ++FG  KP  DGLN +KIVTM
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNQKPSFDGLNRLKIVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             ILNE LRLY P + + R  K + +LG++ LP GV I +P +L HHD + WG+DAK+FNPE
Sbjct  381   ILNEVLRLYPPALGMNRLAKRDLKLGNITLPAGVQIFLPTVLVHHDCEFWGEDAKQFNPE  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGV KATKG+++F PFG GPRIC+G NF++LEAK+ ++MILQ +SFELSP+YAHAP 
Sbjct  441   RFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHAPA  500

Query  247   STVSLQPQYGAPLLFRKL  194
               ++LQPQYGA ++  K+
Sbjct  501   MLITLQPQYGAHIILHKV  518



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/497 (57%), Positives = 376/497 (76%), Gaps = 3/497 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR++NW W RPRK++KC RKQGL G+ Y+ ++GD K++ K TK+AK KPM L+ DI  R
Sbjct  17    MWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAKLKPMKLTDDILTR  76

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LPF+   + + G N F+W+GP P + I EP LIRDI+  N I+ KP   PL++LL  GI
Sbjct  77    VLPFYHYTLNKYGNNCFIWIGPEPRIFIMEPELIRDIVMNNNIFKKPKPTPLVQLLVSGI  136

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             ++YE+ KW+KHR+I+N AF+ EKLK+MVPA + SC +M+   E  + ++  + E+DV P+
Sbjct  137   SSYEDQKWAKHRKILNTAFYTEKLKYMVPAMHKSCEDMMNKWEILICNKNKSCELDVHPY  196

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
              + +  D ISRTAFGS+Y+EG KIF LQKE A+   +  +S+YIPGWRFLPT RNRRMK 
Sbjct  197   FEDLTSDVISRTAFGSSYQEGMKIFHLQKELAELTRQAFQSVYIPGWRFLPTRRNRRMKG  256

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I+ +++  +R I++KR ++M  GE +++DLLGILL+SN NEI+++G K FG+TT EVIEE
Sbjct  257   IDNELKDTLRKIVNKRERSMNLGE-TQEDLLGILLKSNVNEIQQNGTK-FGMTTDEVIEE  314

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQET+S LLVWTMVLL  HQ WQTRAREEV ++F  +KPD +GL  +KIVTMI
Sbjct  315   CKLFYFAGQETSSNLLVWTMVLLSVHQNWQTRAREEVQQVFHNNKPDFEGLKRLKIVTMI  374

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY P     RK  +ET+LG++ +P  V++ IP I  HH+E++WGDD KEF P+R
Sbjct  375   LNEVLRLYPPAPYFLRKANQETKLGNMNIPSEVILMIPTIFIHHNEELWGDDVKEFKPDR  434

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS+G++KATK +L FLPF  GPRIC+G NFAM+E K+ +AMILQR++FELSPSY HAPT 
Sbjct  435   FSQGIAKATKDRLCFLPFSWGPRICIGHNFAMMETKIALAMILQRFAFELSPSYTHAPTY  494

Query  244   TVSLQPQYGAPLLFRKL  194
              V+LQPQ GA L+  KL
Sbjct  495   VVTLQPQCGAHLILNKL  511



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/495 (57%), Positives = 370/495 (75%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             RVLNWAW+RPR L++ LR QGL G  Y+F +GDLK+  + +KEA++KPM LSH+I PRLL
Sbjct  44    RVLNWAWWRPRWLERALRAQGLNGTAYRFPYGDLKENARFSKEARAKPMPLSHNIIPRLL  103

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PF   A+   G+ SF WLGP P V I +P L+R++L+ K   + KP  NPL++  A G+ 
Sbjct  104   PFLNRAMDEYGKISFTWLGPVPQVTITDPELVREVLSNKFGHFGKPNQNPLVRFFARGLF  163

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW KHRRI+NPAFH EKLK M+PAF   C +++   E   G +   E+DVWP LQ
Sbjct  164   VYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACYELDVWPELQ  223

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISRTAFGS+YEEGR IF LQ EQA+   ++++++Y+PG+RFLPT +N+R+K I+
Sbjct  224   SFTGDVISRTAFGSSYEEGRPIFHLQAEQAELLIQVVQNLYVPGYRFLPTPKNKRIKAID  283

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             +++++++R II KR + ++ G+ S DDLLG+L+ESN   +++ GNK+ G+TT +VIEECK
Sbjct  284   REIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKRLQEDGNKNAGMTTEDVIEECK  343

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LL WTM+ L  H  WQ RAREEV R+FG++KPD DGL+H+KIVTMIL 
Sbjct  344   LFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKIVTMILY  403

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PVI L R+  +  +LGD++ PPGVL+ + VI  HHD  +WG DA EFNPERF+
Sbjct  404   EVLRLYPPVIILRRQTYKTMKLGDVVYPPGVLLLLHVIFVHHDPNLWGKDASEFNPERFA  463

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKA+K Q+ F PFGGGPRIC+G NFA+LEAK+ ++MILQ +SF+LSPSYAHAP +  
Sbjct  464   EGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAHAPHTVF  523

Query  238   SLQPQYGAPLLFRKL  194
                PQ+GA +  RKL
Sbjct  524   IHHPQHGAQIRLRKL  538



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 374/498 (75%), Gaps = 2/498 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +W V+   W++P KL++ LR+QGLKG  ++ + G+LK   +  KEA S+PMNLSH+I PR
Sbjct  20    IWSVVYSIWWKPMKLERNLREQGLKGPPHRLLSGNLKDELRMRKEAWSRPMNLSHNIVPR  79

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEG  1325
             ++PF    I+  G+ S  W G  P V I  P LI+DIL+ K   + KP  N LIKLLA G
Sbjct  80    VVPFTHQTIKTYGKMSVTWFGRTPRVNIMHPELIKDILSNKFGHFEKPKLNQLIKLLANG  139

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +A YE +KW+KHRRIINPAFH+EKLK M+PAFY SC E +   EK +  +G  E+DVWP 
Sbjct  140   LANYEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCSETITRWEKLVALKGCCELDVWPE  199

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
              Q + GD ISRTAFGS+Y+EGR+IF+LQ EQA+   +   SIYIPG+  LPT RN RMK+
Sbjct  200   FQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKLVVQAALSIYIPGYSLLPTKRNNRMKE  259

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I+++V+ L+R II+KR KA++ GE S++DLLG+LLESNF EI++H N K+ G+   +VIE
Sbjct  260   IDREVRGLLRGIINKREKAIKLGEASQNDLLGLLLESNFKEIQEHDNAKNLGMNIDDVIE  319

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETT+ LLVWTMV+L  H EWQ R+REEV + FGKDKPD DGLNH+K+VTM
Sbjct  320   ECKLFYFAGQETTANLLVWTMVVLSMHPEWQIRSREEVLQAFGKDKPDFDGLNHLKVVTM  379

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY P + LTR   ++ +LG + LPPGV + +P IL HH  ++WG+DA+EF PE
Sbjct  380   ILYEVLRLYPPAVILTRHTYKKIKLGGIYLPPGVELLLPTILIHHSRELWGEDAQEFKPE  439

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFS GVSKATK Q++F PFG GPRIC+G NFAM EAK+ +A+ILQ++SFELSPSYAHAP 
Sbjct  440   RFSSGVSKATKNQVSFFPFGWGPRICIGQNFAMTEAKMALALILQQFSFELSPSYAHAPY  499

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQYGA ++  KL
Sbjct  500   TIITLQPQYGAQIILHKL  517



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/499 (57%), Positives = 363/499 (73%), Gaps = 2/499 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WR LNW W  P+KL+KCLR+QG  GN Y+   GDLK L   ++EAKSKPMN SHDI+P
Sbjct  23    CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAP  82

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++P     I++ G+NSFVWLGP P V I +P  ++  L+    + KP  NPL+KLL +G
Sbjct  83    RVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDG  142

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +  +E +KW KHR+I+N AFH EKLK MVP  + SC EM+   EK +   G  E+DV P+
Sbjct  143   LINHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDGSCELDVMPY  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRTAFGS YEEG+ IF   KE      +    +YIPG RFLPT  N RMKK
Sbjct  203   LQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMKK  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             I K+++ ++  +IDKR + M+ GE    DDLLGILLESNFNEI++HGN + G++  ++IE
Sbjct  263   ITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLIE  322

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECK+FYF GQETT+VLLVWTM+LLG + +WQ RAR EV ++FG +KPD DGLN +KIVTM
Sbjct  323   ECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNKPDFDGLNRLKIVTM  382

Query  607   ILNESLRLYTPVISLTRK-NKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             ILNE LRLY+P   L+RK  K ET+LG+   P GV++S PVIL H D++IWG+DA EFNP
Sbjct  383   ILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHLDKEIWGEDANEFNP  442

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERF+EGVSKATK Q  F PFG GPRIC+G NFAM+EAK+ +++ILQ +SFELSPSY HAP
Sbjct  443   ERFAEGVSKATKNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQHFSFELSPSYTHAP  502

Query  250   TSTVSLQPQYGAPLLFRKL  194
              S ++ QPQ+GA ++  KL
Sbjct  503   ISILTTQPQHGAHIILHKL  521



>gb|EYU30753.1| hypothetical protein MIMGU_mgv1a004802mg [Erythranthe guttata]
Length=509

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/498 (56%), Positives = 373/498 (75%), Gaps = 7/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHD-ISPR  1502
             W+VLNW WF PR L+K LR+QG  GN YK +FGDLK++    K+  SKP++ S D + PR
Sbjct  16    WKVLNWVWFTPRNLEKRLREQGYNGNSYKILFGDLKEMAFIIKQFNSKPVSFSRDTVVPR  75

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++PF    +++ G  S +W GP P +L  +P ++R++L+K+ ++ +P   PL KLL +G+
Sbjct  76    VIPFISKTVEKYGPKSIMWFGPRPAILCFDPEIVREVLSKSYVFQRPPLTPLTKLLVQGV  135

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEK-KMGDQGLAEVDVWPH  1145
               YE +KW+KHRR++ PAFH +KLK+M+PAFY+SC +ML   E+  + D G  EVDVWP+
Sbjct  136   GAYETEKWAKHRRLVTPAFHPDKLKNMLPAFYLSCNDMLSKWEEIVISDDGSCEVDVWPY  195

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRTAFGS+YEEGR +FELQ+EQ +      +S+YIPGWRFLPT  N+RMK+
Sbjct  196   LQNMSSDVISRTAFGSSYEEGRIVFELQREQTELYGLASQSVYIPGWRFLPTKINKRMKE  255

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             I K+VQ+ +  II+KR++ ME GE + DDLL ILLESN  EI+++GNK +G++  EVIEE
Sbjct  256   IAKEVQSCVLGIINKRMREMETGEANSDDLLSILLESNSKEIQQNGNK-YGMSCEEVIEE  314

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LL WTM+LL +H +WQ+RAR+EV R FG  KP  D LN +KIVTMI
Sbjct  315   CKLFYFAGQETTSALLAWTMILLSKHLDWQSRARDEVLRAFGTRKPTFDELNQLKIVTMI  374

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              +E LRLY PV +LT+  ++ET +G+  +P GV I IP IL H D++IWGDDAKEFNP R
Sbjct  375   FHEVLRLYPPVPTLTKMTQKETSMGEEKIPAGVKIIIPSILIHTDKEIWGDDAKEFNPHR  434

Query  424   FSEGVSKATKGQ-LTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             F+EG S   KGQ L++ PFG GPRIC+G +FAMLEAK+ + MILQR+SF++SPSYAHAP 
Sbjct  435   FNEGFS---KGQILSYFPFGWGPRICIGQSFAMLEAKMALTMILQRFSFDVSPSYAHAPR  491

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQYGA LL +KL
Sbjct  492   TVIALQPQYGAQLLLQKL  509



>ref|XP_008226214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=518

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/497 (55%), Positives = 372/497 (75%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             WRVLNW W RP+KL++ LR+QGL GN YK +FGD K+ +    +A+SKP+ LS  HDI+P
Sbjct  21    WRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESSMMLDQAQSKPIKLSTSHDIAP  80

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++PF    +   G+NSFVW+GP P V I  P  +++I  K+  + +P  NP+I LLA+G
Sbjct  81    RVMPFVHQTVNTYGKNSFVWMGPIPKVNIMNPEDLKEIFNKDQNFRRPSANPMIDLLAQG  140

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +  +E+ KW+KHR+II+PAFH+EKLK M+P FY SC EM+   E+ +  +G  E+DVWP 
Sbjct  141   LLAFEDGKWAKHRKIIHPAFHLEKLKGMLPTFYQSCSEMINEWERLVSKEGSCELDVWPC  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISR AFGS+Y+EGRKIF+L +EQ +     ++S+YIPG RFLPT +N+RMKK
Sbjct  201   LQTLSADMISRAAFGSSYQEGRKIFQLLREQEKFYATAIQSVYIPGSRFLPTKQNKRMKK  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I +++  L++ II+KR +AM+ GE SK DLLGIL+ESN  EI +HGN ++ G++  +VIE
Sbjct  261   IYEEISVLLKGIINKREEAMKLGEASKHDLLGILMESNLKEIREHGNHRNTGMSLEDVIE  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFY  GQETTSVLLVW MVLL ++Q WQ RAREEV ++F  + P  D L+H+K+VTM
Sbjct  321   ECKLFYLAGQETTSVLLVWAMVLLSQNQNWQARAREEVSQVFESNPPTYDTLSHLKVVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             +L E LRLY   + L R ++++T+LG   LP GV +SI ++L HHD+++WG+DA EF PE
Sbjct  381   VLLEVLRLYPAAVELLRTSRKKTQLGKFSLPAGVEVSIHIMLAHHDKELWGEDADEFKPE  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGV+KATK Q  + PFG GPRIC+G NFAMLEAKL +++ILQ ++FELSPSYAHAP 
Sbjct  441   RFSEGVAKATKNQFAYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPSYAHAPL  500

Query  247   STVSLQPQYGAPLLFRK  197
             + ++LQPQYGA ++  K
Sbjct  501   TLITLQPQYGAHIILSK  517



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/495 (55%), Positives = 372/495 (75%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             RVLNWAW+RPR+L++ LR QGL G  Y+F +GD+K++ +  KEA++KPM L+H+I PRLL
Sbjct  28    RVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMPLAHNIIPRLL  87

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PFF  A+   G+ SF W GP P V I +P L+R++L+ K  I+ KP  NPL +  ++G+ 
Sbjct  88    PFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPLSRFFSKGLF  147

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW KHRRI+NPAFH EKLK M+PAF   C +++   E   G +   E+DVWP LQ
Sbjct  148   VYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACYELDVWPELQ  207

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISRTAFGS+YEEGR+IF+LQ EQA+   ++++++Y+PG+RFLPT +N+R+K I+
Sbjct  208   SFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNKRIKAID  267

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             +++++++R II KR + ++ G+ S DDLLG+L+ESN   +++ GNK+ G+TT +VIEECK
Sbjct  268   REIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMTTEDVIEECK  327

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LL WTM+ L  H  WQ RAREEV R+FG++KPD DGL+H+KIVTMIL 
Sbjct  328   LFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKIVTMILY  387

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P I + R+  +  ++GD++ PPGVL+ +  I  HHD  +WG DA EFNPERF+
Sbjct  388   EVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEFNPERFA  447

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKA+K Q+ F PFGGGPRIC+G NF++LEAK+ ++MILQ + F+LSPSYAHAP +  
Sbjct  448   EGVSKASKEQVAFFPFGGGPRICIGQNFSLLEAKMGLSMILQHFYFDLSPSYAHAPRTIF  507

Query  238   SLQPQYGAPLLFRKL  194
             +L PQ GA +  RKL
Sbjct  508   TLFPQRGAQIRLRKL  522



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 377/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++LNWAW +P++++K LRKQG KGN Y+F+FGD+++    +K+AKSKP++   DI+PR+
Sbjct  41    WKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPISFEDDIAPRV  100

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P +   ++  G+  + W+GP PM+ I +P  ++++ TK   + KP +NPL K+L  G+A
Sbjct  101   VPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLA  160

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             ++E +KW+KHR+IINPAFH EKLK M+PAF  SC E++   E  M  +G  E+DVWP++ 
Sbjct  161   SHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIV  220

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGSNYEEG +IF+LQ E A    + ++S+YIPGWR++PT RNRRMK+++
Sbjct  221   NLTSDVISRTAFGSNYEEGIRIFQLQTELADLALQALQSVYIPGWRYVPTKRNRRMKELD  280

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDF-GITTREVIEEC  782
             K+++  +  II KR  AM+ GE +KDDLLG+L+ESN  EI++HGN    GI+  +VI+EC
Sbjct  281   KEIRVRLADIIRKREIAMKTGEAAKDDLLGLLMESNLKEIKEHGNNKLKGISRDDVIDEC  340

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLL+WTMVLL +HQ+WQ  AREEV ++FG  KPD DGLN +KIV MI 
Sbjct  341   KLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVFGDKKPDFDGLNRLKIVQMIF  400

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P+  L+R  ++ET++GDL+LP   +I++  +L HHD+K+WGDDAKEF PERF
Sbjct  401   YEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHHDKKLWGDDAKEFKPERF  460

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+SKATK Q+++ PF  GPRIC+G NFA++EAK+ +AMILQ +SFELS SY HAP + 
Sbjct  461   SEGISKATKNQVSYFPFAWGPRICIGQNFALVEAKMAMAMILQNFSFELSASYVHAPHAF  520

Query  241   VSLQPQYGAPLLFRKL  194
             + LQPQ+GA L+ RKL
Sbjct  521   IFLQPQHGAHLILRKL  536



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/494 (57%), Positives = 380/494 (77%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL G  Y F+FGDLK+ ++   EA SKP+++S DI PRL
Sbjct  22    WRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPISVSDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF+W+GP P V I  P  +++I +K   Y +P +NPL+KLLA+G+A
Sbjct  82    LPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             ++E +KW++HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +      E+D W  LQ
Sbjct  142   SHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVDRSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  + ISRTAFGS++EEG++IFELQ EQAQ     ++S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKSID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  II +R KA+  GE + DDLLG+LLESN  E       + G++  +V+EEC+
Sbjct  262   KEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVMEECR  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV ++FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV  +TRK  +ET+LG L +PP V + +P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++FELSPSYAHAP++ +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQP+YG  ++ RK
Sbjct  495   TLQPRYGVQVILRK  508



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 371/496 (75%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR     W RPR+L++CLR+QGL GN Y+ + GD K+++   KEA S+P+NLS DI PR+
Sbjct  21    WRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSIMLKEANSRPINLSDDIVPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    IQ+ G+NSF W+GP P V I +P LIR++  +   + K   NPL   L  G+ 
Sbjct  81    IPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEAGRFQKQKPNPLANFLLTGLV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE +KW+KHR+++NPAFH+EKLK M PAF++SC +M+  +E+ +  +G  E+DVWP L+
Sbjct  141   SYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMISKMEEMVSPEGSCELDVWPFLK  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DA+SRTAFGS+YEEGR++F+L +EQ     E+ +S+YIPGW +LPT RN+RMKKI+
Sbjct  201   NLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEVFQSVYIPGWWYLPTKRNKRMKKID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K++  L+  II KR KAM+ G+ + +DLLGIL+ESN  EI++ GN K+ GI+ +EVIEEC
Sbjct  261   KEMNTLLNDIITKRDKAMKDGKTANEDLLGILMESNSKEIQEGGNSKNAGISMQEVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LL+WTMVLL +H  WQT AREEVF++FGK+KP+  GL+ +K+VTMI 
Sbjct  321   KLFYLAGQETTSNLLLWTMVLLSKHPNWQTLAREEVFQVFGKNKPEFAGLSRLKVVTMIF  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P  +L R   E+  LG+L LP GV I +P IL HHD +IWGDD KEF PERF
Sbjct  381   YEVLRLYPPGATLNRAVYEDINLGELYLPSGVEIVLPTILVHHDPEIWGDDVKEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV KATKGQ+++ PFG GPRIC+G NFAM EAK+ +AMILQ ++FELSPSY HAPTS 
Sbjct  441   SEGVMKATKGQVSYFPFGWGPRICIGQNFAMAEAKMALAMILQCFTFELSPSYTHAPTSV  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA L+  K+
Sbjct  501   LTLQPQYGAHLILHKI  516



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/495 (56%), Positives = 377/495 (76%), Gaps = 2/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP+KL++ LR+QGL GN Y+F+ GDLK+ T   K+A SKPMNLSHDI+PR+
Sbjct  22    WRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNLSHDIAPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+NSF+W GP P V I  P  ++DILTK   + K  +NP +KLL  G A
Sbjct  82    LPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTKIEDFPKLKSNPYVKLLVTGTA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              Y+ +KW +HRRIINPAFH++KLK M+PAFY+S  EM+   E  +   G  E+DV P L+
Sbjct  142   HYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMIKEWESLVLKAGSCELDVQPCLE  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR+AFGS+Y+EGRKIF+L +EQ Q  +++++++YIPGWRF+PT  N++MK I+
Sbjct  202   NLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQNVYIPGWRFVPTKMNKKMKGID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K++  L+  II+KR + + AGE +KDDLLGIL+ESN  EI++HG NK  G++T +VIEEC
Sbjct  262   KEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKEIKEHGNNKRVGMSTDDVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS+LLVWTMVLLG++Q WQ RAREEV ++FG +KPD DG+ H+K+VTMIL
Sbjct  322   KLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLKVVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   L R   ++T   +  LP GV +++P++L HHD ++WGDDA+EF PERF
Sbjct  382   HEVLRLY-PAPLLVRTTDKKTEFRNFSLPAGVEVALPMLLIHHDRELWGDDAQEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+K TK + T+ PF GGPR+C+G NFAM+EAKL I++ILQ ++FELSPSYAHAP++ 
Sbjct  441   SEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYAHAPSAK  500

Query  241   VSLQPQYGAPLLFRK  197
             + L PQ+GA ++  K
Sbjct  501   LMLHPQFGAHIILHK  515



>ref|XP_010060779.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Eucalyptus 
grandis]
Length=510

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/494 (58%), Positives = 379/494 (77%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+N  W RP++L++ LR+QGL G  Y F+FGDLK+ ++  KEA SKP+ +  DI PRL
Sbjct  22    WRVVNSVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLKEAYSKPITIFDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF+W+GP P V I  P  +++I +K   Y +P +NPL+KLLA+G+ 
Sbjct  82    LPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLADGLT  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             ++E +KW++HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +  +   E+D W  LQ
Sbjct  142   SHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + G+ ISRTAFGS++EEG++IFELQ EQAQ     ++S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKSID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  I+ +R KA+  GE + DDLLG+LLESN  E       + G++  +VIEECK
Sbjct  262   KEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV ++FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV  L RK   ET+LG L +PPGV +S+P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++F+LSPSYAHAP++ +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFDLSPSYAHAPSNVI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQP+YG  ++ RK
Sbjct  495   TLQPRYGVQVILRK  508



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/495 (57%), Positives = 376/495 (76%), Gaps = 2/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP+KL++ LR+QGL GN Y+F+ GDLK+ T   K+A SKPMNLSHDI+PR+
Sbjct  22    WRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNLSHDIAPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+NSF+W GP P V I  P  ++DILTK   + K  +NP +KLL  G A
Sbjct  82    LPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTKIEDFPKLKSNPYVKLLVTGTA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW +HRRIINPAFH++KLK M+PAFY+S  EM+   E  +  +G  E+DV P L+
Sbjct  142   HYEGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSSEMIKEWESLVLKEGSCELDVRPCLE  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR+AFGS+Y+EGRKIF+L +EQ Q  T++++++YIPGWRF+PT  N++MK I+
Sbjct  202   NLTADMISRSAFGSSYKEGRKIFQLLREQLQLVTKVIQNVYIPGWRFVPTKMNKKMKGID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K++  L+  II+KR + + AGE +KDDLLGIL+ESN  EI++HG NK  G+   +VIEEC
Sbjct  262   KEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKEIKEHGNNKGVGMXMYDVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS+LLVWTMVLLG++Q WQ RAREEV ++FG +KPD DG+ H+K+VTMIL
Sbjct  322   KLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLKVVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   L R   ++T   +  LP GV +++P++L HHD ++WGDDA+EF PERF
Sbjct  382   HEVLRLY-PAPLLVRTTSKKTEFRNFSLPAGVEVALPMLLIHHDRELWGDDAQEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+K TK + T+ PF GGPR+C+G NFAM+EAKL I++ILQ ++FELSPSYAHAP++ 
Sbjct  441   SEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYAHAPSAK  500

Query  241   VSLQPQYGAPLLFRK  197
             + L PQ+GA ++  K
Sbjct  501   LILHPQFGAHIILHK  515



>gb|AJD25172.1| cytochrome P450 CYP72A331 [Salvia miltiorrhiza]
Length=516

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/496 (57%), Positives = 372/496 (75%), Gaps = 4/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+ L   WF PRKL+K LR++G  GN Y+F+ GD KQ+    K+A SKP+  S+DI+PR+
Sbjct  23    WKFLTRVWFEPRKLEKRLRQEGFSGNSYRFMIGDSKQIA-AAKQANSKPIAFSNDIAPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF   ++ + GEN F+W G  P ++I +  + ++IL+KN ++ K  T PL KLLA+G+A
Sbjct  82    IPFIHHSLLKYGENCFIWYGSKPTIVILDQEMTKEILSKNYVFQKTST-PLDKLLAQGVA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             TYE DKW+KHRR++NPAFH+EKLK M+P FY+SC EML  LEK +  +G+ EVDVWPHLQ
Sbjct  141   TYEADKWAKHRRLLNPAFHLEKLKLMLPLFYLSCGEMLSKLEKIIPSEGVCEVDVWPHLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGSNYEEG KIFEL KEQ     +  + +YIPGWRFLPT  N+RMK+I 
Sbjct  201   ALTSDVISRTAFGSNYEEGGKIFELLKEQGALLFKAFQMLYIPGWRFLPTRTNKRMKEIA  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKD-DLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              +V +L+  II+KR++ +EAGE ++  DLLGILLESNF EI+K+G    G++ REVI+EC
Sbjct  261   MEVDSLVLGIINKRMQMIEAGEVTESSDLLGILLESNFKEIQKNGEY-LGMSLREVIDEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVWTM+LL +H +WQ RAR+EV ++ G  +PD   L+ ++IVTMI 
Sbjct  320   KLFYLAGQETTSALLVWTMILLSKHPDWQARARDEVLQVLGSHEPDFQELSRLQIVTMIF  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E +RLY     L R   +ET LG++ LP GV + +P +L  HD KIWG+DAKEFNPERF
Sbjct  380   HEVMRLYPGAAILRRTIHKETTLGNVSLPAGVNLFLPTLLLQHDCKIWGEDAKEFNPERF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
              EGVSKAT+GQL + PFGGGPRIC+G NFAML+AK+ +A+IL+ YSFELSPSYAHAP   
Sbjct  440   REGVSKATRGQLXYYPFGGGPRICIGQNFAMLQAKMALALILKHYSFELSPSYAHAPYLV  499

Query  241   VSLQPQYGAPLLFRKL  194
             +S+QPQYGAPL+  +L
Sbjct  500   LSVQPQYGAPLIIHRL  515



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 378/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+L+W W RP++L++CLRKQGL GN Y+F+ GD+K+    +++A+SKPM LS DI+  +
Sbjct  23    WRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSRQARSKPMPLSDDITQYV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF    ++ +G++SF W+GP P V I EP  IR+I TK   + KP +NPL+ LL  G+ 
Sbjct  83    GPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDFQKPHSNPLVSLLVSGLV  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + ++W+KHR+IINPAFH +KLK+M+PAFY SC+EM+   EK +  +G +E+DVWP+L 
Sbjct  143   NLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEKLVFLEGSSELDVWPYLV  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
             ++  D ISR AFGS+YEEGR+IF+L ++Q     ++++S YIPGWR+LPT  NR+MK I 
Sbjct  203   KLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYIPGWRYLPTKTNRKMKVIA  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K ++  ++ +I KR +A +A E S DDLLGIL+ESN  EI++ G+ K+ G++  +VIEEC
Sbjct  263   KDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEQGDHKNMGMSIEDVIEEC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTM+LL RH  WQT+AREEV  +FG  KPD DGLN +K+VTMIL
Sbjct  323   KLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVFGDSKPDSDGLNRLKVVTMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY   ++L R   ++T+LG L+LP G  I++PV+L HHD+++WGDDA EFNP+RF
Sbjct  383   YEVLRLYPAGVALGRSVPKDTKLGKLLLPAGAEITLPVLLIHHDQELWGDDAHEFNPDRF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATK Q+ + PFG GPRIC+G NFA++EAK+ +AMIL+++ FELSPSYAH+P + 
Sbjct  443   SEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPSYAHSPCTF  502

Query  241   VSLQPQYGAPLLFRKL  194
             ++L+PQ+GA ++  KL
Sbjct  503   ITLRPQHGAHIILHKL  518



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/496 (55%), Positives = 375/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++L+W W RP+KL+K LR+QGLKGN Y+ + GD+K+  K+  +A+SKPMNLS DI  R+
Sbjct  21    WKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFKSEMKARSKPMNLSDDIVSRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              P+    + ++G+NSF+W GP P V++ +P L++D+  K   + KP +NPLI+LLA G+ 
Sbjct  81    FPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNKMYDFQKPNSNPLIRLLATGLI  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             T+EE+KW  HR+IINPAFH+EKLK M+P  + SC +M+   E+ +   G  E+DVWP +Q
Sbjct  141   THEEEKWRMHRKIINPAFHLEKLKMMLPVIFESCNDMINKWERMLSSDGSCEIDVWPSIQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D I+RTAFGS+YEEG +IF+LQKEQA+   E++  +YIPGWRFLPT  NRR+K+I+
Sbjct  201   NLASDVIARTAFGSSYEEGIRIFQLQKEQAEITMEILMKVYIPGWRFLPTTTNRRLKEID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNF-NEIEKHGNKDFGITTREVIEEC  782
             + + A +  II+KR  A++AGE  K+DLLGILLESN     E + NK+ G+   +VI+EC
Sbjct  261   RVIIASLTKIINKRENAIKAGETPKNDLLGILLESNHKEIKENNNNKNVGMNIDDVIKEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  G+ETTSVLLVWTM+LL RH  WQ RAREEV ++FG  KPD DGL+H+KI+TMIL
Sbjct  321   KLFYLAGEETTSVLLVWTMILLSRHPNWQARAREEVLQVFGNKKPDFDGLSHLKIITMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P+I L R  ++  R+G+L LP GV I +P++  HH+ ++WGDDAK FNPERF
Sbjct  381   YEVLRLYPPLIVLPRAVQKNVRVGNLTLPAGVQIGLPIVWLHHECELWGDDAKVFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+ KAT G+++F PFG GPRIC+G NF++LEAK+ IA+ILQ +SFELSP+YAHAP   
Sbjct  441   SEGILKATNGKISFFPFGWGPRICIGQNFSLLEAKMAIALILQHFSFELSPTYAHAPAMI  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA ++ RKL
Sbjct  501   ITLQPQHGAHIILRKL  516



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/495 (56%), Positives = 376/495 (76%), Gaps = 2/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP+KL++ LR+QGL GN Y+F+ GDL + T   K+A SKPMNLSHDI+PR+
Sbjct  22    WRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERTMMLKQAYSKPMNLSHDIAPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   ++   G+NSF+W GP P V I  P  ++DILTK   + K  +NP +KLL  G A
Sbjct  82    LPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTKIEDFPKLKSNPYVKLLVTGTA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              Y+ +KW +HRRIINPAFH++KLK M+PAFY+S  EM+   E  +   G  E+DV P L+
Sbjct  142   HYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMIKEWESLVLKAGSCELDVQPCLE  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR+AFGS+Y+EGRKIF+L +EQ Q  +++++++YIPGWRF+PT  N++MK I+
Sbjct  202   NLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQNVYIPGWRFVPTKMNKKMKGID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K++  L+  II+KR + + AGE +KDDLLGIL+ESN  EI++HG NK  G++T +VIEEC
Sbjct  262   KEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKEIKEHGNNKRVGMSTDDVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS+LLVWTMVLLG++Q WQ RAREEV ++FG +KPD DG+ H+K+VTMIL
Sbjct  322   KLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLKVVTMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   L R   ++T   +  LP GV +++P++L HHD ++WGDDA+EF PERF
Sbjct  382   HEVLRLY-PAPLLVRTTDKKTEFRNFSLPAGVEVALPMLLIHHDRELWGDDAQEFKPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+K TK + T+ PF GGPR+C+G NFAM+EAKL I++ILQ ++FELSPSYAHAP++ 
Sbjct  441   SEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYAHAPSAK  500

Query  241   VSLQPQYGAPLLFRK  197
             + L PQ+GA ++  K
Sbjct  501   LMLHPQFGAHIILHK  515



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/495 (56%), Positives = 381/495 (77%), Gaps = 2/495 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP+KL++ LR+QGL GN Y+F  GD+K+++ TT++A SKPM+LSH I+PR+
Sbjct  21    WRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMSLSHYIAPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    +    +NSFVW+G  P V+I  P  ++ ILTK   + +P  NPL+KLLA GIA
Sbjct  81    IPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLATGIA  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KH+RIINP FH+EKLK M+PAFY SC EM+   E  +  +G  E+DV P L+
Sbjct  141   LYEGEKWAKHQRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKEGSCELDVRPCLE  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR+AFGS+Y+EGRKIF+L +EQAQ  T++++++YIPGWRF+PT  N++MK I+
Sbjct  201   NLTADMISRSAFGSSYKEGRKIFQLLREQAQLVTKVIQNVYIPGWRFVPTKMNKKMKGID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+++ L+  II+KR + + AGE +KDDLLG L+ESN  EI++HGN K  G++  +VIEEC
Sbjct  261   KEIRGLLMGIINKREEGIRAGEATKDDLLGNLMESNLKEIKEHGNDKTVGMSMDDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS+LLVWTMVLLG++Q WQ RAREEV ++FG +KPD DG+ H+K+VTMIL
Sbjct  321   KLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLKVVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY P   L R   + T L +  LP GV +++P++L HHD ++WGDDA+EF PERF
Sbjct  381   HEVLRLY-PSPLLVRTTSKTTELRNFSLPAGVEVALPLLLIHHDRELWGDDAQEFKPERF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGV+K TK + T+ PF GGPR+C+G NFAM+EAKL I++ILQ ++FELSPSYAHAP++ 
Sbjct  440   SEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYAHAPSAK  499

Query  241   VSLQPQYGAPLLFRK  197
             ++L PQ+GA ++  K
Sbjct  500   INLHPQFGAHIILHK  514



>ref|XP_008386384.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=511

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/497 (56%), Positives = 363/497 (73%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+V+NW W +P+K ++ LR+QGL GN Y+ + GDL   +K TK A SKPM LSHDI P +
Sbjct  15    WKVVNWIWLKPKKFERHLRQQGLSGNSYRLLIGDLNDNSKMTKAALSKPMELSHDIVPYV  74

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LP   D   + G  SFVWLGP P V++ +  L+R+  TK  +Y KP +NPLI LLA G+ 
Sbjct  75    LPLLHDIFNKYGRKSFVWLGPMPSVILFDAELMREAFTKYRVYEKPHSNPLISLLATGLV  134

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E DKW KHRRIINPAFH+EK+K M+PAF+ +   ML   E     +G  EVDVWP+L 
Sbjct  135   GHEGDKWVKHRRIINPAFHVEKMKDMLPAFHAASENMLSKWEMLFSSKGTCEVDVWPYLC  194

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISR AFG N+EEG++ F+LQKEQA     ++ S+YIP +RFLPT  NRRMK+I 
Sbjct  195   AFAGDVISRAAFGCNFEEGQRFFQLQKEQAAFIRIVLDSVYIPFFRFLPTKMNRRMKQIA  254

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K++  L+R II+KR KAM AGE ++DDLLGILL+SNFNEI++H N KD G++  EVIEEC
Sbjct  255   KEMDTLLRGIINKREKAMRAGEATEDDLLGILLKSNFNEIQEHANDKDVGMSIEEVIEEC  314

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  G+ETT  L+ WT+VLLG++Q+WQ RAREEV  +F  +KPD  GL  +KIV MIL
Sbjct  315   KLFYLAGEETTRDLINWTLVLLGKYQDWQMRAREEVVTIFKNNKPDYAGLKCLKIVNMIL  374

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY  V    R+  +ET+LGD+ LPPG  +++P++  HHD++IWGDD  EF PERF
Sbjct  375   YEVLRLYPSVSFTIREITKETKLGDISLPPGTQLAVPILFVHHDKEIWGDDVHEFKPERF  434

Query  421   SEGVSKATKGQL-TFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             SEG+SKATK Q+  F PF  GPR C+G NFAM+E K +I MILQR++FELSP+Y H+P++
Sbjct  435   SEGISKATKNQVAAFFPFSTGPRTCIGQNFAMIEVKTIITMILQRFTFELSPAYRHSPSN  494

Query  244   TVSLQPQYGAPLLFRKL  194
              ++L+PQYG P++F+K+
Sbjct  495   ILTLEPQYGTPIIFQKI  511



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 382/497 (77%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             WRVLNW W RP KL++CLR+QGL GN Y+ +FGD K+++   ++A+SKP+ LS  HDI+P
Sbjct  24    WRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKPIKLSTTHDIAP  83

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++PF    +   G NSFVW+GP P V I  P  ++D   K+  + +  +NP++K +++G
Sbjct  84    RVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEFQRAISNPIVKSISQG  143

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +++ E +KW+KHR+IINPAFH+EKLK M+P FY SC EM+   E  +  +G  E+DVWP+
Sbjct  144   LSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMINKWESLVFKEGSREMDVWPY  203

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+ +  D ISR AFGS+YEEGRKIF+L +E+A+  T   RS+YIPGWRFLPT +N+RMK+
Sbjct  204   LENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAARSVYIPGWRFLPTKQNKRMKE  263

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I K+V+ L++ II+KR  A++AGE +K +LLGIL+ESNF EI++HGN K+ G++  +VI 
Sbjct  264   IHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESNFREIQEHGNNKNAGMSIEDVIG  323

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWT+VLL ++Q+WQ RAREEV ++FG + P  D L+H+K+VTM
Sbjct  324   ECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARAREEVLQVFGTNIPTYDQLSHLKVVTM  383

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY  V+ L R   ++T+LG  +LP GV +S+ ++L HHD+++WG+DAKEF PE
Sbjct  384   ILLEVLRLYPAVVELPRTTYKKTQLGKFLLPAGVEVSLHIMLAHHDKELWGEDAKEFKPE  443

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGVSKATK Q T+ PFG GPRIC+G NFAMLEAKL +++ILQ ++FELSPSYAHAP+
Sbjct  444   RFSEGVSKATKNQFTYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPSYAHAPS  503

Query  247   STVSLQPQYGAPLLFRK  197
              T++L PQ+GA  +  K
Sbjct  504   VTITLHPQFGAHFILHK  520



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 376/496 (76%), Gaps = 3/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+++N+ WFRP+K++K LR+QG  G  Y+F+ GDL ++     EA SKP++ S D  PR+
Sbjct  21    WKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKNMGNEALSKPIDFSDDFVPRI  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +PF    +  +GEN F+WLGP P VLI +P ++R++L+K  ++ KP+ NPL  +LA G+A
Sbjct  81    IPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKTYVFQKPY-NPLANVLARGLA  139

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW+KHRR+INPAFH++K+KHM+P+F+  C EML   EK +  +G  E+DVWP+LQ
Sbjct  140   SYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCAEMLSKWEKIVPSEGCFELDVWPYLQ  199

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTEL-MRSIYIPGWRFLPTWRNRRMKKI  962
              +  DAIS TAFG++YE+GRKIFELQKEQA   T+  + S +I  WR+LPT  NRRMK+I
Sbjct  200   TMTSDAISLTAFGTSYEQGRKIFELQKEQATLITKSNLFSTFILAWRYLPTKTNRRMKRI  259

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
               ++++L+R IID+R KA+EAGE + +DLL ILLESN  EI+++G+K FG++ ++VIEEC
Sbjct  260   ITELESLLRAIIDQRTKAIEAGEATSNDLLDILLESNSKEIKQNGHK-FGMSLQDVIEEC  318

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETTS LLVWTM+LL ++ +WQ RAREEV  +F  + P+   L  +KIV+MI+
Sbjct  319   KLFYLAGQETTSSLLVWTMILLSKYLDWQARAREEVLHVFRSETPNFQDLGRLKIVSMII  378

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY+P +  +R   +ET LG+++LP G  + +P IL HHD K+WG+D K+FNPERF
Sbjct  379   NEVLRLYSPGLLFSRTVNKETALGNIVLPKGAYLLLPAILLHHDVKLWGEDVKDFNPERF  438

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S GV++AT G+L++ PFG GPRIC+  NFAMLEAK  +AMIL+ YSFELSPSY+HAP   
Sbjct  439   SGGVTEATGGKLSYFPFGWGPRICIAQNFAMLEAKTALAMILRNYSFELSPSYSHAPRIA  498

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQ+GA L+ RKL
Sbjct  499   LNLQPQHGAHLILRKL  514



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/499 (57%), Positives = 362/499 (73%), Gaps = 2/499 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WR LNW W  P+KL+KCLR+QG  GN Y+   GDLK L   ++EAKSKPMN SHDI+P
Sbjct  89    CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAP  148

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++P     I++ G+NSFVWLGP P V I +P  ++  L+    + KP  NPL+KLL +G
Sbjct  149   RVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDG  208

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +  +E +KW KHR+I+N AFH EKLK MVP  + SC EM+   EK +   G  E+DV P+
Sbjct  209   LINHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDGSCELDVMPY  268

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRTAFGS YEEG+ IF   KE      +    +YIPG RFLPT  N RMKK
Sbjct  269   LQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMKK  328

Query  964   IEKQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             I K+++ ++  +IDKR + M+ GE    DDLLGILLESNFNEI++HGN + G++  ++IE
Sbjct  329   ITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLIE  388

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECK+FYF GQETT+VLLVWTM+LLG + +WQ RAR EV ++FG +KPD DGLN +KIVTM
Sbjct  389   ECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNKPDFDGLNRLKIVTM  448

Query  607   ILNESLRLYTPVISLTRK-NKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             ILNE LRLY+P   L+RK  K ET+LG+   P GV++S PVIL H D++IWG+DA EFNP
Sbjct  449   ILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHLDKEIWGEDANEFNP  508

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERF+EGVSKAT  Q  F PFG GPRIC+G NFAM+EAK+ +++ILQ +SFELSPSY HAP
Sbjct  509   ERFAEGVSKATXNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQHFSFELSPSYTHAP  568

Query  250   TSTVSLQPQYGAPLLFRKL  194
              S ++ QPQ+GA ++  KL
Sbjct  569   ISILTTQPQHGAHIILHKL  587



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 382/497 (77%), Gaps = 3/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             WRVLNW W RP KL++CLR+QGL GN Y+ +FGD K+++   ++A+SKP+ LS  HDI+P
Sbjct  25    WRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKPIKLSTTHDIAP  84

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++PF    +   G NSFVW+GP P V I  P  ++D   K+  + +  +NP++K +++G
Sbjct  85    RVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEFQRAISNPIVKSISQG  144

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +++ E +KW+KHR+IINPAFH+EKLK M+P FY SC EM+   E  +  +G  E+DVWP+
Sbjct  145   LSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMINKWESLVFKEGSREMDVWPY  204

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+ +  D ISR AFGS+YEEGRKIF+L +E+A+  T   RS+YIPGWRFLPT +N+RMK+
Sbjct  205   LENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAARSVYIPGWRFLPTKQNKRMKE  264

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I K+V+ L++ II+KR  A++AGE +K +LLGIL+ESNF EI++HGN K+ G++  +VI 
Sbjct  265   IHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESNFREIQEHGNNKNAGMSIEDVIG  324

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWT+VLL ++Q+WQ RAREEV ++FG + P  D L+H+K+VTM
Sbjct  325   ECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARAREEVLQVFGTNIPTYDQLSHLKVVTM  384

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY  V+ L R   ++T+LG  +LP GV +S+ ++L HHD+++WG+DAKEF PE
Sbjct  385   ILLEVLRLYPAVVELPRTTYKKTQLGKFLLPAGVEVSLHIMLAHHDKELWGEDAKEFKPE  444

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGVSKATK Q T+ PFG GPRIC+G NFAMLEAKL +++ILQ ++FELSPSYAHAP+
Sbjct  445   RFSEGVSKATKNQFTYFPFGAGPRICIGQNFAMLEAKLALSLILQHFTFELSPSYAHAPS  504

Query  247   STVSLQPQYGAPLLFRK  197
              T++L PQ+GA  +  K
Sbjct  505   VTITLHPQFGAHFILHK  521



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/496 (56%), Positives = 363/496 (73%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++++W WFRP+KL+K LR+QG  GN Y+ + GDLK+     KEA SKPMN S+ I+PR+
Sbjct  29    WKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMNFSNHIAPRV  88

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P     IQ  G+NSF+WLGP P V I +P  I+ + +    + KP  NPL +LL +GIA
Sbjct  89    IPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFSFINDFQKPTMNPLTRLLVQGIA  148

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E +KW+KHR+IINPAFH+EKLK MVPAFY SC EM+   E  +  +G  E+DV P L+
Sbjct  149   NLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSREGSCELDVMPCLK  208

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YE+G KIF+LQ E      +    IYIPGW FLPT  NR+MK+I 
Sbjct  209   NMASDVISRTAFGSSYEKGXKIFKLQTELGNLVIQASLGIYIPGWSFLPTKSNRKMKEIS  268

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
             K++  LI  I+++R K+M AGE  + DLL IL+ESN NEI++HG NKD G++  EVIEEC
Sbjct  269   KEITTLILGIMNEREKSMNAGEAIQTDLLSILMESNMNEIKQHGNNKDIGMSIEEVIEEC  328

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETT+ LLVWTMVLL  + EWQ RAR EVF +FG  KP+ DGLN +K+VTMI 
Sbjct  329   KLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGNKKPNYDGLNRLKVVTMIF  388

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY PV    R  ++ET+LG+L LP GV++ +P++L   D ++WG+DA EFNPERF
Sbjct  389   NEVLRLYPPVSIFGRIVRKETKLGNLTLPKGVMLGLPIVLIQRDPELWGEDAHEFNPERF  448

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSKATK    F+PFG GPRIC+GLNF M+EAK+ ++MILQR+SFELSPSY H+P+++
Sbjct  449   SEGVSKATKNPCAFIPFGWGPRICIGLNFTMIEAKMTLSMILQRFSFELSPSYTHSPSAS  508

Query  241   VSLQPQYGAPLLFRKL  194
             ++ QPQ+GA ++  KL
Sbjct  509   LTTQPQHGAHIILHKL  524



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/496 (56%), Positives = 378/496 (76%), Gaps = 2/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+VL+  W RP+KL+K LR+QG +GN Y+ + GD+K L K  KEAKSK MNLS DI+PR+
Sbjct  20    WKVLSLLWLRPKKLEKLLREQGFQGNSYRILLGDIKDLFKMEKEAKSKSMNLSDDITPRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P+   +++ +G+NS++W G  P V + EP  I+D+L K + + KP    + KLLA  +A
Sbjct  80    IPYIQHSVKIHGKNSYIWFGIKPRVTLTEPEQIKDVLNKMSEFPKP-NYKIFKLLANALA  138

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KWSKHR++INPAFH+EKLK M PAF+ SC +++   EK +   G  E+D+WP LQ
Sbjct  139   NYEGEKWSKHRKLINPAFHLEKLKIMTPAFFTSCNDLINKWEKMLSSDGSCEIDIWPSLQ  198

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS+YEEG++IF+LQ+EQA+   +++    IP W FLPT  +R+M KI+
Sbjct  199   NLASDAISRTAFGSSYEEGKRIFQLQREQAELIVKVVTKSIIPLWMFLPTIVHRKMNKID  258

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEI-EKHGNKDFGITTREVIEEC  782
             K++ + ++ +I+KR KA++AGE +++DLL ILLESN  EI E   NKD G++  +V+EEC
Sbjct  259   KEITSSLKDMINKREKALKAGEPTRNDLLSILLESNRKEIDENENNKDVGMSLDDVVEEC  318

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLF+F GQETTSVLLVWTM+LL R+ +WQTRAREEV  +FG  KPD DGLN++KIVTMIL
Sbjct  319   KLFHFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLHVFGNRKPDFDGLNNLKIVTMIL  378

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PVI L R  +++ +LG+L LP GV I +P++L HHD ++WGDDAK FNPERF
Sbjct  379   YEVLRLYPPVIGLARNVEKDVKLGNLTLPAGVEIFLPILLIHHDCELWGDDAKMFNPERF  438

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
               G+SKAT G+++F PFG GPRIC+G NF+++EAK+ + +ILQ +SFELSP+YAHAP+S 
Sbjct  439   FGGISKATNGRVSFFPFGWGPRICIGQNFSLMEAKMAMTLILQHFSFELSPTYAHAPSSM  498

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGA ++ RKL
Sbjct  499   ITLQPQYGAHIIIRKL  514



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/494 (58%), Positives = 372/494 (75%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR +NW W RP++L++ LR+QGL G  Y F+ GDLK+  +  KEAKSKP+ +S DI PRL
Sbjct  22    WRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKSKPIAVSDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF W+GP P V I  P  I+++ +K   Y KP +NPL+KLLA+G+A
Sbjct  82    LPFLHQSFQTYGKDSFTWMGPTPRVNITNPEQIKEVFSKIYDYPKPASNPLVKLLADGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E +KW++HR+IINPAFHMEKLK M+PAFY+SC EM+   EK + ++   EVD W  LQ
Sbjct  142   NHEGEKWARHRKIINPAFHMEKLKLMLPAFYLSCTEMVDRWEKSVLEERSCEVDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS++EEG++IFELQ+EQA    + ++S+YIPGWRF+PT  NRRMK I 
Sbjct  202   NLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTKMNRRMKNIN  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+VQA++  II +RVKA+ AG+ + DDLLG+LLESN  E       D G++  +VIEECK
Sbjct  262   KEVQAVLMDIIRRRVKAIRAGDAAGDDLLGLLLESNMKE-------DVGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV + FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSRKPDFDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P I + RK  +ET+LG L LP GV +S+  +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPAIVMARKVPKETKLGKLTLPAGVQLSMSTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVS ATK Q+ F PFG GPR C+G NFAM+EAK+ +AMILQ+++FELSPSYAHAP +  
Sbjct  435   EGVSNATKNQVCFFPFGWGPRTCVGQNFAMIEAKMALAMILQQFTFELSPSYAHAPLTIF  494

Query  238   SLQPQYGAPLLFRK  197
             +LQPQYG  ++  K
Sbjct  495   TLQPQYGVQVILHK  508



>ref|XP_009394216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/495 (55%), Positives = 369/495 (75%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             RVLNWAW+RPR L++ LR  GL G  Y+F +GDLK+  + +KEA++KPM L+H+I PRLL
Sbjct  28    RVLNWAWWRPRWLERALRAHGLNGTAYRFPYGDLKENARFSKEARAKPMPLAHNIIPRLL  87

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PF   A+   G+ SF W GP P V I +P L+R++L+ K  I+ KP  NPL +  ++G+ 
Sbjct  88    PFLNRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPLSRFFSKGLF  147

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW KHRRI+NPAFH EKLK M+PAF   C +++   E   G +   E+DVWP LQ
Sbjct  148   VYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACYELDVWPELQ  207

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISRTAFGS+YEEGR+IF+LQ EQA+   ++++++Y+PG+RFLPT +N+R+K I+
Sbjct  208   SFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNKRIKAID  267

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             +++++++R II KR + ++ G+ S DDLLG+L+ESN   +++ GNK+ G+TT +VIEECK
Sbjct  268   REIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMTTEDVIEECK  327

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTS LL WTM+ L  H  WQ RAREEV R+FG++KPD DGL+H+KIVTMIL 
Sbjct  328   LFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKIVTMILY  387

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P I + R+  +  ++GD++ PPGVL+ +  I  HHD  +WG DA EFNPERF+
Sbjct  388   EVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEFNPERFA  447

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKA+K Q+ F PFGGGPRIC+G NF++LEAK+ ++MILQ + F+LSPSYAHAP +  
Sbjct  448   EGVSKASKEQVAFFPFGGGPRICIGQNFSLLEAKMGLSMILQHFYFDLSPSYAHAPRTIF  507

Query  238   SLQPQYGAPLLFRKL  194
             +L PQ GA +  RKL
Sbjct  508   TLFPQRGAQIRLRKL  522



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/499 (57%), Positives = 363/499 (73%), Gaps = 2/499 (0%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C WR LNW W  P+KL+KCLR+QG  GN Y+   GDL  +    +EAKSKPMN SHDI P
Sbjct  19    CGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVAMEEEAKSKPMNFSHDIVP  78

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++P     I++ G+NSF+WLGPNP VLI +P  ++  L+    + KP TNPL++LL +G
Sbjct  79    RVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSLYNDFQKPTTNPLVRLLFDG  138

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +  +E +KW KHR+IIN AFH EKLK MVP  + SC EM+   EK     G  E+DV P+
Sbjct  139   LINHEGEKWVKHRKIINHAFHFEKLKDMVPTMFESCNEMISKWEKMTSKDGSCELDVVPY  198

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRTAFGS YEEG+ IF   KE  +   +   ++Y+PGWRFLPT  N RMKK
Sbjct  199   LQSLTADVISRTAFGSTYEEGKIIFNHFKELIRLVLQASNTVYLPGWRFLPTKSNNRMKK  258

Query  964   IEKQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             I K+++ ++  IIDKR + M+  E    DDLLGILLESN NEI++HGN + G++  ++IE
Sbjct  259   ITKEIKTILMNIIDKRQRTMKEDETMHSDDLLGILLESNSNEIKEHGNVNIGMSINDLIE  318

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECK+FYF GQETT+VLLVWTMVLLG + +WQ RAR EV ++FG DKPD DGLN +KIVTM
Sbjct  319   ECKIFYFAGQETTAVLLVWTMVLLGSYTKWQDRARAEVLQVFGNDKPDFDGLNRLKIVTM  378

Query  607   ILNESLRLYTPVISLTRK-NKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNP  431
             ILNE LRLY P  +++R   K+ETRLG+L    GV +S P+IL H D+++WG+DA EFNP
Sbjct  379   ILNEVLRLYPPGSAVSRNLVKKETRLGNLKFSSGVTLSFPIILIHRDKELWGEDADEFNP  438

Query  430   ERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAP  251
             ERF+EGVSKATK Q  F PFG GPRIC+G NFAM+EAK+ +++ILQ +SFELSPSY HAP
Sbjct  439   ERFAEGVSKATKNQTAFFPFGWGPRICVGQNFAMIEAKIALSIILQHFSFELSPSYTHAP  498

Query  250   TSTVSLQPQYGAPLLFRKL  194
              S +++QPQ+GA ++  KL
Sbjct  499   ISILTIQPQHGAHIILHKL  517



>emb|CDX97592.1| BnaA05g24870D [Brassica napus]
Length=512

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 373/497 (75%), Gaps = 6/497 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             LWR LNW WF+P+KL+  LR+QGL G+ Y  + GDLK+     KEA+SKP+ L+ DI+PR
Sbjct  21    LWRTLNWVWFKPKKLESYLRRQGLSGSPYTPLVGDLKRNFSLLKEARSKPIKLTDDITPR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             L+P+ +  ++ +G   F WLGP P + I +P  I+++  K   + K  T PL +L+  G+
Sbjct  81    LVPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNKVYDFPKTHTFPLARLIGTGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             A+Y+ DKW+KHRRIINPAFH+EK+K+MVPAF+ SC E++G  +K + D+GL+ EVDVWP 
Sbjct  141   ASYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGEWDKLVSDKGLSCEVDVWPG  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L  +  D ISRTAFGS+Y+EG++IFELQ E AQ   +  R   IPG+R+LPT  NR MK 
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYRYLPTKENRMMKA  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
               ++VQ ++R I++KR++A EAGE   DDLLGILLESN  +++  GN   G++T +VIEE
Sbjct  261   KAREVQDILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVK--GN---GMSTEDVIEE  315

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTMVLL +HQ+WQ +AREEV ++FG   PDIDGLN +K++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPDIDGLNQLKVMTMI  375

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY PV  ++R   +E +LGDL LP GV IS+P++L  HD ++WGDDA EF PER
Sbjct  376   LYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTELWGDDASEFKPER  435

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EG+SKATK Q++F PF  GPRIC+G NFA+LEAK+ +A+ILQR+SFELSPSY HAP +
Sbjct  436   FKEGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYT  495

Query  244   TVSLQPQYGAPLLFRKL  194
              +++ PQYGA L+ +K+
Sbjct  496   VITIHPQYGAHLILKKI  512



>ref|XP_010911572.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=522

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/497 (57%), Positives = 364/497 (73%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR L W W+ PR+L++ LR QGL+G  Y+F+ GDLK+  +  KEA+SKPM  SHDI PR+
Sbjct  26    WRGLEWLWWTPRRLERALRCQGLRGTRYRFLHGDLKETARLNKEARSKPMPFSHDIVPRV  85

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGI  1322
              PFF  AI+ NG+ SF W GP P V I  P  +R++L+ K   + KP  NPL +LLA G+
Sbjct  86    APFFHRAIKENGKISFTWFGPVPRVTIMNPEWVREVLSNKFGHFAKPQINPLGRLLATGL  145

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A YE +KW+KHRRI+NPAFH+EKLK M+PAF     E++   EK +G  G  E+DVW  L
Sbjct  146   ANYEGEKWAKHRRILNPAFHLEKLKRMLPAFSACSGELVNRWEKSIGSLGYYELDVWHEL  205

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q   GD ISRTAFGS+YEEGR+IF+LQ EQA    +  +++YIPG+RFLPT  N R KKI
Sbjct  206   QNFTGDVISRTAFGSSYEEGRRIFQLQTEQAGLLIQAAQTVYIPGYRFLPTPINNRRKKI  265

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +++V+AL+R II+KR KA+  GE S DDLL ++++SN    ++HGN K+  +TT EVIEE
Sbjct  266   DREVRALLRGIIEKREKAINLGEASNDDLLDLMIKSNLKHFQEHGNSKNTRMTTEEVIEE  325

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLL WTMV+L  H  WQ RAREEV  LFGK +PD DGLN +KIVTMI
Sbjct  326   CKLFYFAGQETTSVLLTWTMVVLSMHPSWQVRAREEVLELFGKHRPDYDGLNRLKIVTMI  385

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY  VI L R+  +  ++GD+  P GVL+ +PVI  HHD + WG DA EFNPER
Sbjct  386   LYEVLRLYPSVIQLNRRTYKTMKIGDITCPAGVLLLLPVIFIHHDPEFWGKDASEFNPER  445

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F++G+SKA+KGQ  F PFG GPR C+G +FA+LEAK+ ++MILQ +SFELSPSY HAP +
Sbjct  446   FAQGISKASKGQQAFFPFGWGPRTCIGQSFALLEAKMGLSMILQHFSFELSPSYVHAPYT  505

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQ+GA +  R++
Sbjct  506   VITLQPQHGAQIRLRRV  522



>ref|XP_010060780.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 ref|XP_010060781.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67645.1| hypothetical protein EUGRSUZ_F01392 [Eucalyptus grandis]
Length=510

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/494 (57%), Positives = 373/494 (76%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL G  Y F+FGDLK+ ++   EA SKP+ +S DI PRL
Sbjct  22    WRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAISDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF   + Q  G++SF+W+GP P V I  P  +++I +    Y KP +NPL+KLL +G+A
Sbjct  82    FPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSNINDYPKPASNPLVKLLVDGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E +KW +HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +  +   E+D W  LQ
Sbjct  142   NHEGEKWVRHRKIINPAFHMEKLKLMLPAFYSSCAEMVGRWEKLVSVERSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  + +SRTAFGS++EEG++I ELQ EQAQ      +S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTREVLSRTAFGSSFEEGKRICELQGEQAQLTIIAFQSVYIPGWRFVPTKMNRRMKNID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  I+ +R KA+  GE + DDLLG+LLESN  E       + G++  +VIEECK
Sbjct  262   KEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV R+FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLRIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P   L R+  +ET+LG L +PPGV +S+P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPATDLVREVLKETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++FELSPSYAHAP++ +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQP+YG  ++ RK
Sbjct  495   TLQPRYGVQVILRK  508



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/495 (58%), Positives = 371/495 (75%), Gaps = 5/495 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAWF+P+KLQK L++QG KGN YK I+GDLKQ++   +EA SKP++LS  I PR+
Sbjct  24    WRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDLKQISSLFQEANSKPISLSDGIVPRI  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              P F++A+ + G+N+++W GP PM+LI +P LIR +  K  I+ K   +P   LL  GI 
Sbjct  84    APHFLEAVNKYGKNTYLWSGPRPMMLIMDPELIRKVTQKMDIFQKVKFHPQASLLVAGIL  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW K R+++N AFHMEKLK MVPAFY S  EML   E+ +  +G  EVDVWP +Q
Sbjct  144   GYEGEKWVKQRKLLNQAFHMEKLKLMVPAFYKSACEMLSKWEEMISVKGSFEVDVWPTIQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  DAISRTAFGS YEEGRKIFELQ+EQA H     RSIYIPG RFLPT RNRRMK+I 
Sbjct  204   TMTSDAISRTAFGSRYEEGRKIFELQREQAGHLVLATRSIYIPGSRFLPTKRNRRMKQIA  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+  IR II+ R+KA+ AGE    D+LG+LL ++     +    + G+TT E+I+ECK
Sbjct  264   KEVEGSIREIINARLKALRAGEAIDTDMLGLLLATS-----QETGGESGMTTGEIIQECK  318

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFY  GQETT+VLLVWTM+LL  H +WQ RAREEV + FG + P+ DGLN +KIVTMIL+
Sbjct  319   LFYVAGQETTAVLLVWTMILLSMHPDWQERAREEVLQHFGTNMPNFDGLNQLKIVTMILH  378

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P+ ++ R   EET++G+L +P G  +++PVIL HHD +IWG+D KEF PERF+
Sbjct  379   EVLRLYPPISNIGRTVAEETKIGNLTIPAGQRLALPVILLHHDPEIWGEDVKEFKPERFA  438

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +GVS ATKGQ+ + PFG GPRIC+G NFA+LEAKL +AMILQR+SFELSPSY+HAP   +
Sbjct  439   DGVSSATKGQIVYFPFGWGPRICIGANFALLEAKLALAMILQRFSFELSPSYSHAPHQGI  498

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQ+GAPL+  KL
Sbjct  499   ALQPQFGAPLVLHKL  513



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/494 (58%), Positives = 374/494 (76%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR +NW W RP++L++ LR+QGL G  Y F+FGDLK+  +  KEAKSKP+ +S DI PRL
Sbjct  22    WRAVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENLRMLKEAKSKPIAVSDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++ F W+GP P V I  P  I++I +K   Y KP +N L+KLLA+G+A
Sbjct  82    LPFLHRSFQTYGKDWFTWMGPIPRVNITNPEQIKEIFSKIYDYPKPASNALVKLLADGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E +KW++HR+IINPAFHMEKLKHM+PAFY SC EM+   EK + ++   EVD W  LQ
Sbjct  142   NHEGEKWARHRKIINPAFHMEKLKHMLPAFYSSCTEMVDRWEKSVLEERSCEVDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS++EEG++IFELQ+EQA    + ++S+YIPGWRF+PT  NRRM+ I+
Sbjct  202   NLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTKMNRRMQNID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+VQAL+  I+ +R KA+ AG  + DDLLG+LLESN  E       + G++  +VIEECK
Sbjct  262   KEVQALLMDIVRRREKAIRAGGAAGDDLLGLLLESNMKE-------NAGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFY  GQETTSVLLVWTMVLL  H +WQ RAREEV + FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYIAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSKKPDFDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV+ L RK  +ET+LG L LP GV +S+P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVVVLARKVPKETKLGKLTLPAGVQVSMPTLLIHHDKELWGEDAEEFKPERFT  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFAM+EAK+ +AMILQ+++FELS SYAH+P + +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICVGQNFAMMEAKMALAMILQQFTFELSASYAHSPLTKI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQPQYG  ++  K
Sbjct  495   TLQPQYGVQVILHK  508



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/496 (55%), Positives = 379/496 (76%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+L+W W +P++L++CLRKQGL+GN Y+F+ GD+K+ +  +K+A+SKPM LS DI+  +
Sbjct  23    WRILDWVWLKPKRLERCLRKQGLRGNSYRFLSGDIKESSDMSKQARSKPMPLSDDIAQYV  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF    ++  G+NSFVW+GP P V I EP  IR+I TK   + KP + P+  LL  G+A
Sbjct  83    SPFLHQTVKNYGKNSFVWIGPRPRVTIMEPEQIREIFTKFNDFQKPRSYPVGNLLVCGLA  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + ++W+KHR IINPAFH +KLK+M+PAFY SC+EM+   EK +  +G +E+DVWP+L 
Sbjct  143   NLQGEEWAKHRNIINPAFHQDKLKNMLPAFYQSCIEMISKWEKMVFVEGSSELDVWPYLI  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR AFGS+YEEGR+IF+L  +Q     ++++S+YIPG  FLPT  NR++K I 
Sbjct  203   NLTRDVISRAAFGSSYEEGRRIFQLLDDQINLTMQVIQSVYIPGSWFLPTKTNRKLKVIV  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K ++ L++ +I KR KA++AGE SKDDLLGIL+ESN  EI++HG+ K+ G++  +VIE+C
Sbjct  263   KDIKDLLKEMIKKREKAIKAGEASKDDLLGILVESNIKEIQEHGDHKNMGMSIEDVIEDC  322

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTS+LLVWTM+LL RH  WQT+AR EV ++FG  KPD +G+N +K+VTMIL
Sbjct  323   KLFYFAGQETTSILLVWTMILLARHPHWQTKARAEVSQVFGDSKPDSNGMNRLKVVTMIL  382

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY   I+LTR   +ET+LG ++LP GV IS+PV+L HHD+++WG DA EFNP+RF
Sbjct  383   YEVLRLYPAAIALTRSVPKETKLGKMLLPAGVEISLPVLLIHHDQELWGKDAHEFNPDRF  442

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEGVSK TK Q+ + PFG GPR+C+G+NFA++EAK+ +AMIL+++  E+SPSYAH+P   
Sbjct  443   SEGVSKPTKSQVIYFPFGWGPRMCIGMNFALMEAKMALAMILRQFWLEISPSYAHSPCIF  502

Query  241   VSLQPQYGAPLLFRKL  194
             ++L+PQ+GA L+  KL
Sbjct  503   LTLRPQHGAHLILHKL  518



>ref|XP_004300362.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/498 (56%), Positives = 368/498 (74%), Gaps = 5/498 (1%)
 Frame = -1

Query  1684  CLWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISP  1505
             C W VLNW W RP+ L++ LR+QG +GN YK  +GD+K      +EAKSKPM   HDISP
Sbjct  20    CSWSVLNWVWLRPKILERLLRQQGFQGNSYKLFYGDVKDSYAMLREAKSKPMKHCHDISP  79

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIK-LLAE  1328
             R++PF    +  +G+NSF W GP P V I  P  +++ILTK   +  P   P+ K LLA 
Sbjct  80    RVIPFVHRTVNIHGKNSFTWFGPKPKVNIINPEDVKEILTKYEEF--PKLAPIYKKLLAA  137

Query  1327  GIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWP  1148
             G AT E ++W++H++IINPAFH++KLK M+PA   SC EM+   +  +  +G  E+DVWP
Sbjct  138   GFATLEGEEWARHKKIINPAFHLDKLKSMLPAIQQSCDEMINEWKSFVYKEGSCELDVWP  197

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRS-IYIPGWRFLPTWRNRRM  971
              LQ +  D ISRT+FGS+YEEG+ IF+L KEQA   T  ++S + IPGWRF+PT  N+RM
Sbjct  198   SLQSLSDDVISRTSFGSSYEEGKIIFQLLKEQAVLTTNALQSGVNIPGWRFIPTKTNKRM  257

Query  970   KKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREV  794
             +++ K+++  ++ II  R KA++AGE  KDDLL ILLESN   I +HGN K+FG++T +V
Sbjct  258   REVNKEIKGSLKGIIHNREKAIKAGEPCKDDLLSILLESNLKVIHEHGNNKNFGMSTEDV  317

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             IE CKLFYF GQET +VLLVWTMVLL ++Q WQT AREEV ++FG +KPD DGLN +KIV
Sbjct  318   IENCKLFYFTGQETITVLLVWTMVLLSQYQNWQTLAREEVLQVFGSNKPDFDGLNRLKIV  377

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY   +++TR   +ET+LG+  +P GV I+IP++L  HDE++WGDDAKEF 
Sbjct  378   TMILREVLRLYPSAVTMTRNTYKETQLGEKTIPAGVEITIPILLVQHDEELWGDDAKEFK  437

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERF+EGVSK TKGQL++ PFG GPR+C+G NFAM+EAKLV+A+ILQ ++FELSPSYAHA
Sbjct  438   PERFAEGVSKVTKGQLSYFPFGAGPRVCIGQNFAMIEAKLVVAVILQHFTFELSPSYAHA  497

Query  253   PTSTVSLQPQYGAPLLFR  200
             P +  SLQPQYGA L+  
Sbjct  498   PHAIPSLQPQYGAHLILH  515



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/497 (55%), Positives = 372/497 (75%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             WR++NW W  P++L++ LR+QGL+G  YKF  GD K++ K  KE  SKPM+L SHDI PR
Sbjct  18    WRMVNWLWLTPKRLERLLREQGLEGKPYKFFVGDTKEIEKMKKEGLSKPMDLFSHDIVPR  77

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +  FF  +I  +G+  F W GP P V++ +P LI+D+L K   + +   +P +K L  G+
Sbjct  78    VFSFFHHSINTHGKICFTWFGPIPRVILTDPDLIKDVLNKMNEFGRINMHPQLKFLVPGL  137

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E ++WSKHR+IINPAF++EKLK+M P F   C +++   E+ +G  G +E+DVWP L
Sbjct  138   VSHEGERWSKHRKIINPAFNLEKLKNMFPPFIKCCDDLISKWEEMLGSDGSSEIDVWPFL  197

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
               +  DAISRTAFGS++EEGR+IF+L KEQ +   E++  +YIPGWRF+PT + RRMK I
Sbjct  198   HNMASDAISRTAFGSSFEEGRRIFQLLKEQIELTVEIISKVYIPGWRFVPTTKQRRMKAI  257

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +K+++  +  II+ RVKA+E GE +K DLLGILLESN  EIE+ GN K+ G+   +VI E
Sbjct  258   DKEIKCSLTDIINNRVKALETGEATKMDLLGILLESNQKEIEEQGNNKNIGMNNEDVIAE  317

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF G ET S LLVWTM+LL  + +WQTRAR+E+ ++FG  KPD DGL+H+KIVTMI
Sbjct  318   CKLFYFAGHETVSSLLVWTMILLSMYPDWQTRARKEILQVFGNRKPDFDGLSHLKIVTMI  377

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY PV+SL RK +++ +LG+L LP  V + +P++L HHD ++WGDDAKEF PER
Sbjct  378   LNEVLRLYPPVLSLARKVRKDVKLGNLSLPSEVQVFLPILLVHHDCEVWGDDAKEFKPER  437

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEGV KAT G+++  PFGGGPRIC+G NFA+LE K+ +++ILQR+SF+LSP+Y HAPT+
Sbjct  438   FSEGVLKATNGRVSLFPFGGGPRICIGQNFALLEVKIALSIILQRFSFQLSPTYTHAPTA  497

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGA L+  KL
Sbjct  498   WLTLQPQYGAHLILHKL  514



>ref|XP_004294189.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/497 (57%), Positives = 380/497 (76%), Gaps = 6/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             W +L+W   +P+KL++CLR+QGL+G  Y+F++GDLK+ +    +A+SKPM LS  HDI+P
Sbjct  24    WSMLDWLRLKPKKLERCLREQGLQGKSYRFLYGDLKENSILLNQARSKPMKLSASHDIAP  83

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             RL+PF    I+  G+NSFVW GP P V I  P  ++D+ TK   + +P  NPL+KLL  G
Sbjct  84    RLIPFLDQTIKNYGKNSFVWNGPVPRVTIMNPEDMKDVFTKLDDFRRPPPNPLLKLLTTG  143

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWP  1148
             +A+YE +KW+KHR+IINP FH+EKLK M+PAF+ SC EM+   E     +G + ++DVWP
Sbjct  144   VASYEGEKWAKHRKIINPTFHVEKLKIMLPAFHKSCDEMIKEWESLASKEGSSCQLDVWP  203

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
              LQ +  D ISRTAFGS+Y+EGRKIFEL KEQA      ++S+YIPGWRFLPT +N RMK
Sbjct  204   SLQHLTADVISRTAFGSSYQEGRKIFELLKEQAMLVISSLQSVYIPGWRFLPTKKNNRMK  263

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIE  788
             KI+K+V+ L++ II +R K +EAGE +KDDLLG L+ES F + +  G+   G+++ +VIE
Sbjct  264   KIDKEVKGLLKGIISEREKTIEAGEATKDDLLGALMESKFKDTQ--GDGKGGMSSDDVIE  321

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETTSVLLVWTM+LLG++Q WQ R R+EV ++FG +KPD DGL H+K+VTM
Sbjct  322   ECKLFYFAGQETTSVLLVWTMILLGQNQNWQDRERQEVLQVFGSNKPDFDGLTHLKVVTM  381

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             +L E LRLY  ++ +TR    ET+LG L LP GV +S+P +L H D+++WGDDA EFNPE
Sbjct  382   VLLEVLRLYPALVLVTRTTGRETQLGKLSLPAGVQVSLPTLLIHRDKELWGDDANEFNPE  441

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEGVSKATK  ++F PFGGGPRIC+G NFAMLEAKL +++ILQ + FELSPSYAHAP+
Sbjct  442   RFSEGVSKATKSPISFFPFGGGPRICIGQNFAMLEAKLALSLILQHFHFELSPSYAHAPS  501

Query  247   STVSLQPQYGAPLLFRK  197
             S + ++PQYGAP++ +K
Sbjct  502   SPM-IRPQYGAPIILQK  517



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/496 (54%), Positives = 368/496 (74%), Gaps = 1/496 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR++NW W RPRKL+KC RKQG+ G+ Y+ ++GD K++ + TKEAK KP+ L+ DI PR
Sbjct  19    VWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTKEAKFKPIKLTDDILPR  78

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + PF+     + G + F W+GP P + + +P LI++I+T NTI+ KP   PL++LL  GI
Sbjct  79    IFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIFKKPKPAPLVQLLVSGI  138

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             ++YE+DKW+KHR+I+N AF+ EKLK M+PA + SC +M+   E  + +    E+DV P+ 
Sbjct  139   SSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCEDMINKWEILLSENKSCELDVHPYF  198

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             +    D ISRTAFGS+Y EG +IF LQKE A+   +  +S+YIPGWR+LPT  NRRMK I
Sbjct  199   EDFTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSVYIPGWRYLPTRTNRRMKAI  258

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
             + +++ ++R I+ KR +AM      ++DLLGILL+SN  EI++ G+K FG+TT EVIEEC
Sbjct  259   DNELRDILRKIVSKRERAMVGEASDQEDLLGILLKSNLKEIQERGSK-FGMTTDEVIEEC  317

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K+FYF GQE++S LLVWTMVLL  HQ WQ RAREEV ++F  +KPD +GL+ +KIVTMIL
Sbjct  318   KVFYFAGQESSSNLLVWTMVLLSVHQTWQARAREEVQQVFQNNKPDFEGLSRLKIVTMIL  377

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P     RK  +ET+LG++ +PP V++ IP I  HH+ ++WG+D KEF PERF
Sbjct  378   NEVLRLYPPAPYFVRKVYKETKLGNMSIPPEVILVIPTIFVHHNPELWGEDVKEFKPERF  437

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EG++ ATK +L FLPF  GPRIC+G NFAMLE K+ +AMILQR++FELSPSYAHAPT  
Sbjct  438   AEGIATATKNRLCFLPFSWGPRICIGNNFAMLETKIALAMILQRFAFELSPSYAHAPTYV  497

Query  241   VSLQPQYGAPLLFRKL  194
             V+L+PQ GA L+ +KL
Sbjct  498   VTLRPQCGAHLILQKL  513



>ref|XP_010060782.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/494 (57%), Positives = 375/494 (76%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL G  Y F+FGDLK+ ++   EA SKP+ +S DI PRL
Sbjct  22    WRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAVSDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF+W+GP P V I  P  +++I +K   Y +P +NPL+KLL  G+ 
Sbjct  82    LPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLLTNGLF  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E +KW++HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +  +   E+D W  LQ
Sbjct  142   DHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  + ISRTAFGS++EEG++I ELQ EQAQ     ++S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTREVISRTAFGSSFEEGKRISELQGEQAQLTIIALQSVYIPGWRFVPTKMNRRMKSID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  II +R KA+  GE + DDLLG+LLESN  E       + G++  +V+EEC+
Sbjct  262   KEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVMEECR  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV ++FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV  +TRK  +ET+LG L +PP V + +P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++FELSPSYAHAP++ +
Sbjct  435   EGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVI  494

Query  238   SLQPQYGAPLLFRK  197
             +LQP+YG  ++ RK
Sbjct  495   TLQPRYGVQVILRK  508



>ref|XP_009339373.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=511

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/497 (55%), Positives = 361/497 (73%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+V+NW W +P+KL++ LR+QGL GN Y+ + GDL   +K TK A SKPM  SHDI P +
Sbjct  15    WKVVNWIWLKPKKLERHLRQQGLSGNSYRLLIGDLNDNSKMTKAALSKPMEFSHDIVPYV  74

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LP   D   + G  SF+WLGP P V++ +  L+R+  TK  +Y KP +NPLI LL  G+ 
Sbjct  75    LPLLHDIFNKYGRKSFIWLGPIPSVILFDAELMREAFTKYRVYEKPHSNPLISLLVTGLV  134

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E DKW KHRRIINPAFH+EK+K M+PAF+ +   ML   E     +G  EVDVWP+L 
Sbjct  135   GHEGDKWVKHRRIINPAFHVEKMKDMLPAFHAASENMLSKWETLFSSRGTCEVDVWPYLC  194

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISR AFGSN+EEG++ F+LQKEQA     ++ S+YIP +RFLPT  NRRMK+I 
Sbjct  195   AFAGDVISRAAFGSNFEEGQRFFQLQKEQAAFVRIVLDSVYIPFFRFLPTKMNRRMKQIA  254

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K++  L+R II++R KAM AGE ++DDLLGILL+SNFNEI++H N KD G++  EVIEEC
Sbjct  255   KEMDTLLRGIINQREKAMRAGEATEDDLLGILLKSNFNEIQEHANDKDVGMSIEEVIEEC  314

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  G+ETT  L+ WT+VLLG++Q+WQ RAREEV  +F  +KPD  GLN +KI+ MIL
Sbjct  315   KLFYLAGEETTRDLINWTLVLLGKYQDWQMRAREEVVTIFKNNKPDYAGLNCLKIMNMIL  374

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY       R+  +ET+LGD+ LPPG  +++P++  HHD++IWGDD  EF PERF
Sbjct  375   YEVLRLYPSASFTNREITKETKLGDISLPPGTQLAVPILCVHHDKEIWGDDVHEFKPERF  434

Query  421   SEGVSKATKGQL-TFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             SEG+SKATK Q+  F PF  GPR C+G NFAM+E K +I MILQR++FELSP+Y H+P +
Sbjct  435   SEGISKATKNQVAAFFPFSTGPRTCIGQNFAMIEVKTIITMILQRFTFELSPAYRHSPLN  494

Query  244   TVSLQPQYGAPLLFRKL  194
              ++L+PQYG  ++F+K+
Sbjct  495   ILTLEPQYGTQIIFQKI  511



>emb|CBI39929.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 355/453 (78%), Gaps = 1/453 (0%)
 Frame = -1

Query  1549  EAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIY  1370
             EA S+P++ S DI  R+LPF   +IQ+ G+N+F+WLGP P+V I +P LIRD+L K+  +
Sbjct  4     EANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAF  63

Query  1369  HKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEK  1190
              KP  +PL KLLA G+A+ E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EK
Sbjct  64    QKPPRHPLGKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEK  123

Query  1189  KMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIP  1010
             ++   G  E+D+WP+LQ + GD ISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+Y+P
Sbjct  124   QLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVYVP  183

Query  1009  GWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH  830
             GWRF PT  NRRM++I  +V AL++ II+KR KAM+AGE + DDLLG+L+ESN+ E++++
Sbjct  184   GWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQEN  243

Query  829   GN-KDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKD  653
                K+ G++ ++VIEECKLFY  GQETTS LL+WTMVLL +H  WQ RAREEV R+FG  
Sbjct  244   DERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVLRVFGNK  303

Query  652   KPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHH  473
             KPD DGLNH+KIVTMI +E LRLY P   LTR    ++++G L LP GV I++P++L HH
Sbjct  304   KPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALPILLIHH  363

Query  472   DEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQ  293
             D+KIWGDDAKEFNP RFSEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQ
Sbjct  364   DDKIWGDDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQ  423

Query  292   RYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             R+SFELSPSYAHAP S +++QPQ+GA L+   L
Sbjct  424   RFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  456



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/497 (54%), Positives = 364/497 (73%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+V+NW W +P+KL++ LR+QGL GN Y+ + GDL   +K TKEA SKPM  SHDI P +
Sbjct  22    WKVVNWVWLKPKKLERYLRQQGLSGNSYRLLIGDLTDNSKMTKEALSKPMEFSHDIVPYV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LP   +   + G+ SF+WLGP P V+I +  L+R+ LTK+ ++ KP +NPL+  L  G+ 
Sbjct  82    LPLLQETFNKYGKKSFIWLGPVPSVVIFDAELMRETLTKHRVFEKPHSNPLLSFLVTGLL  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE DKW KH+RIINPAFH++K+K M+PAF+ +C  ML   E     +   E+DVWP+L 
Sbjct  142   SYEGDKWVKHKRIINPAFHIDKMKDMLPAFHAACENMLSKWETHFSSKETCELDVWPYLC  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GDAISR AFGSN+EEG + FELQKEQ     E++ S+YIP  RFLPT  NR MK+I 
Sbjct  202   AFSGDAISRAAFGSNFEEGERFFELQKEQGALTREVLNSVYIPLLRFLPTKMNRSMKQIS  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEEC  782
              ++   +R II+KR KAM AGE ++DDLLGILL+SNF+EI++HG +KD G++  EVIEEC
Sbjct  262   DEMAICLRGIINKREKAMRAGEATEDDLLGILLKSNFSEIQEHGDDKDVGMSIEEVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K+FY  G++TT  L+ WT+VLLG+HQ+WQ RAREEV ++F   +PD  GLN +KIV MIL
Sbjct  322   KVFYLAGEDTTKDLINWTLVLLGKHQDWQRRAREEVVQIFKNKQPDHAGLNRLKIVNMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P I   R+  +ET+LGD+ LPPGV +++P++  HHD++IWGDD  EF PERF
Sbjct  382   YEVLRLYPPAIFTIREITKETKLGDISLPPGVQLAVPILFVHHDKEIWGDDVHEFKPERF  441

Query  421   SEGVSKATKGQLT-FLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             SEG+SKA+K ++  F  F  GPR C+G NFA++EAK VI MILQR++FELSP+Y H+P +
Sbjct  442   SEGISKASKNEVAPFFSFSTGPRTCIGQNFALMEAKTVITMILQRFTFELSPAYRHSPLN  501

Query  244   TVSLQPQYGAPLLFRKL  194
              ++L+PQYG  ++F K+
Sbjct  502   MLTLEPQYGTQIIFHKI  518



>ref|XP_011098149.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/495 (54%), Positives = 364/495 (74%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             +VLNW WFRP+KL+K LRKQGL GN Y+   GD++ LT   K  + K +NLS D+ P +L
Sbjct  21    KVLNWVWFRPKKLEKLLRKQGLNGNPYRLFLGDMQDLTNVLKTQQPKTLNLSDDLRPHIL  80

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P++ + I   G++SFVW GP+P + + +P LI++IL+K  ++HK   +P+ + +  G++ 
Sbjct  81    PYYQNIIDNFGKHSFVWFGPSPRLNVADPELIKEILSKPRLFHKALPDPIGETIVGGLSY  140

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPHLQ  1139
              E++KW+KHR+I+N AFHMEKLK+M+PA ++SC +M+   E  +   G + E+DVWP L+
Sbjct  141   LEDEKWAKHRKIVNEAFHMEKLKNMIPAMFLSCSKMIEKWEALISRSGSSQEIDVWPFLE  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IF+LQKEQ +    L++  +IPGWR+ PT  NRR++ I 
Sbjct  201   DLTGDVISRTAFGSSYEEGRRIFQLQKEQVKLLLHLLQFSFIPGWRYFPTKANRRLRAIT  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             KQ+Q+L+R +I++R KAME GE    DLL IL+ESNF EI++HGNK+ G++  +VIEECK
Sbjct  261   KQIQSLLRGMINQREKAMERGEIIHSDLLSILMESNFKEIQEHGNKNVGLSIEDVIEECK  320

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF G ETTS LLVWTMVLL +HQ+WQ RAREEV ++FGK KP  DGL  +K VTMIL 
Sbjct  321   LFYFAGSETTSTLLVWTMVLLSKHQDWQARAREEVLQVFGKKKPTFDGLQQLKTVTMILQ  380

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY  V  + R   +   LG  ++P GV +++ ++L HHD +IWGDD KEF PERFS
Sbjct  381   EVLRLYPSVPFIARAPTKTVTLGSKIIPVGVQLTLLIVLLHHDPEIWGDDVKEFKPERFS  440

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             +G+S A K Q +F PF  GPR+C+G NFAM+EAK+ +AMILQ +SFELS SY HAP    
Sbjct  441   QGISSAAKAQYSFTPFSTGPRVCIGHNFAMIEAKMALAMILQHFSFELSSSYLHAPFPLT  500

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQYGAPL+ R+L
Sbjct  501   TLQPQYGAPLILRRL  515



>ref|XP_003543172.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=519

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/497 (55%), Positives = 375/497 (75%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W++LNW W  P++L++ LR+QGL+GN Y  + GD  ++ K  KEA SKP+ L SHDI PR
Sbjct  21    WKLLNWLWLTPKRLERLLREQGLQGNPYTLLVGDSMEVIKIRKEALSKPITLFSHDIVPR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +  +    + ++G+NSF+W GP P V + +P LI+++L K   + K   NP +KLL  G+
Sbjct  81    VSSYAQHTLNKHGKNSFIWFGPIPRVTLTDPELIKEVLNKIYDFGKLKLNPHVKLLVPGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A  E +KWSKHR+IINPAF+++KLK+M+P F   C +++   E  +   G +E++VWP L
Sbjct  141   ARLEREKWSKHRKIINPAFNLDKLKNMLPLFIKCCDDLISKWEGMLSSDGSSEINVWPFL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEGR+IF+L KEQ +   +++  +YIPGWRF+PT  +RR+K+I
Sbjct  201   QNLASDAISRTAFGSSYEEGRRIFQLLKEQTELTMKIILKVYIPGWRFVPTTTHRRIKEI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH-GNKDFGITTREVIEE  785
             ++ ++AL+  +I+KR KA++A E +K++LL ILLESN  EI++H  NK+ G+   EVI+E
Sbjct  261   DRVIKALLMDMINKREKALKADEATKNNLLDILLESNHKEIQEHKNNKNVGLNLEEVIQE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTM+LL R+ +WQTRAREEV ++FG  KP+ DGL+H+KIVTMI
Sbjct  321   CKLFYFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLKVFGNQKPNFDGLSHLKIVTMI  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY P I L RK  ++ +LG+L LP GV IS+P++L HHD ++WGDDAKEF PER
Sbjct  381   LYEVLRLYPPAIGLVRKVNKDVKLGNLSLPAGVQISLPIVLVHHDCELWGDDAKEFKPER  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEG+ KAT G+ +F  FGGGPRIC+G NF+ LEAK+ ++MILQR+ F LSP+Y HAPT+
Sbjct  441   FSEGLLKATNGRFSFFAFGGGPRICIGQNFSFLEAKIALSMILQRFLFGLSPTYTHAPTT  500

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGA L+ RK+
Sbjct  501   VITLQPQYGAHLILRKV  517



>emb|CAN72865.1| hypothetical protein VITISV_029731 [Vitis vinifera]
Length=502

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/491 (57%), Positives = 366/491 (75%), Gaps = 17/491 (3%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP++L++CL++QGL GN Y+ + GD K++    KEA S+P+++S DI  R+
Sbjct  23    WRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISISDDIVQRI  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF   +I++ G++SF+W+GP P V I EP LIRD+L+ +T++ KP  + L+KLL  G+ 
Sbjct  83    APFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVKLLVSGLL  142

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + +KW+KHR+IINPAF +EK+K                 +K+MG     E+DVWP+LQ
Sbjct  143   FLDGEKWAKHRKIINPAFRLEKVKRH---------------DKQMGLVS-CELDVWPYLQ  186

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GDAISRTAFGSNYE+GR IFELQ+EQAQ   +   S +IPGWRF PT  N+RMK+I 
Sbjct  187   NLTGDAISRTAFGSNYEKGRMIFELQREQAQLLVQFSESAFIPGWRFXPTKSNKRMKQIR  246

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEEC  782
             K+V AL+  IIDKR KAM+AGE   DDLLGILLESNF EI++H N K+ G++ ++VIEEC
Sbjct  247   KEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEHENDKNVGMSIKDVIEEC  306

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF G ETTS LL+WTMVLL +H  WQ RAREE+  +FG +KP+ DGLNH+KIV MIL
Sbjct  307   KLFYFAGXETTSALLLWTMVLLSKHPNWQARAREEILHVFGNNKPEGDGLNHLKIVMMIL  366

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LRLY PV  L R   E+ ++GD+ LP GV +S+P IL HHD +IWG+DA+EFNPERF
Sbjct  367   HEVLRLYPPVPFLARSVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERF  426

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S+GV KA K  ++F PFG G + C+G NFA+LEAK+V+AMILQR+SF LSPSY+HAP+S 
Sbjct  427   SQGVLKAMKSPVSFFPFGWGSQSCIGQNFAILEAKMVLAMILQRFSFSLSPSYSHAPSSL  486

Query  241   VSLQPQYGAPL  209
             V+L PQYGA L
Sbjct  487   VTLIPQYGAHL  497



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/497 (55%), Positives = 371/497 (75%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W +LNW WF P++L++ LR+QGL+GN Y  + GD  +  K  KEA SKPM+L S+DI  R
Sbjct  25    WMMLNWLWFTPKRLERLLREQGLQGNPYTLLVGDTNEFAKMRKEAFSKPMDLFSNDIVQR  84

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + PFF  +I  +G+NSF+W GP P V++ +P LI+D+  K   + K + NP ++LL  G+
Sbjct  85    VYPFFRHSINTHGKNSFIWFGPAPRVILTDPELIKDVFNKTFDFQKIYLNPQVRLLTPGL  144

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E +KW KHR+II P F++EKLK M+P     C +++   E+ +   G +E+DVWP L
Sbjct  145   VSHEGEKWRKHRKIITPVFNLEKLKDMLPVLIKCCDDLISKWEEMLSLDGSSEMDVWPFL  204

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  +AISRTAFGS+YEEGR+IF+L KEQ++   +L+  +YIPGWRF+PT  +RRMK+I
Sbjct  205   QNLTSEAISRTAFGSSYEEGRRIFQLLKEQSELTAQLVYKVYIPGWRFVPTTTHRRMKEI  264

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +K+ +A +  II+ + KA++AGE +K+DLL ILLESN  EI++HGN K+ G+   +VIEE
Sbjct  265   DKETKASLMDIINNKEKALKAGEATKNDLLDILLESNHKEIQEHGNNKNVGLNIEDVIEE  324

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQ++TS LLVWTM+LL  + +WQTRAREEV ++FG  KPD DGLNH+KIV MI
Sbjct  325   CKLFYFAGQDSTSSLLVWTMILLSMYPDWQTRAREEVLQVFGNHKPDFDGLNHLKIVPMI  384

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE  RLY PVI L RK  ++ +LG+L L  G+ +SIP+IL HHD ++WGDDAKEF PER
Sbjct  385   LNEVFRLYPPVIGLPRKVLKDVKLGNLSLVAGMQVSIPIILVHHDCELWGDDAKEFKPER  444

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F+EGV KAT G+ + +PFGGGPRIC G NF+ LEAK+ ++MILQR+SFELS SY HAP +
Sbjct  445   FAEGVLKATNGRASLIPFGGGPRICTGRNFSFLEAKIALSMILQRFSFELSSSYTHAPIT  504

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGA L+  K+
Sbjct  505   AITLQPQYGAHLILHKV  521



>ref|XP_008785718.1| PREDICTED: cytochrome P450 CYP72A219-like [Phoenix dactylifera]
Length=522

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/497 (56%), Positives = 366/497 (74%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR L W W+RPR L++ LR QGL+G  Y+F++GDLK+  +  KEA++K M LSHDI PR+
Sbjct  26    WRGLEWLWWRPRTLERALRAQGLRGTRYRFLYGDLKENARLIKEARAKLMPLSHDIVPRV  85

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGI  1322
              P     ++ NG+ S  W GP P V I  P  +R++L+ K   + K   +PL +LLA G+
Sbjct  86    APLLHRVMKENGKISITWFGPVPRVTIMNPESVREVLSNKFGHFGKQKLSPLGRLLATGL  145

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE +KW+KHRRI+NPAFHME+LK M+PAF   C E++   EK +   G  E+DVWP L
Sbjct  146   VSYEGEKWAKHRRILNPAFHMERLKRMLPAFSACCRELVDRWEKSIDSLGYYELDVWPEL  205

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q   GD ISRTAFG +YEEGR+IF+LQ EQA+   +  +S+YIPG+RFLPT  N R K+I
Sbjct  206   QNFTGDVISRTAFGCSYEEGRQIFQLQAEQAELFIQAAQSVYIPGYRFLPTPMNNRRKEI  265

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +++V+AL+R II+KR +A++ G+ S DDLLG+++ESN    ++HGN K+  +TT EVIEE
Sbjct  266   DREVRALLRGIIEKRDQAIKMGKASNDDLLGLMMESNLKHFQEHGNFKNTVMTTDEVIEE  325

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLL WTMV+L  H  WQ RAREEV   FGK+KPD DGL+ +KIVTM+
Sbjct  326   CKLFYFAGQETTSVLLTWTMVVLSMHPIWQLRAREEVLEFFGKNKPDFDGLSRLKIVTMV  385

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY P+I LTR+  +  +LGD+  PPGVL+S+PVI  HHD + WG DA EFNP+R
Sbjct  386   LYEVLRLYPPLILLTRRTYKTMKLGDITYPPGVLLSLPVIFIHHDPEFWGKDASEFNPQR  445

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EGVSKA+K Q+ F PFG GPR C+G NFA+LEAK+ ++MILQ +SFELSP+Y H+P +
Sbjct  446   FVEGVSKASKDQMAFFPFGWGPRTCIGQNFALLEAKMGLSMILQHFSFELSPTYVHSPCT  505

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQ+GA + F +L
Sbjct  506   VITLQPQHGAQIRFHRL  522



>ref|XP_010060784.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67652.1| hypothetical protein EUGRSUZ_F01400 [Eucalyptus grandis]
Length=510

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/494 (57%), Positives = 372/494 (75%), Gaps = 7/494 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL    Y F+FGDLK+ ++   EA SKP+ +S DI PRL
Sbjct  22    WRVVNWVWVRPKRLERLLRQQGLSRKPYTFLFGDLKENSRLLTEANSKPIAISDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF   + Q  G++SF+W+GP P V I  P  +++I +    Y KP  NPL+KLL +G+ 
Sbjct  82    LPFLHQSSQTYGKDSFMWIGPTPGVRITNPEQLKEIFSNINDYPKPGPNPLVKLLGDGLV  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              +E +KW+++R+IINPAFHMEKLK M+PAFY SC EM+G  EK +  +   E+D W  LQ
Sbjct  142   NHEGEKWTRYRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLVSVERSCEIDAWVDLQ  201

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  + ISRTAFGS++EEG++IFELQ EQA      ++S+YIPGWRF+PT  NRRMK I+
Sbjct  202   NLTREVISRTAFGSSFEEGKRIFELQGEQAHLAIIALQSVYIPGWRFVPTKMNRRMKNID  261

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K+V+AL+  II +R KA+  GE + DDLLG+LLESN  E       + G++  +VIEECK
Sbjct  262   KEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEECK  314

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL  H +WQ RAREEV ++FG  KPD DGL+H+KIVTMILN
Sbjct  315   LFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILN  374

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV  L RK  +ET+LG L +PPGV +S+P +L HHD+++WG+DA+EF PERF+
Sbjct  375   EVLRLYPPVTELARKVPKETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPERFA  434

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVS ATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++FELSPSYAHAP++ +
Sbjct  435   EGVSMATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVL  494

Query  238   SLQPQYGAPLLFRK  197
              LQP+YG  ++ RK
Sbjct  495   ILQPRYGVQVILRK  508



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/497 (56%), Positives = 364/497 (73%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++++W WFRP+KL+K LR+QG  GN Y+ + GDLK+     +EA SKPMN S+ I+PR+
Sbjct  25    WKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPRV  84

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P     IQ  G+ S +WLGP P V I +P  ++ + +    + KP  NPL +LL +G+A
Sbjct  85    IPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDFQKPTMNPLTRLLVQGLA  144

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCV-EMLGNLEKKMGDQGLAEVDVWPHL  1142
             + E  KW KHR+IINPAFH+EKLK MVPAFY SC  EM+   E  +  +G  E+DV P+L
Sbjct  145   SLEGQKWVKHRKIINPAFHVEKLKDMVPAFYHSCYNEMVSKWEGMVSREGSCELDVMPYL  204

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRTAFGS+YE+G+KIFELQ E A    +    IYIPGWRFLPT  NR+MK+I
Sbjct  205   QNMASDVISRTAFGSSYEKGKKIFELQTELANLVIQANLGIYIPGWRFLPTKSNRKMKEI  264

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
              K++  LI  I++++ K+++AGE  + DLL IL+ESN NEI++HGN K+ G++  +VIEE
Sbjct  265   SKEITTLILGIMNEKEKSIKAGEAIQTDLLSILMESNMNEIKQHGNNKNIGMSIEDVIEE  324

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFY  GQETT+ LLVWTMVLL  + EWQ RAR EVF +FG  KPD DGLN +K+VTMI
Sbjct  325   CKLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLNRLKVVTMI  384

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              NE LRLY PV    R  ++ETRLG+L LP GV++ +PV+L H D ++WG+DA EFNPER
Sbjct  385   FNEVLRLYPPVNMFGRIIRKETRLGNLTLPEGVMLGLPVVLIHLDPELWGEDAHEFNPER  444

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEG+SKATK    F+PFG GPRIC+G NFAM+EAK+ +++ILQR+SFELSPSY HAP +
Sbjct  445   FSEGISKATKNPSAFIPFGWGPRICIGQNFAMIEAKMALSIILQRFSFELSPSYTHAPIA  504

Query  244   TVSLQPQYGAPLLFRKL  194
              ++ QPQ+GA ++  KL
Sbjct  505   VLTTQPQHGAHIILHKL  521



>ref|XP_011098148.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/497 (54%), Positives = 368/497 (74%), Gaps = 3/497 (1%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             ++LNW WFRP+KL+K LRKQGL GN Y+   GD++      K  + K + LS D+ P +L
Sbjct  23    KLLNWVWFRPKKLEKLLRKQGLSGNPYRLFLGDMQDFGNVMKTEQPKTLKLSDDLPPHIL  82

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P++ + I + G+ SFVW GP+P V + +P LI++IL+K  ++HKP  +P+ + +  G+  
Sbjct  83    PYYHNIIHKYGKLSFVWFGPSPRVNVADPELIKEILSKPGLFHKPLPDPIGETIVGGLLF  142

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPHLQ  1139
              E DKW+KHR+IIN AFHMEKLK+M+PA ++SC +M+   E  +   G + E+DVWP L+
Sbjct  143   LEGDKWAKHRKIINQAFHMEKLKNMIPAMFLSCSKMIEKWEASISSCGSSQEIDVWPSLE  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS+YEEGR+IFELQKEQ +    L++  +IPGWR+ PT  NRR+++I 
Sbjct  203   DLSGDVISRTAFGSSYEEGRRIFELQKEQVKLVLHLLQFSFIPGWRYFPTNANRRLREIT  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGS--KDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
             KQ+++L+R II++R KAME  +G   ++DLLGIL+ESNF EI++HGNK+ G++  +VIEE
Sbjct  263   KQIESLLRGIINQRGKAMERADGEIIRNDLLGILMESNFREIQQHGNKNVGLSIEDVIEE  322

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF G+ETTS LLVWTMVLL +HQ+WQ RAREEV ++FGK +P  DGL+ +KIVTMI
Sbjct  323   CKLFYFAGKETTSNLLVWTMVLLSKHQDWQARAREEVLQVFGKKQPTFDGLHQLKIVTMI  382

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
               E LRLY P   + R   +  +LG  ++P GV +++ + L HHD  IWG+D KEF PER
Sbjct  383   FQEVLRLYPPAPLIIRAPTKTVQLGSTIIPVGVQLTLLIGLLHHDPDIWGNDVKEFKPER  442

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEG+S ATK Q +F+PF  GPR+C+G NFAM+EAK+ +AMILQ +SFELS SY HAP  
Sbjct  443   FSEGISSATKTQYSFIPFSSGPRVCVGQNFAMIEAKMALAMILQHFSFELSSSYLHAPFP  502

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGAPL+ RKL
Sbjct  503   IMTLQPQYGAPLIVRKL  519



>ref|XP_010644766.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=460

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/459 (60%), Positives = 353/459 (77%), Gaps = 2/459 (0%)
 Frame = -1

Query  1567  LTKTTKEAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDIL  1388
             ++   KEA S+P++LS +I+PR+LPF    I++ G+N F W GPNPMV I EP LIRD+L
Sbjct  1     MSMMLKEAYSRPISLSDEIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDVL  60

Query  1387  TKNTIYHKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEM  1208
              K+ ++ KP  +PL KLL  G+ T E ++W+K R+IINPAFH+EKLK+M+PAF++SC +M
Sbjct  61    LKSNVFQKPPPHPLGKLLVSGLVTLEGERWAKRRKIINPAFHLEKLKNMLPAFHLSCSDM  120

Query  1207  LGNLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELM  1028
             +    K +   G  E+DVWP+L+ + GD ISRTAFGS+YEEGR+IF+LQKEQ     ++ 
Sbjct  121   VTKW-KMLSVGGSCELDVWPYLENLTGDVISRTAFGSSYEEGRRIFQLQKEQTHLAIQVT  179

Query  1027  RSIYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNF  848
              S+YIPGWRFLPT  NRRMK+I K+V AL+R II+KR KAM+AGE +  DLLGIL+ESNF
Sbjct  180   MSVYIPGWRFLPTKTNRRMKQISKEVYALLRGIINKREKAMKAGETANSDLLGILMESNF  239

Query  847   NEIEKH-GNKDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVF  671
              EI++H  NK   ++ ++VIEECKLFY  GQETTSVLLVWTMVLL  H  WQ RAREEV 
Sbjct  240   REIQEHQNNKKIRMSVKDVIEECKLFYLAGQETTSVLLVWTMVLLSEHPNWQARAREEVL  299

Query  670   RLFGKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIP  491
             ++FG  KP+  GLNH+KIVTMI +E LRLY PV  L R   ++T++GD+  P GV + +P
Sbjct  300   QVFGNKKPEAAGLNHLKIVTMIFHEVLRLYPPVAMLARAVYKDTQVGDMCFPAGVQVVLP  359

Query  490   VILNHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLV  311
              IL HHD +IWGDDAKEFNPERF+EGV KATK Q++F PFG GPR+C+G NFAM+EAK+ 
Sbjct  360   TILVHHDHEIWGDDAKEFNPERFAEGVLKATKNQVSFFPFGWGPRVCIGQNFAMMEAKIA  419

Query  310   IAMILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             +AMILQ +SFELSPSYAHAP S +++QPQYGA L+ R L
Sbjct  420   LAMILQHFSFELSPSYAHAPFSILTMQPQYGAHLILRGL  458



>ref|XP_009339348.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=525

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/501 (55%), Positives = 372/501 (74%), Gaps = 7/501 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMN-LSHDISPR  1502
             W +LNW WFRP+KL++ LR+QGL GN Y+ +FGDLK+++   K+A+SKP+N LSHDI P 
Sbjct  22    WSLLNWVWFRPKKLERYLRQQGLAGNSYRLLFGDLKEISMMHKQARSKPINHLSHDIVPH  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LPF    +   G+NSF+W+GP   V I  P  +RD+L +   + KP +NP+ K+L++G+
Sbjct  82    ILPFLHQTVITYGKNSFIWMGPTLRVNILNPEDLRDVLNRYDDFRKPLSNPITKVLSQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
                + +KW+KHR+IINPAFH++KLK MVP FY SC EM+   E  + ++GL E+DVWP L
Sbjct  142   VNIDGEKWTKHRKIINPAFHLDKLKFMVPIFYQSCSEMIDTWENLVANEGLFELDVWPWL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMR---SIYIPGWRFLPTWRNRRM  971
             Q + GD ISR AFGS+YEEG+KIF+L KEQA+    L+R   S+YIPGWRFLP+  N+RM
Sbjct  202   QSLAGDVISRAAFGSSYEEGKKIFQLLKEQARIGATLLRSATSVYIPGWRFLPSKMNKRM  261

Query  970   KKIEKQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHG-NKDFGITTRE  797
             K+I + ++ LI  II+KR + ++AG+  +KDDLL +LLESN NEI++HG NK+ G++  E
Sbjct  262   KEINRVIKVLIMDIINKRERTIKAGDDINKDDLLRMLLESNSNEIKEHGNNKNLGMSIEE  321

Query  796   VIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDK-PDIDGLNHMK  620
             VIEECKLFYFVGQETT+ LLVW MVLL  +Q WQ RAREEV ++ G +  P +D L H+ 
Sbjct  322   VIEECKLFYFVGQETTAALLVWAMVLLSHNQNWQNRAREEVLQVIGSNNTPTLDALIHLH  381

Query  619   IVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKE  440
             +VTMIL E LRLY P + ++R   + T+L  L LP GV + +P++L HHD+++WGDDA E
Sbjct  382   VVTMILLEVLRLYPPGVEVSRITHKTTQLRKLSLPAGVDVYVPILLVHHDKELWGDDADE  441

Query  439   FNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYA  260
             F PERFS GVSKAT  + T+ PFG GPRIC+G NFAM+EAKL +++ILQ ++FELS SYA
Sbjct  442   FKPERFSGGVSKATNNRFTYFPFGAGPRICIGQNFAMMEAKLALSLILQHFTFELSSSYA  501

Query  259   HAPTSTVSLQPQYGAPLLFRK  197
             H P +  +LQPQ GA ++ RK
Sbjct  502   HDPLTYTTLQPQSGAHIILRK  522



>ref|XP_009146334.1| PREDICTED: cytochrome P450 72A15 [Brassica rapa]
Length=512

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/497 (55%), Positives = 370/497 (74%), Gaps = 6/497 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR LNW WF+P+ L+  LR+QGL G+ Y  + GDLK+     K A+SKP+ L+ DI+PR
Sbjct  21    VWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNFSLLKNARSKPIKLTDDITPR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             L+P+ +  ++ +G   F WLGP P + I +P  I+++  K   + K  T PL +L+  G+
Sbjct  81    LVPYPLKMLKTHGRTYFTWLGPIPTITIVDPEQIKEVFNKVYDFPKTHTFPLARLIGTGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             A+Y+ DKW+KHRRIINPAFH+EK+K+MVPAF+ SC E++G  +K + D+GL+ EVDVWP 
Sbjct  141   ASYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGEWDKLVSDKGLSCEVDVWPG  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L  +  D ISRTAFGS+Y+EG++IFELQ E AQ   +  R   IPG+R+LPT  NR MK 
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYRYLPTKENRMMKA  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
               ++VQA++R I++KR++A EAGE   DDLLGILLESN  +++  GN   G++  +VIEE
Sbjct  261   KAREVQAILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVK--GN---GMSNEDVIEE  315

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTMVLL +HQ+WQ +AREEV ++FG   PDIDGLN +K++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPDIDGLNQLKVMTMI  375

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY PV  ++R   +E +LGDL LP GV IS+P++L  HD ++WG+DA EF PER
Sbjct  376   LYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTELWGNDAAEFKPER  435

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F EG+SKATK Q++F PF  GPRIC+G NFA+LEAK+ +A+ILQR+SFELSPSY HAP +
Sbjct  436   FKEGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYT  495

Query  244   TVSLQPQYGAPLLFRKL  194
              +++ PQ+GA L+  KL
Sbjct  496   VITIHPQFGAHLILHKL  512



>ref|XP_007149364.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
 gb|ESW21358.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
Length=520

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/497 (55%), Positives = 370/497 (74%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNL-SHDISPR  1502
             W +LNW WF P++L++ LR+QGL+GN Y  + GD K   K  KEA SKPMNL SHDI PR
Sbjct  21    WMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSHDIVPR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +  FF  +I  +G+NSF+W GP P V + +P LI+D+  K   + K   NP I LL  G+
Sbjct  81    VFSFFHHSINTHGKNSFIWFGPVPRVTLTDPELIKDVFNKTHDFQKINMNPQIWLLGPGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++  +KWSKHR+IINPAF++EKLK+M+P F     +++G  E+ +   G +E+DVWP L
Sbjct  141   LSHHGEKWSKHRKIINPAFNLEKLKNMLPLFIKCGDDLIGKWEEMLSLDGSSEMDVWPFL  200

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  DAISRTAFGS+YEEGR+IF+L KEQ++   +LM  +YIPGWRF+PT  +R+M  I
Sbjct  201   QNLTSDAISRTAFGSSYEEGRRIFQLLKEQSELTVQLMLEVYIPGWRFVPTATHRKMNAI  260

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEE  785
             +++++A ++ II+ R KA++AGE SK+ LL  LLESN  EI++ GN K+ G+   +VI E
Sbjct  261   DRKIKASLKDIINSREKALKAGEASKNYLLDTLLESNQKEIQEQGNNKNVGMNIEDVIGE  320

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTM+LL  + +WQTRAREEV ++FG  KPD DGLNH+KIVTM+
Sbjct  321   CKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQVFGNGKPDFDGLNHLKIVTMV  380

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             LNE LRLY P+I L R+  ++ +LG+L L  G+ + I +IL HHD ++WGDDAKEF PER
Sbjct  381   LNEVLRLYPPIIGLAREVCKDVKLGNLSLAAGMQVYISIILVHHDCELWGDDAKEFKPER  440

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F+EGV KAT G++   PFG GPRIC+G NF++LEAK+ ++MIL+ +SFELSP+Y HAPT+
Sbjct  441   FAEGVLKATNGKVALFPFGWGPRICIGQNFSLLEAKVALSMILRHFSFELSPTYTHAPTT  500

Query  244   TVSLQPQYGAPLLFRKL  194
              ++LQPQYGA L+ RK+
Sbjct  501   VITLQPQYGAQLILRKV  517



>gb|EYU38228.1| hypothetical protein MIMGU_mgv1a004669mg [Erythranthe guttata]
Length=516

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 367/496 (74%), Gaps = 2/496 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             + +NW W +P+KL+K LRK+GL GN YK + GD+KQL    KE + K +  S  + P +L
Sbjct  21    KFVNWVWIKPKKLEKLLRKEGLNGNPYKLLLGDMKQLISVMKEEQPKSIQFSDHLLPHIL  80

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P +     + GENSF+W+GP+P ++I +P L+++IL K  ++ KP  +P+ + +A G+  
Sbjct  81    PHYHHNRTKFGENSFMWVGPSPKLIIADPQLMKEILEKPNVFQKPHPDPIGETIAGGLVV  140

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKM-GDQGLAEVDVWPHLQ  1139
              E++KW+KHRRIINPAFHMEKLK MVPA  +SC  ML   E    G     E+DVWP+LQ
Sbjct  141   LEDEKWTKHRRIINPAFHMEKLKKMVPAIRLSCSNMLDQWEASFAGSDESKEIDVWPYLQ  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISR AFGS++E+G +IFELQK+Q +   EL++ +++PGWRF+PT  NRRMK I 
Sbjct  201   NLSGDVISRVAFGSSHEQGVRIFELQKDQVKLALELLKFMFVPGWRFVPTKANRRMKAIS  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK-DFGITTREVIEEC  782
             K++Q+L+R II++R KA+E GE   +DLLG L+ESN  EI+++G+K + G+T  EVI EC
Sbjct  261   KEIQSLLRDIINQREKAIEDGEVIGEDLLGTLMESNLREIDENGSKKNMGMTIEEVINEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF G E+TS LL+WTMV+L ++QEWQ RAREEV ++FG  +P  DGLN +KIVTMIL
Sbjct  321   KLFYFAGSESTSGLLMWTMVMLSKNQEWQARAREEVLQIFGNKEPTFDGLNRLKIVTMIL  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY+P   ++R   +  +LG++ LP GV + + + L HHD KIWGDDA EFNPERF
Sbjct  381   NEVLRLYSPAPLISRAPAKAVKLGNINLPVGVDLLLLIGLVHHDPKIWGDDANEFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             SEG+S ATKGQ +FLPF  GPRIC+GL FAM EAKL ++M+LQR++FELSPSY HAP   
Sbjct  441   SEGISGATKGQFSFLPFSLGPRICIGLQFAMTEAKLAVSMMLQRFAFELSPSYLHAPFPI  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++LQPQYGAPL+ RKL
Sbjct  501   LTLQPQYGAPLILRKL  516



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/497 (55%), Positives = 373/497 (75%), Gaps = 4/497 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNW W RP+KL+K LR+QGL+GN Y+ ++GD+K L K  KEA+SK MNL+ DI PR+
Sbjct  20    WRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLKMEKEARSKSMNLTDDIMPRV  79

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTN-PLIKLLAEGI  1322
             +P+    ++ +G+NSF+W G  P V++ EP  I D+L  N I   P  N  + KLL  G+
Sbjct  80    IPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVL--NNISDFPKNNHKIFKLLVSGL  137

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
             A+ E +KWSKHRR+INPAFH EKLK M P F+ SC +++   E+ +   G  E+D+WP L
Sbjct  138   ASLEGEKWSKHRRLINPAFHSEKLKVMTPTFFTSCNDLIRKWEEMLSPDGSCEIDIWPSL  197

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             Q +  D ISRT FGS+YEEGR+IF+LQ EQA+  T++  + YIP WRF+PT  NRR+ +I
Sbjct  198   QNLASDVISRTTFGSSYEEGRRIFQLQIEQAELMTKVQMNFYIPLWRFVPTMVNRRINEI  257

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK-DFGITTREVIEE  785
              K +++ ++ +I+KRVK ++ G  +K+DLLGIL+E+N  EI++HGN  + G+   +VI+E
Sbjct  258   GKDIKSSLKDMINKRVKILKEGGENKNDLLGILIETNHKEIKEHGNNVNVGMNIEDVIQE  317

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTS LLVWTMVLL R+ EWQ RAREEV ++FG  KP+ DGLN++KIVTMI
Sbjct  318   CKLFYFAGQETTSTLLVWTMVLLSRYPEWQARAREEVLQIFGNKKPNFDGLNNLKIVTMI  377

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E +RLY P+I L+R  ++  +LG+L L  GV + +P+IL HHD ++WGDDAK FNPER
Sbjct  378   LYEVMRLYPPIIELSRNVEKNVKLGNLTLSAGVEVFMPIILLHHDCELWGDDAKMFNPER  437

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FS G+SKAT G+++F PFG GPRIC+G NF++LEAK+ + +ILQ +SF+LSP+YAHAP +
Sbjct  438   FSGGISKATNGRVSFFPFGWGPRICIGQNFSLLEAKMAMTLILQHFSFQLSPAYAHAPAT  497

Query  244   TVSLQPQYGAPLLFRKL  194
              ++L+PQYGA ++ RKL
Sbjct  498   VIALKPQYGAHIILRKL  514



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/496 (54%), Positives = 370/496 (75%), Gaps = 2/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W+++NW W RPRKL+KC RKQG+ G+ Y+ ++GD K++ + TKEA  KP+ L+ DI PR+
Sbjct  21    WKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAELTKEAMLKPIKLTDDILPRI  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
              PF+   + + G + + W+GP P + + EP LI++I+T NTI+ KP   PL++LL  GI+
Sbjct  81    FPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTNNTIFKKPKPAPLVQLLVSGIS  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
             +YE++KW+KHR+IIN AF+ EKLK M+PA + SC +M+   E  + +    E+DV P+ +
Sbjct  141   SYEDEKWAKHRKIINTAFYAEKLKCMLPAMHTSCEDMINKWEILLSENKSYELDVHPYFE  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+Y EG +IF LQKE A+   +  +S+YIPGWR+LPT  NRRMK I+
Sbjct  201   DLTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSVYIPGWRYLPTRTNRRMKAID  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGS-KDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              +++ ++R I+ KR +AM+ GE S ++DLLGILL+SN  EI++ G K FG+TT EVIEEC
Sbjct  261   NELRDILRKIVSKRERAMKVGEASDEEDLLGILLKSNLKEIQEGGRK-FGMTTDEVIEEC  319

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             K+FYF GQE++S LL+WTMVLL  HQ WQ RAREEV ++F  +KPD +GL+ +KIVTMIL
Sbjct  320   KIFYFAGQESSSNLLIWTMVLLSMHQNWQARAREEVQQVFQNNKPDFEGLSRLKIVTMIL  379

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P     RK  +ET+LG++ +PP V++ IP I  HH+ ++WGDD KEF PERF
Sbjct  380   NEVLRLYPPAPYFVRKAYKETKLGNMSIPPEVILVIPTIFVHHNPELWGDDVKEFKPERF  439

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EG++ ATK +L FLPF  GPRIC+G NFA++E K+ +AMILQR++F+LSPSY HAPT  
Sbjct  440   AEGIATATKNRLCFLPFSWGPRICIGNNFAIMETKIALAMILQRFAFQLSPSYTHAPTYV  499

Query  241   VSLQPQYGAPLLFRKL  194
             V+L+PQ GA L+ +KL
Sbjct  500   VTLRPQCGAHLILQKL  515



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/498 (54%), Positives = 366/498 (73%), Gaps = 4/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             WRVLNW W RP+KL++CLR+QG  GN Y+ +FGD K  +   ++A+SKPM LS  HDI+P
Sbjct  21    WRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKPMKLSTSHDIAP  80

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             R++PF    ++  G NSFVW+GP P + I  P  +++I  K   + +P  NPLIKLL +G
Sbjct  81    RVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQNFQRPSANPLIKLLVQG  140

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +   E+ KW+KHR+II PAFH+EKLK M+P FY SC +M+   +  +   G  E DVWP 
Sbjct  141   LLHIEDVKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDMINEWKGLVSKDGSCEFDVWPC  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+ +  D I+R AFGS+Y+EGRKIF+L ++Q ++ + ++RS+YIPGWRFLPT  NRRMK+
Sbjct  201   LKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLVVRSVYIPGWRFLPTKHNRRMKE  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK-DFGITTREVIE  788
             I K++  L+R II+KR + ++ GE +KDDLLGIL+ESN  EI +HGNK D G++ ++VIE
Sbjct  261   INKEINVLLRGIINKREEEIKLGEDNKDDLLGILMESNLKEIREHGNKTDTGMSIQDVIE  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             EC+LFY  G E+TS LLVW M+LLG++Q WQ RAREEV + F  + P  + L+ +K+VTM
Sbjct  321   ECRLFYLAGSESTSTLLVWAMILLGQNQNWQARAREEVLQAFESNPPSFNALSQLKVVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             +L E LRLY   + L R   ++T+LG  +LP GVL+S+ ++  HHD+++WG+DA EF PE
Sbjct  381   VLLEVLRLYPAGVELPRTTCKKTQLGKFLLPAGVLVSLHIMFVHHDKELWGEDADEFKPE  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RFSEG+SKATK Q  + PFG GPRIC+G NFAM EAKL +A+ILQ ++FELSPSYAHAPT
Sbjct  441   RFSEGISKATKNQFAYFPFGAGPRICIGQNFAMQEAKLALALILQHFTFELSPSYAHAPT  500

Query  247   STVS-LQPQYGAPLLFRK  197
             +  + LQPQYGA ++ RK
Sbjct  501   TQGNLLQPQYGAHIILRK  518



>ref|XP_004295684.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 366/499 (73%), Gaps = 5/499 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLS--HDISP  1505
             W VL+W W +P+KL++CLR+QG KGN Y+ ++GD K  +    EAKSKPMN+S  HDI P
Sbjct  24    WSVLDWVWLKPKKLERCLREQGFKGNSYRILYGDTKDESIMRAEAKSKPMNISTSHDIGP  83

Query  1504  RLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEG  1325
             +L  F    ++  G+NSFVW+GP P V +  P  ++++ T++  + +P TNPLI LL  G
Sbjct  84    QLDAFVDKTVKSYGKNSFVWIGPIPRVNVMNPEELKEVFTRHEEFRRPITNPLILLLTSG  143

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGL-AEVDVWP  1148
             +   E +KW+KHRRIINPAFH EKLK M+PAF+ S  EM+   E  +  +G  AE+DVWP
Sbjct  144   LNFCEGEKWAKHRRIINPAFHFEKLKLMIPAFHQSFDEMIKEWESAVSKEGSSAELDVWP  203

Query  1147  HLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMK  968
              LQ +  D ISRTAFG+NY+EGR++FEL +EQ  H T+ + SIYIPGWRFLPT RN R+ 
Sbjct  204   SLQSMTADVISRTAFGTNYQEGRQMFELLREQTIHVTKALHSIYIPGWRFLPTKRNMRIN  263

Query  967   KIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHG--NKDFGITTREV  794
             KI K++  ++R II+ R +A  AGE S DDLLG L+ESN   I+++G  NK+ G++ ++V
Sbjct  264   KINKEINGIVRGIIENREQATRAGEASGDDLLGALMESNLKHIQENGKNNKNVGMSIQDV  323

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIV  614
             ++ECKLFYF GQETTSV+LVWTM+LL ++Q WQ  AR+EV ++ G  KPD DGL+H+K+V
Sbjct  324   MQECKLFYFAGQETTSVMLVWTMILLSQNQNWQDPARQEVLQVSGSKKPDYDGLSHLKVV  383

Query  613   TMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFN  434
             TMIL E LRLY    +  R   + T+LG   LP GV + +P++L HHD+++WGDDA EF 
Sbjct  384   TMILLEVLRLYPAGGATNRIVPKNTQLGKYSLPAGVEVRVPILLIHHDKELWGDDANEFK  443

Query  433   PERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHA  254
             PERF+EGVSKATK QL+++PFG GPRIC+G NF+M E KL +A+ILQ ++FELSPSYAH+
Sbjct  444   PERFAEGVSKATKNQLSYIPFGAGPRICIGQNFSMTEGKLALALILQHFTFELSPSYAHS  503

Query  253   PTSTVSLQPQYGAPLLFRK  197
             P    +LQPQYGAP++  +
Sbjct  504   PFYLFTLQPQYGAPIILHR  522



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/497 (54%), Positives = 365/497 (73%), Gaps = 6/497 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR+L W WF+P+ L+  LR QGL G  Y  + GD+K+ +    EA+SKP+ L+ DI+ R
Sbjct  21    IWRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNSNMLLEARSKPIKLTDDIASR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P+ +   + +G N F WLGP P + + +P LI+++  K   + KP   PL +L+A G+
Sbjct  81    VVPYPLQMAKTHGRNFFTWLGPIPSITLMDPELIKEVFNKIYNFQKPNVFPLGRLVATGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
              +Y++DKW+KHRRIINPAFH+EK+K MVPAF+ SC E++G  +K   D+GL+ EVDVWP 
Sbjct  141   FSYDDDKWAKHRRIINPAFHIEKIKSMVPAFHQSCSEVVGKWDKLASDKGLSCEVDVWPW  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L  + GD ISRTAFGS+Y+EG +IFELQ E  +   + ++  +IPG+R+LPT  NRRMK 
Sbjct  201   LGSLTGDVISRTAFGSSYKEGHRIFELQSELTELLIQAVQRFFIPGYRYLPTKDNRRMKV  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
               ++VQ ++R II+KR+ A EAGE   +DLLG LLESN  E      K  G++  +V+EE
Sbjct  261   AAREVQDILRGIINKRLAAREAGEAPSNDLLGTLLESNLGE-----GKGNGMSIEDVMEE  315

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTM+LL +HQ+WQ RAREEV + FG  +PD +GLNH+K++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQAFGDKEPDTEGLNHLKVMTMI  375

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
              NE LRLY PVI LTR   +ET+LGD+ LP GV I++P++L  HD ++WG+DA EF PER
Sbjct  376   FNEVLRLYPPVIQLTRAIHKETKLGDMTLPSGVHITLPILLVQHDTELWGNDAAEFKPER  435

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +G+SKATK Q++F PFG GPRIC+G N AMLEAK+ +A+ILQR+SFELSPSY HAP  
Sbjct  436   FKDGISKATKSQVSFFPFGWGPRICIGQNLAMLEAKMAMALILQRFSFELSPSYVHAPLP  495

Query  244   TVSLQPQYGAPLLFRKL  194
               ++ PQ+GAPL+  KL
Sbjct  496   VFTVHPQFGAPLILHKL  512



>ref|XP_010926800.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Elaeis guineensis]
Length=519

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/496 (54%), Positives = 362/496 (73%), Gaps = 2/496 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             R L W W+RPR+L+  LR QGL G  Y+F++GDLK   +  K A+SKPM LSH I PR+L
Sbjct  24    RALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDLKDNVRLQKAARSKPMPLSHCIGPRVL  83

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PFF  AI+ +G+ SF W GP P V++K+P L+R++L+ K   + KP  NPL KLLA G+A
Sbjct  84    PFFHQAIEDHGKISFTWFGPYPRVILKDPELVREVLSNKFGHFEKPNINPLGKLLARGVA  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHRRIINPAFH+EKLKHM+P     C E++   +  +G QG  E+DVWP  Q
Sbjct  144   DYEGEKWAKHRRIINPAFHLEKLKHMLPTLATCCDELINRWDNHLGSQGYCELDVWPAFQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISR AFGS+++EG++IF+LQ+EQ +   +  + IYIPG+RFLPT +N RM +I+
Sbjct  204   NFTGDVISRAAFGSSFKEGQRIFQLQQEQTELVVQAAQKIYIPGYRFLPTKKNNRMYEID  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFN-EIEKHGNKDFGITTREVIEEC  782
             ++++AL+  +I++R +AM     S DDLLG+L+ESN     E+ G+K+ G+T  +VIEEC
Sbjct  264   REIRALLSRMIEQRERAMRKAGVSNDDLLGLLIESNLRYSQEQGGSKNTGMTKDDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF G ETTSVLL WT+V+LG H  WQ RAREEV +++GK+KPD DGL+ ++IVTM+L
Sbjct  324   KLFYFAGHETTSVLLTWTVVVLGMHPSWQARAREEVLQVYGKNKPDYDGLSQLRIVTMVL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY  +  L R+  +E +LGD   PPGV + +P++  HHD + WGDDA EFNPERF
Sbjct  384   YEVLRLYPAITFLVRRTYKEMKLGDFTFPPGVQLLLPLLFIHHDPQFWGDDATEFNPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             + GVSKA+K Q TF PFGGGPRIC+G NFAM+EAK+ +A ILQ +S E S SYAHAP + 
Sbjct  444   ASGVSKASKIQGTFFPFGGGPRICIGQNFAMMEAKMALARILQHFSLEPSSSYAHAPYTV  503

Query  241   VSLQPQYGAPLLFRKL  194
             ++L PQYGA ++  +L
Sbjct  504   ITLHPQYGAQIMLHRL  519



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/497 (56%), Positives = 380/497 (76%), Gaps = 2/497 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR+LNWA+ RP++L+K LRKQGL GN Y  + GD+K++ K  +EA SKP+NL  DI PRL
Sbjct  22    WRLLNWAYLRPKRLEKILRKQGLNGNSYIPVSGDMKEMVKAMQEANSKPINLDDDIKPRL  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKP-FTNPLIKLLAEGI  1322
              PF ++ I+++G   F+W GP P+V+I E  LI+ +L K++++ KP   NPL+++ ++GI
Sbjct  82    QPFLLNTIRKHGNECFMWKGPTPVVVITETELIKQVLNKHSVFEKPRVLNPLVRMFSQGI  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              ++E+DKWSKHR+IINPAFH++KLK MVPAF++SC E+L   EK++  +G  E DV P+L
Sbjct  142   FSHEKDKWSKHRKIINPAFHLDKLKLMVPAFHLSCDEVLKEWEKRVSREGWCEFDVCPYL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
             + I  DAISRTAFGS+Y++GR++FELQ EQ+    + M+S+YIPG RFLPT RNRR+K+I
Sbjct  202   ESITSDAISRTAFGSSYKQGRRVFELQLEQSALIMKAMQSVYIPGSRFLPTKRNRRIKQI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              ++V++ IR +IDKR+ AM+AGE   +DLLG++L+SN  EIE++GN+ FG+T  +VIEEC
Sbjct  262   YEEVRSNIRGLIDKRIDAMKAGEAIDEDLLGLMLQSNLQEIEENGNRKFGMTIDQVIEEC  321

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQET S LLVW+++LL RH +WQ +AREE   + G++ P  D +N +KIV MIL
Sbjct  322   KLFYFAGQETISSLLVWSLILLSRHPDWQAKAREEAVHVLGEENPTFDAINRLKIVGMIL  381

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             +E LR Y PV++L R   EET+LG L LP GV +S+P+IL  HD   WG+DA EF+P RF
Sbjct  382   HEVLRHYPPVLALERSVGEETQLGRLTLPAGVRVSLPIILAQHDRGSWGEDAAEFDPGRF  441

Query  421   SEGVSKATK-GQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
              EGV+ A K G   F PFG GPRIC+GLNFAM+EAKLV+AM+L+R+SFELSPSY HAP +
Sbjct  442   GEGVTNAAKGGGGFFFPFGWGPRICIGLNFAMIEAKLVLAMMLRRFSFELSPSYTHAPMA  501

Query  244   TVSLQPQYGAPLLFRKL  194
              ++ +PQ+GA L  RKL
Sbjct  502   ALTTRPQHGAHLRLRKL  518



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/496 (55%), Positives = 359/496 (72%), Gaps = 1/496 (0%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++ +W WFRP+KL+K LR+QG  GN Y+ + GDLK+     +EA SKPMN S+ I+PR+
Sbjct  21    WKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPRV  80

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P     IQR G+NSF+WLGP P V I +P  ++ + +    + KP  NP  KLL +GI 
Sbjct  81    IPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGIV  140

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               + +KW KHR+IINPAFH+EKLK MVPAFY SC EM+   E  +  +G  E+DV P+L+
Sbjct  141   NLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSKEGSCELDVMPYLK  200

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISRTAFGS+YE+G+KIF+LQ E      +    IYIPGWRFLPT  NR+MK+I 
Sbjct  201   XMASDVISRTAFGSSYEKGKKIFKLQTELTNFVIQTTLGIYIPGWRFLPTKLNRKMKEIS  260

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKD-FGITTREVIEEC  782
             K++  LI  I+D+R K+M+AGE  + DLL IL+ESN NEI++HGNK   G++  +VIEEC
Sbjct  261   KEITTLILGIMDEREKSMKAGEAIQTDLLSILMESNMNEIKQHGNKKXIGMSIEDVIEEC  320

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFY  GQETT+ LLVWTM+LL  + EWQ RAR EVF +FG  +P+ DGLN +K+VTMI 
Sbjct  321   KLFYIAGQETTATLLVWTMILLSSYSEWQERARAEVFEIFGNKQPNYDGLNRLKVVTMIF  380

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
             NE LRLY P     R  ++ETRLG+L LP GV++ +P++L   D ++WG+DA EFNPERF
Sbjct  381   NEVLRLYPPGSLFVRIVRKETRLGNLTLPGGVMLGLPIVLIQRDPELWGEDAHEFNPERF  440

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             S GVSKATK    F+PFG GPRIC+G  FAM+EAK+ ++MILQR+SFELSPSY H+P ++
Sbjct  441   SGGVSKATKNPSAFIPFGWGPRICIGQTFAMIEAKMALSMILQRFSFELSPSYTHSPIAS  500

Query  241   VSLQPQYGAPLLFRKL  194
             ++ QPQ+GA ++  KL
Sbjct  501   LTTQPQHGAHIILHKL  516



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/497 (55%), Positives = 369/497 (74%), Gaps = 3/497 (1%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             R+LNW WFRP+KL+K LRKQGL+GN Y+F+ GD+K L   TKE ++K + LS  ++P +L
Sbjct  25    RILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKTLISVTKEEQTKSIQLSDHLAPHIL  84

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P++   I   G+NSF+W GP+P + I +P L+++ILTK  ++HKP  +P+ + +A G+  
Sbjct  85    PYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEILTKPEVFHKPLPDPIGETIAGGLLF  144

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMG-DQGLAEVDVWPHLQ  1139
              E++KW++HR+IINPAFHMEKLK+MV A  +SC  M+   E      +   E+DVWPHL+
Sbjct  145   LEDEKWAQHRKIINPAFHMEKLKNMVSAIRLSCSNMVEKWESMFSRSERSLEIDVWPHLE  204

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFGS++EEGR+IFEL +EQ +   EL++  +IPGWRF+PT  NRRM+ I 
Sbjct  205   SLSGDVISRTAFGSSHEEGRRIFELHREQVKLVLELLKFFFIPGWRFVPTKANRRMRAIS  264

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK--DFGITTREVIEE  785
             K++Q+L+R II++R KAME GE   DDLL  L+ESN  EIE+HG K  D G+   +VI E
Sbjct  265   KEIQSLLRGIINQREKAMERGETVGDDLLSTLMESNLKEIEEHGGKKKDVGMDIEDVINE  324

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF G ETTS+LLVWTMV+L +HQEWQ RAREEV ++FGK++P  +GLN +K+VT I
Sbjct  325   CKLFYFAGSETTSLLLVWTMVMLSKHQEWQVRAREEVSQVFGKNEPTFEGLNRLKVVTTI  384

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L+E LRLY PV  +TR   +  +LG++ LP GV + + + L HHD KIWGDD  +F PER
Sbjct  385   LHEVLRLYPPVPLITRAPTKTLKLGNITLPVGVDLILLIGLLHHDPKIWGDDVNQFKPER  444

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             FSEG+S ATKGQ +F+PF  GPR+C+G  FAM+EAKL + MILQ++SFELS SY HAP S
Sbjct  445   FSEGISSATKGQFSFIPFSAGPRVCVGQQFAMIEAKLALVMILQKFSFELSSSYLHAPFS  504

Query  244   TVSLQPQYGAPLLFRKL  194
              ++L+PQYGA L+  +L
Sbjct  505   ILTLRPQYGAALILHRL  521



>ref|XP_010676734.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/502 (53%), Positives = 366/502 (73%), Gaps = 6/502 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             LW++LN  W  P KL++CLR QGL G  Y+F+ GD+K+ +    EA  KP+  S+D   R
Sbjct  22    LWKLLNGIWLTPNKLERCLRNQGLAGKSYRFLIGDMKENSMLRSEAMKKPIPFSNDYFYR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + P     + + G N F W+GP P + I +P LIRD  T+   + KP  NPL +LLA G+
Sbjct  82    IQPLLHQLVTKAGSNCFTWMGPVPTIFITQPELIRDAFTRMNEFRKPKMNPLTELLAPGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE +KW+ HRR++NPAFH++KLK M+PAF  S  E++   E+ +   G +EVDVWPHL
Sbjct  142   VSYEGEKWANHRRLVNPAFHVQKLKLMLPAFETSVTEIMNKWEQIISKTGSSEVDVWPHL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
               +  DAISR AF S+YE+GRK+FEL  EQ +    L + +YIPGW++LPT   RRM  I
Sbjct  202   TTLTADAISRAAFCSSYEDGRKLFELLTEQKELVIRLFKFVYIPGWKYLPTKGKRRMNNI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEK----HGNKDFGITTREV  794
              +++Q++I+  IDKR KAMEAGE  KDDLLGI+L+SN+ E ++       + F +++RE+
Sbjct  262   NREIQSIIKTEIDKRKKAMEAGEAVKDDLLGIMLDSNYKETQQSKIGSNKQHFAMSSREI  321

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNH-MKI  617
             I+ECKLFY  GQETTSVLL WTM+LL +HQ+WQ RAREEV   FG ++PD DGLN+ +KI
Sbjct  322   IDECKLFYLAGQETTSVLLTWTMILLSKHQDWQIRAREEVLATFGNNQPDFDGLNNRLKI  381

Query  616   VTMILNESLRLYTPVISLTRKNKE-ETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKE  440
             VTMIL E LRLY  +++ +R+  + ET+LGDL++PPGV++S+ ++  H D  +WGDDAKE
Sbjct  382   VTMILYEVLRLYPSIVATSRRIYDCETKLGDLIIPPGVVVSLSILHAHLDPNVWGDDAKE  441

Query  439   FNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYA  260
             FNPERFSEG++KATKG  ++ PFG GPRIC+G NFA++EAKLV++MILQR++FELSPSY 
Sbjct  442   FNPERFSEGIAKATKGISSYFPFGWGPRICIGQNFALIEAKLVLSMILQRFAFELSPSYT  501

Query  259   HAPTSTVSLQPQYGAPLLFRKL  194
             HAPT+ ++LQPQ+GA L+  +L
Sbjct  502   HAPTTLLALQPQHGAYLILHRL  523



>ref|XP_010676732.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/502 (53%), Positives = 366/502 (73%), Gaps = 6/502 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             LW++LN  W  P KL++CLR QGL G  Y+F+ GD+K+ +    EA  KP+  S+D   R
Sbjct  22    LWKLLNGIWLTPNKLERCLRNQGLTGKSYRFLIGDMKENSMLRSEAMKKPIPFSNDYFHR  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             + P     + + G N F W+GP P + I +P LIRD  T+   + KP  NPL +LLA G+
Sbjct  82    IQPLLHQLVTKAGSNCFTWMGPVPTIFITQPELIRDAFTRMNEFRKPKMNPLTELLAPGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
              +YE +KW+ HRR++NPAFH++KLK M+PAF  S  E++   E+ +   G +EVDVWPHL
Sbjct  142   VSYEGEKWANHRRLVNPAFHVQKLKLMLPAFETSVTEIMNKWEQIISKTGSSEVDVWPHL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
               +  DAISR AF S+YE+GRK+FEL  EQ +    L + +YIPGW++LPT   RRM  I
Sbjct  202   TTLTADAISRAAFCSSYEDGRKLFELLTEQKELVIRLFKFVYIPGWKYLPTKGKRRMNNI  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEK----HGNKDFGITTREV  794
              +++Q++I+  IDKR KAMEAGE  KDDLLGI+L+SN+ E ++       +   +++RE+
Sbjct  262   NREIQSIIKTEIDKRRKAMEAGEAVKDDLLGIMLDSNYKETQQSKICSNKQHLAMSSREI  321

Query  793   IEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNH-MKI  617
             I+ECKLFY  GQETTSVLL WTM+LL +HQ+WQTRAREEV   FG ++PD DGLN+ +KI
Sbjct  322   IDECKLFYLAGQETTSVLLTWTMILLSKHQDWQTRAREEVLATFGNNQPDFDGLNNRLKI  381

Query  616   VTMILNESLRLYTPVISLTRKNKE-ETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKE  440
             VTMIL E LRLY  +++ +R+  + ET+LGDL++PPGV++S+ ++  H D  +WGDDAKE
Sbjct  382   VTMILYEVLRLYPSIVATSRRIYDCETKLGDLIIPPGVVVSLSILHAHLDPNVWGDDAKE  441

Query  439   FNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYA  260
             FNPERFSEG++KATKG  ++ PFG GPRIC+G NFA++EAKLV++MILQR++FELSPSY 
Sbjct  442   FNPERFSEGIAKATKGISSYFPFGWGPRICIGQNFALIEAKLVLSMILQRFTFELSPSYT  501

Query  259   HAPTSTVSLQPQYGAPLLFRKL  194
             HAPT+ ++LQPQ+GA L+  +L
Sbjct  502   HAPTTLLALQPQHGAYLILHRL  523



>gb|AGX93044.1| secologanin synthase-like protein, partial [Lonicera japonica]
Length=520

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/498 (55%), Positives = 368/498 (74%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVLNWAWF P+KL+K LR QG KGN Y+F+ GD+K+     ++A SKP+  S+DI PR+
Sbjct  23    WRVLNWAWFTPKKLEKKLRDQGFKGNPYRFLVGDVKESAAMLEQAMSKPIPYSNDIVPRI  82

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT--NPLIKLLAEG  1325
             +P     I+  G+NSF W+G  P + I +P LIR++LT +T + K F   NPL K L  G
Sbjct  83    MPHIDHTIKTFGDNSFTWMGRIPRIHIMDPELIREVLTHSTKFVKNFDVHNPLAKFLLTG  142

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + ++E DKW  HRRII+PAF ++KLK M+PAF +S  E+L + E    + G  EVDV+P 
Sbjct  143   VGSFEGDKWRMHRRIISPAFTLDKLKGMLPAFAISYDELLSHWETVAHNYGSHEVDVFPT  202

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
                +  D IS+ AFGSNY+EG KIF+L KE       +MR +YIPGW +LPT  N RMK+
Sbjct  203   FDTLTSDVISKVAFGSNYDEGGKIFQLLKELMDLTIMVMRDVYIPGWSYLPTKTNNRMKE  262

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK-DFGITTREVIE  788
             I  ++++++R II+KRVKAM+AGE S+DDLLG+LL+SNF EI++ GNK + G+T  +VIE
Sbjct  263   INNELKSMLRKIINKRVKAMKAGEASEDDLLGVLLDSNFKEIQRLGNKKNAGMTIDDVIE  322

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETT +LL WTMV+L +H EWQ RAREEV   FGK KPD + LN +K+V M
Sbjct  323   ECKLFYFAGQETTGILLTWTMVMLSKHPEWQDRAREEVISAFGKSKPDFERLNQLKVVGM  382

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY PVI LT+   EET+LGDL +PPGV I +P ++ H ++KIWGDDA EFNP 
Sbjct  383   ILYEVLRLYPPVIDLTKIVHEETKLGDLSIPPGVQIMLPTVMLHREKKIWGDDAMEFNPS  442

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF++GV+ ATK  ++++PF  GPR+C+G NFA+L+AKL +AMILQR++F+LSPSY HAP 
Sbjct  443   RFADGVANATKNNVSYIPFSWGPRVCIGQNFALLQAKLGLAMILQRFTFDLSPSYTHAPM  502

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQ+GA +++RK+
Sbjct  503   TILTLQPQHGAHVIYRKI  520



>gb|KHG18227.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/498 (54%), Positives = 366/498 (73%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR LNW W  P++L++CL+++G  GN Y+F+ GD+K+    +++ ++KPM +S DI   +
Sbjct  24    WRALNWVWLTPKRLERCLKQEGFAGNPYRFLSGDIKESFTMSRQTRAKPMPVSDDIEAYV  83

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             LPF    I+ +G NSF+W+GP P V I +P  IR+I TK T + K  +NPL + L  G++
Sbjct  84    LPFLHQTIKNHGNNSFMWIGPRPRVTIMDPEKIREIFTKFTDFQKLHSNPLARFLVGGLS  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
               E D+WSKHR+I+NPAFH +KLK+M+PAFY SC EM+   E+ +  +G +E+DVWP++ 
Sbjct  144   NLEGDQWSKHRKIVNPAFHQDKLKNMLPAFYQSCNEMISKWEEMVSKEGYSELDVWPYIV  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              +  D ISR AFGS+YEEGR+IF+L ++      ++ +S+YIPGWRFLPT  NR +K   
Sbjct  204   NMTRDVISRAAFGSSYEEGRRIFQLLEDLTSLTIKVFQSVYIPGWRFLPTKTNRELKMKH  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K ++  +R +I +R KA++AGE S +DLL IL+ESN  E+E    K  G++  +VIEECK
Sbjct  264   KDIKESLREMIKRREKAIKAGEESNEDLLDILVESNIREMEA---KHMGMSIEDVIEECK  320

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF GQETTSVLLVWTMVLL R+ +WQT+AR+EV  + G  KPD DGLN +K+VTMIL 
Sbjct  321   LFYFAGQETTSVLLVWTMVLLARYPDWQTKARDEVLHVLGDRKPDADGLNRLKVVTMILY  380

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PV+SL R   +E ++G L+LP G  + IP++  HHD+  WGDDA EF PERF+
Sbjct  381   EVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKDHWGDDAHEFRPERFA  440

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKATK Q+TFLPFG GPRIC+G NFAM+E K+ +AMILQR+ FELSPSYAH+P +T+
Sbjct  441   EGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFWFELSPSYAHSPCTTM  500

Query  238   SLQPQYGAPLLFRKL*SR  185
             +L+PQ+GA ++  KL S+
Sbjct  501   TLRPQHGAQIILHKLGSK  518



>emb|CBI39917.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 353/453 (78%), Gaps = 1/453 (0%)
 Frame = -1

Query  1549  EAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIY  1370
             EA S+P++ S DI  R+LPF   +IQ+ G+N+F+WLGP P+V I +P LI D+L K+  +
Sbjct  4     EANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHNAF  63

Query  1369  HKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEK  1190
              K   +PL KLLA GIA+ E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EK
Sbjct  64    QKAPRHPLRKLLASGIASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEK  123

Query  1189  KMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIP  1010
             ++   G  E+D+WP+LQ + GD ISRTAFGS+YEEGR+IF+LQKEQA    ++ RS+Y+P
Sbjct  124   QLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSVYVP  183

Query  1009  GWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH  830
             GWRF PT  NRRM++I  +V AL++ II+KR KAM+AGE + DDLLG+L+ESN+ E++++
Sbjct  184   GWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQEN  243

Query  829   GN-KDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKD  653
                K+ G++ ++VIEECKLFY  GQETTSVLL+WTMVLL +H  WQ  AREEV R+FG  
Sbjct  244   DERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQACAREEVLRVFGNK  303

Query  652   KPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHH  473
             KPD D LNH+KIVTMI +E LRLY PV  LTR    ++++G L LP GV I++P++L HH
Sbjct  304   KPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQVGGLYLPDGVQIALPILLIHH  363

Query  472   DEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQ  293
             D+KIWG+DAKEFNP RFSEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQ
Sbjct  364   DDKIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQ  423

Query  292   RYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             R+SFELSPSYAHAP S +++QPQ+GA L+   L
Sbjct  424   RFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  456



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/498 (55%), Positives = 357/498 (72%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             W++++W WFRP+KL+K LR+QG  GN Y+ ++GDLK+      +A SKPMN S+ I+PR+
Sbjct  28    WKLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMNFSNHIAPRV  87

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT--NPLIKLLAEG  1325
             +P     IQ  G+NSF+W+GP P V I +P  ++ + +    Y KP    NPL KLLA+G
Sbjct  88    IPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLADG  147

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             +  +E  KW KHR+IINPAFH+EKLK MVPAFY SC EM+   E  +  QG  E+DV P+
Sbjct  148   LLNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVQGSCELDVMPY  207

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             LQ +  D ISRTAFGS+YE+G+KIF+LQ E A+        IYIPGWRFLPT  N +MK 
Sbjct  208   LQNMTADVISRTAFGSSYEKGKKIFKLQTELAEMVIRSTLGIYIPGWRFLPTKSNNKMKV  267

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             I K++  LI  II++R  +M+AGE ++ DLL IL+ESN NEI++HGN KD G++  +VI+
Sbjct  268   ISKEISTLIMGIINERETSMKAGEATQTDLLSILMESNLNEIKQHGNNKDIGMSIEDVID  327

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFY  GQETT+ LL WTMVLL  + EWQ RAR EVF +FG  KPD DGL+ +K+VTM
Sbjct  328   ECKLFYIAGQETTATLLTWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLSRLKVVTM  387

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             ILNE LRLY PV    R  K+ET+LG L LP GV++ +P +L   D ++WG+DA EF PE
Sbjct  388   ILNEVLRLYPPVSMFGRFIKKETKLGKLTLPAGVMLGLPTVLIQCDPELWGEDAHEFKPE  447

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF EGVSKATK    F+PFG GPRIC+GLNFAM+EAK+ ++MILQR+S ELS SY HAP 
Sbjct  448   RFFEGVSKATKNSGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLELSSSYTHAPI  507

Query  247   STVSLQPQYGAPLLFRKL  194
               ++ QPQ+GA ++  KL
Sbjct  508   VAITTQPQHGAHIILHKL  525



>ref|XP_010926808.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Elaeis guineensis]
Length=519

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/496 (54%), Positives = 361/496 (73%), Gaps = 2/496 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             R L W W+RPR+L+  LR QGL G  Y+F++GDLK   +  K A+SKPM LSH I PR+L
Sbjct  24    RALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDLKDNVRLQKAARSKPMPLSHCIGPRVL  83

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIA  1319
             PFF  AI+ +G+ SF W GP P V++K+P L+R++L+ K   + KP  NPL KLLA G+A
Sbjct  84    PFFHQAIEDHGKISFTWFGPYPTVILKDPELVREVLSNKFGHFEKPNINPLGKLLARGVA  143

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQ  1139
              YE +KW+KHRRIINPAFH+EKLKHM P F   C E++   +  +G Q   E+DVWP  Q
Sbjct  144   DYEGEKWAKHRRIINPAFHLEKLKHMFPTFATCCDELINRWDNHVGSQAYCELDVWPEFQ  203

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
                GD ISR AFGS+++EG++IF+LQ+EQ +   +  ++IYIPG+RFLPT +N RM +I 
Sbjct  204   NFTGDVISRVAFGSSFKEGQRIFQLQEEQMELLVQAAQNIYIPGYRFLPTKKNNRMYEIY  263

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFN-EIEKHGNKDFGITTREVIEEC  782
             ++++AL+  +I++R +AM     + DDLLG+L+ESN     E+ G+K+ G+T  +VIEEC
Sbjct  264   REIRALLSRMIEQRERAMRKSGATNDDLLGLLIESNLRYSQEQGGSKNTGMTKDDVIEEC  323

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF G +TT VLL WT+V+LG H  WQ RAR+EV +++GK+KPD DGL+ ++IVTMIL
Sbjct  324   KLFYFAGHKTTLVLLTWTVVILGMHPSWQARARKEVLQVYGKNKPDYDGLSQLRIVTMIL  383

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P I L R+  +E +LGD   PPGV + +P++  HHD + WGDDA EFNPERF
Sbjct  384   YEVLRLYPPAIFLLRRTYKEMKLGDFTFPPGVQLLLPLLFIHHDPQFWGDDATEFNPERF  443

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             + GVSKA+K Q TF PFGGGPRIC+G NFAM+EAK+ +A ILQ +S E S SYAHAP + 
Sbjct  444   ASGVSKASKIQGTFFPFGGGPRICIGQNFAMMEAKMALARILQHFSLEPSSSYAHAPYTV  503

Query  241   VSLQPQYGAPLLFRKL  194
             ++L PQYGA ++  +L
Sbjct  504   ITLHPQYGAQIMLHRL  519



>emb|CBI39937.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/453 (59%), Positives = 348/453 (77%), Gaps = 1/453 (0%)
 Frame = -1

Query  1549  EAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIY  1370
             EA S+P++ S DI  R+LPF   +IQ+ G+NSF W GP P+V I EP LIRD+L K+ ++
Sbjct  4     EANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVF  63

Query  1369  HKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEK  1190
              KP  +PL KLLA G+   E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EK
Sbjct  64    QKPPPHPLSKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEK  123

Query  1189  KMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIP  1010
             K+   G  E+DVWP+L+ + GD ISRTAFGS+YEEGR+IF+LQ+EQA    ++ RSIY+P
Sbjct  124   KLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVP  183

Query  1009  GWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH  830
             GWRF PT  NRRM++I  +V AL++ II+KR KAM+ GE +  DLLG+L+ESN+ +++++
Sbjct  184   GWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQEN  243

Query  829   GN-KDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKD  653
                K+ G++ ++VIEECKLFY  GQETTSVLL+WTMVLL +H  WQT AREEV R+FG  
Sbjct  244   DERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVFGNK  303

Query  652   KPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHH  473
             KPD DGLNH+KIVTMI +E LRLY PV  L R    ++++G L LP GV I++P++L HH
Sbjct  304   KPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHH  363

Query  472   DEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQ  293
             D +IWG+DAKEFNP RFSEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQ
Sbjct  364   DHEIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQ  423

Query  292   RYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             R+SFELSPSYAHAP S ++  PQYGA L+   L
Sbjct  424   RFSFELSPSYAHAPISLLTTHPQYGAHLILHGL  456



>ref|XP_008804072.1| PREDICTED: cytochrome P450 72A15-like [Phoenix dactylifera]
Length=523

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/495 (54%), Positives = 364/495 (74%), Gaps = 3/495 (1%)
 Frame = -1

Query  1672  VLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLLP  1493
              L WAW+RPR+L++ LR QGLKG  Y+F++GDL+   +  KEA+S PM  SH I PR+LP
Sbjct  28    ALEWAWWRPRRLERALRAQGLKGTRYRFLYGDLRDYDRLNKEARSMPMAFSHQIIPRVLP  87

Query  1492  FFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIAT  1316
                 AI++NG+ SF W GP+P V I +PGL R+IL+ K   + KP +NPL +LLA G+A+
Sbjct  88    HLHQAIKKNGKTSFTWFGPDPRVAIMDPGLTREILSNKFGHFEKPNSNPLGRLLAGGLAS  147

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQ  1136
             YE +KW+KHRRIINPAFH+EKLK M+PAF   C E++   ++ +  +G  E+DVWP  Q 
Sbjct  148   YEREKWAKHRRIINPAFHLEKLKCMLPAFSTCCDELIDKWDRLVASKGSCELDVWPEFQS  207

Query  1135  IGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEK  956
                D ISRTAFGSN+ EG++IF LQ+EQA+     +++IYIPG+RFLPT +N+RMK+I  
Sbjct  208   FTADVISRTAFGSNFREGQRIFHLQEEQAELVIPALQNIYIPGFRFLPTKKNKRMKEINI  267

Query  955   QVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH--GNKDFGITTREVIEEC  782
             ++Q+L+R +ID+R  A+  G  S +DLLG+L+ESNF   +++  G+K+ G++  +VIEEC
Sbjct  268   EIQSLLRSMIDRREVAIRKGGTSNEDLLGLLMESNFRHSKENEGGSKNSGMSIEDVIEEC  327

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF G ETTSVLL WT+V L  H  WQ RAREEV ++FG +KPD DGL+ +KIVTM+L
Sbjct  328   KLFYFAGHETTSVLLTWTLVALSLHPSWQARAREEVLQVFGGNKPDYDGLSRLKIVTMVL  387

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY P + L R   +E +LG    P GV + +P+I  HHD + WG+DA EFNPERF
Sbjct  388   YEVLRLYPPAVFLLRMTYKEMKLGQFTFPEGVQLLLPIIFIHHDPEFWGEDASEFNPERF  447

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
             +EGVSKA+K Q  F+PFGGGPRIC+G +FAM+EAK+ +A ILQ ++F+LSPSYAHAP + 
Sbjct  448   AEGVSKASKIQGAFIPFGGGPRICIGQSFAMMEAKMALARILQHFTFQLSPSYAHAPYTV  507

Query  241   VSLQPQYGAPLLFRK  197
              +L PQ+GA ++  +
Sbjct  508   ATLHPQHGAQIILHR  522



>ref|XP_009339365.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=526

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/502 (54%), Positives = 368/502 (73%), Gaps = 8/502 (2%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMN-LSHDISPR  1502
             W +LNW WFRP+KL++ LR+QGL GN Y+ +FGDLK+ +   K+A+SKPMN LSHDI P 
Sbjct  22    WSLLNWVWFRPKKLERYLRQQGLGGNSYRLLFGDLKESSMMHKQARSKPMNHLSHDIVPH  81

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             +LPF    +   G+NSF+W+GP   V I  P  +RD+L +   + KP +NP+ ++L +G+
Sbjct  82    ILPFLHQTVITYGKNSFIWMGPTLRVNILNPEDLRDVLNRYDDFRKPLSNPITRVLPQGL  141

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHL  1142
                + +KW+KH+RIINPAFH+EKLK MVP FY  C EM+   E  + ++GL E+DVWP L
Sbjct  142   VNIDGEKWTKHKRIINPAFHLEKLKVMVPTFYQCCSEMIDTWENLVANEGLYELDVWPWL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMR----SIYIPGWRFLPTWRNRR  974
             Q + GD +SR AFGS+YEEG+KIF+L KE A+    L+R    S+YIPGWRFLP+  N+R
Sbjct  202   QSLAGDVLSRAAFGSSYEEGKKIFQLLKEHARIGATLLRRSLTSVYIPGWRFLPSKMNKR  261

Query  973   MKKIEKQVQALIRCIIDKRVKAMEAGEG-SKDDLLGILLESNFNEIEKHGN-KDFGITTR  800
             MK+I K+++ LI  II+KR   ++AG+  +KDDLLG+LLESN  EI++HGN K+ G++  
Sbjct  262   MKEINKEIRVLIMDIINKREGTIKAGDNINKDDLLGVLLESNSKEIKEHGNHKNVGMSIE  321

Query  799   EVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDK-PDIDGLNHM  623
             EVIEECKLFYFVGQETT+  LVW MVLL  +Q WQ RAREEV ++ G +  P  D L H+
Sbjct  322   EVIEECKLFYFVGQETTAAFLVWAMVLLSHNQNWQNRAREEVLQVIGSNNTPTFDELMHL  381

Query  622   KIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAK  443
             ++VTMIL E LRLY P + ++R   ++T+LG L LP GV + +P++L HHD+++WGDDA 
Sbjct  382   RVVTMILLEVLRLYPPGVEVSRITHKKTQLGKLSLPAGVDVYVPILLVHHDKELWGDDAD  441

Query  442   EFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSY  263
             EF PERFS GVS AT  + T+ PFG GPRIC+G NFAM+E KL +++ILQ ++FELS SY
Sbjct  442   EFKPERFSGGVSNATNNRFTYFPFGAGPRICIGQNFAMMEEKLALSLILQHFTFELSSSY  501

Query  262   AHAPTSTVSLQPQYGAPLLFRK  197
             AH P++  +LQPQ+GA ++  K
Sbjct  502   AHDPSTYATLQPQFGAHIILHK  523



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/497 (54%), Positives = 366/497 (74%), Gaps = 6/497 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR L W WF+P+ L+  LR+QGL G  Y  + GDLK+      EA+SKP+ L+ DISPR
Sbjct  21    IWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNFTMLSEARSKPLKLTDDISPR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P+ +   +  G   F W GP P + I +P  I+++  K   + KP T PL  ++A+G+
Sbjct  81    VVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVFNKVYDFQKPHTFPLATIIAKGL  140

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             A Y+ DKW+KHRRIINPAFH+EK+K+MVPAF+ SC E++G  ++ + D+G + EVDVWP 
Sbjct  141   ANYDGDKWAKHRRIINPAFHIEKIKNMVPAFHQSCREVVGEWDQLVSDKGSSCEVDVWPG  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L  +  D ISRTAFGS+Y+EG++IFELQ E AQ   +  R  +IPG+ +LPT  NRRMK 
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYSYLPTKSNRRMKA  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
               +++Q ++R I++KR++A EAGE   DDLLGILLESN  + E  GN   G++T +++EE
Sbjct  261   AAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLRQTE--GN---GMSTEDLMEE  315

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTMVLL +HQ+WQ RAREEV ++FG  +PD +GLN +K++TMI
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMI  375

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY PV  LTR   +E +LGDL LP GV IS+P++L  HD ++WG+DA EFNP+R
Sbjct  376   LYEVLRLYPPVTQLTRAIHKELKLGDLTLPGGVQISLPILLVQHDIELWGNDAAEFNPDR  435

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +G+SKATK Q++F PF  GPRIC+G NFA+LEAK+ +A+IL+R+SFE+SPSY HAP +
Sbjct  436   FKDGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILRRFSFEISPSYVHAPYT  495

Query  244   TVSLQPQYGAPLLFRKL  194
              +++ PQ+GA L+  KL
Sbjct  496   VITIHPQFGAQLIMHKL  512



>gb|KCW67648.1| hypothetical protein EUGRSUZ_F01396 [Eucalyptus grandis]
Length=519

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/503 (56%), Positives = 370/503 (74%), Gaps = 16/503 (3%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRV+NW W RP++L++ LR+QGL G  Y F+FGDLK+ ++   EA SKP+ +S DI PRL
Sbjct  22    WRVVNWVWVRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAISDDIKPRL  81

Query  1498  LPFFIDAIQRNG---------ENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPL  1346
              PF   + Q            ++SF+W+GP P V I  P  +++I +    Y KP +NPL
Sbjct  82    FPFLHQSSQTYAMHFFIVSLRKDSFMWIGPTPRVRITNPEQLKEIFSNINDYPKPASNPL  141

Query  1345  IKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA  1166
             +KLL +G+A +E +KW +HR+IINPAFHMEKLK M+PAFY SC EM+G  EK +  +   
Sbjct  142   VKLLVDGLANHEGEKWVRHRKIINPAFHMEKLKLMLPAFYSSCAEMVGRWEKLVSVERSC  201

Query  1165  EVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTW  986
             E+D W  LQ +  + +SRTAFGS+ EEG++I ELQ EQAQ      +S+YIPGWRF+PT 
Sbjct  202   EIDAWVDLQNLTREVLSRTAFGSSLEEGKRICELQGEQAQLTIIAFQSVYIPGWRFVPTK  261

Query  985   RNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGIT  806
              NRRMK I+K+V+AL+  II +R KA+  GE + DDLLG+LLESN  E       + G++
Sbjct  262   MNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMS  314

Query  805   TREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNH  626
               +VIEECKLFYF GQETTSVLLVWTMVLL  H +WQ RAREEV R+FG  KPD DGL+H
Sbjct  315   LHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLRIFGSGKPDPDGLSH  374

Query  625   MKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDA  446
             +KIVTMILNE LRLY P   L R+  +ET+LG L +P GV +S+P +L HHD+++WG+DA
Sbjct  375   LKIVTMILNEVLRLYPPATDLVREVLKETKLGKLTIPTGVQLSMPTLLIHHDKELWGEDA  434

Query  445   KEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPS  266
             +EF PERF+EGVSKATK Q++F PFG GPRIC+G NFA++EAK+ +AMILQ+++FELSPS
Sbjct  435   EEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPS  494

Query  265   YAHAPTSTVSLQPQYGAPLLFRK  197
             YAHAP++ ++LQP+YG  ++ RK
Sbjct  495   YAHAPSNVITLQPRYGVQVILRK  517



>emb|CBI39923.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 349/453 (77%), Gaps = 1/453 (0%)
 Frame = -1

Query  1549  EAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIY  1370
             EA S+P++ S DI  R+LPF   +IQ+ G+NSF WLGP P+V I EP LIRD+  K+  +
Sbjct  4     EANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAF  63

Query  1369  HKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEK  1190
              K   +PL KLLA G+   E ++W+K R+IINPAFH+EKLKHMV AF +SC +M+   EK
Sbjct  64    QKVPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEK  123

Query  1189  KMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIP  1010
             K+   G  E+DVWP+L+ + GD ISRTAFGS+YEEGR+IF+LQ+EQA    ++ RSIY+P
Sbjct  124   KLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVP  183

Query  1009  GWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKH  830
             GWRF PT  NRRM++I  +V AL++ II+KR KAM+ GE +  DLLG+L+ESN+ +++++
Sbjct  184   GWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQEN  243

Query  829   GN-KDFGITTREVIEECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKD  653
                K+ G++ ++VIEECKLFY  GQETTSVLL+WTMVLL +H  WQTRAREEV R+FG  
Sbjct  244   DERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVFGNK  303

Query  652   KPDIDGLNHMKIVTMILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHH  473
             KPD DGLNH+KIVTMI +E LRLY PV  L R    ++++G L LP GV I++P++L HH
Sbjct  304   KPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILLLHH  363

Query  472   DEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQ  293
             D +IWG+DAKEFNP RFSEGVSKA K Q++F PFG GPRIC+G NFAM+EAK+ +AMILQ
Sbjct  364   DHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQ  423

Query  292   RYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             R+SFELSPSYAHAP S +++QPQYGA L+   L
Sbjct  424   RFSFELSPSYAHAPISLITMQPQYGAHLILHGL  456



>ref|XP_011098146.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=517

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/495 (53%), Positives = 363/495 (73%), Gaps = 1/495 (0%)
 Frame = -1

Query  1675  RVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLL  1496
             ++LNW WFRP+KL+K LRKQGL GN Y+   GD++ L+   K  + K + LS D+ P +L
Sbjct  23    KLLNWVWFRPKKLEKLLRKQGLNGNPYRLFRGDMQDLSNVMKTKQPKTLKLSDDLPPHIL  82

Query  1495  PFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIAT  1316
             P++ + I + G++SF+W+GP+P + + +P  I++IL+K  ++HKP  +P+ + +  G+A 
Sbjct  83    PYYHNIIDKYGKHSFIWVGPSPRLNVADPEHIKEILSKPGLFHKPLPDPIGETIVGGLAY  142

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPHLQ  1139
              E+D+W+KHRRI+NPAFHMEKLK+M+PA ++SC +++   E  +   G + E+DVWP+LQ
Sbjct  143   LEDDRWAKHRRIMNPAFHMEKLKNMIPAMFLSCSKLIEKWEASISGSGSSQEIDVWPYLQ  202

Query  1138  QIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIE  959
              + GD ISRTAFG +YEEGR+IFELQ+EQ +    L    ++PGWR+ PT  NR+++ I 
Sbjct  203   DLTGDVISRTAFGRSYEEGRRIFELQREQVKLVLHLFPFSFLPGWRYFPTKANRKLRAIT  262

Query  958   KQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEECK  779
             K++Q+L+R II++R +AM  GE    DLLGIL+ESN  EI++HGNK+ G++  +VIEECK
Sbjct  263   KEIQSLVRGIINQREQAMARGEIIHMDLLGILMESNSREIQQHGNKNAGLSIEDVIEECK  322

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF G ++TS LLVWTMVLL  HQ+WQ RAREEV ++FGK +P  DGL+ +KIVTMI  
Sbjct  323   LFYFAGSDSTSTLLVWTMVLLSNHQDWQARAREEVLKVFGKKQPTFDGLHQLKIVTMIFQ  382

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY P   + R   +  +LG   +P GV +++ + L HHD  IWG+D KEF PERFS
Sbjct  383   EVLRLYPPAPLIIRAPTKTVQLGSTTIPVGVQLTLLIGLLHHDPNIWGNDVKEFKPERFS  442

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EG+S ATK Q +F+PF  GPR+C+G NFAM+EAK+ +AMILQ +SFELS SY HAP    
Sbjct  443   EGISSATKTQYSFIPFSAGPRVCVGQNFAMIEAKMALAMILQHFSFELSSSYLHAPFPIF  502

Query  238   SLQPQYGAPLLFRKL  194
             +LQPQYGAPL+ RKL
Sbjct  503   TLQPQYGAPLIVRKL  517



>ref|XP_010683652.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=481

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/479 (55%), Positives = 357/479 (75%), Gaps = 1/479 (0%)
 Frame = -1

Query  1627  LRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFV  1448
             LRKQG  GN Y+ ++GD+K+ +K  KEA S P+ +S DI PR+ PF    ++  G+NSFV
Sbjct  3     LRKQGFSGNRYRLLYGDMKESSKMAKEAISSPIEISDDIVPRVQPFTHQIVKNFGKNSFV  62

Query  1447  WLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIATYEEDKWSKHRRIINPA  1268
             W GP P V I EP +I+++L +   + KP  NP++K+  +G+  YE  KW+KHR+I+NPA
Sbjct  63    WFGPVPCVNIMEPQMIKEVLMRYEEFQKPNINPILKMFVKGLVVYEGQKWAKHRKILNPA  122

Query  1267  FHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYE  1088
             FHMEKLK ++  FY+SC +M+   E+ +   G  E+DVWP L  +  D ISR AFGS+YE
Sbjct  123   FHMEKLKDLLGKFYVSCDDMISKWEEMVSTTGSCELDVWPCLDNLSSDVISRAAFGSSYE  182

Query  1087  EGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKA  908
             EG+KIF+LQKEQ+    +L++ +YIPG RFLPT  N+RM +I K+++ L+  II KR   
Sbjct  183   EGKKIFKLQKEQSTMAMKLIQQVYIPGLRFLPTKTNKRMNEINKEMRVLMNNIITKRENQ  242

Query  907   MEAGEGSKDDLLGILLESNFNEIEKHG-NKDFGITTREVIEECKLFYFVGQETTSVLLVW  731
             M+ GE   DDLLGILLES+  E ++ G  K+ G+T  E++EECKLFY  G++TTSVLLVW
Sbjct  243   MKMGETCNDDLLGILLESSLKEAQEQGYRKNAGLTIEEIVEECKLFYLAGRDTTSVLLVW  302

Query  730   TMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKN  551
              MV LG+H +WQ RAREEV R+FG++KPD +GLN++KIVTMI+NE LRLY PVI + R  
Sbjct  303   LMVRLGKHLDWQARAREEVLRVFGQNKPDYNGLNNLKIVTMIINEVLRLYPPVILMYRMI  362

Query  550   KEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPF  371
              + T++GD++LPPGV IS+P +L H+D K+WG+DA EFNPERFSEG++KAT  Q+ + PF
Sbjct  363   HKPTKIGDILLPPGVQISVPTMLVHNDPKLWGEDATEFNPERFSEGIAKATNSQVIYTPF  422

Query  370   GGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             G GPRIC+G NFAMLE K+ +AMILQRYSFELSPSY+HAP   ++LQPQ+G P++ RK+
Sbjct  423   GWGPRICIGQNFAMLEVKMALAMILQRYSFELSPSYSHAPFLVMNLQPQHGVPMILRKI  481



>ref|XP_010241316.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/498 (55%), Positives = 368/498 (74%), Gaps = 2/498 (0%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR+L   W+RP KL++ L++QG+KG  YK + G+LK  ++  KEA SKPMNLSH+I+PR
Sbjct  21    VWRMLYLIWWRPMKLERYLKEQGIKGPPYKLLVGNLKDESRLRKEALSKPMNLSHNIAPR  80

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEG  1325
             + PF +  IQ  G+ S  W G  P + I +P LI+DIL  K   + +   NP  + LA G
Sbjct  81    VAPFVLQTIQNYGKMSVSWSGRTPRIYITDPELIKDILLYKFGHFERSKPNPFARSLASG  140

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + +YE +KW KHRRIINPAFH++KLK ++P F +SC +++   EK +  +G  E+DVWP 
Sbjct  141   LVSYEGEKWVKHRRIINPAFHLDKLKRLLPVFSISCCDLITRWEKLVPSEGSYEMDVWPE  200

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L+ + GD ISR AFGS+YEEGR+IF++Q+EQA    +   SI+IPG RFLPT RN RMK+
Sbjct  201   LKNLSGDIISRAAFGSSYEEGRRIFQIQEEQASLIMQDAMSIHIPGLRFLPTKRNNRMKE  260

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIE  788
             +E++V+AL+  II KR KAM  GE   +DLLG+L+E NF EI++HGN K+ G++  EVI 
Sbjct  261   MEREVRALLEGIISKREKAMRMGEACTNDLLGLLMEFNFKEIQEHGNLKNVGMSIDEVIG  320

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF G+ETTS+LL WTM++L  H EWQ RAREEV ++FGK+KPD + LN +KIVTM
Sbjct  321   ECKLFYFAGRETTSILLTWTMLVLSMHSEWQLRAREEVLQVFGKNKPDFNELNQLKIVTM  380

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY PV  ++R   ++ +LG++ LPPGV +S+P+IL HH  + WGDDA+EF PE
Sbjct  381   ILYEVLRLYPPVFRISRWTYKKIKLGEIFLPPGVELSLPIILLHHSIEFWGDDAQEFKPE  440

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF+ GVSKATK Q+TF PF  GPRIC+G NFA++  K+ +AMILQR+SFELSP+Y HAP 
Sbjct  441   RFAGGVSKATKNQVTFFPFSWGPRICIGQNFALMVVKMALAMILQRFSFELSPTYCHAPC  500

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQYGA +L  KL
Sbjct  501   TVLTLQPQYGAQILLHKL  518



>ref|XP_004488665.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=524

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 369/479 (77%), Gaps = 4/479 (1%)
 Frame = -1

Query  1624  RKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLLPFFIDAIQRNGENSFVW  1445
             R+QGL+GN Y+F+ GDLK L K   EAKSK MNL+ DI PR+ P+   +++ +G+NSF+W
Sbjct  46    REQGLQGNPYRFLVGDLKDLFKMENEAKSKSMNLTDDIVPRVFPYTQQSVKIHGKNSFIW  105

Query  1444  LGPNPMVLIKEPGLIRDILTKNTIYHKPFTN-PLIKLLAEGIATYEEDKWSKHRRIINPA  1268
              G  P + + EP  I+D+L  N I   P TN  + KLLA G+A+Y  +KWSKHR++IN A
Sbjct  106   FGTKPRLTLTEPEQIKDVL--NKISDFPKTNYKIFKLLASGLASYHGEKWSKHRKLINSA  163

Query  1267  FHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQIGGDAISRTAFGSNYE  1088
             FH+EKLK M P+F+ SC +++   E+ +   G  E+D+WP LQ +  DAISRTAFGS+YE
Sbjct  164   FHLEKLKIMTPSFFTSCNDLISEWEEILSSNGSCEIDIWPSLQNMASDAISRTAFGSSYE  223

Query  1087  EGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEKQVQALIRCIIDKRVKA  908
             EG++IF+LQ+EQA+  T+++   +IP WRF+PT  +RRM +++K +++ ++ +I+KR K 
Sbjct  224   EGKRIFQLQREQAELITKVVMKSFIPLWRFVPTIVHRRMNEVDKDIKSSLKDMINKREKT  283

Query  907   MEAGEGSKDDLLGILLESNFNEIEKHGN-KDFGITTREVIEECKLFYFVGQETTSVLLVW  731
             ++AGE +K+DLLGILLESN  EI++HGN K+ G+   +VIEECKLFYF GQETTSVLLVW
Sbjct  284   LKAGEANKNDLLGILLESNHKEIKEHGNNKNAGMNIEDVIEECKLFYFAGQETTSVLLVW  343

Query  730   TMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILNESLRLYTPVISLTRKN  551
             TM+LL R+ +WQ RAREEVF +FG  KPD DGL+++KIVTM+L E LRLY PVI L RK 
Sbjct  344   TMILLSRYPDWQARAREEVFHVFGNKKPDFDGLSNLKIVTMVLYEVLRLYPPVIGLARKI  403

Query  550   KEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFSEGVSKATKGQLTFLPF  371
              ++ +LG+L LP GV + +P+IL HHD ++WGDDA  FNPERFS GVSKAT G+++F PF
Sbjct  404   DKDMKLGNLTLPAGVEVFLPIILLHHDTQLWGDDATMFNPERFSGGVSKATNGRVSFFPF  463

Query  370   GGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTVSLQPQYGAPLLFRKL  194
             G GPRIC+G NF++LEAK+ +AMILQ +SFELSP+Y+HAPT+ ++L+PQ+GA ++ RK+
Sbjct  464   GWGPRICVGQNFSLLEAKMAMAMILQHFSFELSPTYSHAPTTVITLRPQHGAHIILRKV  522



>gb|AGX93046.1| secologanin synthase-like protein [Amsonia hubrichtii]
Length=524

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/498 (55%), Positives = 365/498 (73%), Gaps = 3/498 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WRVL+WAWF P++L+K LR+QG KGN Y+F+ GD+K+  K  +EA SKPM  ++DI PR+
Sbjct  25    WRVLDWAWFTPKRLEKRLRQQGYKGNAYRFLVGDVKENGKMLQEAMSKPMAFNNDIVPRI  84

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFT--NPLIKLLAEG  1325
             +P     IQ  G NSF W+G  P + + EP LI+++LT ++ Y K F   NPL+K L  G
Sbjct  85    MPHIHHTIQTYGRNSFTWMGRIPRIHVMEPELIKEVLTHSSKYQKNFDVHNPLVKFLLTG  144

Query  1324  IATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPH  1145
             + ++E  KWSKHRRII+PAF +EKLK M+PAF +S  +ML   EK    QG  EVD++P 
Sbjct  145   VGSFEGAKWSKHRRIISPAFTLEKLKTMLPAFAISYDDMLRKWEKIAEKQGSHEVDIFPT  204

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
                +  D IS+ AFGS YEEG KIF+L KE      E MR +YIPGW +LPT RN+RM++
Sbjct  205   FDVLTSDVISKVAFGSTYEEGGKIFQLLKELMDLTIECMRDVYIPGWSYLPTKRNKRMRE  264

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNK-DFGITTREVIE  788
             I K++  ++R II+KR KA++AGE  +DDLLG+LLESNF EI+K GNK + G+T  +VIE
Sbjct  265   INKELTDMLRNIINKRTKALKAGEPGEDDLLGVLLESNFQEIQKQGNKKNVGMTINDVIE  324

Query  787   ECKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTM  608
             ECKLFYF GQETT VLL W  +LL +H EWQ RAREEV + FGK+KPD + LNH+K V+M
Sbjct  325   ECKLFYFAGQETTGVLLTWATILLSKHPEWQERAREEVLQAFGKNKPDFERLNHLKYVSM  384

Query  607   ILNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPE  428
             IL E LRLY PVI LT+   E+T+LG   +P G  + +P ++ H ++ IWG+DA EFNP 
Sbjct  385   ILYEVLRLYPPVIDLTKIVHEDTKLGPYTIPAGTQVMLPTVILHREKSIWGEDAMEFNPM  444

Query  427   RFSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPT  248
             RF++GV+ ATK  +T+LPF  GPR+CLG NFA+L+AKL +AMILQR++F++SPSYAHAP 
Sbjct  445   RFADGVANATKNNVTYLPFSWGPRVCLGQNFALLQAKLGLAMILQRFTFDVSPSYAHAPF  504

Query  247   STVSLQPQYGAPLLFRKL  194
             + ++LQPQ G+ ++++KL
Sbjct  505   TILTLQPQLGSHVIYKKL  522



>ref|XP_010927467.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/494 (55%), Positives = 358/494 (72%), Gaps = 2/494 (0%)
 Frame = -1

Query  1672  VLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRLLP  1493
              L W W+RPR+L++ LR QGLKG  Y+F+ GD K+  +  KEA SKPM  SH I PR+LP
Sbjct  28    ALEWVWWRPRRLERALRAQGLKGTRYRFLHGDQKEYHRLHKEALSKPMAFSHQIIPRILP  87

Query  1492  FFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILT-KNTIYHKPFTNPLIKLLAEGIAT  1316
                 AI++NG+ SF W GP P V+I +PGL R+IL+ K   + KP +NPL +LL  G+  
Sbjct  88    HLHQAIKKNGKISFTWFGPKPRVIIMDPGLTREILSNKFGHFEKPHSNPLGRLLVAGLVR  147

Query  1315  YEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLAEVDVWPHLQQ  1136
             YE +KW+KHRRIINPAFH+EKLK M+PAF   C E++   E+ +  +G  E+DVWP  Q 
Sbjct  148   YEGEKWAKHRRIINPAFHLEKLKCMMPAFSTCCDELINKWERLVASKGSCELDVWPEFQS  207

Query  1135  IGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKIEK  956
               GD ISRTAFGSN+ EG++IF LQ+EQAQ   + +++IYIPG+RFLPT +N+RMK+I+ 
Sbjct  208   FTGDVISRTAFGSNFREGQRIFHLQEEQAQLVVQALQNIYIPGFRFLPTKKNKRMKEIDI  267

Query  955   QVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFN-EIEKHGNKDFGITTREVIEECK  779
             ++++L+R +I++R   +     S DDLLG+L+ESNF    E  G+K+ G++T +VIEECK
Sbjct  268   EIRSLLRSMIEQREMVIRKEGASNDDLLGLLMESNFRYSKENGGSKNSGMSTEDVIEECK  327

Query  778   LFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMILN  599
             LFYF G ETTSVLL WT+V L  H  WQ RAREEV  +FGK+KPD DGL+ +KIVTM+L 
Sbjct  328   LFYFAGHETTSVLLTWTLVALSMHPSWQARAREEVHGVFGKNKPDYDGLSRLKIVTMVLY  387

Query  598   ESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERFS  419
             E LRLY PVI L RK  +E +LG    P GV +S+P+I  HHD + WG+DA EFNPERF+
Sbjct  388   EVLRLYPPVILLQRKTFKEMKLGQFTFPDGVELSLPIIFIHHDPEFWGEDASEFNPERFA  447

Query  418   EGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTSTV  239
             EGVSKA+K    F PF GGPRIC+G +FAM+EAK+ +A ILQ + FELSPSYAHAP +  
Sbjct  448   EGVSKASKIPGAFFPFSGGPRICIGQSFAMMEAKMALARILQHFMFELSPSYAHAPYTVA  507

Query  238   SLQPQYGAPLLFRK  197
             +L PQ+GA ++  +
Sbjct  508   TLHPQHGAQIILHR  521



>emb|CDX98485.1| BnaC05g38900D [Brassica napus]
Length=512

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/496 (55%), Positives = 366/496 (74%), Gaps = 6/496 (1%)
 Frame = -1

Query  1678  WRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPRL  1499
             WR LNW WF+P+ L+  LR+QGL G+ Y  + GDLK+     KEA+SKP+ L+ DI+PR+
Sbjct  22    WRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNFSLLKEARSKPIKLTDDITPRV  81

Query  1498  LPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGIA  1319
             +P+ +  ++ +G   F WLGP P + I +P  I+++  K   + K  T PL +L+  G+A
Sbjct  82    VPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNKVYDFQKTHTFPLARLIGTGLA  141

Query  1318  TYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPHL  1142
             +Y+ DKW+KHRRIINPAFH+EK+K+MVPAF+ SC E++G  +K + ++GL+ EVDVWP L
Sbjct  142   SYDCDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGEWDKLVSEKGLSCEVDVWPGL  201

Query  1141  QQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKKI  962
               +  D ISRTAFGS+Y+EG++IFELQ E AQ   +  R   IPG+ +LPT  NR MK  
Sbjct  202   VSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYSYLPTKENRMMKAK  261

Query  961   EKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEEC  782
              ++V A++R I++KR++A EAGE   DDLLGILLESN  +++  GN   G++  +VIEEC
Sbjct  262   AREVHAILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVK--GN---GMSNEDVIEEC  316

Query  781   KLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMIL  602
             KLFYF GQETTSVLLVWTMVLL +HQ+WQ +AREEV ++FG   PD DGLN +K++TMIL
Sbjct  317   KLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGHKIPDTDGLNQLKVMTMIL  376

Query  601   NESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPERF  422
              E LRLY PV  ++R   +E +LGDL LP GV IS+P++L   D ++WGDDA EF PERF
Sbjct  377   YEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGDDAGEFKPERF  436

Query  421   SEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTST  242
              EG+SKATK Q++F PF  GPRIC+G NFA+LEAK+ +A+ILQR+SFELSPSY HAP + 
Sbjct  437   REGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYTV  496

Query  241   VSLQPQYGAPLLFRKL  194
             +++ PQ+GA L+  KL
Sbjct  497   ITIHPQFGAHLILHKL  512



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/497 (55%), Positives = 366/497 (74%), Gaps = 6/497 (1%)
 Frame = -1

Query  1681  LWRVLNWAWFRPRKLQKCLRKQGLKGNEYKFIFGDLKQLTKTTKEAKSKPMNLSHDISPR  1502
             +WR L W WF+P+ L+  LR+QGL G  Y  + GD+K+      EA+SKP+NL+ DI+PR
Sbjct  56    VWRALQWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKRNFSMLTEARSKPINLTDDITPR  115

Query  1501  LLPFFIDAIQRNGENSFVWLGPNPMVLIKEPGLIRDILTKNTIYHKPFTNPLIKLLAEGI  1322
             ++P  +  ++ +G   F W GP P++ I +P  I+++  K   + KP T PL  L+A+G+
Sbjct  116   VMPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVFNKVYDFQKPHTFPLATLIAKGL  175

Query  1321  ATYEEDKWSKHRRIINPAFHMEKLKHMVPAFYMSCVEMLGNLEKKMGDQGLA-EVDVWPH  1145
             A Y+ DKW+KHRRIINPAFH+EK+K+MVPAF+ SC E+LG  EK + D+G + EVDVWP 
Sbjct  176   ANYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVLGEWEKLVSDKGSSCEVDVWPG  235

Query  1144  LQQIGGDAISRTAFGSNYEEGRKIFELQKEQAQHKTELMRSIYIPGWRFLPTWRNRRMKK  965
             L  +  D ISRTAFGS+Y+EG++IFELQ E AQ   +  R   IPG+ +LPT  NRRMK 
Sbjct  236   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRRMKA  295

Query  964   IEKQVQALIRCIIDKRVKAMEAGEGSKDDLLGILLESNFNEIEKHGNKDFGITTREVIEE  785
               +++Q ++R I++KR++A EAGE   DDLLGILLESN  + +  GN   G++T +++EE
Sbjct  296   KAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQTK--GN---GMSTEDLMEE  350

Query  784   CKLFYFVGQETTSVLLVWTMVLLGRHQEWQTRAREEVFRLFGKDKPDIDGLNHMKIVTMI  605
             CKLFYF GQETTSVLLVWTMVLL +HQ+WQ RAREEV ++FG  +PD +GLN +K++TMI
Sbjct  351   CKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMI  410

Query  604   LNESLRLYTPVISLTRKNKEETRLGDLMLPPGVLISIPVILNHHDEKIWGDDAKEFNPER  425
             L E LRLY PV  LTR   +E +LGDL LP GV IS+P++L   D ++WG DA EF PER
Sbjct  411   LYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGKDAGEFKPER  470

Query  424   FSEGVSKATKGQLTFLPFGGGPRICLGLNFAMLEAKLVIAMILQRYSFELSPSYAHAPTS  245
             F +G+SKATK Q++F PF  GPRIC+G NFAMLEAK+ +A+ILQ++SFELSPSY HAP +
Sbjct  471   FKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYLHAPYT  530

Query  244   TVSLQPQYGAPLLFRKL  194
              +++ PQ+GA L+ +KL
Sbjct  531   IITIHPQFGAQLILQKL  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5262573346098