BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25014_g1_i1 len=1784 path=[1:0-160 162:161-320 @322@!:321-675
677:676-745 747:746-799 801:800-809 811:810-843 845:844-874
876:875-912 914:913-919 921:920-1004 1006:1005-1030
@1032@!:1031-1275 1277:1276-1306 1308:1307-1437 1439:1438-1462
1464:1463-1492 1494:1493-1501 1503:1502-1783]

Length=1784
                                                                      Score     E

ref|XP_009623238.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       663   0.0      
ref|XP_009768273.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       652   0.0      
emb|CDP01584.1|  unnamed protein product                                644   0.0      
ref|XP_004250158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       630   0.0      
ref|XP_006353155.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       627   0.0      
gb|AAM12787.1|  putative anthocyanidine rhamnosyl-transferase           626   0.0      Capsicum annuum
ref|XP_006353158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       626   0.0      
ref|XP_006353157.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       625   0.0      
ref|XP_004253507.2|  PREDICTED: UDP-glycosyltransferase 91A1-like       606   0.0      
ref|XP_006353156.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       602   0.0      
ref|XP_002532392.1|  UDP-glucosyltransferase, putative                  600   0.0      Ricinus communis
ref|XP_007156464.1|  hypothetical protein PHAVU_003G288200g             598   0.0      
gb|AFK35814.1|  unknown                                                 594   0.0      
ref|XP_004250160.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       593   0.0      
gb|KHN06911.1|  UDP-glycosyltransferase 91A1                            592   0.0      
ref|XP_006466331.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       592   0.0      
gb|KDO60536.1|  hypothetical protein CISIN_1g011765mg                   591   0.0      
ref|XP_007156463.1|  hypothetical protein PHAVU_003G288100g             590   0.0      
gb|KDP29778.1|  hypothetical protein JCGZ_18713                         590   0.0      
ref|XP_003551309.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       589   0.0      
ref|XP_006426251.1|  hypothetical protein CICLE_v10025508mg             588   0.0      
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g             588   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002270260.1|  PREDICTED: UDP-glycosyltransferase 91A1            588   0.0      Vitis vinifera
ref|XP_009623233.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       586   0.0      
ref|XP_003552084.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       585   0.0      
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       585   0.0      
ref|XP_003635105.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       584   0.0      
ref|XP_010312900.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       580   0.0      
ref|XP_009803298.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       578   0.0      
dbj|BAO45905.1|  UDP-glycosyltransferase                                577   0.0      
ref|XP_007047762.1|  UDP-Glycosyltransferase superfamily protein,...    580   0.0      
ref|XP_002270294.1|  PREDICTED: UDP-glycosyltransferase 91A1            578   0.0      Vitis vinifera
ref|XP_002297733.1|  glycosyltransferase family protein                 574   0.0      Populus trichocarpa [western balsam poplar]
gb|KEH20104.1|  UDP-glucosyltransferase family protein                  572   0.0      
ref|XP_008440527.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       569   0.0      
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  567   0.0      
ref|XP_011000621.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       565   0.0      
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     565   0.0      
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       565   0.0      
ref|XP_010023433.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       564   0.0      
ref|XP_004143439.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       563   0.0      
ref|XP_009795659.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       563   0.0      
ref|XP_008440525.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       563   0.0      
gb|KGN48689.1|  hypothetical protein Csa_6G497390                       562   0.0      
ref|XP_008440526.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       558   0.0      
ref|XP_004143546.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       557   0.0      
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       557   0.0      
ref|XP_004143545.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       556   0.0      
ref|XP_004160942.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    553   0.0      
ref|XP_009615005.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       553   0.0      
ref|XP_002533517.1|  UDP-glucosyltransferase, putative                  542   0.0      Ricinus communis
ref|XP_004151488.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       542   0.0      
ref|XP_010023430.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       542   0.0      
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       540   0.0      
gb|KCW59684.1|  hypothetical protein EUGRSUZ_H02443                     538   0.0      
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       534   0.0      
ref|XP_008236324.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       533   0.0      
ref|XP_007205156.1|  hypothetical protein PRUPE_ppa005394mg             533   0.0      
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       533   0.0      
emb|CAN70983.1|  hypothetical protein VITISV_027120                     537   0.0      Vitis vinifera
ref|NP_565540.4|  UDP-glycosyltransferase 91A1                          527   4e-179   Arabidopsis thaliana [mouse-ear cress]
gb|AAD15567.1|  putative anthocyanidin-3-glucoside rhamnosyltrans...    525   3e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419269.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       524   9e-178   
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  524   9e-178   Ricinus communis
gb|KCW59686.1|  hypothetical protein EUGRSUZ_H02446                     522   1e-177   
ref|XP_006294142.1|  hypothetical protein CARUB_v10023135mg             522   4e-177   
ref|XP_010431575.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       520   2e-176   
ref|XP_004143544.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       519   5e-176   
ref|XP_006404721.1|  hypothetical protein EUTSA_v10000154mg             520   5e-176   
ref|XP_010472246.1|  PREDICTED: UDP-glycosyltransferase 91A1            514   5e-174   
ref|XP_010417017.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       514   6e-174   
emb|CDP01583.1|  unnamed protein product                                511   8e-173   
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    511   9e-173   
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    508   1e-171   
ref|XP_002532389.1|  UDP-glucosyltransferase, putative                  506   3e-171   Ricinus communis
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             506   9e-171   Populus trichocarpa [western balsam poplar]
gb|KFK32801.1|  hypothetical protein AALP_AA6G289900                    505   1e-170   
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    506   1e-170   
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         504   4e-170   
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         503   6e-170   
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             502   2e-169   
ref|XP_002325254.2|  hypothetical protein POPTR_0018s13720g             499   1e-168   Populus trichocarpa [western balsam poplar]
emb|CAN80741.1|  hypothetical protein VITISV_015058                     499   2e-168   Vitis vinifera
ref|XP_010506988.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       500   2e-168   
gb|KGN48693.1|  hypothetical protein Csa_6G498410                       498   3e-168   
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    499   3e-168   
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    498   5e-168   
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    498   6e-168   
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    499   6e-168   Fragaria x ananassa
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       499   9e-168   
ref|XP_002270331.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    498   2e-167   Vitis vinifera
ref|XP_010502543.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       496   3e-167   
emb|CAN80742.1|  hypothetical protein VITISV_015059                     496   7e-167   Vitis vinifera
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         494   4e-166   
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         493   1e-165   
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    493   2e-165   
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    490   2e-164   
gb|EYU30925.1|  hypothetical protein MIMGU_mgv1a005472mg                489   3e-164   
ref|XP_010492649.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       488   1e-163   
emb|CDP01582.1|  unnamed protein product                                488   1e-163   
ref|XP_010506987.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       488   1e-163   
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         487   1e-163   
ref|XP_011001966.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       485   3e-163   
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    486   4e-163   
ref|XP_010518639.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       485   1e-162   
ref|XP_006360400.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    485   2e-162   
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    484   2e-162   
ref|XP_002270369.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    482   1e-161   Vitis vinifera
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         481   4e-161   
emb|CDP21083.1|  unnamed protein product                                481   6e-161   
ref|XP_006292848.1|  hypothetical protein CARUB_v10019108mg             480   1e-160   
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    480   2e-160   
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    479   5e-160   
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    478   7e-160   
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    478   9e-160   
ref|XP_011084238.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    476   3e-159   
ref|XP_004250156.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    476   6e-159   
emb|CDP21820.1|  unnamed protein product                                475   7e-159   
emb|CDP21084.1|  unnamed protein product                                474   1e-158   
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    474   3e-158   
gb|AFJ53033.1|  UDP-glycosyltransferase 1                               468   6e-156   
emb|CDP04856.1|  unnamed protein product                                465   9e-155   
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    463   6e-154   
ref|XP_011073572.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    461   2e-153   
gb|AFJ53032.1|  UDP-glycosyltransferase 1                               453   3e-150   
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    454   5e-150   
gb|AFJ53031.1|  UDP-glycosyltransferase 1                               452   1e-149   
ref|XP_002878624.1|  At2g22590/T9I22.3                                  451   2e-149   
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    451   2e-148   
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    447   5e-148   
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            447   8e-148   
ref|XP_009623239.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    446   2e-147   
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        444   1e-146   
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    443   2e-146   
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    444   2e-146   
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            440   8e-145   
ref|XP_004233155.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       439   1e-144   
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg             438   2e-144   
ref|XP_011020572.1|  PREDICTED: UDP-glycosyltransferase 91C1            439   2e-144   
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          437   4e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       438   7e-144   
ref|XP_010430764.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       435   1e-143   
emb|CDP00929.1|  unnamed protein product                                436   3e-143   
ref|XP_002303861.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    436   3e-143   Populus trichocarpa [western balsam poplar]
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    434   7e-143   
emb|CDP00928.1|  unnamed protein product                                435   7e-143   
ref|XP_010442438.1|  PREDICTED: UDP-glycosyltransferase 91C1            433   2e-142   
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    433   2e-142   
ref|XP_009108218.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       433   2e-142   
ref|XP_010482257.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    433   2e-142   
emb|CAN73977.1|  hypothetical protein VITISV_022298                     432   2e-142   Vitis vinifera
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    433   3e-142   
ref|XP_006353004.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       431   2e-141   
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            430   4e-141   
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                    428   1e-140   
ref|XP_006396998.1|  hypothetical protein EUTSA_v10028640mg             428   2e-140   
ref|XP_008788932.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    429   3e-140   
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            426   8e-140   
gb|ACE87855.1|  UDP-glucosyltransferase                                 426   1e-139   Stevia rebaudiana
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       425   5e-139   Stevia rebaudiana
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       423   2e-138   
gb|AHL38585.1|  glycosyltransferase                                     437   2e-138   
gb|AIE12480.1|  UGT3                                                    423   2e-138   
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            423   4e-138   Stevia rebaudiana
ref|XP_006415140.1|  hypothetical protein EUTSA_v10007607mg             419   5e-137   
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    418   1e-136   
ref|XP_007222833.1|  hypothetical protein PRUPE_ppa005106mg             418   2e-136   
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       417   2e-136   
ref|XP_008219240.1|  PREDICTED: UDP-glycosyltransferase 91C1            417   3e-136   
ref|XP_002532391.1|  UDP-glucosyltransferase, putative                  416   1e-135   Ricinus communis
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             416   1e-135   
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                415   2e-135   
ref|XP_008779257.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    413   4e-135   
gb|KDP41496.1|  hypothetical protein JCGZ_15903                         415   5e-135   
ref|XP_009408288.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       414   7e-135   
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    413   1e-134   
ref|XP_008378603.1|  PREDICTED: UDP-glycosyltransferase 91C1            413   3e-134   
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  412   5e-134   Ricinus communis
ref|XP_003547595.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    410   3e-133   
gb|KHN33503.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            409   5e-133   
ref|XP_006353274.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       400   3e-132   
ref|XP_007148435.1|  hypothetical protein PHAVU_006G208400g             407   4e-132   
ref|XP_009151459.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       405   8e-132   
ref|XP_010942592.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    405   1e-131   
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            405   2e-131   
ref|XP_007206476.1|  hypothetical protein PRUPE_ppa019000mg             400   7e-131   
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    404   8e-131   
ref|XP_006852904.1|  hypothetical protein AMTR_s00033p00224400          403   1e-130   
ref|XP_007134314.1|  hypothetical protein PHAVU_010G036800g             400   4e-130   
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             399   1e-129   
ref|XP_010927293.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    400   2e-129   
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    399   5e-129   
ref|XP_007134322.1|  hypothetical protein PHAVU_010G037600g             397   6e-129   
ref|XP_007012761.1|  UDP-Glycosyltransferase superfamily protein        401   6e-129   
ref|XP_007134316.1|  hypothetical protein PHAVU_010G037000g             397   7e-129   
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    398   1e-128   
ref|XP_004485549.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    397   4e-128   
ref|NP_201358.1|  UDP-glycosyltransferase 91B1                          396   6e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148434.1|  hypothetical protein PHAVU_006G208300g             396   6e-128   
ref|XP_002323718.1|  hypothetical protein POPTR_0017s07030g             396   7e-128   Populus trichocarpa [western balsam poplar]
dbj|BAC43110.1|  putative anthocyanidin-3-glucoside rhamnosyltran...    395   9e-128   Arabidopsis thaliana [mouse-ear cress]
emb|CBI40856.3|  unnamed protein product                                418   2e-127   
ref|XP_008242170.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       393   7e-127   
ref|XP_006852901.1|  hypothetical protein AMTR_s00033p00222830          393   8e-127   
ref|XP_009361645.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       392   2e-126   
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    392   2e-126   
ref|XP_008242383.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       391   5e-126   
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein        390   1e-125   
ref|XP_003593143.1|  UDP-glucosyltransferase                            390   1e-125   
dbj|BAJ84800.1|  predicted protein                                      390   2e-125   
ref|XP_008378602.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       390   3e-125   
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    389   3e-125   
ref|XP_010671540.1|  PREDICTED: UDP-glycosyltransferase 91C1            389   3e-125   
emb|CDO97382.1|  unnamed protein product                                389   4e-125   
ref|XP_008388229.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       389   4e-125   
ref|XP_009351089.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       387   6e-125   
ref|XP_004485550.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    389   6e-125   
ref|XP_004489092.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    388   7e-125   
dbj|BAJ99561.1|  predicted protein                                      388   1e-124   
ref|XP_007148436.1|  hypothetical protein PHAVU_006G208500g             387   2e-124   
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       388   2e-124   
ref|XP_003593142.1|  Glucosyltransferase                                387   2e-124   
ref|XP_011043118.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    386   3e-124   
ref|XP_009361641.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       386   6e-124   
ref|XP_004287583.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       388   7e-124   
ref|XP_010277530.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       385   2e-123   
ref|XP_002275824.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    384   3e-123   Vitis vinifera
gb|KHN27169.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            384   3e-123   
ref|XP_003593144.1|  Glucosyltransferase                                384   3e-123   
ref|XP_003535899.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    383   5e-123   
gb|AFK37289.1|  unknown                                                 384   5e-123   
ref|XP_011036928.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    383   6e-123   
ref|XP_009351087.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       383   7e-123   
ref|XP_008362978.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    382   9e-123   
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    382   1e-122   
ref|NP_001240857.1|  soyasaponin III rhamnosyltransferase               382   1e-122   
ref|XP_008362977.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    381   3e-122   
ref|XP_002320817.1|  hypothetical protein POPTR_0014s08440g             381   3e-122   Populus trichocarpa [western balsam poplar]
gb|EPS70335.1|  hypothetical protein M569_04423                         380   5e-122   
ref|XP_008354446.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       380   8e-122   
ref|XP_008342850.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       380   1e-121   
ref|XP_008388212.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       380   1e-121   
dbj|BAJ89368.1|  predicted protein                                      380   1e-121   
ref|XP_009376199.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    380   1e-121   
ref|XP_010047534.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       380   1e-121   
gb|KCW79477.1|  hypothetical protein EUGRSUZ_C00864                     379   1e-121   
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                     379   1e-121   
ref|XP_010051441.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       378   3e-121   
gb|KEH32398.1|  UDP-glucosyltransferase family protein                  378   4e-121   
gb|KCW82044.1|  hypothetical protein EUGRSUZ_C03414                     378   4e-121   
gb|KEH23150.1|  UDP-glucosyltransferase family protein                  377   7e-121   
ref|XP_008362434.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       378   8e-121   
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    378   8e-121   
ref|XP_002275850.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    377   1e-120   Vitis vinifera
ref|XP_010050451.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       380   2e-120   
ref|XP_009606311.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    377   2e-120   
ref|XP_008337731.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       377   2e-120   
emb|CDX73276.1|  BnaC05g28300D                                          374   7e-120   
gb|AES79436.2|  UDP-glucosyltransferase family protein                  374   7e-120   
emb|CDY67034.1|  BnaCnng53280D                                          373   8e-120   
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     374   1e-119   
ref|XP_002458815.1|  hypothetical protein SORBIDRAFT_03g040830          375   1e-119   Sorghum bicolor [broomcorn]
ref|XP_010047531.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       374   2e-119   
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       374   2e-119   
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       374   2e-119   
ref|XP_010047532.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       374   2e-119   
gb|AFJ53030.1|  UDP-glycosyltransferase 1                               372   9e-119   
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              374   1e-118   
emb|CDY54711.1|  BnaA09g52430D                                          370   2e-118   
ref|XP_008466142.1|  PREDICTED: UDP-glycosyltransferase 91C1            371   2e-118   
emb|CDP01580.1|  unnamed protein product                                386   3e-118   
ref|XP_004972263.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    372   4e-118   
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       370   5e-118   
ref|XP_010030919.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       370   6e-118   
gb|KCW66654.1|  hypothetical protein EUGRSUZ_F00432                     367   3e-117   
ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    368   4e-117   
ref|NP_001051624.1|  Os03g0804900                                       369   6e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564684.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    367   9e-117   
ref|XP_003570831.2|  PREDICTED: UDP-glycosyltransferase 91C1-like       368   9e-117   
gb|KEH37740.1|  UDP-glucosyltransferase family protein                  367   2e-116   
ref|XP_002302598.1|  hypothetical protein POPTR_0002s16380g             367   2e-116   
ref|XP_004970691.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    366   3e-116   
ref|XP_002459516.1|  hypothetical protein SORBIDRAFT_02g005940          366   3e-116   
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       365   3e-116   
ref|XP_011023290.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    365   4e-116   
ref|NP_001044898.1|  Os01g0865400                                       365   4e-116   
ref|XP_010905696.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    365   5e-116   
dbj|BAK04512.1|  predicted protein                                      364   1e-115   
ref|NP_001147674.1|  anthocyanidin 3-O-glucosyltransferase              363   4e-115   
ref|XP_011093242.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    363   5e-115   
gb|EEE55719.1|  hypothetical protein OsJ_04191                          362   6e-115   
ref|XP_010047533.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       361   1e-114   
ref|XP_003559278.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    361   3e-114   
ref|XP_010099555.1|  UDP-glycosyltransferase 91C1                       360   3e-114   
ref|XP_004955982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    360   7e-114   
tpg|DAA56689.1|  TPA: anthocyanidin 3-O-glucosyltransferase             359   2e-113   
ref|XP_004981372.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    358   4e-113   
ref|XP_002511902.1|  UDP-glucosyltransferase, putative                  358   4e-113   
ref|XP_007012766.1|  UDP-Glycosyltransferase superfamily protein        358   4e-113   
gb|EEC81695.1|  hypothetical protein OsI_25291                          365   4e-113   
ref|XP_002458816.1|  hypothetical protein SORBIDRAFT_03g040840          357   5e-113   
dbj|BAK03755.1|  predicted protein                                      358   7e-113   
ref|XP_011093243.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    357   9e-113   
gb|KCW79469.1|  hypothetical protein EUGRSUZ_C00854                     356   1e-112   
ref|XP_003619124.1|  Anthocyanidin 3-O-glucosyltransferase              357   1e-112   
ref|XP_010026589.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       349   2e-112   
ref|XP_004136252.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    355   2e-112   
ref|NP_001150609.1|  anthocyanidin 3-O-glucosyltransferase              356   3e-112   
gb|EAZ03129.1|  hypothetical protein OsI_25275                          356   5e-112   
ref|XP_006657538.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    356   8e-112   
tpg|DAA56691.1|  TPA: anthocyanidin 3-O-glucosyltransferase             355   1e-111   
emb|CDP01581.1|  unnamed protein product                                350   2e-111   
ref|XP_002463702.1|  hypothetical protein SORBIDRAFT_01g004560          353   4e-111   
ref|XP_008674785.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    352   1e-110   
ref|XP_003564213.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       351   2e-110   
ref|XP_007051734.1|  UDP-Glycosyltransferase superfamily protein,...    350   3e-110   
gb|EAZ03128.1|  hypothetical protein OsI_25274                          350   8e-110   
gb|AAS07237.1|  putative UDP-glucoronosyl and UDP-glucosyl transf...    349   1e-109   
gb|EPS66584.1|  hypothetical protein M569_08191                         348   1e-109   
ref|XP_003619079.1|  Anthocyanidin 3-O-glucosyltransferase              348   2e-109   
gb|KGN48692.1|  hypothetical protein Csa_6G498400                       342   4e-109   
ref|XP_006292348.1|  hypothetical protein CARUB_v10018560mg             341   1e-108   
ref|XP_003607432.1|  Anthocyanidin 3-O-glucosyltransferase              345   2e-108   
dbj|BAJ86656.1|  predicted protein                                      346   2e-108   
emb|CDX81291.1|  BnaC09g07020D                                          344   3e-108   
ref|XP_009767381.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    345   5e-108   
ref|NP_001059133.1|  Os07g0201500                                       346   6e-108   
ref|XP_004171403.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    342   6e-108   
dbj|BAJ97320.1|  predicted protein                                      344   1e-107   
ref|XP_006852898.1|  hypothetical protein AMTR_s00033p00222540          342   1e-107   
ref|XP_009587012.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    344   1e-107   
gb|KHN26938.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            343   1e-107   
ref|XP_004955765.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    343   2e-107   
ref|XP_010271397.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       343   2e-107   
gb|KHN26940.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            343   3e-107   
gb|KHN26937.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            342   4e-107   
gb|EAZ28971.1|  hypothetical protein OsJ_13015                          341   1e-106   
ref|XP_010928970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    338   2e-106   
ref|XP_002463705.1|  hypothetical protein SORBIDRAFT_01g004570          341   3e-106   
gb|KDO86267.1|  hypothetical protein CISIN_1g036520mg                   340   3e-106   
gb|AGU14093.1|  UDP-glycosyltransferase                                 340   4e-106   
ref|XP_006444980.1|  hypothetical protein CICLE_v10019998mg             340   5e-106   
ref|XP_009768930.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       338   1e-105   
gb|KEH17945.1|  UDP-glucosyltransferase family protein                  338   1e-105   
ref|XP_006645072.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    338   2e-105   
gb|KEH17952.1|  UDP-glucosyltransferase family protein                  338   2e-105   
gb|EMT10636.1|  Anthocyanidin 3-O-glucosyltransferase                   335   6e-105   
ref|XP_004306714.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    336   1e-104   
ref|XP_004955768.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    337   1e-104   
gb|EAZ03144.1|  hypothetical protein OsI_25293                          337   1e-104   
ref|XP_004134320.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       336   1e-104   
ref|XP_008386125.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    335   3e-104   
ref|XP_009366540.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    334   4e-104   
ref|XP_004955764.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    335   4e-104   
ref|XP_008346201.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    334   5e-104   
ref|XP_008438010.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       334   9e-104   
ref|XP_004955767.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    334   9e-104   
ref|XP_009343124.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    333   1e-103   
ref|NP_001059134.1|  Os07g0202000                                       334   1e-103   
ref|XP_002460289.1|  hypothetical protein SORBIDRAFT_02g026040          334   2e-103   
gb|KHN46708.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            332   3e-103   
ref|XP_003548650.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    332   5e-103   
ref|XP_009624393.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    331   7e-103   
ref|XP_009767882.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    331   8e-103   
ref|XP_007217954.1|  hypothetical protein PRUPE_ppa005180mg             330   1e-102   
emb|CBI40428.3|  unnamed protein product                                329   2e-102   
gb|KHN26939.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            329   2e-102   
ref|XP_006658379.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    331   3e-102   
ref|XP_008232998.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    329   5e-102   
gb|EEC76369.1|  hypothetical protein OsI_13968                          329   6e-102   
ref|XP_007220939.1|  hypothetical protein PRUPE_ppa025376mg             329   6e-102   
ref|XP_004171402.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       321   2e-101   
ref|XP_003560669.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    326   4e-101   
ref|XP_004306716.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    325   2e-100   
ref|XP_004955936.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    326   2e-100   
ref|XP_011092852.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       325   2e-100   
ref|XP_006378647.1|  hypothetical protein POPTR_0010s18990g             319   3e-100   
ref|XP_002273963.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    318   6e-100   
ref|XP_008346552.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    324   9e-100   
ref|XP_006339794.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    323   2e-99    
ref|XP_003560664.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       321   6e-99    
ref|XP_008237180.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    316   7e-99    
ref|XP_008391056.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       322   9e-99    
gb|KDP28588.1|  hypothetical protein JCGZ_14359                         319   9e-99    
ref|XP_004306715.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    317   1e-97    
dbj|BAC83826.1|  putative UDP-glucosyltransferase                       319   1e-97    
ref|XP_008346533.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    317   2e-97    
ref|NP_001175095.1|  Os07g0201200                                       318   2e-97    
ref|XP_008352352.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    317   3e-97    
emb|CDP20375.1|  unnamed protein product                                317   4e-97    
ref|XP_008793359.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    315   1e-96    
ref|XP_009361723.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       312   3e-96    
ref|XP_006650455.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       314   3e-96    
ref|XP_010938196.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    313   6e-96    
ref|XP_007217920.1|  hypothetical protein PRUPE_ppa022969mg             309   1e-95    
ref|XP_006650454.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       311   3e-95    
ref|XP_008233032.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    310   3e-95    
ref|XP_010230871.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       311   4e-95    
gb|KCW79473.1|  hypothetical protein EUGRSUZ_C00858                     306   5e-94    
gb|KDO54147.1|  hypothetical protein CISIN_1g019759mg                   303   7e-94    
ref|XP_007205575.1|  hypothetical protein PRUPE_ppa008811mg             302   9e-94    
ref|NP_001051007.2|  Os03g0702000                                       306   2e-93    
ref|XP_008804284.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    306   2e-93    
gb|KCW59685.1|  hypothetical protein EUGRSUZ_H02445                     297   3e-93    
emb|CDP21723.1|  unnamed protein product                                301   4e-93    
dbj|BAJ98242.1|  predicted protein                                      305   4e-93    
ref|XP_007012763.1|  UDP-Glycosyltransferase superfamily protein        303   2e-92    
gb|KEH33307.1|  UDP-glucosyltransferase family protein                  303   2e-92    
gb|ABR16160.1|  unknown                                                 304   2e-92    
ref|NP_001051010.1|  Os03g0702500                                       304   3e-92    
ref|XP_009408752.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    300   4e-92    
dbj|BAJ94055.1|  predicted protein                                      303   4e-92    
ref|XP_003635104.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    297   5e-92    
ref|XP_007051735.1|  UDP-Glycosyltransferase superfamily protein,...    302   6e-92    
ref|XP_010227258.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       302   8e-92    
gb|EAY91547.1|  hypothetical protein OsI_13181                          302   9e-92    
ref|XP_003571408.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    301   1e-91    
gb|EYU23564.1|  hypothetical protein MIMGU_mgv1a026446mg                301   2e-91    
ref|XP_008237191.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    294   5e-91    
ref|XP_002466606.1|  hypothetical protein SORBIDRAFT_01g010900          300   7e-91    
ref|XP_003559503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    298   1e-90    
gb|EEE66761.1|  hypothetical protein OsJ_23476                          299   2e-90    
gb|ABR18376.1|  unknown                                                 298   3e-90    
gb|AAS07253.1|  putative UDP-glucoronosyl and UDP-glucosyl transf...    305   8e-90    
ref|XP_004982059.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       292   2e-88    
ref|NP_001140739.1|  uncharacterized protein LOC100272814               293   3e-88    
ref|XP_004982120.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    293   6e-88    
dbj|BAJ92561.1|  predicted protein                                      293   8e-88    
dbj|BAJ89506.1|  predicted protein                                      293   8e-88    
ref|XP_004982379.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       290   3e-87    
gb|ACU23401.1|  unknown                                                 287   4e-87    
ref|XP_003615305.1|  Anthocyanidin 3-O-glucosyltransferase              288   1e-86    
gb|EMT01232.1|  Anthocyanidin 3-O-glucosyltransferase                   288   2e-86    
dbj|BAJ99464.1|  predicted protein                                      286   8e-86    
emb|CBI40427.3|  unnamed protein product                                293   2e-85    
emb|CBI40857.3|  unnamed protein product                                281   3e-85    
gb|EEE66752.1|  hypothetical protein OsJ_23460                          286   6e-85    
gb|KFK28226.1|  hypothetical protein AALP_AA8G488700                    280   1e-84    
ref|XP_009623240.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       275   3e-84    
ref|XP_003568849.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       283   3e-84    
gb|KDP29787.1|  hypothetical protein JCGZ_18722                         274   1e-83    
dbj|BAJ91449.1|  predicted protein                                      280   2e-83    
gb|EMT03457.1|  Anthocyanidin 3-O-glucosyltransferase                   278   2e-83    
ref|NP_001064066.1|  Os10g0122000                                       280   3e-83    
ref|XP_008804286.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    278   9e-83    
dbj|BAJ93155.1|  predicted protein                                      279   1e-82    
ref|XP_008391093.1|  PREDICTED: uncharacterized protein LOC103453328    293   3e-82    
ref|XP_007206642.1|  hypothetical protein PRUPE_ppa021249mg             270   4e-82    
tpg|DAA41232.1|  TPA: transferase                                       276   6e-82    
ref|NP_001150595.1|  transferase, transferring glycosyl groups          276   8e-82    
dbj|BAJ96765.1|  predicted protein                                      276   1e-81    
gb|ACU24590.1|  unknown                                                 275   2e-81    
gb|KDP29784.1|  hypothetical protein JCGZ_18719                         278   4e-81    
gb|EAZ00153.1|  hypothetical protein OsI_22159                          274   7e-81    
dbj|BAD17459.1|  putative UDP-glucosyltransferase                       272   7e-81    
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      273   2e-80    
gb|EAY86485.1|  hypothetical protein OsI_07863                          271   3e-80    
gb|EMS63353.1|  UDP-glycosyltransferase 91C1                            270   8e-80    
ref|XP_007204467.1|  hypothetical protein PRUPE_ppa023177mg             266   1e-79    
gb|ABR18123.1|  unknown                                                 271   2e-79    
gb|KCW79471.1|  hypothetical protein EUGRSUZ_C00856                     266   2e-79    
gb|EMT28296.1|  Anthocyanidin 3-O-glucosyltransferase                   267   3e-79    
ref|NP_001047279.2|  Os02g0589400                                       267   4e-79    
emb|CBI27877.3|  unnamed protein product                                265   7e-79    
gb|ABR16053.1|  unknown                                                 268   3e-78    
gb|EMT31905.1|  Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltra...    266   4e-78    
ref|XP_008667488.1|  PREDICTED: hypothetical protein isoform X1         265   4e-78    
ref|XP_009767885.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    264   5e-78    
dbj|BAJ88830.1|  predicted protein                                      265   2e-77    
gb|KDP29782.1|  hypothetical protein JCGZ_18717                         258   2e-77    
ref|XP_004979736.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    261   3e-76    
gb|EYU25693.1|  hypothetical protein MIMGU_mgv1a026946mg                254   4e-76    
ref|XP_004980756.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    261   5e-76    
ref|XP_004979741.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    259   2e-75    
gb|EMS61554.1|  UDP-glycosyltransferase 91C1                            258   5e-75    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          258   8e-75    
gb|ADJ67198.1|  hypothetical protein                                    246   1e-73    
emb|CBI40855.3|  unnamed protein product                                246   5e-73    
ref|XP_006361439.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    251   2e-72    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    251   2e-72    
gb|AFK79036.1|  glycosyltransferase UGT4                                250   3e-72    
gb|EMS56661.1|  UDP-glycosyltransferase 91A1                            247   5e-72    
ref|XP_010696238.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    249   9e-72    
ref|XP_010032103.1|  PREDICTED: crocetin glucoside glucosyltransf...    249   1e-71    
ref|XP_004249996.1|  PREDICTED: crocetin glucoside glucosyltransf...    245   2e-70    
dbj|BAC10994.1|  rhamnosyl transferase                                  246   2e-70    
ref|XP_010032098.1|  PREDICTED: crocetin glucoside glucosyltransf...    245   3e-70    
ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    246   3e-70    
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    246   3e-70    
dbj|BAD35324.1|  putative UDP-glucosyltransferase                       245   3e-70    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050          245   5e-70    
sp|Q43716.1|UFOG_PETHY  RecName: Full=Anthocyanidin 3-O-glucosylt...    244   6e-70    
ref|XP_006367679.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    243   8e-70    
gb|ABA98944.1|  UDP-glucoronosyl and UDP-glucosyl transferase fam...    245   8e-70    
emb|CAA81057.1|  UDP rhamnose: anthocyanidin-3-glucoside rhamnosy...    244   9e-70    
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    243   2e-69    
ref|XP_010035826.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    243   2e-69    
ref|XP_009604940.1|  PREDICTED: crocetin glucoside glucosyltransf...    242   3e-69    
ref|XP_004244816.1|  PREDICTED: crocetin glucoside glucosyltransf...    241   4e-69    
ref|XP_009767952.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    242   5e-69    



>ref|XP_009623238.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=468

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/467 (69%), Positives = 380/467 (81%), Gaps = 8/467 (2%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
                 KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKLPPNL   +N
Sbjct  3     ENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLVPFLN  62

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK P+P  + LP+NAEATID+PY++VKYLKLA+D LQ++MAKFLE+ +PD+IL DF S+
Sbjct  63    FVKFPMPKIEKLPKNAEATIDVPYEQVKYLKLAQDELQQSMAKFLEDSAPDFILFDFTSH  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVA  1094
             W+  VA    + TA FSIF    + F G +     D+  R   E+Y VPPKW+PF+TTV 
Sbjct  123   WVPSVAKNFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKTPEEYCVPPKWVPFETTVC  182

Query  1093  FRLYEILRIIDAVTEEDD-NVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             ++L+E+LRI DA  E D+ NV DIFRL   +E CDI+ VR CSEF+ EWLK+LENIHQKP
Sbjct  183   WKLFEVLRIFDASMEGDEENVPDIFRLYKTLEDCDILVVRSCSEFEPEWLKVLENIHQKP  242

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             VFPVGQLPTT+Y+       T D+W+ IK WLD QE GKV+YVAFGSEAKPSQ ELTEI+
Sbjct  243   VFPVGQLPTTSYEDDST---TMDAWRSIKLWLDMQEKGKVVYVAFGSEAKPSQNELTEIS  299

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLE SG PFFWVLR +RGE+D ELI LPEGFEERTK RGIVCTSWAPQLKILS++SVGG
Sbjct  300   LGLEKSGLPFFWVLRTKRGESDDELIRLPEGFEERTKERGIVCTSWAPQLKILSNDSVGG  359

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTHSGWSSVVEAIQFEKPLVLLTFLADQG+NAR+LEEKK+ YSVPRD+RDG FTRE+VA
Sbjct  360   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSVPRDDRDGSFTRESVA  419

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             ESL LV+VE+EG IYREK+KE+K LFCD+ RQDGYV+ LL YL  ++
Sbjct  420   ESLSLVLVEEEGKIYREKVKEVKNLFCDKRRQDGYVENLLSYLQDYR  466



>ref|XP_009768273.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=468

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/467 (68%), Positives = 375/467 (80%), Gaps = 8/467 (2%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
                 KLHI ++PWLAFGHMIPYLELSK IA +GHKVSF+STPRNIDRLPKLPPNL   +N
Sbjct  3     ENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKVSFISTPRNIDRLPKLPPNLVPFLN  62

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             F K P+P  + LP+NAEATID+PY++VKYLKLA+D LQE+MAKFLE+ +PD+IL DF SY
Sbjct  63    FFKFPVPKIEKLPKNAEATIDVPYEQVKYLKLAQDGLQESMAKFLEDSAPDFILFDFTSY  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVA  1094
             W+  VA K  + TA FSIF    + F G +     D+  RT  E+YTVPP W+P +TTV 
Sbjct  123   WVPSVAKKFDIPTAYFSIFIAAFLGFVGPVPGLNNDYEIRTTPEEYTVPPAWVPIETTVC  182

Query  1093  FRLYEILRIIDAVTEEDD-NVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             ++L+E+LRI DA  E D+ NV DIFR+   +E CDI+ VR CSEF+ EWLK+LE+IH+KP
Sbjct  183   WKLFEVLRIFDASMEGDEENVPDIFRMYKTLEDCDILFVRSCSEFEPEWLKVLEDIHRKP  242

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             VFPVGQLPTT+Y+       T D+WK IK WLD QE GKV+YVAFGSEAKPSQ ELTEI+
Sbjct  243   VFPVGQLPTTSYEDDSS---TIDAWKSIKLWLDMQEKGKVVYVAFGSEAKPSQNELTEIS  299

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLE SG PFFWVLR +RGE+D ELI LPEGFEERTKGRGIVCTSWAPQLKILS +SVGG
Sbjct  300   LGLEKSGLPFFWVLRTKRGESDDELIRLPEGFEERTKGRGIVCTSWAPQLKILSDDSVGG  359

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTHSGWSSVVEAIQFEKPLVLLTFLADQG+NAR+L EKK+ YSVPRD+RDG FTR++VA
Sbjct  360   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLAEKKMAYSVPRDDRDGSFTRDSVA  419

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             ESL LV+VE++G IYREK+KE K LFCD+ RQD YV+  L Y   ++
Sbjct  420   ESLSLVLVEEKGKIYREKVKEAKTLFCDKGRQDSYVENFLSYFQNYR  466



>emb|CDP01584.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/469 (66%), Positives = 378/469 (81%), Gaps = 8/469 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLHI+M+PWLAFGHMIPYLELSK IA +GHKVSF+STPRNIDRLPK PPNL   + F
Sbjct  3     EDGKLHIVMFPWLAFGHMIPYLELSKLIAKKGHKVSFLSTPRNIDRLPKPPPNLTRHLKF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+PLP  +NLPENAEAT DLPY+KVKYLKLA D LQ+ +++FL +  PDW+L DF  YW
Sbjct  63    VKIPLPHIENLPENAEATTDLPYNKVKYLKLACDGLQQPISEFLRQTCPDWVLFDFAPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLV----DFAERTKAEDYTVPPKWIPFKTTVAF  1091
             +  VASKL + TA FSIFT P + F G +     +  +R   +D+TV PKW+PF+T VAF
Sbjct  123   IPSVASKLNIRTAFFSIFTAPFLGFCGPVEVMKGNGEDRKTPQDFTVKPKWVPFETNVAF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             +L+EILR++D++  +++ +SDIFR  S +E CD +AVR CSEF+ EWL+L+E I+QKPV 
Sbjct  183   KLFEILRLVDSLIGDEEPISDIFRGGSSIENCDFLAVRSCSEFEPEWLQLMEEIYQKPVI  242

Query  910   PVGQLPTTAY-DAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
             PVGQLPTT   DA GG +   ++W+ IK WLDKQE G V+YVAFGSEAKPSQ E+ EI+L
Sbjct  243   PVGQLPTTGNNDADGGKD---EAWRPIKEWLDKQERGSVVYVAFGSEAKPSQAEVNEISL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVLR +RG  D E+I LPEGFE+RTK RG+VC SWAPQLKILSH+SVGGF
Sbjct  300   GLELSGLPFFWVLRTKRGGEDTEVIELPEGFEDRTKDRGVVCASWAPQLKILSHDSVGGF  359

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTHSGWSSVVEAIQFEK L+LLT LADQG+NARVL EKK+GY +PRD+ DG FTR++VAE
Sbjct  360   LTHSGWSSVVEAIQFEKALILLTMLADQGINARVLGEKKMGYPIPRDDSDGSFTRDSVAE  419

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             SLRLV++E EG IYR+K KEM+ LFCD++RQDGY++ LL++L  +KS K
Sbjct  420   SLRLVMIEDEGKIYRDKSKEMRRLFCDESRQDGYIENLLNFLQSYKSAK  468



>ref|XP_004250158.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 382/468 (82%), Gaps = 8/468 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
             G KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKLPPNL   +NFV
Sbjct  5     GKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLTPFLNFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP+P  + LPENAEATIDLPY++VKYLKLA+DALQE+M+KF+E+   D+IL DF SYW+
Sbjct  65    KLPMPHVEKLPENAEATIDLPYEQVKYLKLAQDALQESMSKFIEDSDIDFILFDFTSYWV  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + +  FSIF    + F G +     D+  R   E+YTV PKW+PF+TTVAF+
Sbjct  125   PSIASKFNIPSGYFSIFIAAFLGFTGPVPGLNNDYEIRMTPEEYTVTPKWVPFETTVAFK  184

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             L+E+ RI +A  + E++N++DI R    VE CD + VR CSEF+ EWLK++ +IH+KPVF
Sbjct  185   LFEVSRIFEASMKGEEENIADIVRYYRSVENCDFLLVRSCSEFEPEWLKVVGDIHRKPVF  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT Y+         D+W++IK WLDKQE GKVIYVAFGSEAKPSQ ELTE++LG
Sbjct  245   PVGQLPTTPYEDDSTK---IDAWREIKLWLDKQEKGKVIYVAFGSEAKPSQNELTELSLG  301

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D ELI LPEGFEERTKGRGIVCTSWAPQLKILSH+SVGGFL
Sbjct  302   LELSGLPFFWVLRIKRGESDDELIQLPEGFEERTKGRGIVCTSWAPQLKILSHDSVGGFL  361

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             THSGWSSVVEAIQFEK LVLLTFLADQG+NAR+LEEKK+ YS+PR+++DG FTR++VAES
Sbjct  362   THSGWSSVVEAIQFEKSLVLLTFLADQGINARLLEEKKMAYSIPRNDQDGSFTRDSVAES  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             L LV+V++EG IYREKIKEMK LFCD+ RQ+ YV+ LL +L  ++ IK
Sbjct  422   LNLVLVKEEGFIYREKIKEMKDLFCDKKRQNNYVENLLSFLQDYEKIK  469



>ref|XP_006353155.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=470

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/465 (67%), Positives = 375/465 (81%), Gaps = 8/465 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
               KLHI ++PWLAFGHMIPYLELSK IA +GH++SF+STPRNIDRLPKLPPNL   +NFV
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHRISFISTPRNIDRLPKLPPNLIPFLNFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP+P  + LPENAEATID+PY++VKYLKLA+D L+E+MAKFLE+   D+IL DF SYW+
Sbjct  65    KLPMPHVERLPENAEATIDVPYEQVKYLKLAQDGLEESMAKFLEDSDLDFILFDFTSYWV  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + +  FSIF    + F G +     D+  RT  E+YTVPPKW+PF+TTVAF+
Sbjct  125   PSIASKFNIPSGHFSIFIAAFLGFTGPVPGLNNDYEIRTTPEEYTVPPKWVPFETTVAFK  184

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             L+E+LRI +A  + E+DN++DI R    VE CD + VR CSE + EWLK++ +IH+KPVF
Sbjct  185   LFEVLRIFEATMKGEEDNIADITRYCKSVENCDFLLVRSCSELEPEWLKVVGDIHRKPVF  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT Y+         D+WK+IK WLDKQE GKVIYVAFGSE KPSQ ELTE++LG
Sbjct  245   PVGQLPTTPYEDDSTE---MDAWKEIKLWLDKQEKGKVIYVAFGSETKPSQNELTELSLG  301

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D EL  LPEGFE+RTKGRGIVCTSWAPQLKILSH+SVGGFL
Sbjct  302   LELSGLPFFWVLRTKRGESDDELTQLPEGFEDRTKGRGIVCTSWAPQLKILSHDSVGGFL  361

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             THSGWSSVVEAIQFEK LVLLTF ADQG+NAR+LEEKKI YS+PRD+ DG FT E++AES
Sbjct  362   THSGWSSVVEAIQFEKSLVLLTFSADQGINARLLEEKKIAYSIPRDDCDGSFTHESIAES  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             L LV+V++EG IYREK+KEMK LFCD+ RQD YV+ LL YL  +K
Sbjct  422   LNLVLVKREGEIYREKVKEMKSLFCDKERQDNYVENLLRYLQNYK  466



>gb|AAM12787.1| putative anthocyanidine rhamnosyl-transferase [Capsicum annuum]
Length=470

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/469 (66%), Positives = 382/469 (81%), Gaps = 10/469 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
             G KLHI ++PWLAFGHMIPYLELSK IA +GH VSF+STPRNIDRLPKLPPNL+  + FV
Sbjct  5     GKKLHIAVFPWLAFGHMIPYLELSKLIARKGHTVSFISTPRNIDRLPKLPPNLSQFLKFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP+P  + LPENAEATID+P+++VKYLKLA+D L+E+MAKFLE+ +PD+I  DF SYW+
Sbjct  65    KLPMPHVEKLPENAEATIDVPFEQVKYLKLAQDGLEESMAKFLEDSAPDFIFFDFTSYWV  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               VASK  + TA FSIF    + F G +     D+  R   E+YTVPPKW+ F+TTVA++
Sbjct  125   PSVASKFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKTPEEYTVPPKWVSFETTVAWK  184

Query  1087  LYEILRIIDAVTEEDD-NVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             L+E+ RI +A  E D+ N++DI R    VE CD   VR CSEF+ EWLK++++IH+KPVF
Sbjct  185   LFEVSRIFEASMEGDEENIADITRFYKSVENCDFFLVRSCSEFEPEWLKVIQDIHRKPVF  244

Query  910   PVGQLPTTAYDAGGGHEPTG-DSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
             PVGQLPTT Y+     E T  ++W++IK WLDKQE G+VIYVAFGSEAKPSQ ELTE++L
Sbjct  245   PVGQLPTTTYE----DETTKINAWREIKFWLDKQEKGRVIYVAFGSEAKPSQNELTELSL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVLR +RGE+D ELI LPEGFEERTKGRGIVCTSWAPQLKILSH+S+GGF
Sbjct  301   GLELSGLPFFWVLRTKRGESDDELICLPEGFEERTKGRGIVCTSWAPQLKILSHDSIGGF  360

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTHSGWSSVVEAIQFEKPLVLLTFLADQG+NAR+LEEKK+ YS+PR++RDG FTR++VAE
Sbjct  361   LTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSIPRNDRDGSFTRDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             S+ +V+V++EG IYR+K+KE+K LFCD+ RQD YV  LL YL  +K  +
Sbjct  421   SVSMVLVKEEGEIYRKKVKEVKYLFCDKKRQDNYVKNLLSYLQNYKKTR  469



>ref|XP_006353158.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=468

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/465 (67%), Positives = 379/465 (82%), Gaps = 8/465 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
               KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STP+NIDRLPKLPPN A  INFV
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIARKGHKISFISTPKNIDRLPKLPPNFAPFINFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             K+PLP  + LP+NAEATIDLPY++VKYLK+A+D L+E +AKFLE+ +PD+I+ DF SYW+
Sbjct  65    KIPLPHVEKLPKNAEATIDLPYEQVKYLKIAQDGLKEPIAKFLEDSAPDFIIFDFASYWI  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + T  FSIF    + F G       D+  R   E+YTVPPKW+PF+TTVAF+
Sbjct  125   PSIASKFNIPTGYFSIFIAAVLGFTGPEPGLNNDYEIRKTPEEYTVPPKWVPFETTVAFK  184

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             L+E+LRI +A  + E++NVSDI R    VE CD + VR CSEF+ EWLK++ +IH+K VF
Sbjct  185   LFEVLRIFEASMKGEEENVSDIIRYYKSVENCDFLLVRSCSEFEPEWLKVVGDIHRKLVF  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT Y+         D+W++IK WLD+QE GKVIYVAFGSEAKPSQ ELTE++LG
Sbjct  245   PVGQLPTTPYEDDSTK---IDAWREIKLWLDEQEKGKVIYVAFGSEAKPSQNELTELSLG  301

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D ELI LPEGF++RTKGRGIVCTSW PQLKILSH SVGGFL
Sbjct  302   LELSGLPFFWVLRTKRGESDDELIQLPEGFKDRTKGRGIVCTSWVPQLKILSHHSVGGFL  361

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             THSGWSSVVEAIQFEKPLVLLTFLADQG+NAR+LEEKK+ YS+PRD+RDG FTR++VAES
Sbjct  362   THSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSIPRDDRDGSFTRDSVAES  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             L LV++EK+G IYR+KIKE K LFCD+ RQ+ YV++LL+YL  +K
Sbjct  422   LNLVLIEKKGEIYRKKIKEAKNLFCDERRQNDYVESLLNYLQNYK  466



>ref|XP_006353157.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=483

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/468 (66%), Positives = 377/468 (81%), Gaps = 8/468 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
             G KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKLP NL    NFV
Sbjct  18    GKKLHIALFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPSNLTPFFNFV  77

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP+P  + LPENAEATIDLPY++VKYLKLA+DAL+E+MAKFLE+   D+IL DF SYW+
Sbjct  78    KLPMPHVEKLPENAEATIDLPYEQVKYLKLAQDALEESMAKFLEDSDIDFILFDFTSYWV  137

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + +  FSIF    + F G +     D+  R   E+YTV PKW+PF+TTVAF+
Sbjct  138   PSIASKFNIPSGYFSIFIAAFLGFTGPVPGLNNDYEIRMTPEEYTVTPKWVPFETTVAFK  197

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
              +E+ RI +A  + E++N++DI R    VE CD + VR CSEF+ EWLK++ +IH+KPV 
Sbjct  198   FFEVSRIFEASMKGEEENIADIIRYYKSVENCDFLLVRSCSEFEPEWLKVVGDIHRKPVI  257

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT Y+         D+W++IK WLDKQE GKVIYVAFGSEAKPSQ ELTE++LG
Sbjct  258   PVGQLPTTPYEDDSTK---IDAWREIKLWLDKQEKGKVIYVAFGSEAKPSQNELTELSLG  314

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D ELI LPEGFEERTKGRGIVCTSWAPQLKILSH+SVGGFL
Sbjct  315   LELSGLPFFWVLRTKRGESDDELIQLPEGFEERTKGRGIVCTSWAPQLKILSHDSVGGFL  374

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             THSGWSSVVEAIQFEK LVLLTFLADQG+NAR+LEEK++ YS+PR+++DG FTR++VAES
Sbjct  375   THSGWSSVVEAIQFEKSLVLLTFLADQGINARLLEEKEMAYSIPRNDQDGSFTRDSVAES  434

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             L LV+V+KEG IYREKIKEMK LFCD+ RQ+ YV+  L +L  ++ IK
Sbjct  435   LNLVLVKKEGFIYREKIKEMKDLFCDKERQNNYVENFLSFLQNYEKIK  482



>ref|XP_004253507.2| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=483

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/462 (66%), Positives = 369/462 (80%), Gaps = 8/462 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKL PNL   +NFVKLP
Sbjct  21    LHIGVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLSPNLTPFLNFVKLP  80

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             +P  +NLPENAEAT D+ Y++VKYLKLA+D L+E+MAKFLE+   D+IL DF SYW+  +
Sbjct  81    MPYVENLPENAEATTDVTYEQVKYLKLAQDGLEESMAKFLEDSDLDFILFDFTSYWVPSI  140

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             ASK  + +  FSI+    + F G +     D+  RT  E+YTVPPKW+PF+TTVAF+L+E
Sbjct  141   ASKFNIRSGHFSIYIAAFLGFTGPVPGLNNDYEIRTTPEEYTVPPKWVPFETTVAFKLFE  200

Query  1078  ILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             +LRI +A  + E++N++DI R    VE CD + VR CSE + EWLK+L +IH+KPV PVG
Sbjct  201   VLRIFEATMKGEEENIADITRYYKSVENCDFLFVRSCSELEPEWLKVLGDIHRKPVLPVG  260

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             QLPTT Y+         D+W +IK WLDK+E GKVIYVAFGSEAK SQ EL E++LGLEL
Sbjct  261   QLPTTPYEDDSTK---IDAWIEIKLWLDKREKGKVIYVAFGSEAKSSQNELIELSLGLEL  317

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG  F WVLR +RGE+D EL+ LPEGFE+R KGRGIVCTSWAPQLKILSH+SVGGFLTHS
Sbjct  318   SGLSFLWVLRTKRGESDDELVQLPEGFEDRMKGRGIVCTSWAPQLKILSHDSVGGFLTHS  377

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVEAIQ+EKPLVLLTF ADQG+NAR+LEEKKI YS+PRD+ DG FTR++VA+SL L
Sbjct  378   GWSSVVEAIQYEKPLVLLTFSADQGINARLLEEKKIAYSIPRDDCDGSFTRDSVAKSLNL  437

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V++EKEG IYREK+K+MK LFCD+ RQD YVD LL YL  +K
Sbjct  438   VLIEKEGEIYREKVKQMKSLFCDKERQDNYVDNLLCYLQNYK  479



>ref|XP_006353156.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=470

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/468 (65%), Positives = 368/468 (79%), Gaps = 8/468 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
               KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKLPPNL   +NFV
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLTPFLNFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP+P  + LPENAEATIDLPY++VKYLKLA DAL+E+MAKFLE+   D+IL DF SYW+
Sbjct  65    KLPMPHVEKLPENAEATIDLPYEQVKYLKLAHDALKESMAKFLEDSDIDFILFDFASYWI  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + T  FSIF    + F G +     ++  R   E+ TV PKW+PF+T VAF+
Sbjct  125   PSIASKFNIPTGYFSIFIAAYLGFTGPVPGLNNNYGIRMTMEELTVSPKWVPFETAVAFK  184

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
              +E+LRI +   + E++N+ DI R+    E CD + VR C EF+ EWLK++E+IH KPV 
Sbjct  185   EFELLRIYEGCKDGEEENIYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHLKPVI  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT+Y+     +   D+W++IK WLDKQE GKVIYVAFGSE K SQ ELTE++LG
Sbjct  245   PVGQLPTTSYE---DDDTNIDAWREIKQWLDKQEKGKVIYVAFGSETKLSQNELTELSLG  301

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D ELI LPEGFEERTKGRGIV TSW PQLKILSH+SVGGFL
Sbjct  302   LELSGLPFFWVLRTKRGESDDELIQLPEGFEERTKGRGIVYTSWVPQLKILSHDSVGGFL  361

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
              H+GWSSVVEAIQFEKPL+LLTFLADQG++AR+LEEKK+ Y +PR++ DG FTR+AV ES
Sbjct  362   NHAGWSSVVEAIQFEKPLILLTFLADQGIDARLLEEKKVAYLIPRNDLDGSFTRDAVVES  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             L LV+VEKEG IYR+KIKE+K L CD+ RQD YV+ LL +L  +K IK
Sbjct  422   LSLVLVEKEGEIYRQKIKEVKNLCCDKKRQDNYVENLLRFLQNYKKIK  469



>ref|XP_002532392.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30004.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=471

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/474 (64%), Positives = 365/474 (77%), Gaps = 6/474 (1%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             DH  S+LHI+M+PWLAFGHMIPYLEL+KHIA +GHKVSFVS+PRNIDRLPKLPPNL+  I
Sbjct  3     DH--SELHIVMFPWLAFGHMIPYLELAKHIAQKGHKVSFVSSPRNIDRLPKLPPNLSPYI  60

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FVKL LP    LP++AEAT D+PYDKV+YLK A D L+E + KFLE   P W+L+DF  
Sbjct  61    KFVKLRLPHVAGLPQDAEATTDVPYDKVQYLKKAYDGLKEPLTKFLETSDPHWLLYDFAP  120

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             YWL  VA  LG+S A FSIF   +++F         R+K ED+TVPPKW+ F + V FRL
Sbjct  121   YWLPDVAKNLGISNAFFSIFLAASLSFVKPHSWIEYRSKPEDFTVPPKWVSFPSKVTFRL  180

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +EILRI D VT ++ +VSDI+R+   V+ CD+V VR C EF+ EWL LLE  H KP  PV
Sbjct  181   HEILRIFDVVTGDESDVSDIYRMEEVVKGCDVVVVRSCVEFEPEWLHLLEENHGKPSIPV  240

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G L TT Y++    EP  ++W+ IK WLDKQE G V+YVAFGSEAKP+Q EL EIA GLE
Sbjct  241   GMLATTEYNSED-EEP--EAWRSIKEWLDKQEKGSVVYVAFGSEAKPTQVELNEIAFGLE  297

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              SG PFFWVL+ RRG AD E+I LP+GFEERTK RG+VCTSWAPQLKIL+H S+GGFLTH
Sbjct  298   FSGLPFFWVLKKRRGIADTEVIELPDGFEERTKERGMVCTSWAPQLKILAHGSIGGFLTH  357

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGWSSVVEAIQ+E+ L+LLTFLADQ  NAR+LEEKK+GY +PR+E DG F R++VAESLR
Sbjct  358   SGWSSVVEAIQYERALILLTFLADQSFNARLLEEKKMGYPIPRNEIDGSFNRDSVAESLR  417

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH-KSIKYGTQTIS  206
             LV+V++EGNIYREK+KEMKGLF D+ +Q  YVD  L YLH H +S K   Q ++
Sbjct  418   LVMVKEEGNIYREKVKEMKGLFADREKQGSYVDNFLDYLHSHARSKKNPNQGVN  471



>ref|XP_007156464.1| hypothetical protein PHAVU_003G288200g [Phaseolus vulgaris]
 gb|ESW28458.1| hypothetical protein PHAVU_003G288200g [Phaseolus vulgaris]
Length=465

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/460 (64%), Positives = 361/460 (78%), Gaps = 12/460 (3%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             S LHI+M+PWLAFGHMIP LEL+K IA +GH+VSFVSTPRNIDRLPKL P L   INFVK
Sbjct  7     SVLHIVMFPWLAFGHMIPNLELAKLIAEKGHRVSFVSTPRNIDRLPKLSPTL---INFVK  63

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LPLP  QNLPENAEAT D+PYD V+YLK A DAL++ + +FLE    DW+ +DF  +W A
Sbjct  64    LPLPNVQNLPENAEATTDVPYDAVQYLKKAYDALEQPLTRFLESSKADWLFYDFVPFWAA  123

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG---RLVDF-AERTKAEDYTVPPKWIPFKTTVAFRL  1085
              VASKLG+ TA +SIFTPP + F G    L D  + R K E+Y V P W+ F TTVAFR 
Sbjct  124   SVASKLGIKTAFYSIFTPPFLGFIGPPSYLTDNNSPRHKPEEYIVVPPWVTFPTTVAFRY  183

Query  1084  YEILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             YEI+RI+D +++++++  SD +R  +G++ CDIV VRGC+EFD+EW  LLENI+ KPV P
Sbjct  184   YEIMRIVDILSDQNNSGFSDTYRHGAGIQNCDIVVVRGCTEFDAEWFPLLENIYGKPVLP  243

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
              GQLP+TA      +E    +W+ +K WLDKQ  G+V+YVAFGSEAKP+Q E+TEIALGL
Sbjct  244   AGQLPSTAPVGSEDNE----TWRWMKEWLDKQARGRVVYVAFGSEAKPTQEEVTEIALGL  299

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             E S  PF WVLR +RG +DP+++ LPEGFEERTK RG+VC SWAPQLKIL H +VGGFLT
Sbjct  300   EKSELPFLWVLRVQRGPSDPDVLRLPEGFEERTKARGVVCRSWAPQLKILEHVAVGGFLT  359

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             HSGW+SVVE IQ EK LVLLTFL+DQG+NARVLEEKK+GYSVPRDE DG F+ ++VAESL
Sbjct  360   HSGWTSVVEGIQNEKALVLLTFLSDQGINARVLEEKKMGYSVPRDEEDGSFSSDSVAESL  419

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +LVVVE+EG IYRE+IKEMK LF ++ RQ+ Y+D L+H L
Sbjct  420   KLVVVEEEGKIYRERIKEMKDLFVNEDRQNRYIDNLIHNL  459



>gb|AFK35814.1| unknown [Medicago truncatula]
 gb|KEH20105.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=469

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/461 (62%), Positives = 349/461 (76%), Gaps = 8/461 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   LHI+M+PWLAFGHMIPYLEL+K IA +GHKVS+VSTPRNI RLPKLPPN+A  I F
Sbjct  7     EEKALHIVMFPWLAFGHMIPYLELAKLIAQKGHKVSYVSTPRNIQRLPKLPPNVAPLIKF  66

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V LPLP   NLPENAEAT D+PYD V YLK A D L++    FLE  +  WI HDF ++W
Sbjct  67    VNLPLPKVDNLPENAEATTDIPYDVVPYLKNAFDKLEKPFTHFLETSNAGWIFHDFANFW  126

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAF  1091
             +AP AS+LG+  A FSIFT PT+ F G     L D   RTK ED+TV P W+PF+TTVA+
Sbjct  127   IAPTASQLGIKCAFFSIFTAPTMGFLGPVSVILGDEPGRTKPEDFTVAPPWVPFQTTVAY  186

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +EI++  D ++++    SD+ R    ++  D + +RGC+EF+ EW ++++NIHQK V 
Sbjct  187   RYFEIIKTADILSDKILGTSDLHRYGLSIQNSDFILIRGCTEFEPEWFQVIQNIHQKTVL  246

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P GQLP T +D+G  HE   DSW  IK WLDKQ  G V+YVAFGSEAKPSQ E+ EIALG
Sbjct  247   PAGQLPNTEFDSG--HE--NDSWPRIKEWLDKQPHGTVVYVAFGSEAKPSQEEVNEIALG  302

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVL+ RRG  D  ++ LPEGFEERTKGRG+VCT W PQ+KIL H +VGGFL
Sbjct  303   LEKSNLPFFWVLKVRRGPTDKVVLQLPEGFEERTKGRGVVCTDWVPQMKILGHMAVGGFL  362

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH+GW+SVVEA+Q EKPLVLLT+L+DQG+NARVLEEKK+GYSVPRDERDG FT ++VA S
Sbjct  363   THAGWTSVVEAVQHEKPLVLLTYLSDQGINARVLEEKKMGYSVPRDERDGSFTSDSVAHS  422

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +RL+VVE+EG IYRE IK MK LF +  RQD YV+ LL +L
Sbjct  423   IRLIVVEEEGMIYRENIKNMKDLFVNIERQDKYVNNLLSHL  463



>ref|XP_004250160.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/468 (64%), Positives = 367/468 (78%), Gaps = 8/468 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
               KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKLPP+LA  +NFV
Sbjct  5     SKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPSLAPFLNFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             K+PLP  + LP+NAEAT DLPY++VKYLKLA DAL+E MAKFLE+ +PD+IL DF SYWL
Sbjct  65    KIPLPYVEKLPKNAEATTDLPYEQVKYLKLAHDALKEPMAKFLEDSAPDFILFDFTSYWL  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + T  FSIF    + F G +     ++  R   E+ TV PKW+PF+T VAF+
Sbjct  125   PSIASKFNIPTGYFSIFVAAYLGFTGPVPGLNNNYENRMTLEELTVSPKWVPFETAVAFK  184

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
              +E+LRI +   E E++N  DI R+    E CD + VR C EF+ EWLK++E+IH KPV 
Sbjct  185   EFELLRIYEGCKEGEEENFYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHPKPVI  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT+Y+         D+W++IK WLDKQE GKVIYVAFGSEAK SQ ELTE++LG
Sbjct  245   PVGQLPTTSYEDDNTD---IDAWREIKLWLDKQEKGKVIYVAFGSEAKLSQNELTELSLG  301

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D ELI +PEGFEERTK RGIV TSW PQLKILSH+SVGGFL
Sbjct  302   LELSGLPFFWVLRTKRGESDNELIQVPEGFEERTKERGIVYTSWVPQLKILSHDSVGGFL  361

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH+GWSS+VEAIQFEKPL+LLTFLADQG+NAR+LEEKK+ Y +PR++ DG FT +AV ES
Sbjct  362   THAGWSSIVEAIQFEKPLLLLTFLADQGINARLLEEKKVAYLIPRNDWDGSFTHKAVVES  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             L LV++EKEG IY++KIKE+K L CD+ RQD YV+ L+ +L  +K IK
Sbjct  422   LYLVLLEKEGEIYQKKIKEVKNLCCDKKRQDDYVENLIRFLQNYKKIK  469



>gb|KHN06911.1| UDP-glycosyltransferase 91A1 [Glycine soja]
Length=468

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 354/458 (77%), Gaps = 7/458 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH+IP LEL+K IA +GH +SFVSTPRNI+RLPKL PNLAS I FVKL
Sbjct  7     KLHIVMFPWLAFGHLIPNLELAKLIAQKGHNISFVSTPRNIERLPKLSPNLASFIKFVKL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT D+PYD V+YLK A D L+E + +FLE    DW+ +D   +W   
Sbjct  67    PLPKVDKLPENAEATTDVPYDVVQYLKKAYDDLEEPLTRFLESSKVDWLFYDLIPFWAGT  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             VASKLG+ +A +SI TPP + F G     + +   RTK +D+TV P WI F TTVA+R +
Sbjct  127   VASKLGIKSAFYSICTPPCMGFLGPPSVLMGEDPYRTKLKDFTVTPPWISFPTTVAYRYF  186

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E++R  DAV++ D  +SD++R  + ++ CDIV +RGC+EF+ EW ++LENI+QKPV PVG
Sbjct  187   EMMRNSDAVSDNDSGISDMYRFGAVIKNCDIVVIRGCTEFEPEWFQVLENIYQKPVLPVG  246

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             QL    ++   G E    +W+ +K WLDKQ  G V+YVAFGSEAKPSQ E+T+IALGLE 
Sbjct  247   QLINREFE---GDEDNITTWQWMKDWLDKQPCGSVVYVAFGSEAKPSQDEVTQIALGLEE  303

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             S   FFWVLR +RG  DP+++ LPEGFEERTKGRGIVCTSWAPQLKILSH +VGGFLTHS
Sbjct  304   SKIRFFWVLRVQRGPWDPDVLRLPEGFEERTKGRGIVCTSWAPQLKILSHVAVGGFLTHS  363

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GW+SVVEA+Q EKPL+LL FLADQGLNARVLEEKK+GYSVPRDERDG  T +A+A S+RL
Sbjct  364   GWTSVVEAVQNEKPLILLAFLADQGLNARVLEEKKMGYSVPRDERDGSITSDAIANSIRL  423

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V+VE EG +YREKIKE+K LF +  RQ+ Y+D LLHYL
Sbjct  424   VMVEDEGRVYREKIKEVKDLFVNTVRQEKYIDELLHYL  461



>ref|XP_006466331.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Citrus sinensis]
Length=478

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/477 (61%), Positives = 361/477 (76%), Gaps = 7/477 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + SKL I M+PWLAFGHMIP+LEL+K IA +GHK+ F+STPRNIDRLP+LP NLAS I F
Sbjct  3     DNSKLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+ LP   NL ENAEATIDLPYD+VKYLK + D L+E MAK L+  +PDW+L DF +YW
Sbjct  63    VKISLPHVDNLRENAEATIDLPYDEVKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKA-EDYTVPPKWIPFKTTVA  1094
             L   A +LG+ +  FSIFT  T+ +FG     + D  +  K  EDYT  P W+ F TT++
Sbjct  123   LPARARELGIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPNWVSFPTTIS  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +RL+E  ++ D +  ++ NVS  +R    ++ CDIVAVR C EF+ EWLKLLE +H+KPV
Sbjct  183   YRLFEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVGQLPTT  D  G  +   D+W+ IK WLD+QE G V+YVAFGSEAKPSQ ELTEIAL
Sbjct  243   IPVGQLPTTTGD--GDSDAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELS  PFFWVL+ R G+AD E I LP+GFEERT+GRG+V TSWAPQL IL+H+SVGGF
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH+GWSSVVEA+QF  PL++LT  ADQGLNA++LEEK+I   +PRDE DG FTR +VAE
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGSFTRNSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             SLRLV+VE++G IYR+K+KEMK LF D+ RQD YVD  L+YL  H+ ++ G +  +T
Sbjct  421   SLRLVLVEEKGQIYRDKLKEMKELFGDRGRQDHYVDNFLNYLKIHRCLRKGEEINTT  477



>gb|KDO60536.1| hypothetical protein CISIN_1g011765mg [Citrus sinensis]
Length=478

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/477 (61%), Positives = 360/477 (75%), Gaps = 7/477 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + SKL I M+PWLAFGHMIP+LEL+K IA +GHK+ F+STPRNIDRLP+LP NLAS I F
Sbjct  3     DNSKLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+ LP   NL ENAEATIDLPYD+VKYLK + D L+E MAK L+  +PDW+L DF +YW
Sbjct  63    VKISLPHVDNLRENAEATIDLPYDEVKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKA-EDYTVPPKWIPFKTTVA  1094
             L   A +LG+ +  FSIFT  T+ +FG     + D  +  K  EDYT  P W+ F TT++
Sbjct  123   LPARARELGIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPNWVSFPTTIS  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +RL+E  ++ D +  ++ NVS  +R    ++ CDIVAVR C EF+ EWLKLLE +H+KPV
Sbjct  183   YRLFEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVGQLPTT  D  G  +   D+W+ IK WLD+QE G V+YVAFGSEAKPSQ ELTEIAL
Sbjct  243   IPVGQLPTTTGD--GDSDAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELS  PFFWVL+ R G+AD E I LP+GFEERT+GRG+V TSWAPQL IL+H+SVGGF
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH+GWSSVVEA+QF  PL++LT  ADQGLNA++LEEK+I   +PRDE DG FTR +VAE
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGFFTRNSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             SLRLV+VE++G IYR+K KEMKGLF D+ R D YVD  L+YL  H+ ++ G +  +T
Sbjct  421   SLRLVLVEEKGQIYRDKAKEMKGLFGDKGRHDRYVDNFLNYLKNHRCLRKGEEINTT  477



>ref|XP_007156463.1| hypothetical protein PHAVU_003G288100g [Phaseolus vulgaris]
 gb|ESW28457.1| hypothetical protein PHAVU_003G288100g [Phaseolus vulgaris]
Length=469

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/468 (62%), Positives = 355/468 (76%), Gaps = 12/468 (3%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             S LHI+M+PWLAFGHMIP LEL+K IA +GH+VSFVSTPRNIDRLPKL P L   INFVK
Sbjct  7     SVLHIVMFPWLAFGHMIPNLELAKLIAEKGHRVSFVSTPRNIDRLPKLSPTL---INFVK  63

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LPLP  QNLPENAEAT D+PYD V+YLK A DAL++   +FLE    DW+ +DF  +W A
Sbjct  64    LPLPKLQNLPENAEATTDVPYDAVQYLKKAYDALEQPFTRFLESSKADWLFYDFVPFWAA  123

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
              VASKLG+ TA +SIFT   + F G       + + R K E+Y V P W+ F TTVA+R 
Sbjct  124   SVASKLGIKTAFYSIFTASVLGFIGPPSYLTANDSPRQKPEEYIVVPPWVTFPTTVAYRY  183

Query  1084  YEILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             YEI+RI+D+++ +++  VSD +R  + ++ CDI  VRGC+EF+ EW  LLENI+ KPV P
Sbjct  184   YEIMRIVDSLSAQNNTGVSDTYRFGASIQNCDIAVVRGCTEFEPEWFHLLENIYGKPVLP  243

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
              GQLP+TA      +E    +W+ +K WLDKQ  G+V+YVAFGSEAKP+Q E+TEIALGL
Sbjct  244   AGQLPSTAPVGSEDNE----TWRWMKEWLDKQARGRVVYVAFGSEAKPTQEEVTEIALGL  299

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             E S  PF WVLR +RG +DP+++ LPEGFEERTK RG+VC SWAPQLKIL H +VGGFLT
Sbjct  300   EKSELPFLWVLRVQRGPSDPDVLRLPEGFEERTKARGVVCRSWAPQLKILEHVAVGGFLT  359

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             HSGW+SVVE IQ EK LVLLTFL+DQG+NARVLEEKK+GYSVPRDE DG F+ ++VAESL
Sbjct  360   HSGWTSVVEGIQNEKALVLLTFLSDQGINARVLEEKKMGYSVPRDEEDGSFSSDSVAESL  419

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             +LVVVE+EG IYRE+IKEMK LF ++ RQ+ Y+D L+H L       Y
Sbjct  420   KLVVVEEEGKIYRERIKEMKDLFVNEDRQNRYIDNLIHNLKTFSKCVY  467



>gb|KDP29778.1| hypothetical protein JCGZ_18713 [Jatropha curcas]
Length=466

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/461 (62%), Positives = 357/461 (77%), Gaps = 5/461 (1%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
              SKLHI ++PWLAFGH IPYLEL+K IA +GHK+SF+STP+NI RLPKLPPNL+S I F+
Sbjct  5     NSKLHIALFPWLAFGHFIPYLELAKLIAQKGHKISFLSTPQNIHRLPKLPPNLSSSITFI  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLPLP    LPENAEAT D+P DKV+YLK A D L++ +  FL+   PDW+++DF  YWL
Sbjct  65    KLPLPSVDGLPENAEATADVPLDKVQYLKKAFDGLKQPITSFLQISKPDWLIYDFAPYWL  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG-RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
               VAS L +S   FSIF    +     + V   +R K ED+TVPP+WI F T VAFR +E
Sbjct  125   PTVASNLCISHGFFSIFLGALLGIAKPKSVINDDRVKPEDFTVPPQWITFPTNVAFRHFE  184

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I++I ++VT +   VSD+FRL   +  C++++VR CS+F+ EWL LL++IH+KP  PVG 
Sbjct  185   IVKIFESVTGDASEVSDMFRLEEVLNGCEMISVRSCSDFEPEWLNLLQDIHRKPCIPVGM  244

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LPTT Y+    +E   D+W+ IK WLDKQ+ G V+YVAFGSEAKPSQ E+ EIALGLELS
Sbjct  245   LPTTQYE----NEDETDTWRTIKEWLDKQKKGYVVYVAFGSEAKPSQVEINEIALGLELS  300

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
               PFFWVLR RRG  D E++ LP+GFEERTK RG+VCTSWAPQLKIL+H+SVGGFLTHSG
Sbjct  301   ELPFFWVLRKRRGLTDTEVVELPDGFEERTKDRGLVCTSWAPQLKILAHDSVGGFLTHSG  360

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSVVEA Q E+PL+LLTFLADQG+NARVLE KK+GY +PR+E DG FTR++VAESLRLV
Sbjct  361   WSSVVEASQNERPLILLTFLADQGINARVLEGKKMGYPIPRNELDGSFTRDSVAESLRLV  420

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +V++EG +YREK KEM+ LF D+++Q+ Y+D  L +LH HK
Sbjct  421   IVKEEGEVYREKAKEMRILFGDRSKQERYLDKFLDFLHAHK  461



>ref|XP_003551309.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Glycine max]
Length=468

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/458 (62%), Positives = 353/458 (77%), Gaps = 7/458 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH+IP LEL+K IA +GH +SFVSTPRNI+RLPKL PNLAS I FVKL
Sbjct  7     KLHIVMFPWLAFGHLIPNLELAKLIAQKGHNISFVSTPRNIERLPKLSPNLASFIKFVKL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT D+PYD V+YLK A D L+E + +FLE    DW+ +D   +W   
Sbjct  67    PLPKVDKLPENAEATTDVPYDVVQYLKKAYDDLEEPLTRFLESSKVDWLFYDLIPFWAGT  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             VASKLG+ +A +SI TPP + F G     + +   RTK + +TV P WI F TTVA+R +
Sbjct  127   VASKLGIKSAFYSICTPPCMGFLGPPSVLMGEDPVRTKLKGFTVTPPWISFPTTVAYRYF  186

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E++R  DAV++ D  +SD++R  + ++ CDIV +RGC+EF+ EW ++LENI+QKPV PVG
Sbjct  187   EMMRNSDAVSDNDSGISDMYRFGAVIKNCDIVVIRGCTEFEPEWFQVLENIYQKPVLPVG  246

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             QL    ++   G E    +W+ +K WLDKQ  G V+YVAFGSEAKPSQ E+T+IALGLE 
Sbjct  247   QLINREFE---GDEDNITTWQWMKDWLDKQPCGSVVYVAFGSEAKPSQDEVTQIALGLEE  303

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             S   FFWVLR +RG  DP+++ LPEGFEERTKGRGIVCTSWAPQLKILSH +VGGFLTHS
Sbjct  304   SKTRFFWVLRVQRGPWDPDVLRLPEGFEERTKGRGIVCTSWAPQLKILSHVAVGGFLTHS  363

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GW+SVVEA+Q EKPL+LL FLADQGLNARVLEEKK+GYSVPRDERDG  T +A+A S+RL
Sbjct  364   GWTSVVEAVQNEKPLILLAFLADQGLNARVLEEKKMGYSVPRDERDGSITSDAIANSIRL  423

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V+VE EG +YREKIKE+K LF +  RQ+ Y+D LLHYL
Sbjct  424   VMVEDEGRVYREKIKEVKDLFVNTVRQEKYIDELLHYL  461



>ref|XP_006426251.1| hypothetical protein CICLE_v10025508mg [Citrus clementina]
 gb|ESR39491.1| hypothetical protein CICLE_v10025508mg [Citrus clementina]
Length=478

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/477 (60%), Positives = 359/477 (75%), Gaps = 7/477 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + SKL I M+PWLAFGHMIP+LEL+K IA +GHK+ F+STPRNIDRLP+LP NLAS I F
Sbjct  3     DNSKLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+ LP   NL ENAEATIDLPYD+VKYLK + D L+E MAK L+  +PDW+L DF +YW
Sbjct  63    VKISLPHVDNLRENAEATIDLPYDEVKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKA-EDYTVPPKWIPFKTTVA  1094
             L   A +L + +  FSIFT  T+ +FG     + D  +  K  EDYT  P W+ F TT++
Sbjct  123   LPARARELDIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPSWVSFPTTIS  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +RL+E  ++ D +  ++ NVS  +R    ++ CDIVAVR C EF+ EWLKLLE +H+KPV
Sbjct  183   YRLFEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVGQLPTT  D  G  +   D+W+ IK WLD+QE G V+YVAFGSEAKPSQ ELTEIAL
Sbjct  243   IPVGQLPTTTGD--GDSDAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELS  PFFWVL+ R G+AD E I LP+GFEERT+GRG+V TSWAPQL IL+H+SVGGF
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH+GWSSVVEA+QF  PL++LT  ADQGLNA++LEEK+I   +PRDE DG FTR +VAE
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGFFTRNSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             SLRLV+VE++G IYR+K KEMKGLF D+ R D YVD  L+YL  H+ ++ G +  +T
Sbjct  421   SLRLVLVEEKGQIYRDKAKEMKGLFGDKGRHDRYVDNFLNYLKNHRCLRKGEEINTT  477



>ref|XP_002318358.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa]
 gb|EEE96578.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa]
Length=475

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/465 (60%), Positives = 355/465 (76%), Gaps = 7/465 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             K+H+ M+PWLAFGHM+P+LEL+K  A++GHK+SF+STPRNIDRLPK P +++S ++FVKL
Sbjct  7     KIHVAMFPWLAFGHMMPWLELAKLFAAKGHKISFISTPRNIDRLPKPPADVSSTLHFVKL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  + LP +AEATIDLP +KV+YLK+A D +QE  AK LE  +PDWI +DF  YW  P
Sbjct  67    PLPQVEGLPPDAEATIDLPANKVQYLKIALDKVQEPFAKVLESLNPDWIFYDFAQYWTGP  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +A++LG+ +  FSI     VAF G    L+D  + R K ED+T+PPKW+ F+TTVA++ Y
Sbjct  127   IAAQLGIKSTYFSICIAAMVAFLGPPSPLIDGDDYRKKPEDFTIPPKWVSFQTTVAYKYY  186

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             +I+   D V ++   V+D+ R    ++ CD +AVR   E + EWL++LE IH+KPVFPVG
Sbjct  187   DIMNTFDCVEDDASGVNDLKRWGLCLQSCDFIAVRSSFEIEPEWLQVLETIHEKPVFPVG  246

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             QLP   Y+     E   D+W  +K W D QE   V+YVAFGSEAKPSQ +LTE+ALGLEL
Sbjct  247   QLPPVEYEL---EEKNSDAWSSMKKWFDMQEKSSVVYVAFGSEAKPSQAQLTELALGLEL  303

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFWVLR RRG  D +LI LP GFEERTKG+G+VCT+WAPQL IL+HES+ GFLTHS
Sbjct  304   SGLPFFWVLRTRRGITDTDLIELPPGFEERTKGQGVVCTTWAPQLMILAHESIAGFLTHS  363

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVEA+ F+K L+LLTF +DQG+NARVLEEKKIGYS+PR+E DG FTR++VAESLRL
Sbjct  364   GWSSVVEALTFQKALILLTFYSDQGINARVLEEKKIGYSIPRNELDGSFTRDSVAESLRL  423

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             V+V +EG +YR+K KEM GLF D+ RQD YVD +L YL  H+ +K
Sbjct  424   VMVSEEGKMYRDKAKEMSGLFGDRDRQDKYVDNILIYLKSHRPVK  468



>ref|XP_002270260.1| PREDICTED: UDP-glycosyltransferase 91A1 [Vitis vinifera]
Length=479

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/465 (61%), Positives = 356/465 (77%), Gaps = 4/465 (1%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
              + +KLHI+++PWLAFGHMIPYLEL+K +A RGH VSFVSTPRNIDRLPKLPPNL   I+
Sbjct  10    QDDAKLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFIS  69

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+PLP   NLPENAEAT DLP +KV++LK A + L+E +  FL+  +PDW+LHDF +Y
Sbjct  70    FVKIPLPHVPNLPENAEATTDLPENKVQFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAY  129

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             WL P+A+KLG++    SIFT   + FF        RT+ ED+TV PKW+PF + VAFR +
Sbjct  130   WLVPIATKLGIACGFLSIFTASVLCFFNPSGQ-DHRTEPEDFTVAPKWVPFPSRVAFRYF  188

Query  1081  EILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             E+++I + A+  +    SD+ R  + +  CD++AVR C+E + EWL+LLE ++QKPV PV
Sbjct  189   EVVKIFNNAIAGDASGTSDMHRFEACIRGCDLLAVRSCTELEPEWLRLLEQLYQKPVVPV  248

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             GQLP       GG +   ++W +IK WLDKQ  G V+YVAFGSEAKP+QTELTEIALGLE
Sbjct  249   GQLPPIL--PNGGDDDEDETWLEIKCWLDKQAGGSVVYVAFGSEAKPNQTELTEIALGLE  306

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              S  PFFW L+ +RG  D E+I LPEGF+ERTKGRG+VCTSWAPQLKILSH S+ GFL+H
Sbjct  307   QSELPFFWALKLKRGPCDTEVIQLPEGFKERTKGRGVVCTSWAPQLKILSHPSICGFLSH  366

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGW+SVVEA+Q E+PL+LLTFLADQGLNA  L EKK+G  +PR+E DG FTREAVA+SLR
Sbjct  367   SGWTSVVEALQLERPLILLTFLADQGLNASFLREKKMGCLIPRNEEDGSFTREAVAQSLR  426

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             LVVVE+ G IYR+K KEM+G+F D+ RQ+ YVDTL+  L  H+ I
Sbjct  427   LVVVEEGGKIYRDKAKEMRGVFGDRDRQNQYVDTLVSCLKEHRHI  471



>ref|XP_009623233.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=484

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/469 (60%), Positives = 350/469 (75%), Gaps = 5/469 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLHI M PWLAFGHM+PYLEL+KHIA +GHK+SF+STPRNIDRLPKLPPN++  I F
Sbjct  4     ENKKLHIAMVPWLAFGHMLPYLELAKHIALKGHKISFISTPRNIDRLPKLPPNISPFIRF  63

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+PL P +NLP++AEAT DLPY+KV+YLK+A DAL++++  FL+   PDWI  DF +YW
Sbjct  64    VKIPLQPVENLPKDAEATTDLPYEKVQYLKIAYDALRDSIRHFLQTNKPDWIFFDFAAYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAF  1091
               P+A++L +S+A FSI     + F G     +  +    + +  T  PKW+ F TTVAF
Sbjct  124   AGPIATELNISSAFFSIMIAAVLGFLGPAPVLMSGYGTLDELKVLTASPKWVNFPTTVAF  183

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RLYE+LR+ D+ T      SDI+R  +G++ CD++  R CSEF+ EWL L+E IH+KPVF
Sbjct  184   RLYEVLRMKDSFTGNMSEASDIYRFGAGIKSCDVLLNRSCSEFEPEWLHLVEQIHRKPVF  243

Query  910   PVGQL-PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
             PVGQL P T  +              IK WLD QE G VIYVAFGSEAKPSQ ELTEIA 
Sbjct  244   PVGQLSPLTIDNCDDESNGVWTGGSTIKQWLDSQEKGSVIYVAFGSEAKPSQEELTEIAH  303

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVLR +RGE D +LI LPEGFEERT  RG+VCT WAPQLKILSH+SVGGF
Sbjct  304   GLELSGLPFFWVLRKQRGEFDTDLIELPEGFEERTNDRGMVCTGWAPQLKILSHDSVGGF  363

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTHSGWSSVVEA+ +EK L+LL FL+DQGLNAR+LEEKK+ YS+PRDER+G FTR++VA 
Sbjct  364   LTHSGWSSVVEALSYEKALILLPFLSDQGLNARLLEEKKMAYSIPRDEREGTFTRDSVAN  423

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             SL LV++E+ G +YRE  K M+ LF D+ +Q+ YVD L+ YL  H+ I+
Sbjct  424   SLSLVMLEEGGKVYRENAKNMRELFADKGKQEKYVDNLMKYLQKHREIE  472



>ref|XP_003552084.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Glycine max]
 gb|KHN27633.1| UDP-glycosyltransferase 91A1 [Glycine soja]
Length=465

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/459 (63%), Positives = 355/459 (77%), Gaps = 11/459 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KL I+M+PWLAFGHMIP LEL+K IA +GH+VSFVSTPRNI RLPK  PN  + INFVKL
Sbjct  7     KLTIVMFPWLAFGHMIPNLELAKLIARKGHQVSFVSTPRNIQRLPKPSPN--TLINFVKL  64

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  QNLPENAEAT D+PYD V++LK+A DALQE + +FLE   PDW+ +DF  +W   
Sbjct  65    PLPKIQNLPENAEATTDIPYDVVEHLKVAYDALQEPLKRFLESSKPDWLFYDFVPFWAGS  124

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF----AERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +ASKLG+ +A +SI TPP   F G         + R K ED+ V P W+PF TTVAFR +
Sbjct  125   IASKLGIKSAFYSICTPPFSGFLGPPSSLMGKDSLRQKPEDFIVSPPWVPFPTTVAFRYF  184

Query  1081  EILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             EI+RI+D+++ E++  VSD +R  +  E CDIV +RGC+EF  EW ++LENI++KPV P+
Sbjct  185   EIMRIVDSLSAENNTGVSDAYRYGASAENCDIVVIRGCTEFQPEWFQVLENIYRKPVLPI  244

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             GQLP+T  D  GG +   D+W+ +K WLDK   G V+YVAFGSEAKP Q E+TEIALGLE
Sbjct  245   GQLPST--DPVGGED--TDTWRWVKDWLDKHARGSVVYVAFGSEAKPRQDEVTEIALGLE  300

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              S  PFFW LR +RG  DP+++ LPEGFEERTK  G+VCT+WAPQLKIL H +VGGFLTH
Sbjct  301   KSKLPFFWALRLQRGPWDPDVLRLPEGFEERTKALGVVCTTWAPQLKILGHMAVGGFLTH  360

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGW+SVVEAI  EKPLVLLTFL+DQG+NARVLEEKK+GYSVPR+ERDG FT ++VAESLR
Sbjct  361   SGWTSVVEAILNEKPLVLLTFLSDQGINARVLEEKKMGYSVPRNERDGLFTSDSVAESLR  420

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             LV+VE+EG IYRE+IKEMK LF ++ RQ+ Y+D LL  L
Sbjct  421   LVMVEEEGRIYRERIKEMKDLFVNRERQNMYIDNLLRTL  459



>ref|XP_011017699.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=468

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/464 (61%), Positives = 355/464 (77%), Gaps = 6/464 (1%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
              SKLHI M+PWLAFGHMIPYLEL+K +A +GHK+SF+STPRN DRLPKL P+++  I FV
Sbjct  4     SSKLHIAMFPWLAFGHMIPYLELAKLVAQKGHKISFISTPRNTDRLPKLHPSISPLITFV  63

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP-DWILHDFDSYW  1259
             +L LP  +NLP+ AEAT D+PYDKV+YLK A D L+E ++KFL+     D IL DF  YW
Sbjct  64    RLSLPQVENLPKGAEATTDVPYDKVQYLKQACDDLKEPLSKFLQTCDDLDCILFDFAPYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             L  +A   G+ +  FSIFT   +++        +R+K ED+TVPPKW+PF T V FRL+E
Sbjct  124   LPDIAMSFGIPSVFFSIFTAAMLSYVKPASGIDDRSKPEDFTVPPKWVPFPTNVVFRLFE  183

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             +LRI    +   + VSD++R   G++ CD++AVR C EF+ EWL+LLE IH KPV PVG 
Sbjct  184   VLRIF-YQSLAGNVVSDLYRTQEGIKGCDMIAVRSCMEFEPEWLQLLEEIHGKPVIPVGV  242

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             L TT YD G   E    +W+ IK WLDKQ+ G V+Y+AFGSEAKPSQ ELTEIALGLELS
Sbjct  243   LATTVYDTGVEDE----AWRSIKDWLDKQKQGSVVYIAFGSEAKPSQVELTEIALGLELS  298

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PFFWVLR  RG AD ELI LPEGFEERT+ +G+V TSWAPQLKIL+H+SVGGFLTHSG
Sbjct  299   GLPFFWVLRKHRGSADTELIKLPEGFEERTRAQGLVWTSWAPQLKILAHDSVGGFLTHSG  358

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSVVEA+Q  + L+LLTFLADQG+NARVLE+KK+GYS+PR+E++G FTR++VAESLRLV
Sbjct  359   WSSVVEALQHARSLILLTFLADQGINARVLEDKKMGYSIPRNEKNGYFTRDSVAESLRLV  418

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             + ++EG IYR+K+KEMK LF D+ RQD YVD L+ +L  H   K
Sbjct  419   MEKEEGKIYRDKVKEMKPLFADKDRQDKYVDKLVDHLRSHGRTK  462



>ref|XP_003635105.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Vitis vinifera]
Length=480

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/463 (60%), Positives = 354/463 (76%), Gaps = 3/463 (1%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             ++LH++M+PWLAFGHMIPYLEL+K IA  G+ VSFVSTPRNIDRLPKLPPNLA  I FVK
Sbjct  13    AQLHVVMFPWLAFGHMIPYLELAKLIAQSGNHVSFVSTPRNIDRLPKLPPNLAPFITFVK  72

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LPLP   NL ENAEAT DLP DKV++LK+A D LQ+ MA+FL+   PDW++HDF  YWL 
Sbjct  73    LPLPHVPNLLENAEATADLPNDKVQFLKVAYDLLQQPMARFLDAADPDWVIHDFAPYWLG  132

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
             P+A+KLG+S A FSIF    V+FF        R++ + +TVPPKW+PF++ VAFR +EI 
Sbjct  133   PIATKLGISCAFFSIFNASCVSFFTPGDQLEYRSEPDHFTVPPKWVPFQSKVAFRYFEIK  192

Query  1072  RII-DAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +II + ++ +   +S  +RL   +E CD++AVR C E + EWL+LLE +++KPV PVGQL
Sbjct  193   KIISEGLSGDASGISFKYRLTESIEGCDLLAVRSCFELEPEWLRLLEQLNRKPVIPVGQL  252

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
                  D G   +   ++W+ IK WLDK   G V+YVAFGSEAKP+QTE+TEIALGLE S 
Sbjct  253   APELDDRG--DDGKDETWQQIKEWLDKLARGSVVYVAFGSEAKPNQTEITEIALGLEQSE  310

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWVL+   G +D E++ LPEGFEERTKGRG+VCTSWAPQLKILSH+S+GGFL+HSGW
Sbjct  311   LPFFWVLKMSLGPSDTEMVKLPEGFEERTKGRGVVCTSWAPQLKILSHDSIGGFLSHSGW  370

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEA+  E+PL+LLTF ADQGLNA  L+EKK+GY +PR+  DG FTREAVA+SLRLV+
Sbjct  371   SSVVEALSLERPLILLTFFADQGLNASFLQEKKMGYLIPRNGGDGSFTREAVAQSLRLVM  430

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             VE+ G IYR+K KEM GLF D+ +Q  Y+D  + YL  ++ IK
Sbjct  431   VEEGGKIYRDKAKEMSGLFRDRDKQKHYMDNFVSYLKAYRRIK  473



>ref|XP_010312900.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/465 (63%), Positives = 362/465 (78%), Gaps = 8/465 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
             G KLHI ++PWLAFGHMIPYLELSK IA +GHK+SF+STPRNIDRLPKLPP+L    NFV
Sbjct  5     GKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPSLIPFFNFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP+P  + LPENAEATIDLPY++VK+LKLA DALQE++AKFLE+   D+IL DF SYWL
Sbjct  65    KLPMPHVEKLPENAEATIDLPYEQVKHLKLAHDALQESIAKFLEDSDIDFILFDFVSYWL  124

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRL----VDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +ASK  + T  FSIF    + F G +     ++  R   E+ TV PKW+PF+T VAF+
Sbjct  125   PSIASKFNIPTGYFSIFVAAYLGFTGPVPGLNNNYEIRMTLEELTVSPKWVPFETAVAFK  184

Query  1087  LYEILRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
              +E+LRI +   E E++N  DI R+    E CD + VR C EF+ EWLK++E+IH KPV 
Sbjct  185   EFELLRIYEGCKEGEEENFYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHPKPVI  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQLPTT+Y+         D+W++IK WLDKQ+ GKVIYVAFGSEAK SQ ELTE++LG
Sbjct  245   PVGQLPTTSYEDDNT---DIDAWREIKLWLDKQDKGKVIYVAFGSEAKLSQNELTELSLG  301

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE+D ELI +PEGFEERTK RGIV TSW PQLKILSH+SVGGFL
Sbjct  302   LELSGLPFFWVLRTKRGESDDELIQVPEGFEERTKERGIVYTSWVPQLKILSHDSVGGFL  361

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH+GWSS+VEAIQFEKPL+LLTFLADQG+NAR++EEK + Y +PR++ DG FT +AV ES
Sbjct  362   THAGWSSIVEAIQFEKPLLLLTFLADQGINARLVEEKNVAYLIPRNDWDGSFTHDAVVES  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             L  V+++KEG IYR+KIKE+K L CD+ RQD YV+ LL +L  +K
Sbjct  422   LYFVLLKKEGEIYRKKIKEVKNLCCDKKRQDDYVENLLRFLQNYK  466



>ref|XP_009803298.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=483

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/468 (59%), Positives = 347/468 (74%), Gaps = 4/468 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLHI M PWLAFGH++PYLEL+KHIA +GHK+SF+STPRNIDRLPKLP +++  I F
Sbjct  4     ENRKLHIAMLPWLAFGHILPYLELAKHIALKGHKISFISTPRNIDRLPKLPSHISPFIRF  63

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+PL P +NLP++AEAT DLPYDKV+YLK+A DA+++++  FL+   PDWI  DF +YW
Sbjct  64    VKIPLQPVENLPKDAEATTDLPYDKVQYLKIAYDAMRDSIHHFLQTNKPDWIFFDFAAYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAF  1091
               P+A++L +S+A FSI     + F G     +  +    + E  T  PKW+ F TTVAF
Sbjct  124   AGPIATELNISSAFFSIMIAAVLGFLGPAPVLISGYGTLDEPEVLTASPKWVNFPTTVAF  183

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RLYE+LR+ D+ T      SDI+R  +G++ CD++ +R CSEF+ EWL L+E IHQK VF
Sbjct  184   RLYEVLRMKDSFTGNMSEASDIYRFGAGIKSCDVLLIRSCSEFEPEWLHLVEEIHQKLVF  243

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVGQL     D          +   IK WLD QE G VIYVAFGSEAKPSQ ELTEIA G
Sbjct  244   PVGQLSPLTIDNCDDESNGAWTGGSIKQWLDSQEKGSVIYVAFGSEAKPSQEELTEIAHG  303

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RGE D +L  LP+GFE+RTK RG+VC  WAPQLKILSH+SVGGFL
Sbjct  304   LELSGLPFFWVLRKQRGEFDTDLNELPKGFEQRTKDRGVVCMGWAPQLKILSHDSVGGFL  363

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             THSGWSSVVEAI +EK L+LL FLADQGLNAR+LEEKK+ YS+PRDER+G FTR++VA S
Sbjct  364   THSGWSSVVEAISYEKALILLPFLADQGLNARLLEEKKMAYSIPRDEREGTFTRDSVANS  423

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             L LV++E+ G +YRE  K M+ LF D+ +Q+ YV+ L+ YL  H+ I+
Sbjct  424   LSLVMLEEGGKVYRENAKNMRELFADKRKQEKYVENLMKYLQKHREIQ  471



>dbj|BAO45905.1| UDP-glycosyltransferase [Acacia mangium]
Length=468

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/463 (60%), Positives = 348/463 (75%), Gaps = 9/463 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH+IPYLEL+K IA +GH VSFVS PRNIDRLPKLPP+L+  I  VKL
Sbjct  6     KLHIVMFPWLAFGHIIPYLELAKLIAEKGHHVSFVSAPRNIDRLPKLPPHLSPLIKLVKL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   +LP +AEAT+D+PY+ V++LK A D  Q+ M  FLE   PDWIL+DF  YW+  
Sbjct  66    PLPKVHDLPHDAEATVDVPYNVVQHLKKAYDEFQQPMTLFLESSKPDWILYDFAPYWIGS  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLV-----DFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +ASKLG+ TA F IF   ++ F G  +     D   R   +DY VPP W+PF TTVAFR 
Sbjct  126   IASKLGIKTAFFCIFMAMSMGFMGSSLTLMGTDDNSRKTLQDYLVPPPWVPFPTTVAFRY  185

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +EI++I D+ +  +  VSD +RL   ++ CDIV VR C EF++EW++LLE++++KPV PV
Sbjct  186   FEIMKISDSFSNNNSGVSDTYRLALSIQNCDIVLVRSCFEFEAEWIQLLEHLYKKPVVPV  245

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP+T YD G  +E    +W+ +  WLD+Q  G V+YVAFGSEAKPSQ E+ EIALGLE
Sbjct  246   GLLPSTTYDDGKENE----TWRWMNEWLDRQRKGTVVYVAFGSEAKPSQEEVREIALGLE  301

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              S  PF W LR +RG  DPE++ LPEGFEERT+GRG+VC+ W PQLKIL HESVGGFL+H
Sbjct  302   KSELPFLWALRVQRGPTDPEILQLPEGFEERTRGRGVVCSYWVPQLKILGHESVGGFLSH  361

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SG SSVVEAIQ EKPLV L  LADQGL +RVLEEKKIGYS+PRD+RDG FT E+VA++LR
Sbjct  362   SGCSSVVEAIQNEKPLVFLALLADQGLISRVLEEKKIGYSIPRDDRDGSFTSESVADALR  421

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +VVVE+ G I+REK+KE+KG+F ++ RQ+ YV  LL  L  HK
Sbjct  422   MVVVEERGRIFREKMKEIKGIFVNRERQEEYVRKLLSCLRDHK  464



>ref|XP_007047762.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX91919.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=535

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/466 (60%), Positives = 346/466 (74%), Gaps = 8/466 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             SKLHI M+PWLAFGHMIP+LE +K +A +GHK+SF STP+NIDRLPKLPP+LAS I F+K
Sbjct  64    SKLHIAMFPWLAFGHMIPFLEFAKLVAEKGHKISFSSTPKNIDRLPKLPPHLASLIYFIK  123

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LPLP   +LP+NAEATID+P D V Y K A D LQ+ MA+ L+  SPDW+L DF +YWL 
Sbjct  124   LPLPQINHLPQNAEATIDVPLDDVWYFKKAYDGLQQPMAQLLQSLSPDWLLLDFAAYWLP  183

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
              +A  L +  A FSI T   + + G     +    +  K EDY V PKW+ F +TV  +L
Sbjct  184   SIARSLNIPNAFFSIVTAACLGYLGPPSFLMHGDEDHKKPEDYAVLPKWVTFPSTVRLKL  243

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             YE+L+I + +T +  N SD +R  + ++ CD+VAVR C E + EWLKLLE +++KPV PV
Sbjct  244   YEVLKIYNGITGDKTNTSDFYRFGATLKDCDMVAVRSCMELEPEWLKLLEQLYEKPVIPV  303

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G+LPTT Y+    +    + WK +K WLDKQE G V+Y+AFGSEAKPSQ EL EIA GLE
Sbjct  304   GELPTTDYN----NSEETEGWKSMKEWLDKQEKGSVVYIAFGSEAKPSQEELNEIAQGLE  359

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              SG PF WVLR  RG  D E I LPEGFEERTK RG+V T+WAPQLKIL+H+S+GGFLTH
Sbjct  360   FSGLPFLWVLRKSRGSTDAEPIKLPEGFEERTKERGVVLTTWAPQLKILAHDSIGGFLTH  419

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             +GWSSVVEA QF +PL+L TFLADQG+NAR+LEEKKIGYS+PR E+DG FTR +VAESLR
Sbjct  420   TGWSSVVEAPQFLRPLILFTFLADQGINARLLEEKKIGYSIPRKEQDGSFTRNSVAESLR  479

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             LVVVE EG IYR+K KEMK +F D+ +Q+ Y+D  L YL  H+ +K
Sbjct  480   LVVVEDEGKIYRDKAKEMKRVFGDRDKQNWYLDNFLGYLENHRRLK  525



>ref|XP_002270294.1| PREDICTED: UDP-glycosyltransferase 91A1 [Vitis vinifera]
Length=479

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/471 (60%), Positives = 353/471 (75%), Gaps = 9/471 (2%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
              + +KLHI+++PWLAFGHMIPYLEL+K +A RGH VSFVSTPRNIDRLPKLPPNL   I+
Sbjct  10    QDDAKLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFIS  69

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+PLP   NLPENAEAT DLP +KV +LK A + L+E +  FL+  +PDW+LHDF +Y
Sbjct  70    FVKIPLPHVPNLPENAEATTDLPENKVPFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAY  129

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             WL P+A+KLG++    SIFT   + FF        RT+ ED+TV PKW+PF + VAFR +
Sbjct  130   WLVPIATKLGIACGFLSIFTASALCFFNPSGQ-DHRTEPEDFTVAPKWVPFPSRVAFRYF  188

Query  1081  EILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             E+++I + A+  +    SD+ R  + +  CD++AVR C+E + EWL+LLE ++QKPV PV
Sbjct  189   EVVKIFNNAIAGDASGTSDMHRFEACLRGCDLLAVRSCTELEPEWLRLLEQLYQKPVVPV  248

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             GQLP       GG +   ++W +IK WLDKQ  G V+YVAFGSEAKP+QTELTEIALGLE
Sbjct  249   GQLPPIL--PHGGDDDEDETWLEIKGWLDKQAGGSVVYVAFGSEAKPNQTELTEIALGLE  306

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              S  PFFW L+ +RG  D E+I LPEGFEERTKGRG+VCTSWAPQLKILSH S+ GFL+H
Sbjct  307   QSELPFFWALKLKRGPCDIEVIQLPEGFEERTKGRGVVCTSWAPQLKILSHPSICGFLSH  366

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGW+SVVEA+Q E+PL+LLTFLADQGLNA  L EKK+G  +PR+E DG FTREAVA SLR
Sbjct  367   SGWTSVVEALQLERPLILLTFLADQGLNASFLREKKMGCLIPRNEEDGSFTREAVARSLR  426

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLL-----HYLHCHKSIK  227
             LVVVE+    YR+K KEM+ +F D+ RQ+ YVDTL+     H  H HK+ +
Sbjct  427   LVVVEEGDKFYRDKAKEMRAVFGDRDRQNQYVDTLVSCLKEHRRHVHKAAR  477



>ref|XP_002297733.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE82538.1| glycosyltransferase family protein [Populus trichocarpa]
Length=475

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/462 (62%), Positives = 348/462 (75%), Gaps = 3/462 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + SKLHI M+PWLAFGHMIPYLEL+K IA +GHK++F+STPRNIDRLPKLPP L+  INF
Sbjct  3     DDSKLHIAMFPWLAFGHMIPYLELAKLIAQKGHKITFISTPRNIDRLPKLPPYLSPLINF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLE-EFSPDWILHDFDSY  1262
             VKLPLP   +L E  EAT D+PY+KV+YLK+A D L+E M +FL      D++L+DF  Y
Sbjct  63    VKLPLPHAAHLLEGDEATTDVPYNKVQYLKVAFDGLKEPMTRFLATSHDIDYLLYDFAPY  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             WL  +A+ LG+  A FSIF    V F        +RT+ E +TVPPK IPF TTV F+L+
Sbjct  123   WLPEIATGLGIPNAFFSIFLGAAVCFLKPASLIEDRTEPEHFTVPPKSIPFPTTVRFKLF  182

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             EILRI ++VT +  +VSDI+RL   +  C +VA+R C EF+ EWL L + +  KPV PVG
Sbjct  183   EILRIFESVTGDASDVSDIYRLQEVLRCCQMVAIRSCMEFEPEWLHLFQELIGKPVIPVG  242

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              L  T  DA    +     WK +K WLDKQE G V+YVAFGSEAKPSQ ELTEIALGLEL
Sbjct  243   LLAPTEDDAV--RDEGSGMWKSMKDWLDKQEKGSVVYVAFGSEAKPSQVELTEIALGLEL  300

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFWVLR RRG  D E+I LPEGFE+RT+GRG+V TSW PQLKIL+H+SVGGFLTHS
Sbjct  301   SGLPFFWVLRTRRGLTDNEVIKLPEGFEDRTRGRGLVFTSWVPQLKILAHDSVGGFLTHS  360

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVEA+Q E+ L+LL+FLA+QGLN+RV EEKKIGY +PRDE DG FTR++VAESLRL
Sbjct  361   GWSSVVEALQHERALILLSFLAEQGLNSRVFEEKKIGYPIPRDESDGSFTRDSVAESLRL  420

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V+V++EG IYREK KEMKGLF ++  QD YV   L Y+  H+
Sbjct  421   VMVKEEGKIYREKAKEMKGLFGNKDIQDQYVVNFLRYIMSHR  462



>gb|KEH20104.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=468

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/462 (60%), Positives = 349/462 (76%), Gaps = 9/462 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   LHI+M+PWLAFGHMIPYLEL+K IA +GH+VS+VSTPRNI RLPKLPPN+A  I F
Sbjct  7     EEKALHIVMFPWLAFGHMIPYLELAKLIAQKGHQVSYVSTPRNIQRLPKLPPNVAPLIKF  66

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V LPLP   NLPENAEAT D+PYD V +LK A D L++ +  FL+  + DWILHDF  +W
Sbjct  67    VSLPLPKVDNLPENAEATTDIPYDVVPHLKNAFDKLEQPLTHFLQSSNADWILHDFVPFW  126

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAF  1091
             L  VA +LG+    FSIFTPP + F G     L +   RTK ED+ V P W+PFKTTVA+
Sbjct  127   LGSVAPQLGIKCVFFSIFTPPFMGFMGPGSVLLGNDPVRTKPEDFLVSPSWVPFKTTVAY  186

Query  1090  RLYEILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             R +EI++I+D +++ +D+  SD +R  S ++  + + +RGC+EF+ EW ++++NIH K V
Sbjct  187   RYFEIIKIMDILSDNNDSGFSDAYRFCSSIKNSEFILIRGCTEFEPEWFQVIQNIHNKLV  246

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P GQL +T ++  GG E   ++W  +K WLDK+  G V+YVAFGSEAKPSQ E+ EIAL
Sbjct  247   LPAGQLLSTEFE--GGDE--NNTWWWMKEWLDKKPNGTVVYVAFGSEAKPSQEEVNEIAL  302

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE S  PFFWVLR RRG  D  ++ LPEGFEERTK RG+VCT WAPQ+KILSH +VGGF
Sbjct  303   GLEKSNLPFFWVLRVRRGPTDKVVLQLPEGFEERTKVRGVVCTEWAPQMKILSHVAVGGF  362

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH+GW+SVVEA+Q EKPLVLLT LADQG+NAR+LEEKK+GYSVPRDERDG FT + VA 
Sbjct  363   LTHAGWTSVVEAVQHEKPLVLLTCLADQGINARMLEEKKMGYSVPRDERDGSFTSDMVAH  422

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             S+RLV+VE+EG IYR+ IK MK LF +  RQD YV +LL +L
Sbjct  423   SIRLVMVEEEGRIYRDNIKNMKDLFVNPERQDRYVTSLLDHL  464



>ref|XP_008440527.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=466

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 345/457 (75%), Gaps = 7/457 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFV  1436
             +KLHI ++PWLAFGHMIP+LELSKHIA +GH+VSFVSTPRNIDRLP KLPP+L+S + FV
Sbjct  5     NKLHIAIFPWLAFGHMIPFLELSKHIAQKGHRVSFVSTPRNIDRLPTKLPPHLSSFLRFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP P   +LP +AEAT D+PYDKV++LK A D L++ +  FL+    DWIL DF  YWL
Sbjct  65    KLPFPQIHDLPPDAEATSDVPYDKVQFLKKALDDLKQPLVDFLQSSDVDWILFDFAPYWL  124

Query  1255  AP-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             +  +   LG+ TA FSI+TP  + F G +     R K ED+TV P W+PF T V FR +E
Sbjct  125   SQDIGPTLGIKTAFFSIYTPECLVFLGPMFG-DNRIKPEDFTVSPDWVPFPTNVVFRHFE  183

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I+RI D+V+     VSD+ R+  G    D+V VRGC EF  EW++LL +I+ KPVFPVGQ
Sbjct  184   IMRIFDSVSGNITGVSDLDRMKRGAHYSDLVVVRGCPEFGQEWIQLLGDIYCKPVFPVGQ  243

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LPTT Y+ G  +     +W+ IK WLDKQ    V+YVAFGSEAKPSQ ELTEIALGLE S
Sbjct  244   LPTTEYETGDENP----AWRTIKEWLDKQPKASVVYVAFGSEAKPSQNELTEIALGLEKS  299

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
                FFWV R RRG +DP+ I LPEGFEERTK RG+V T+WAPQLKIL HESVGGFLTHSG
Sbjct  300   DLRFFWVFRTRRGPSDPDPIELPEGFEERTKERGVVWTTWAPQLKILGHESVGGFLTHSG  359

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSVVEAIQ EK LVLLTFLADQG+NARVLEEKK+GYSVPR+E DG FTR+AVAESL+LV
Sbjct  360   WSSVVEAIQSEKALVLLTFLADQGINARVLEEKKMGYSVPRNELDGSFTRDAVAESLKLV  419

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V E+EG IYRE I++ K LF ++ + D  +D LL ++
Sbjct  420   VAEEEGKIYRETIRKAKSLFVNKEKDDKLIDRLLDHM  456



>gb|KEH20103.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 344/462 (74%), Gaps = 9/462 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   LHI+M+PWLAFGHMIPYLE++K IA +GH+VS+VSTPRNI RLP+LPPN+A  I F
Sbjct  3     EEKALHIVMFPWLAFGHMIPYLEVAKLIAQKGHQVSYVSTPRNIQRLPQLPPNVAPLIKF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V LP+P   NLPENAEAT D+ +D  +YLK A D L++ +  FLE    DWILHDF  +W
Sbjct  63    VSLPMPKVDNLPENAEATTDVSWDVFQYLKDAFDKLEQPLTNFLESSDADWILHDFAPFW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTVA  1094
             L PVA+K+G+    F+I TPP +AF G +          RTK EDYT PP WIPF TTVA
Sbjct  123   LGPVATKIGIKCVFFNITTPPNLAFLGPISVLTGKEKDPRTKLEDYTAPPPWIPFNTTVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             ++ +EI +  +  +++D  VS++ R+ S V+ CD + +RGC+EF+ EW +LL+N+ QKPV
Sbjct  183   YKYFEIKKNAEVFSKKDSGVSEMHRVSSCVQNCDTILIRGCTEFEPEWFELLQNLLQKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P GQLP+T ++    +    D+W+ IK WLD Q  G V+YVAFGSEA PSQ E+ EIAL
Sbjct  243   LPAGQLPSTGFNFVDEN----DTWQGIKKWLDNQPHGSVVYVAFGSEATPSQEEVNEIAL  298

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE S  PFFWVLRA+ G  D  ++ LPEGFE+RTKGRG+VCT WAPQ+KIL H ++G F
Sbjct  299   GLEKSNLPFFWVLRAQHGRKDKAVLQLPEGFEDRTKGRGVVCTDWAPQMKILGHMAIGVF  358

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
              +H+GW+SVVEA+Q EKPLVL+TFL DQG+NA+VLEEKK+ Y+VPRDE+DG FT ++VA 
Sbjct  359   FSHAGWTSVVEAVQNEKPLVLMTFLVDQGINAKVLEEKKMAYTVPRDEQDGSFTSDSVAR  418

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++RLV++E+EG IYRE IKE+K LF +  RQD Y+D LL +L
Sbjct  419   TIRLVMLEEEGRIYRENIKEVKDLFVNIERQDRYIDNLLDHL  460



>ref|XP_011000621.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=472

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 345/462 (75%), Gaps = 3/462 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + SKLHI M+PWLAFGHMIPYLEL+K IA +GHK++F+STPRNIDRLPKLPP L+  INF
Sbjct  3     DDSKLHIAMFPWLAFGHMIPYLELAKLIAQKGHKITFISTPRNIDRLPKLPPYLSPLINF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLE-EFSPDWILHDFDSY  1262
             VKLPLP   +L E  EAT D+PY+KV++LK+A D L+E M +FL      D++L+DF  Y
Sbjct  63    VKLPLPHAAHLLEGDEATTDVPYNKVQHLKVAFDGLKEPMTRFLATSHDIDYLLYDFAPY  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             WL  +A+ LG+  A FSIF    V F        +RT+ E +TVPPK IPF TTV F+L+
Sbjct  123   WLPEIATGLGIPNAFFSIFLGAAVCFLKPASLIEDRTEPEHFTVPPKSIPFPTTVRFKLF  182

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             EILRI +++T +  +VSD +RL   +  C +VA+R C EF+ EWL L + +  KPV PVG
Sbjct  183   EILRIFESITGDASDVSDSYRLQEVLRCCQMVAIRSCMEFEPEWLHLFQELIGKPVIPVG  242

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              L  T  DA    +     WK +K WLDKQE G V+YVAFGSEAKPSQ ELTEIALGLEL
Sbjct  243   LLAPTEDDAV--RDEGSGMWKSMKDWLDKQEKGSVVYVAFGSEAKPSQVELTEIALGLEL  300

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR RRG  D E I LPEGFE+RT+GRG+V TSW PQLKIL+H+SVGGFLTHS
Sbjct  301   SGLPFFWALRTRRGLTDNEAIKLPEGFEDRTRGRGLVFTSWVPQLKILAHDSVGGFLTHS  360

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVEA+Q E+ L+LL+FLA+QGLN+RV EEKKIGY +PRDE DG FTR++VAESLRL
Sbjct  361   GWSSVVEALQHERALILLSFLAEQGLNSRVFEEKKIGYPIPRDEFDGSFTRDSVAESLRL  420

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V+V++EG IYREK KEMKGLF ++  QD YV   L Y+  H+
Sbjct  421   VMVKEEGKIYREKAKEMKGLFGNKDIQDQYVVNFLRYIMSHR  462



>gb|KCW59683.1| hypothetical protein EUGRSUZ_H02441 [Eucalyptus grandis]
Length=475

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/465 (58%), Positives = 347/465 (75%), Gaps = 7/465 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LHI+M PWLAFGHM PYLEL+K +A +GH++SF+S PRNIDRLPK  P+L   I+FVKL
Sbjct  7     NLHIVMLPWLAFGHMTPYLELAKLMAGKGHRISFLSAPRNIDRLPKPTPDLTPLISFVKL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  ++LPE AEAT DLPYDK++YLK A D LQE +A+FLE   PDWI++DF  YW   
Sbjct  67    PLPAIEHLPEGAEATSDLPYDKIQYLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWAGS  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE---RTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             +AS+LG+ +  F+I     + F G   D      R   ED+T PPKW+PF T VAF  +E
Sbjct  127   IASRLGIRSVFFTILIGAGLGFIGPSQDSKGGDYRKTPEDFTRPPKWVPFPTKVAFHHFE  186

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I +I D+VT     V+D++RL +  E CDI+A+R   E + EWL LL++++ KPVFPVGQ
Sbjct  187   IKKIFDSVTGNASGVTDLYRLKASQENCDIIALRSSYEVEPEWLTLLKDVYAKPVFPVGQ  246

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LP    D+ G  E    +W+ IK WLD Q+ G V+YVAFGSE+KP+QTELTEIALGLELS
Sbjct  247   LPPGDPDSRGETE----TWRLIKEWLDAQKNGTVVYVAFGSESKPTQTELTEIALGLELS  302

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PFFWVL+ R G AD ELI LP+GFEER KGRG+V  SW PQLKIL+H SVGGFLTH G
Sbjct  303   GLPFFWVLKTRLGSADSELIMLPDGFEERVKGRGVVWDSWVPQLKILAHNSVGGFLTHGG  362

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             W+S VEA+ FE+ L+L TFLADQGLNAR+LEE++IGYS+PR+E DG  TR++VAESLR+V
Sbjct  363   WNSAVEALSFERALILFTFLADQGLNARLLEERQIGYSIPRNESDGSVTRQSVAESLRMV  422

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             +VE++G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+ +K+
Sbjct  423   MVEEKGRVYREKAKEMRPIFEDKDIQERYVNNLLNYLKDHRPVKH  467



>ref|XP_010023429.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=494

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/465 (58%), Positives = 347/465 (75%), Gaps = 7/465 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LHI+M PWLAFGHM PYLEL+K +A +GH++SF+S PRNIDRLPK  P+L   I+FVKL
Sbjct  26    NLHIVMLPWLAFGHMTPYLELAKLMAGKGHRISFLSAPRNIDRLPKPTPDLTPLISFVKL  85

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  ++LPE AEAT DLPYDK++YLK A D LQE +A+FLE   PDWI++DF  YW   
Sbjct  86    PLPAIEHLPEGAEATSDLPYDKIQYLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWAGS  145

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE---RTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             +AS+LG+ +  F+I     + F G   D      R   ED+T PPKW+PF T VAF  +E
Sbjct  146   IASRLGIRSVFFTILIGAGLGFIGPSQDSKGGDYRKTPEDFTRPPKWVPFPTKVAFHHFE  205

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I +I D+VT     V+D++RL +  E CDI+A+R   E + EWL LL++++ KPVFPVGQ
Sbjct  206   IKKIFDSVTGNASGVTDLYRLKASQENCDIIALRSSYEVEPEWLTLLKDVYAKPVFPVGQ  265

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LP    D+ G  E    +W+ IK WLD Q+ G V+YVAFGSE+KP+QTELTEIALGLELS
Sbjct  266   LPPGDPDSRGETE----TWRLIKEWLDAQKNGTVVYVAFGSESKPTQTELTEIALGLELS  321

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PFFWVL+ R G AD ELI LP+GFEER KGRG+V  SW PQLKIL+H SVGGFLTH G
Sbjct  322   GLPFFWVLKTRLGSADSELIMLPDGFEERVKGRGVVWDSWVPQLKILAHNSVGGFLTHGG  381

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             W+S VEA+ FE+ L+L TFLADQGLNAR+LEE++IGYS+PR+E DG  TR++VAESLR+V
Sbjct  382   WNSAVEALSFERALILFTFLADQGLNARLLEERQIGYSIPRNESDGSVTRQSVAESLRMV  441

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             +VE++G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+ +K+
Sbjct  442   MVEEKGRVYREKAKEMRPIFEDKDIQERYVNNLLNYLKDHRPVKH  486



>ref|XP_010023433.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/465 (59%), Positives = 343/465 (74%), Gaps = 7/465 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LH+ M PWLAFGHM+PYLEL+K +A +GH++SF+S P NIDRLPK PP+LA  I+FV L
Sbjct  7     NLHMAMLPWLAFGHMMPYLELAKLMAGKGHRISFLSVPGNIDRLPKPPPDLAPLISFVNL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  ++LPE A AT DLPYDK+++LK A D LQE +A+FLE   PDWI++DF  YW  P
Sbjct  67    PLPTVEHLPEGAGATSDLPYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWAGP  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             +AS+LG+ +  FSI T  ++ FFG    L     R   ED+T  P W+PF T VAFR +E
Sbjct  127   IASRLGIRSVFFSITTAASLGFFGPIWALKGGDYRKTPEDFTKRPNWVPFPTKVAFRHFE  186

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I +I DAV      V+D++R  +G E CDI+A R   E + EWL LL++IH KP+FPVGQ
Sbjct  187   IKKIFDAVIGNASGVTDLYRFGAGQESCDIIAARSSYEVEPEWLSLLKDIHTKPIFPVGQ  246

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LP    +  G      DSW+ IK WLD Q+ G V+YVAFGSEAKPSQ ELTEIALGLELS
Sbjct  247   LPPRDPETRG----EIDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIALGLELS  302

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PFFWVL+ R G +D E + LP GFEER KGRG+V  SW PQLKIL H+SVGGFLTH+G
Sbjct  303   GLPFFWVLKTRLGSSDTESVVLPNGFEERVKGRGVVWDSWVPQLKILEHDSVGGFLTHAG  362

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSVVEA+ FE+ L+L TFLADQGLNAR LEE++IGY +PR+E DG  TR++VAESLRLV
Sbjct  363   WSSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVAESLRLV  422

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             +VE++G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+ +K+
Sbjct  423   MVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHRPVKH  467



>ref|XP_004143439.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 gb|KGN48691.1| hypothetical protein Csa_6G497900 [Cucumis sativus]
Length=468

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/461 (62%), Positives = 348/461 (75%), Gaps = 7/461 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
              LHI+M+PWLAFGHMIPYLELSK IA +GH+VSFVSTP+NIDRLP +LPP+L+  ++FVK
Sbjct  6     NLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP   NLP +AEAT DLPYDKV++LK A DAL++ ++ FL+    DWIL+DF  YW+ 
Sbjct  66    IPLPQLHNLPPDAEATSDLPYDKVQFLKKAFDALKQPLSDFLQTSDADWILYDFAPYWVG  125

Query  1252  P-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
               +   L + TA F+IF   ++AF G +     R K ED+TVPP WIPF TTVAFR +EI
Sbjct  126   QEIGPNLRIKTAFFTIFILQSLAFVGPMSG-DSRMKLEDFTVPPDWIPFPTTVAFRHFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              ++ D V      V+DI RL       D+V VR   EF+ EW++LLE+IH K V PVGQL
Sbjct  185   KKLFDFVAGNTTGVTDIDRLKMSAHYSDLVVVRAFPEFEPEWIQLLEDIHHKTVLPVGQL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PT+ YD    + PT   W+ IK WLDKQ  G V+YVAFGSEAKP+Q ELTEIALGLE S 
Sbjct  245   PTSEYDLKEDN-PT---WQSIKEWLDKQAKGSVVYVAFGSEAKPNQHELTEIALGLEQSR  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
             F FFWVLR R G +DPE I LPEGFEERTKGRG+VCT+WAPQLKIL HESVGGFLTHSGW
Sbjct  301   FSFFWVLRTRLGLSDPEPIELPEGFEERTKGRGVVCTTWAPQLKILGHESVGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEAIQ E+ LVLL+F+ADQG+ ARVLEEKK+GY VPR E DG FTR++VAESL+LV+
Sbjct  361   SSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYCVPRSELDGSFTRDSVAESLKLVM  420

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             VE+EG +YRE+I+EMK LF ++ R +  +D  L YL  H++
Sbjct  421   VEEEGKVYRERIREMKDLFVNKERDEKLIDGFLSYLKKHRN  461



>ref|XP_009795659.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=472

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/465 (58%), Positives = 342/465 (74%), Gaps = 7/465 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
               H  M+PWLAFGHMIPYLEL+K +A +GHK+SF STP+NI RLPKLPPNL  +I F+ L
Sbjct  6     NFHFFMFPWLAFGHMIPYLELAKLLAKKGHKISFFSTPKNIQRLPKLPPNLKPKIEFITL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP  +NLPENAEATIDLPY+KV+YLK+A D LQE+M K +E  SPD+++ DF SYWL P
Sbjct  66    QLPHVENLPENAEATIDLPYNKVRYLKIAFDKLQESMPKLIETLSPDFVIQDFASYWLVP  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +  K    T  FSIF    ++  G     ++   +R K ED+TV PKW+PF+T V    Y
Sbjct  126   ITKKSQTPTIYFSIFPATGLSMGGDPSSIIIGDDDRVKPEDFTVKPKWVPFETNVRPSFY  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             +I R+ + +  +  NVSDI+RL   V+  D+VA+R C EF+ EWL+++EN+++K + P+G
Sbjct  186   QIQRMFNDLVIDGGNVSDIYRLAVTVKGVDVVAIRSCYEFEGEWLQVIENLYEKEIIPIG  245

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LPTT+YD   G +   ++W ++KAWLD Q+ G V+Y+AFGSE KPSQ ELT IALGLEL
Sbjct  246   LLPTTSYD--DGEDDNNETWLEMKAWLDMQQKGSVVYIAFGSETKPSQDELTIIALGLEL  303

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             S  PFFWV R +RG AD E+I LPE FEERT GRG +CTSWAPQLKIL+HES+GGFLTHS
Sbjct  304   SNLPFFWVFRQQRGCADSEVIELPEQFEERTNGRGFICTSWAPQLKILNHESIGGFLTHS  363

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSV+EA+QFEKPL+LL FLADQG+    L EKK+GY + R+E DG FT+E VAESLRL
Sbjct  364   GWSSVIEAVQFEKPLILLPFLADQGMICSHLTEKKLGYPIFRNELDGSFTKECVAESLRL  423

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             V+VE++G IYR+ +KEMK   C +  Q  +VD LL YL  HK  +
Sbjct  424   VIVEEKGKIYRQNVKEMKES-CSKDVQQRFVDNLLDYLQSHKRFQ  467



>ref|XP_008440525.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=467

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/462 (61%), Positives = 349/462 (76%), Gaps = 7/462 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
              LHI+M+PWLAFGHMIPYLELSK IA +GH+VSFVSTP+NIDRLP +LPP+L+  ++FVK
Sbjct  6     NLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP   NLP +AEAT DLPYDKV++LK A DAL++ ++ FL     DWI++DF  YW+ 
Sbjct  66    IPLPQLHNLPPDAEATSDLPYDKVQFLKEAFDALKQPLSDFLRTSDADWIVYDFVPYWIG  125

Query  1252  P-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
               V   L + TA FSIF   ++AF G ++    R K ED+TVPP WIPF TTVAFR +EI
Sbjct  126   QEVGPNLRIKTAFFSIFILQSLAFVGPMLG-DRRMKLEDFTVPPDWIPFPTTVAFRHFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              ++ D V      VSDI R        D+V VR   E++ EW++LLE+IH K V PVGQL
Sbjct  185   KKLFDFVAGNTTGVSDIDRFKMSAHYSDLVVVRAFPEYEPEWIQLLEDIHDKTVIPVGQL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PT+ +D+   +     SW+ IK WLDKQ  G V+YVAFGSEAKPSQ ELTEIALGLE S 
Sbjct  245   PTSEHDSKEDNR----SWQSIKEWLDKQAKGSVVYVAFGSEAKPSQHELTEIALGLEKSR  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
             FPFFWVLR R G +DP+ I LPEGFEERTKG+G+VCT+WAPQLKIL HESVGGFLTHSGW
Sbjct  301   FPFFWVLRTRLGLSDPDPIELPEGFEERTKGQGVVCTTWAPQLKILGHESVGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEAIQ E+ LVLL+FLADQG+ ARVLEEKK+GY VPR + DG FTR++VAESL+LV+
Sbjct  361   SSVVEAIQSERALVLLSFLADQGIIARVLEEKKMGYCVPRSQLDGSFTRDSVAESLKLVM  420

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             VE+EG IYRE+I+EMK LF ++ R +  +D  L YL  H+++
Sbjct  421   VEEEGKIYRERIREMKDLFVNKERDEKLMDGFLSYLKKHRNV  462



>gb|KGN48689.1| hypothetical protein Csa_6G497390 [Cucumis sativus]
Length=468

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/461 (62%), Positives = 347/461 (75%), Gaps = 7/461 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
             KLHI+M+PWLAFGHMIPYLELSK IA +GH+VSFVSTP+NIDRLP +LPP+L+  ++FVK
Sbjct  6     KLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP    LP +AEAT DLPYDKV++LK A DAL++ ++ FL+    DWIL+DF  YW+ 
Sbjct  66    IPLPQLHTLPPDAEATSDLPYDKVQFLKEAFDALKQPLSDFLQTSDADWILYDFAPYWVG  125

Query  1252  P-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
               +   L + TA FSIF   ++AF G +     R K ED+TVPP WIPF TTVAFR +EI
Sbjct  126   QEIGPNLRIKTAFFSIFILQSLAFVGPMSG-DSRMKLEDFTVPPDWIPFPTTVAFRHFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              +I D V      V+DI R        D+V VR   EF+ EW++LLE+IH K V PVGQL
Sbjct  185   KKIFDFVAGNATGVTDIDRFKMSAHYSDLVVVRAFPEFEPEWIQLLEDIHHKTVLPVGQL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PT+ YD    + PT   W+ IK WLDKQ  G V+YVAFGSEAKP+Q ELTEIALGLE S 
Sbjct  245   PTSEYDLKEDN-PT---WQSIKEWLDKQAKGSVVYVAFGSEAKPNQHELTEIALGLEQSR  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
             F FFWVLR R G +DPE I LPEGFEERTKGRG+VCT+WAPQLKIL HESVGGFLTHSGW
Sbjct  301   FSFFWVLRTRLGLSDPEPIELPEGFEERTKGRGVVCTTWAPQLKILGHESVGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEAIQ E+ LVLL+F+ADQG+ ARVLEEKK+GY VPR E DG FTR++VAESL+LV+
Sbjct  361   SSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYCVPRSELDGSFTRDSVAESLKLVM  420

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             VE+EG +YRE+I+EMK LF ++ R +  +D  L YL  H++
Sbjct  421   VEEEGKVYRERIREMKDLFVNKERDEKLIDGFLSYLKKHRN  461



>ref|XP_008440526.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=468

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/466 (59%), Positives = 342/466 (73%), Gaps = 7/466 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRIN  1442
             E  KLHI+M PW AFGHMIP+LELSK IA +GH+VSFVSTP+NIDRLP +LPP+L+  ++
Sbjct  3     EDKKLHIVMLPWFAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLS  62

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+P+P   NLP +AEATIDLPYDK+++LK A DAL++ ++ FL     D +L+DF  Y
Sbjct  63    FVKIPMPQLDNLPPDAEATIDLPYDKIRFLKEAYDALKQPLSDFLRTSDADCVLYDFFPY  122

Query  1261  WLAP-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             W+   +   LG+ TA FSIF P T+AF G +     R K ED+TVPP WIPF TTVA R 
Sbjct  123   WIGQEIGPNLGIKTAFFSIFIPETLAFAGPMSSRDHRKKVEDFTVPPDWIPFPTTVALRH  182

Query  1084  YEILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             YE+ +I D AVT E   VSD+ RL       D + ++ C EF  EW++L+ +IH K VFP
Sbjct  183   YEMKKIFDEAVTGESTGVSDLDRLKLSAHNSDFIVLKACPEFGQEWIQLVGDIHGKNVFP  242

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             +GQLPT+ YD+G  ++     W+ IK WLDKQ    V+YVAFGSEAKPSQ ELTEIA GL
Sbjct  243   IGQLPTSEYDSGDDNQ----EWQSIKEWLDKQPIASVVYVAFGSEAKPSQDELTEIAFGL  298

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             E S  PFFWVLR R G +DP +  LPEGFEERTKGRGIV  +WAPQLKIL HESVGGFL+
Sbjct  299   EKSELPFFWVLRTRSGLSDPNVTELPEGFEERTKGRGIVWNTWAPQLKILGHESVGGFLS  358

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             HSGWSS VEAIQ EK ++ L FL DQG+ AR+LEEKK+GY +PR+  DG FTR++V ESL
Sbjct  359   HSGWSSAVEAIQSEKAMIFLPFLVDQGIIARILEEKKVGYCIPRNLLDGSFTRDSVEESL  418

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             +LV+VE EG IYREKIKE+KGLF ++ R +  +D  L YL  H+++
Sbjct  419   KLVMVEDEGKIYREKIKELKGLFVNKERDERLIDQFLSYLKTHRNV  464



>ref|XP_004143546.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
Length=466

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/456 (61%), Positives = 343/456 (75%), Gaps = 7/456 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
             KLHI+++PWLAFGHMIP+LELSK IA +GHKVSFVSTP+NIDRLP KLP +L+S + FVK
Sbjct  6     KLHIVIFPWLAFGHMIPFLELSKLIAQKGHKVSFVSTPKNIDRLPTKLPSHLSSFLRFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LP P   +LP +AEAT D+PYDKV++LK A D L++ +  FL+    DWIL DF  YWL+
Sbjct  66    LPFPQIHDLPPDAEATSDVPYDKVQFLKKAFDDLKQPLFDFLQSSDVDWILFDFAPYWLS  125

Query  1252  P-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
               +   LG+ TA FSI++P  + F G +     R K ED+TV P W+PF T V FR +EI
Sbjct  126   QDIGPTLGIKTAFFSIYSPECLVFLGPMFG-DNRIKPEDFTVSPHWVPFPTNVVFRHFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +RI D+V      VSD++R+       D+V VRGC EF  EW++LL +++ KP+FPVGQL
Sbjct  185   MRIFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPVGQL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PT+ Y+ G  +     +W  IK WLDKQ    V+YVAFGSEAKPSQ ELTEIALGLE S 
Sbjct  245   PTSEYETGDENP----AWGRIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEKSE  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
               FFWV R RRG +DP+ I LPEGFEERTKGRG+V T+WAPQLKIL HESVGGFLTHSGW
Sbjct  301   LRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILGHESVGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEAIQ EK LVLLTFLADQG+NARVLEEKK+GYSVPR+E DG FT +AVAESL+LV+
Sbjct  361   SSVVEAIQSEKALVLLTFLADQGINARVLEEKKMGYSVPRNELDGSFTWDAVAESLKLVL  420

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             VE+EG IYRE I+E+K LF ++ R D  +D LL ++
Sbjct  421   VEEEGKIYRETIREIKDLFVNKERDDELIDRLLDHM  456



>ref|XP_010023432.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/464 (58%), Positives = 343/464 (74%), Gaps = 7/464 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+M PWLAFGHM+PYL+L+K +A +GH++SF+S PRNIDR+PK P +LAS I+FVKLP
Sbjct  8     LHIVMLPWLAFGHMMPYLKLAKLMAGKGHRISFLSAPRNIDRIPKPPSDLASLISFVKLP  67

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  ++LPE AEAT DLPY+K++YLK + D LQE +A+FLE   PDWI++DF  YW   +
Sbjct  68    LPAVEHLPEGAEATSDLPYNKIQYLKKSYDMLQEPVAQFLESSDPDWIMYDFAPYWAGSI  127

Query  1246  ASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             AS+LG+ +  FSI T   + F G    L     R   ED+T  P W+PF T VAFR +EI
Sbjct  128   ASRLGIRSVFFSIMTGACLGFLGPVWALKGGDYRKTPEDFTKRPNWVPFPTRVAFRHFEI  187

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              +I DAV      V+D++R  +G E CDI+A+R   E + EWL LL +IH KP+FPVG L
Sbjct  188   KKIFDAVIGNASGVTDLYRFGAGQESCDIIALRSSYEVEPEWLSLLRDIHTKPIFPVGLL  247

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P    +  G      DSW+ IK WLD Q+ G V+YVAFGSEAKPSQ ELTEIALGLELSG
Sbjct  248   PPRDPETRG----EMDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIALGLELSG  303

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWVL+ R G +D E + LP GFEER KG G+V  SW PQLKIL+H+SVGGFLTH+GW
Sbjct  304   LPFFWVLKTRLGSSDTESVVLPNGFEERVKGHGVVWDSWVPQLKILAHDSVGGFLTHAGW  363

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEA+ FE+ L+L TFLADQGLNAR LEE++IGY +PR+E DG  TR++VAESLRLV+
Sbjct  364   SSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVAESLRLVM  423

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             VE++G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+ +K+
Sbjct  424   VEEKGRVYREKAKEMRPIFGDKEIQERYVNNLLNYLKEHRPVKH  467



>ref|XP_004143545.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
Length=466

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/463 (60%), Positives = 345/463 (75%), Gaps = 7/463 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
             KLHI+++PW+AFGHMIP+LELSK IA +GH+VSFVSTP+NIDRLP KLPP+L+S + FVK
Sbjct  6     KLHIVIFPWIAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPTKLPPHLSSFLRFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LP P   +LP +AEAT D+PYDKV++LK A D L++ +  FL     DWIL DF  YWL+
Sbjct  66    LPFPQINDLPPDAEATSDVPYDKVQFLKKAFDDLKQPIFDFLRSSDVDWILFDFAPYWLS  125

Query  1252  P-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
               +   LG+ TA FSIFTP  + F G +     R K ED+TV P W+PF T V FR +EI
Sbjct  126   QDIGPTLGIKTAFFSIFTPEFLVFVGPMFG-DNRIKPEDFTVSPHWVPFPTNVVFRHFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +RI D+V      VSD++R+       D+V VRGC EF  EW++LL +++ KP+FPVGQL
Sbjct  185   MRIFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPVGQL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PT+ Y+ G  +     +W+ IK WLDKQ    V+YVAFGSEAKPSQ ELTEIALGLE S 
Sbjct  245   PTSEYETGDENP----AWERIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEKSE  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
               FFWV R RRG +DP+ I LPEGFEERTKGRG+V T+WAPQLKIL HES+GGFLTHSGW
Sbjct  301   LRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILRHESMGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEAIQ E+ LVLL+F+ADQG+ ARVLEEKK+GYSVPR+E DG FTR+AVAESL+LVV
Sbjct  361   SSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYSVPRNELDGSFTRDAVAESLKLVV  420

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             VE+EG IYRE I+E K LF ++ R D  +D LL ++    S K
Sbjct  421   VEEEGKIYRETIREAKDLFVNKERDDKLIDRLLDHMKEKISKK  463



>ref|XP_004160942.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 91A1-like 
[Cucumis sativus]
 gb|KGN48695.1| hypothetical protein Csa_6G498430 [Cucumis sativus]
Length=466

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/456 (61%), Positives = 342/456 (75%), Gaps = 7/456 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
             KLHI+++PWLAFGHMIP+LELSK IA +GHKVSFVSTP+NIDRLP KLP +L+S + FVK
Sbjct  6     KLHIVIFPWLAFGHMIPFLELSKLIAQKGHKVSFVSTPKNIDRLPTKLPSHLSSFLRFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LP P   +LP +AEAT D+PYDKV++LK A D L++ +  FL+    DWIL DF  YWL+
Sbjct  66    LPFPQIHDLPPDAEATSDVPYDKVQFLKKAFDDLKQPLFDFLQSSDVDWILFDFAPYWLS  125

Query  1252  P-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
               +   LG+ TA FSI++P  + F G +     R K ED+TV P W+PF T V FR +EI
Sbjct  126   QDIGPTLGIKTAFFSIYSPECLVFLGPMFG-DNRIKPEDFTVSPHWVPFPTNVVFRHFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +RI D+V      V+D+ R+       D+V VRGC EF  EW++LL +++ KP+FPVGQL
Sbjct  185   MRIFDSVAGNITGVTDLDRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPVGQL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PT+ Y+ G  +     +W  IK WLDKQ    V+YVAFGSEAKPSQ ELTEIALGLE S 
Sbjct  245   PTSEYETGDENP----AWGRIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEKSE  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
               FFWV R RRG +DP+ I LPEGFEERTKGRG+V T+WAPQLKIL HESVGGFLTHSGW
Sbjct  301   LRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILGHESVGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             SSVVEAIQ EK LVLLTFLADQG+NARVLEEKK+GYSVPR+E DG FT +AVAESL+LV+
Sbjct  361   SSVVEAIQSEKALVLLTFLADQGINARVLEEKKMGYSVPRNELDGSFTWDAVAESLKLVL  420

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             VE+EG IYRE I+E+K LF ++ R D  +D LL ++
Sbjct  421   VEEEGKIYRETIREIKDLFVNKERDDELIDRLLDHM  456



>ref|XP_009615005.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=472

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/466 (57%), Positives = 339/466 (73%), Gaps = 9/466 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
               H  M+PWLAFGHMIPY+EL+K +A +GHK+SF STP+NI RLPKLPPNL   I F+ L
Sbjct  6     NFHFFMFPWLAFGHMIPYVELAKLLAEKGHKISFFSTPKNIQRLPKLPPNLKPHIEFITL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP  +NLPENAEAT DLPY+KV+YLK+A D LQE+M K +E   PD+++ DF SYWL P
Sbjct  66    QLPHVENLPENAEATSDLPYNKVRYLKIAFDRLQESMPKLIESIYPDFVIQDFASYWLVP  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF-----AERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +  KL + T  FSIF P T    G +         +R K ED+TV PKW+ F+T V    
Sbjct  126   ITEKLQIPTIYFSIF-PATCLSLGGIPSSIINGDNDRVKPEDFTVKPKWVTFETNVRPSF  184

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             Y+I R+ + +  +  NVSDI+RL   V+  D+VA+R C EF+ EWL+++ENI++KP+ P+
Sbjct  185   YQIQRMFNDLVIDGGNVSDIYRLAVTVKGVDVVAIRSCYEFEGEWLQVIENIYEKPIIPI  244

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LPTT+YD   G E   ++W ++KAWLD Q+ G V+Y+AFGSE KPSQ ELT IALGLE
Sbjct  245   GLLPTTSYD--DGEEDNNETWLEMKAWLDMQQKGSVVYIAFGSETKPSQDELTIIALGLE  302

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LS  PFFWV R +RG AD ++I LPE FEERTKGRG +CTSWAPQLK+L+HES+GGFLTH
Sbjct  303   LSNLPFFWVFRKQRGCADSKVIELPEQFEERTKGRGFICTSWAPQLKLLNHESIGGFLTH  362

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGWSSV+EA+QFEKPL+LL FL DQG+    L EKK+GY + R+E DG FT+E VA+SLR
Sbjct  363   SGWSSVIEAVQFEKPLILLPFLGDQGMICSHLTEKKLGYPIFRNELDGSFTKECVAKSLR  422

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             LV+VE++G IY + +KEMK   C +  Q  +VD LL YL  HK  +
Sbjct  423   LVMVEEKGKIYSQNVKEMKES-CSKDVQQRFVDNLLAYLQSHKRFQ  467



>ref|XP_002533517.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF28861.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=415

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/415 (62%), Positives = 321/415 (77%), Gaps = 5/415 (1%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             SKLHI ++PWLAFGHMIPYLEL+K IA +GHK+S++STPRNIDRLP+LPPNL+S INFVK
Sbjct  5     SKLHIALFPWLAFGHMIPYLELAKLIAQKGHKISYISTPRNIDRLPELPPNLSSFINFVK  64

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP   +LP++AEAT D+P++KV+YLK + D L+E +  FLE    DWIL+DF +YWL 
Sbjct  65    IPLPRSDDLPQDAEATTDVPFNKVQYLKKSYDRLKEPLTVFLENSDIDWILYDFAAYWLP  124

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
              +A+ LG+S A F IF   T+    +     + RTK E +TVPPKW+ F T VA++L+EI
Sbjct  125   DLANSLGISHAFFGIFLGATMGVIVKPASLTDDRTKPEQFTVPPKWVNFPTKVAYKLFEI  184

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             LRI ++V  +   VSD+ R    ++ C+I+A+R C EF+ EWL LLE IH KP  PVG L
Sbjct  185   LRIFESVEGDASGVSDLSRAAEVLKGCEIIAIRSCIEFEPEWLNLLEEIHGKPCIPVGML  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             PTT Y+ G       + W+ IK WLDKQ+   V+YVAFGSE KPSQ EL EIALGLELSG
Sbjct  245   PTTGYENGK----ETNEWRKIKQWLDKQDKASVVYVAFGSEGKPSQLELNEIALGLELSG  300

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWVLR RRG  D E+I LP+GFEERTKGRG+V T WAPQLKIL+H+S+GGFLTHSGW
Sbjct  301   LPFFWVLRKRRGSTDAEVIELPDGFEERTKGRGVVSTGWAPQLKILAHDSIGGFLTHSGW  360

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             SSVVEA Q+E+PL+LLTFLADQG+NAR+LEEKK+GYSVPR+E DG FT E+VAES
Sbjct  361   SSVVEASQYERPLILLTFLADQGINARILEEKKMGYSVPRNEFDGSFTSESVAES  415



>ref|XP_004151488.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 ref|XP_004160943.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 gb|KGN48690.1| hypothetical protein Csa_6G497890 [Cucumis sativus]
Length=468

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/466 (57%), Positives = 337/466 (72%), Gaps = 7/466 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRIN  1442
             +  KLHI+M PW AFGHMIP+LELSK IA +GH+VSFVSTP+NIDRLP +LPP+L+  ++
Sbjct  3     DDKKLHIVMLPWFAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPAQLPPHLSPFLS  62

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             F+K+P+P   N P +AEATIDLPYDK+ +LK A DAL++ ++ FL     D IL+DF  Y
Sbjct  63    FIKIPMPQLHNFPPDAEATIDLPYDKIPFLKEAFDALKQPLSDFLRTSDADCILYDFFPY  122

Query  1261  WLAP-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             W+   +   LG+ TA FSIF P T+AF G +     R K ED+TVPP WIPF +TVA R 
Sbjct  123   WIGQEIGPNLGIKTAFFSIFIPETLAFIGPMSPRDHRKKVEDFTVPPDWIPFPSTVALRH  182

Query  1084  YEILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             YE+ +I D AV  +   +SD+ R+  G    D + ++ C EF  EW++L+ ++H K VFP
Sbjct  183   YEMKKIFDEAVAGKSTGISDLDRIKLGAHNSDFIVLKACPEFGQEWIQLVGDLHGKTVFP  242

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             +GQLPT+ YD G  ++    +W+ IK WLDKQ    V+YVAFGSEAKPSQ ELTEIA GL
Sbjct  243   IGQLPTSEYDCGDDNQ----AWQSIKEWLDKQPVASVVYVAFGSEAKPSQDELTEIAFGL  298

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             E S  PFFWVLR R G +D  +  LPEGFEERTKGRGIV  +WAPQLKIL HESVGGFLT
Sbjct  299   EKSELPFFWVLRTRAGLSDSNVTELPEGFEERTKGRGIVWNTWAPQLKILGHESVGGFLT  358

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H+GWSS VEAIQ EK ++ L FL DQG+ AR+LEEKK+GY +PR+  DG FTR++V ESL
Sbjct  359   HAGWSSSVEAIQSEKAMIFLPFLVDQGIIARILEEKKVGYCIPRNLLDGSFTRDSVEESL  418

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             +LV+VE EG IYREKIKE+K +F ++ R +  +D  L YL  H+ +
Sbjct  419   KLVMVEDEGKIYREKIKELKAIFVNKERDERLIDQFLSYLKSHRKV  464



>ref|XP_010023430.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/466 (56%), Positives = 347/466 (74%), Gaps = 11/466 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M PWLAFGHM+PYLEL+K +A +GH++SF+ +P NIDRLPK P +LAS I+FVKLP
Sbjct  8     LHVVMLPWLAFGHMMPYLELAKLMAGKGHRISFLLSPGNIDRLPKPPSDLASLISFVKLP  67

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  + LPE A AT DLPYDK+++LK A D LQE +A+FLE   PDWI++DF  YW  P+
Sbjct  68    LPAVEQLPEGAGATSDLPYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWAGPI  127

Query  1246  ASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +S+LG+ +  FSI T  ++ F G     +  D+  R   ED+T  P W+PF T+VA+R +
Sbjct  128   SSRLGIRSVFFSITTAASLGFLGPTWASKGGDY--RKTPEDFTKRPNWVPFPTSVAYRHF  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             EI +I DAV+     V+D++R  +G E CDI+AVR   E + EWL LL++I  KP+FPVG
Sbjct  186   EIEKIFDAVSRNASGVTDLYRWGAGRECCDIIAVRSSYEVEPEWLSLLKDILAKPIFPVG  245

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             QLP +  +  G      DSW+ IK WLD Q+   V+YVAFGSEAKPSQTELT+IALGLEL
Sbjct  246   QLPPSNPEMRG----ETDSWRSIKEWLDVQKKCTVVYVAFGSEAKPSQTELTDIALGLEL  301

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFWVL+ + G AD E + LP+GFEER +GR +V  SW PQLKIL+H+SVG FLTH+
Sbjct  302   SGLPFFWVLKTQLGSADTESVVLPDGFEERVRGRVMVWDSWVPQLKILAHDSVGWFLTHA  361

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVEA+ F + L+L TFLADQGLNAR+LEE++IGY +PR+E DG  TR++V+ESL L
Sbjct  362   GWSSVVEALSFGRALILFTFLADQGLNARLLEERQIGYPIPRNESDGSVTRQSVSESLSL  421

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             V+VE++G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+ +K+
Sbjct  422   VMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHRPVKH  467



>ref|XP_004288529.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=476

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/470 (56%), Positives = 334/470 (71%), Gaps = 12/470 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D++ SKLHI M+PWLAFGHM+PYLEL+K IA +GHK+SF+STPRNIDRLP+LPPNL++ I
Sbjct  13    DNKDSKLHIAMFPWLAFGHMLPYLELAKLIAGKGHKISFISTPRNIDRLPQLPPNLSTLI  72

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV++PLP +QNLPE AE+T DL  D+V YLK+A D+LQE + +FL    PDW+L DF  
Sbjct  73    TFVEVPLPQNQNLPEGAESTADLAEDQVPYLKIAYDSLQEPITQFLNRSKPDWLLFDFAP  132

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRL---VDFAERTKAEDYTVPPKWIPFKTTVA  1094
             YW+  +A+ LG+ TA FSI     ++  G     +   +R   EDY VPPKW+PF  TVA
Sbjct  133   YWVPEIANTLGIPTAFFSIILAAALSIVGPTSPEIPADDRKLPEDYIVPPKWVPFPATVA  192

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
              RL+E+ R+   V  ++ NV D +R    +  CD++ VR C+EF+ EWL LLE++H KPV
Sbjct  193   LRLFEVRRLYTRVIGDETNVGDKYRFTETMWSCDMIVVRSCTEFEPEWLSLLEDLHGKPV  252

Query  913   FPVGQL-PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
              PVG L P    D     +   ++W+ IK WLD+Q    V+YVAFGSEA PSQ E TEIA
Sbjct  253   LPVGVLSPMPKAD-----DDDDETWRSIKDWLDRQSKNTVVYVAFGSEAMPSQEEATEIA  307

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLE SG PF WVLR + GE   + + LPEGFEER +GRG+VC SW PQLKIL+H+S G 
Sbjct  308   LGLEKSGLPFVWVLRTKHGE---DAVMLPEGFEERNEGRGVVCRSWVPQLKILAHDSFGV  364

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FL+HSGWSSVVEA+ F +PLVLL    DQGLNAR   EKK+GY +PRDE DG FT EAVA
Sbjct  365   FLSHSGWSSVVEALTFGRPLVLLPMSNDQGLNARYFMEKKVGYELPRDEGDGSFTSEAVA  424

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             ESLR+V+ ++EG +YR+K KE+K LF D+ RQ+ YVD  L YL  H   +
Sbjct  425   ESLRMVIEKEEGRVYRDKAKELKPLFGDRERQNMYVDKFLEYLTIHNGCR  474



>gb|KCW59684.1| hypothetical protein EUGRSUZ_H02443, partial [Eucalyptus grandis]
Length=464

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/462 (57%), Positives = 344/462 (74%), Gaps = 11/462 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M PWLAFGHM+PYLEL+K +A +GH++SF+ +P NIDRLPK P +LAS I+FVKLP
Sbjct  8     LHVVMLPWLAFGHMMPYLELAKLMAGKGHRISFLLSPGNIDRLPKPPSDLASLISFVKLP  67

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  + LPE A AT DLPYDK+++LK A D LQE +A+FLE   PDWI++DF  YW  P+
Sbjct  68    LPAVEQLPEGAGATSDLPYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFAPYWAGPI  127

Query  1246  ASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +S+LG+ +  FSI T  ++ F G     +  D+  R   ED+T  P W+PF T+VA+R +
Sbjct  128   SSRLGIRSVFFSITTAASLGFLGPTWASKGGDY--RKTPEDFTKRPNWVPFPTSVAYRHF  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             EI +I DAV+     V+D++R  +G E CDI+AVR   E + EWL LL++I  KP+FPVG
Sbjct  186   EIEKIFDAVSRNASGVTDLYRWGAGRECCDIIAVRSSYEVEPEWLSLLKDILAKPIFPVG  245

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             QLP +  +  G      DSW+ IK WLD Q+   V+YVAFGSEAKPSQTELT+IALGLEL
Sbjct  246   QLPPSNPEMRG----ETDSWRSIKEWLDVQKKCTVVYVAFGSEAKPSQTELTDIALGLEL  301

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFWVL+ + G AD E + LP+GFEER +GR +V  SW PQLKIL+H+SVG FLTH+
Sbjct  302   SGLPFFWVLKTQLGSADTESVVLPDGFEERVRGRVMVWDSWVPQLKILAHDSVGWFLTHA  361

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVEA+ F + L+L TFLADQGLNAR+LEE++IGY +PR+E DG  TR++V+ESL L
Sbjct  362   GWSSVVEALSFGRALILFTFLADQGLNARLLEERQIGYPIPRNESDGSVTRQSVSESLSL  421

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V+VE++G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+
Sbjct  422   VMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHR  463



>ref|XP_004289539.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/465 (57%), Positives = 329/465 (71%), Gaps = 12/465 (3%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++  KLHI M+PWLAFGHMIPYLEL+K IA +GH++SF+STPRNIDRLP LPP L++ I 
Sbjct  13    NKDCKLHIGMFPWLAFGHMIPYLELAKLIARKGHQISFISTPRNIDRLPPLPPKLSTLIT  72

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVKLPLP + NLPE AEAT DLP D+V++LK+A D+L+E + +FL+  + DW+L+DF  Y
Sbjct  73    FVKLPLPENPNLPEGAEATSDLPEDQVEHLKIAYDSLKEPITQFLKSSNLDWLLYDFAPY  132

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRL---VDFAERTKAEDYTVPPKWIPFKTTVAF  1091
             WL  +   L + TA FSIF      F G     V    R   EDY V PKW+PF+ TVA 
Sbjct  133   WLPEITRNLEIPTAFFSIFLASCSVFLGPTSPEVPSDYRKLPEDYLVSPKWVPFRATVAL  192

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RL+E+LR+   +T ++ NVSD++R       CD++AVR C EF+  WL LL  IH KPV 
Sbjct  193   RLFEVLRLYKRITGDETNVSDVYRFKETTRGCDVIAVRSCVEFEPGWLSLLGVIHGKPVI  252

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG L TT  D         DSW  IK WLDKQ    V+YVAFG+EA PSQ E+TEIALG
Sbjct  253   PVGLLSTTPNDD------ENDSWWSIKDWLDKQSKNTVVYVAFGTEAMPSQEEVTEIALG  306

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE SG PFFWVLR + GE   E + LPEGFEER +GRG+V  SW PQLKIL+H+S G FL
Sbjct  307   LEKSGLPFFWVLRTKHGE---EAVKLPEGFEERNEGRGVVYRSWVPQLKILAHDSFGVFL  363

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             +H+GWSSVVEA+ F +PLVLL  L DQGLNAR+  EKK+GY +PRD   G FT EAVAES
Sbjct  364   SHAGWSSVVEALTFARPLVLLPMLNDQGLNARLFGEKKVGYELPRDNETGSFTSEAVAES  423

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             LR+V+ ++EG +YR+K KE+K LF D+ RQ+ YVD  L YL  HK
Sbjct  424   LRMVIEKEEGRVYRDKAKELKPLFGDRERQNVYVDKFLEYLTIHK  468



>ref|XP_008236324.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Prunus mume]
Length=463

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/468 (57%), Positives = 330/468 (71%), Gaps = 20/468 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASR-  1448
             D    KLHI M+PWLAFGHMIPYLEL+K IA  GH++SF+STPRNI+RLP+LPP L+S  
Sbjct  2     DSSDQKLHIAMFPWLAFGHMIPYLELAKLIAQEGHQISFISTPRNIERLPQLPPILSSSL  61

Query  1447  INFVKLPLPP-HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDF  1271
             I FVKLPLP    + PE AEAT D+  +KV  LK   DALQ+ +  FLE  +PDW+L DF
Sbjct  62    ITFVKLPLPRVDDDFPEAAEATTDVSQNKVMKLKKVYDALQQPLTHFLESSNPDWLLFDF  121

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFGRL---VDFAERTKAEDYTVPPKWIPFKTT  1100
              +YW    A  LG+  A FSIF    +AF G     +   +R   EDYTVPPKW+PF + 
Sbjct  122   AAYWAPTTARNLGIPCAFFSIFIGACLAFVGPTSPEISPDDRKNPEDYTVPPKWVPFPSN  181

Query  1099  VAFRLYEILRI-IDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             VAF L+E+ R+ +D +T ++ NVSDI+R + G+  CD++A+R C EFD EWL+LL++IH+
Sbjct  182   VAFHLFEVHRVYLDTITGDESNVSDIYRFMEGMRGCDVIAIRDCMEFDPEWLRLLQDIHR  241

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVGQLPTT ++         D W  +  WLD+Q    V+YVAFGSEA PSQ E+T 
Sbjct  242   KPVLPVGQLPTTNHEEN-------DRWGSMSEWLDRQPKASVVYVAFGSEAMPSQEEITT  294

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELS  PF WVLR         ++ LP+GFEER  GRG+VC SWAPQLKIL H+SV
Sbjct  295   IALGLELSELPFIWVLRTN-------VVKLPQGFEERIGGRGLVCRSWAPQLKILGHDSV  347

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G FL+HSGWSSVVEA+ F + LVLLT   DQGLNAR+LEE+KIGY +PRDE DG FT ++
Sbjct  348   GVFLSHSGWSSVVEALSFGRALVLLTMSNDQGLNARLLEERKIGYCIPRDEEDGSFTSDS  407

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             VAESL+LV+  +EG IYR+K KE+K LF D+ +QD YV   L YL  H
Sbjct  408   VAESLKLVIEMEEGKIYRDKAKELKPLFGDRKKQDTYVHNFLEYLKAH  455



>ref|XP_007205156.1| hypothetical protein PRUPE_ppa005394mg [Prunus persica]
 gb|EMJ06355.1| hypothetical protein PRUPE_ppa005394mg [Prunus persica]
Length=463

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/468 (56%), Positives = 332/468 (71%), Gaps = 20/468 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASR-  1448
             D    KLHI M+PWLAFGHMIPYLEL+K IA +GH++SF+STPRNI+RLP+LPPNL+S  
Sbjct  2     DSSDQKLHIAMFPWLAFGHMIPYLELAKLIAQKGHQISFISTPRNIERLPQLPPNLSSSL  61

Query  1447  INFVKLPLPP-HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDF  1271
             I FVKLPLP    + PE AEAT D+  +KV  LK   DALQ+ +  FLE  +PDW+L DF
Sbjct  62    ITFVKLPLPRVDDDFPEGAEATTDVSQNKVMKLKKVYDALQQPLTHFLESSNPDWLLFDF  121

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFGRL---VDFAERTKAEDYTVPPKWIPFKTT  1100
              +YW    A  LG+  A FSIF    +AF G     +   +R   EDYTV PKW+PF + 
Sbjct  122   AAYWAPTTARNLGIPCAFFSIFIGACLAFLGPTSPEISPDDRKNPEDYTVQPKWVPFPSN  181

Query  1099  VAFRLYEILRI-IDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             VAF L+E+ R+ +D+ T ++ NVSD++R + G++ CD++A+RGC EFD +WL+LL++IH+
Sbjct  182   VAFHLFEVHRVYLDSTTGDESNVSDVYRFMGGMKGCDVIAIRGCMEFDLKWLRLLQDIHR  241

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KP+ PVGQLPTT Y+         D W  ++ WLD+Q    V+YVAFGSEA PSQ E+T 
Sbjct  242   KPILPVGQLPTTNYEEN-------DRWGSMREWLDRQLKASVVYVAFGSEAMPSQEEITT  294

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELS  PF WVLR         ++ LPEGFE+R  GRG+VC SWAPQLKIL H+SV
Sbjct  295   IALGLELSKLPFIWVLRT-------NVVKLPEGFEKRMGGRGLVCRSWAPQLKILGHDSV  347

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G FL+HSGWSSVVEA+ F + LVLLT   DQGLNAR LEE+KI Y +PRDE DG FT ++
Sbjct  348   GVFLSHSGWSSVVEALTFGRALVLLTMSNDQGLNARFLEERKIVYCIPRDEEDGSFTSDS  407

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             VAESL+LV+  +EG IYR+K +E+K LF D+ +QD YV   L YL  H
Sbjct  408   VAESLKLVIEMEEGKIYRDKAEELKPLFGDRKKQDAYVHNFLEYLKAH  455



>ref|XP_004288528.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/468 (55%), Positives = 337/468 (72%), Gaps = 11/468 (2%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++ +KLHI ++PWLAFGHM+PYLEL+K IA +GHK+SF+STP+NIDRLP LPP L++ I 
Sbjct  14    NKDTKLHIALFPWLAFGHMLPYLELAKLIAGKGHKISFISTPKNIDRLPPLPPKLSALIT  73

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+PL  + NLPE AEAT DL  ++V +LK+A D+L+E + +FL+  +PDW+L DF  Y
Sbjct  74    FVKIPLQQYPNLPEGAEATADLTEEQVFHLKIAYDSLREPITQFLKSSNPDWVLFDFAPY  133

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRL---VDFAERTKAEDYTVPPKWIPFKTTVAF  1091
             W+  +A  LG+ TA ++I     VAF G     +   +R   EDYTVPPKW+ F TTVA+
Sbjct  134   WVPEIARSLGIRTAFYTIVMAVVVAFLGPTSPEIPADDRKLPEDYTVPPKWVSFSTTVAW  193

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RL+E+LR++  +T +D NVS + R + G++ CD++AVR C+EF+ EWL LLE +H KPV 
Sbjct  194   RLFEVLRLLKQITGDDTNVSVVQRFMVGLQGCDLIAVRSCAEFEPEWLNLLEVMHGKPVL  253

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG L T         +   ++W+ IK WLD+Q    V+YVAFG+EA P+Q E TEIALG
Sbjct  254   PVGVLSTMP-----KTDDDDETWRSIKEWLDRQSKKTVVYVAFGTEAIPTQEEATEIALG  308

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE SG PFFWVLR + GE   + + LPEGFEER +GRG+VC SW PQLKIL+H+S G FL
Sbjct  309   LEKSGLPFFWVLRTKHGE---DAVKLPEGFEERNEGRGVVCRSWVPQLKILAHDSFGVFL  365

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             +HSGWSSVVEA+ F +PLVL     DQGLNAR   EKK+GY +PRDE DG FT EAVAES
Sbjct  366   SHSGWSSVVEALTFGRPLVLFPLSNDQGLNARYFGEKKVGYELPRDEHDGSFTSEAVAES  425

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             LR+V+ ++EG +YRE  KE+K LF D+  Q+ Y+D  L YL  HK  +
Sbjct  426   LRMVIEKEEGRVYRETAKELKTLFGDRDLQNVYLDKFLEYLTTHKGCR  473



>emb|CAN70983.1| hypothetical protein VITISV_027120 [Vitis vinifera]
Length=605

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/453 (58%), Positives = 327/453 (72%), Gaps = 30/453 (7%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             +G +LHI+M+PWLAFGHMIPYLEL+K IA  GH+VSFVSTPRNIDRLPKLPPNLAS I F
Sbjct  10    QGDELHIVMFPWLAFGHMIPYLELAKLIAQSGHRVSFVSTPRNIDRLPKLPPNLASFITF  69

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VKLPLP   NLPENAEAT DLPY+KV+YLKLA D LQE MA FLE  +PDW+LHDF ++W
Sbjct  70    VKLPLPHVSNLPENAEATTDLPYNKVQYLKLAHDLLQEPMALFLEAAAPDWVLHDFTAHW  129

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             L P+A+KLG+S A FSIF    ++  G       R++ E +TV PKW+PF + VAF  +E
Sbjct  130   LDPIATKLGISCAFFSIFIASAMSVLGSGYQLDYRSEPEHFTVVPKWVPFHSNVAFCYFE  189

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I +I D +  +   VSD +R    ++ CD++AVR C E + EWL+LLE +H+KPV PVGQ
Sbjct  190   IKKIFDCMNGDASGVSDRYRFTESIKGCDLLAVRSCFELEPEWLRLLEQLHRKPVIPVGQ  249

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             L    +D G   +   + W+ +K WLDK  +G V+YVAFGSEAKP+QTELTE ALGLE S
Sbjct  250   LAPNLHDCGD--DDKDERWQQMKEWLDKXASGSVVYVAFGSEAKPNQTELTESALGLEQS  307

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
               PFFWVL+ RRG  D E+I LP+GFEERTK                            G
Sbjct  308   QLPFFWVLKLRRGPTDTEVIRLPDGFEERTK----------------------------G  339

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             W+SVVEA+Q E+PL+LLTFLADQGLNA  L+EK++GY +PR+E+DG FTREAVA SLRLV
Sbjct  340   WTSVVEALQLERPLILLTFLADQGLNASFLQEKRMGYLIPRNEQDGSFTREAVAHSLRLV  399

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTL  260
             V+E+ G IYR+K KEM+G+F D+ RQ+ YVDTL
Sbjct  400   VMEEGGKIYRDKAKEMRGVFGDRDRQNHYVDTL  432



>ref|NP_565540.4| UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 sp|Q940V3.1|U91A1_ARATH RecName: Full=UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 gb|AAK96560.1| At2g22590/T9I22.3 [Arabidopsis thaliana]
 gb|AAL36076.1| At2g22590/T9I22.3 [Arabidopsis thaliana]
 gb|AEC07325.1| UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 gb|AHL38846.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=470

 Score =   527 bits (1358),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 259/468 (55%), Positives = 338/468 (72%), Gaps = 10/468 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             D +G+KLH++M+PWLAFGHM+PYLELSK IA +GHKVSF+STPRNIDRL P+LP NL+S 
Sbjct  8     DGDGTKLHVVMFPWLAFGHMVPYLELSKLIAQKGHKVSFISTPRNIDRLLPRLPENLSSV  67

Query  1447  INFVKLPLPPHQN-LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDF  1271
             INFVKL LP   N LPE+ EAT D+P++ + YLK+A D L+  + +FLE   PDW+L DF
Sbjct  68    INFVKLSLPVGDNKLPEDGEATTDVPFELIPYLKIAYDGLKVPVTEFLESSKPDWVLQDF  127

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
               +WL P++ +LG+ T  FS F   T+    +   F E RT   D+  PPKW+PF+T+VA
Sbjct  128   AGFWLPPISRRLGIKTGFFSAFNGATLGIL-KPPGFEEYRTSPADFMKPPKWVPFETSVA  186

Query  1093  FRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             F+L+E   I      E  + NV DI R+   ++ CD++ VR C E+++EWL L + +H+K
Sbjct  187   FKLFECRFIFKGFMAETTEGNVPDIHRVGGVIDGCDVIFVRSCYEYEAEWLGLTQELHRK  246

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV PVG LP    +     E T D+W  +K WLD +++  ++YVAFGSEAKPSQTEL EI
Sbjct  247   PVIPVGVLPPKPDEK---FEDT-DTWLSVKKWLDSRKSKSIVYVAFGSEAKPSQTELNEI  302

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             ALGLELSG PFFWVL+ RRG  D E + LPEGFEERT  RG+V   W  QL+ LSH+S+G
Sbjct  303   ALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHDSIG  362

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
               LTH GW +++EAI+F KP+ +L F+ DQGLNARV+EEKKIGY +PRDE +G FT+E+V
Sbjct  363   LVLTHPGWGTIIEAIRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFTKESV  422

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             A SLRLV+VE+EG +YRE +KEMKG+F D  RQD YVD+ L YL  ++
Sbjct  423   ANSLRLVMVEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLEYLVTNR  470



>gb|AAD15567.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
Length=470

 Score =   525 bits (1352),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 259/468 (55%), Positives = 337/468 (72%), Gaps = 10/468 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             D +G+KLH++M+PWLAFGHM+PYLELSK IA +GHKVSF+STPRNIDRL P LP NL+S 
Sbjct  8     DGDGTKLHVVMFPWLAFGHMVPYLELSKLIAQKGHKVSFISTPRNIDRLLPWLPENLSSV  67

Query  1447  INFVKLPLPPHQN-LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDF  1271
             INFVKL LP   N LPE+ EAT D+P++ + YLK+A D L+  + +FLE   PDW+L DF
Sbjct  68    INFVKLSLPVGDNKLPEDGEATTDVPFELIPYLKIAYDGLKVPVTEFLESSKPDWVLQDF  127

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
               +WL P++ +LG+ T  FS F   T+    +   F E RT   D+  PPKW+PF+T+VA
Sbjct  128   AGFWLPPISRRLGIKTGFFSAFNGATLGIL-KPPGFEEYRTSPADFMKPPKWVPFETSVA  186

Query  1093  FRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             F+L+E   I      E  + NV DI R+   ++ CD++ VR C E+++EWL L + +H+K
Sbjct  187   FKLFECRFIFKGFMAETTEGNVPDIHRVGGVIDGCDVIFVRSCYEYEAEWLGLTQELHRK  246

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV PVG LP    +     E T D+W  +K WLD +++  ++YVAFGSEAKPSQTEL EI
Sbjct  247   PVIPVGVLPPKPDEK---FEDT-DTWLSVKKWLDSRKSKSIVYVAFGSEAKPSQTELNEI  302

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             ALGLELSG PFFWVL+ RRG  D E + LPEGFEERT  RG+V   W  QL+ LSH+S+G
Sbjct  303   ALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHDSIG  362

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
               LTH GW +++EAI+F KP+ +L F+ DQGLNARV+EEKKIGY +PRDE +G FT+E+V
Sbjct  363   LVLTHPGWGTIIEAIRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFTKESV  422

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             A SLRLV+VE+EG +YRE +KEMKG+F D  RQD YVD+ L YL  ++
Sbjct  423   ANSLRLVMVEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLEYLVTNR  470



>ref|XP_010419269.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=471

 Score =   524 bits (1349),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 258/469 (55%), Positives = 335/469 (71%), Gaps = 11/469 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             + +G+KLH+ M+P+LAFGHM+PYLELSK IA +GH VSF+STPRNIDRL P+LP NL+S 
Sbjct  8     NGDGAKLHVAMFPFLAFGHMVPYLELSKLIAEKGHTVSFISTPRNIDRLLPRLPENLSSA  67

Query  1447  INFVKLPLP--PHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHD  1274
             INFVKLPLP      LPE+ EAT DLP + + YLK+A D L+  + KFLE   PDW+L D
Sbjct  68    INFVKLPLPVVGDNKLPEDGEATTDLPVELISYLKIAYDGLKSPVTKFLESAKPDWVLQD  127

Query  1273  FDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTV  1097
             F +YWL P++  LG+ T   S +   T+    +   F E RT   D+  PPKW+PF+T V
Sbjct  128   FAAYWLPPISRSLGIKTGFLSAYNGATLGIL-KPPGFEEYRTCPADFMKPPKWVPFETPV  186

Query  1096  AFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             AF+L+E   I      E  + NV DI R+   ++ CD + VR C E+++EWL +++++H+
Sbjct  187   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  246

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +     E T D+W  +K WLD ++T  V+YVAFGSEAKPSQTEL E
Sbjct  247   KPVIPVGVLPPKMEEK---FEDT-DTWLTVKKWLDSRKTKSVVYVAFGSEAKPSQTELNE  302

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELSG PFFWVLR RRG  D E + LPEGFEERT GRG+V   W  QL+ LSH+S+
Sbjct  303   IALGLELSGLPFFWVLRTRRGSGDTEPVELPEGFEERTAGRGMVWRGWVEQLRTLSHDSI  362

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G  LTH GW +++EAI+F KP+ +L FL DQGLNARV+E+KKIGY +PRDE +G FT+E+
Sbjct  363   GLALTHPGWGTIIEAIRFSKPMAVLVFLNDQGLNARVIEQKKIGYMIPRDETEGFFTKES  422

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA+SL+LV+ E+EG +YRE +K+MKG+F D  RQD YVD+ L YL  H+
Sbjct  423   VAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYLVAHR  471



>ref|XP_002533518.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF28862.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   524 bits (1350),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 262/473 (55%), Positives = 335/473 (71%), Gaps = 7/473 (1%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             +   +LHI M+PWLAFGHMIP+LEL+K IA +GHK+SF+STPRNIDRLPKLPP+LA  IN
Sbjct  11    NRDDELHIAMFPWLAFGHMIPFLELAKLIAQKGHKISFISTPRNIDRLPKLPPHLAPFIN  70

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+PLP  +NLP +AEAT DLP + V +LK A D LQE ++ FL+   PDWI+ DF SY
Sbjct  71    FVKIPLPYVENLPRSAEATADLPAEDVVHLKKAYDCLQEPLSNFLQSSLPDWIVFDFVSY  130

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             W+  +A K  + +  FSIF    + +     +   R   EDY V PKW+PF + VA+RL+
Sbjct  131   WVPDIACKFNIPSVYFSIFISACLCYLSSGEEDYRRV-IEDYIVAPKWVPFPSKVAYRLF  189

Query  1081  EILRIIDA-VTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             E+ +I +A +T ++ N+ DI R    ++ CD++A R C   + EWL+L E +HQKPVFPV
Sbjct  190   EVRKIFEAGITGDESNIYDIKRFQETMKNCDLIAARTCFGLEPEWLQLTEQLHQKPVFPV  249

Query  904   GQLP-TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             G LP  T  D+    E T   WK IK WLD+QE   V+Y+AFGSEA PSQ E+ EIA GL
Sbjct  250   GVLPRETDQDSEEDQEET---WKPIKKWLDRQEKRSVVYIAFGSEALPSQEEVIEIAHGL  306

Query  727   ELSGFPFFWVLRARRG-EADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             ELSG PFFWVLR   G   + E++ LP GFE+R K RG+V T+WAPQL+IL HES+G FL
Sbjct  307   ELSGLPFFWVLRKSCGLSEEEEVVDLPNGFEDRVKDRGMVFTNWAPQLRILGHESIGAFL  366

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             THSG  SVVEA+Q  +PLVLL F +DQGLNA++LEEKKIGY +PR+E DG FTR +VAES
Sbjct  367   THSGICSVVEALQHGRPLVLLPFNSDQGLNAKLLEEKKIGYLMPRNEEDGSFTRNSVAES  426

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQT  212
             LRLV+VE+EG IYR+K +EM+ LF D+ RQ  YVD  L YL   +  + G + 
Sbjct  427   LRLVIVEEEGKIYRDKAEEMRALFTDKDRQSRYVDAFLDYLKTQRLRENGNKV  479



>gb|KCW59686.1| hypothetical protein EUGRSUZ_H02446 [Eucalyptus grandis]
Length=437

 Score =   522 bits (1345),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 256/461 (56%), Positives = 325/461 (70%), Gaps = 39/461 (8%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+M PWLAFGHM+PYL+L+K +A +GH++SF+S PRNIDR+PK P +LAS I+FVKLP
Sbjct  8     LHIVMLPWLAFGHMMPYLKLAKLMAGKGHRISFLSAPRNIDRIPKPPSDLASLISFVKLP  67

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  ++LPE AEAT DLPY+K++YLK + D LQE +A+FLE   PDWI++DF  YW   +
Sbjct  68    LPAVEHLPEGAEATSDLPYNKIQYLKKSYDMLQEPVAQFLESSDPDWIMYDFAPYWAGSI  127

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILRI  1067
             AS+LG+ +  FSI T   + F G                                    I
Sbjct  128   ASRLGIRSVFFSIMTGACLGFLGP-----------------------------------I  152

Query  1066  IDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPTT  887
              DAV      V+D++R  +G E CDI+A+R   E + EWL LL++IH KP+FPVGQLP  
Sbjct  153   FDAVIGNASGVTDLYRFGAGQESCDIIALRSSYEVEPEWLSLLKDIHTKPIFPVGQLPPR  212

Query  886   AYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFPF  707
               +  G      DSW+ IK WLD Q+ G V+YVAFGSEAKPSQ ELTEIALGLELSG PF
Sbjct  213   DPETRG----EIDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIALGLELSGLPF  268

Query  706   FWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSSV  527
             FWVL+ R G +D E + LP GFEER KGRG+V  SW PQLKIL H+SVGGFLTH+GWSSV
Sbjct  269   FWVLKTRLGSSDTESVVLPNGFEERVKGRGVVWDSWVPQLKILEHDSVGGFLTHAGWSSV  328

Query  526   VEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVEK  347
             VEA+ FE+ L+L TFLADQGLNAR LEE++IGY +PR+E DG  TR++VAESLRLV+VE+
Sbjct  329   VEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVAESLRLVMVEE  388

Query  346   EGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             +G +YREK KEM+ +F D+  Q+ YV+ LL+YL  H+ +K+
Sbjct  389   KGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHRPVKH  429



>ref|XP_006294142.1| hypothetical protein CARUB_v10023135mg [Capsella rubella]
 gb|EOA27040.1| hypothetical protein CARUB_v10023135mg [Capsella rubella]
Length=471

 Score =   522 bits (1345),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 259/466 (56%), Positives = 333/466 (71%), Gaps = 10/466 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRIN  1442
             +G+KLH+ M+PWLAFGHM+PY ELSK IA +GH VSF+STPRNIDRL P+LP NL+S IN
Sbjct  11    DGTKLHVAMFPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPQNLSSAIN  70

Query  1441  FVKLPLPPHQN-LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
             FVKLPLP   N LPE+ EAT D+P++ V YLK+A D L+  + +FLE   PDW+L DF +
Sbjct  71    FVKLPLPVGDNKLPEDGEATTDVPFELVSYLKIAFDGLKSPVTEFLESSKPDWVLQDFAA  130

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVAFR  1088
             YWL PV+ +LG+ T   S F   T+    +   F E RT   D+  PPKW+PF+T VAF+
Sbjct  131   YWLPPVSRRLGIKTGFLSAFNGATLGIL-KPPGFEEYRTCPADFMKPPKWVPFETPVAFK  189

Query  1087  LYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             L+E   I      E  + NV DI R+   ++ CD + VR C E+++EWL +++++H+KPV
Sbjct  190   LFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHRKPV  249

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP    +     E T D+W  +K WLD ++   V+YVAFGSEAKPSQTEL EIAL
Sbjct  250   IPVGVLPPKPEEK---FEDT-DTWLTVKKWLDSRKAKSVVYVAFGSEAKPSQTELNEIAL  305

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVL+ RRG  D E   LPEGFEERT  RG+V   W  QL+ LSHES+G  
Sbjct  306   GLELSGLPFFWVLKTRRGSWDTEPTELPEGFEERTADRGMVWRGWVEQLRTLSHESIGLV  365

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GW +++EAI+F KP+ +L F+ DQGLNARV+EEKKIGY +PRDE +G FT+E+VA+
Sbjct  366   LTHPGWGTIIEAIRFAKPMAMLVFVFDQGLNARVIEEKKIGYMIPRDETEGFFTKESVAK  425

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             SL+LV+ E+EG +YRE +KEMKG+F D  RQD YVD+ L YL  H+
Sbjct  426   SLKLVMEEEEGKVYRENVKEMKGVFGDMDRQDLYVDSFLDYLVAHR  471



>ref|XP_010431575.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=471

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 257/469 (55%), Positives = 334/469 (71%), Gaps = 11/469 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             D +G+KLH+ M+P+LAFGHM+PYLELSK IA +GH VSF+STPRNIDRL P+LP NL+S 
Sbjct  8     DGDGTKLHVAMFPFLAFGHMVPYLELSKLIAQKGHTVSFISTPRNIDRLLPRLPENLSSA  67

Query  1447  INFVKLPLP--PHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHD  1274
             INFVKLPLP      LPE+ EAT DLP + + YLK+A D L+  + +FLE   PDW+L D
Sbjct  68    INFVKLPLPVVGDNKLPEDGEATTDLPVELISYLKIAYDGLKSPVTEFLESSKPDWVLQD  127

Query  1273  FDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTV  1097
             F +YWL P++ +LG+ T   S +   T+    +   F E RT   D+  PPKW+PF+T V
Sbjct  128   FAAYWLPPISRRLGIKTGFLSAYNGATLGIL-KPPGFEEYRTCPADFMKPPKWVPFETPV  186

Query  1096  AFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             AF+L+E   I      E  + NV DI R+   ++ CD + VR C E+++EWL +++++H+
Sbjct  187   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  246

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +     E T D+W  +K WLD ++   V+YVAFGSEAKPSQTEL E
Sbjct  247   KPVIPVGVLPPKLEEK---FEDT-DTWLTVKKWLDSRKAKSVVYVAFGSEAKPSQTELNE  302

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELSG PFFWVLR RRG  D E + LPEGFEERT  RG+V   W  QL+ LSHES+
Sbjct  303   IALGLELSGLPFFWVLRTRRGSGDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHESI  362

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G  LTH GW +++EAI+F KP+ +L FL DQGLNARV+E+KKIGY +PRDE +G FT+E+
Sbjct  363   GLALTHPGWGTIIEAIRFSKPMAVLVFLNDQGLNARVIEQKKIGYMIPRDETEGFFTKES  422

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA+SL+LV+ E+EG +YRE +K+MKG+F D  RQD YVD+ L YL  H+
Sbjct  423   VAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYLVAHR  471



>ref|XP_004143544.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
Length=467

 Score =   519 bits (1337),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 264/441 (60%), Positives = 326/441 (74%), Gaps = 11/441 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFV  1436
             + LHI+++PWLAFGHMIP+LELSK IA +GHKVSFVSTP+NIDRLP KLP +L+S + FV
Sbjct  5     NNLHIVIFPWLAFGHMIPFLELSKLIAQKGHKVSFVSTPKNIDRLPTKLPSHLSSFLRFV  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             KLP P   +LP +AEAT D+PYDKV++LK A D L++ +  FL+    DWIL DF  YWL
Sbjct  65    KLPFPQIHDLPPDAEATSDVPYDKVQFLKKAFDDLKQPLFDFLQSSDVDWILFDFAPYWL  124

Query  1255  AP-VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             +  +   LG+ TA FSI++P  + F G +     R K ED+TV P W+PF T V FR +E
Sbjct  125   SQDIGPTLGIKTAFFSIYSPECLVFLGPMFG-DNRIKPEDFTVSPHWVPFPTNVMFRHFE  183

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I+ + D+V      VSD++R+       D+V VRGC EF  EW++LL +++ KP+FPVGQ
Sbjct  184   IVNVFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDLYGKPIFPVGQ  243

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LPT+ Y+ G  +     +W+  K WLDKQ    V+YVAFGSEAKPSQ ELTEIALGLE S
Sbjct  244   LPTSEYEIGDENP----AWRTTKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEKS  299

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
               PFF V R RRG +DP+ I LPEGFEERTKGRG+V T+WAPQLKIL HESVGGFLTH G
Sbjct  300   ELPFFGVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILGHESVGGFLTHCG  359

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
              SS+VEAIQ EK LVLLTFLADQG+NARVLEEKK+GYS+ R+E DG F R+AVAESL+LV
Sbjct  360   CSSLVEAIQNEKALVLLTFLADQGINARVLEEKKMGYSIRRNELDGSFRRDAVAESLKLV  419

Query  358   VVEKEGNI----YREKIKEMK  308
             VV +EG I    YRE I+E+K
Sbjct  420   VVGEEGKIVGSVYRETIREIK  440



>ref|XP_006404721.1| hypothetical protein EUTSA_v10000154mg [Eutrema salsugineum]
 gb|ESQ46174.1| hypothetical protein EUTSA_v10000154mg [Eutrema salsugineum]
Length=472

 Score =   520 bits (1338),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 336/467 (72%), Gaps = 11/467 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRIN  1442
              G+KLH+ M+PWLAFGHM+PYLELSK IA +GH VSF+STPRNIDRL P+LP NL S I 
Sbjct  11    NGAKLHVAMFPWLAFGHMVPYLELSKLIAQKGHTVSFISTPRNIDRLLPRLPENLHSAIK  70

Query  1441  FVKLPLPP--HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFD  1268
             FVKLPL     + LPE+ EAT D+P+D + YLK+A D L+  + +FLE   PDWIL DF 
Sbjct  71    FVKLPLSGGVDKKLPEDGEATTDVPFDLIPYLKIAFDGLRIPVTEFLESSKPDWILQDFA  130

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVAF  1091
             +YWL P++ +LG+ T  FS F   T+    +   F E RT   D+  PPKW+PF+T VAF
Sbjct  131   AYWLPPISRRLGIKTGFFSAFNGATLGIL-KPPGFDEYRTSPADFMTPPKWVPFETPVAF  189

Query  1090  RLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             +L+E   I      E  + NV D+ R+   ++ CD++AVR C E+++EWL L++++H+KP
Sbjct  190   KLFECRYIFKGFMAETTEGNVPDVHRVAGVIDGCDVIAVRSCYEYEAEWLGLIQDLHRKP  249

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP    +    ++ T D+W  IKAWLD +++  V+YVAFGSEAKP+QTEL  IA
Sbjct  250   VIPVGVLPPKTEEK---YDDT-DTWLSIKAWLDSRKSKSVVYVAFGSEAKPNQTELNAIA  305

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELSG PFFWVL+ RRG  D E + LPEGFEERTK RG+V   W  QL+ LSH+S+G 
Sbjct  306   FGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTKERGMVWRGWVEQLRTLSHDSIGL  365

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
              LTH GW +++EA++F KP+ +L F+ DQGLNARV+EEKKIGY +PRDE +G FT+E+VA
Sbjct  366   VLTHPGWGTIIEAVRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFTKESVA  425

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +SLRLV+ E+EG +YRE +KEMK +F D  RQD YVD+ L+YL  ++
Sbjct  426   KSLRLVMEEEEGKVYRENVKEMKRVFGDMDRQDRYVDSFLNYLVTNR  472



>ref|XP_010472246.1| PREDICTED: UDP-glycosyltransferase 91A1 [Camelina sativa]
Length=471

 Score =   514 bits (1324),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 254/469 (54%), Positives = 331/469 (71%), Gaps = 11/469 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             D +G+KLH+ M PWLAFGHM+PY ELSK IA +GH VSF+STPRNIDRL P+LP NL+S 
Sbjct  8     DGDGTKLHVAMLPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPKNLSSA  67

Query  1447  INFVKLPLP--PHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHD  1274
             INFV+LPLP      LPE+ EAT D+P++ + YLK+A D L+  + +FLE   PDW+L D
Sbjct  68    INFVRLPLPVVGDNKLPEDGEATTDVPFELISYLKIAFDGLKSPVTEFLESSKPDWVLQD  127

Query  1273  FDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTV  1097
             F +YWL P++ +LG+ T   S F   T+    +   F E RT    +  PPKW+PF+T V
Sbjct  128   FAAYWLPPISRRLGIKTGFLSAFNGATLGIL-KPPGFEEYRTCPAGFMKPPKWVPFETPV  186

Query  1096  AFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             AF+L+E   I      E  + NV DI R+   ++ CD + VR C E+++EWL +++++H+
Sbjct  187   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  246

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +     E T D+W  +K WLD ++T  V+YVAFGSEAKPSQTEL  
Sbjct  247   KPVIPVGVLPPKPEEK---FEDT-DTWLTVKKWLDSRKTKSVVYVAFGSEAKPSQTELNA  302

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELSG PFFWVL+ RRG  D E + LPEGFEERT  RG+V   W  QL+ LSH S+
Sbjct  303   IALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHASI  362

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G  LTH GW +V+EAI+F KP+ +L F+ DQGLNARV+E+KKIGY +PRDE +G FT+E+
Sbjct  363   GLVLTHPGWGTVIEAIRFAKPMAMLVFVYDQGLNARVIEQKKIGYMIPRDETEGFFTKES  422

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA+SL+LV+ E+EG +YRE +KEMKG+F D  RQD YVD+ L YL  H+
Sbjct  423   VAKSLKLVMEEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLDYLVAHR  471



>ref|XP_010417017.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=472

 Score =   514 bits (1324),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 332/469 (71%), Gaps = 11/469 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             + +G+KLH+ M PWLAFGHM+PY ELSK IA +GH VSF+STPRNIDRL P+LP NL+S 
Sbjct  9     NGDGTKLHVAMLPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPKNLSSA  68

Query  1447  INFVKLPLP--PHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHD  1274
             INFV+LPLP      LPE+ EAT D+P++ + YLK+A D L+  + +FLE   PDW+L D
Sbjct  69    INFVRLPLPVVGDNKLPEDGEATTDVPFELISYLKIAFDGLKSPVTEFLESSKPDWVLQD  128

Query  1273  FDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTV  1097
             F +YWL P++ +LG+ T   S F   T+    +   F E RT   D+  PPKW+PF+T V
Sbjct  129   FAAYWLPPISRRLGIKTGFLSAFNGATLGIL-KPPGFEEYRTCPADFMKPPKWVPFETPV  187

Query  1096  AFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             AF+L+E   I      E  + NV DI R+   ++ CD + VR C E+++EWL +++++H+
Sbjct  188   AFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDLHR  247

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +     E T D+W  +K WLD ++   V+Y+AFGSEAKPSQTEL  
Sbjct  248   KPVIPVGVLPPKMEEK---FEDT-DTWLTVKKWLDSRKAKSVVYIAFGSEAKPSQTELNA  303

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELSG PFFWVL+ RRG  D E + LPEGFEERT  RG+V   W  QL+ LSHES+
Sbjct  304   IALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHESI  363

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G  LTH GW +V+EAI+F KP+ +L F+ DQGLNARV+E+KKIGY +PRDE +G FT+E+
Sbjct  364   GVVLTHPGWGTVIEAIRFSKPMAMLVFVYDQGLNARVIEQKKIGYMIPRDETEGFFTKES  423

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA+SL+LV+ E+EG +YRE +K+MKG+F D  RQD YVD+ L YL  H+
Sbjct  424   VAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYLVAHR  472



>emb|CDP01583.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   511 bits (1316),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 321/457 (70%), Gaps = 3/457 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH++++PWLAFGHMIP+LEL+K IA +GH+V++VSTPRN+DRLPK+P  L S++N+
Sbjct  4     EAKKLHVVVFPWLAFGHMIPFLELAKSIAQKGHRVTYVSTPRNVDRLPKIPSTLISQLNY  63

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             +KLPLP   NLPENAEAT DLP  KV  LK A D LQ  +A+FLE   PDW+++DF S+ 
Sbjct  64    LKLPLPQIANLPENAEATTDLPITKVHCLKKAYDGLQIEVAQFLETTLPDWLIYDFASHS  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             L  +  KLG+S A FS     + AFFG    F  RT+ ED+ VPPKW+PF + VAFR +E
Sbjct  124   LPSMVGKLGISLAFFSSMNAWSAAFFGSAKTFHTRTQPEDFLVPPKWVPFPSKVAFRRHE  183

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             ++R+     E    VSD  R+   +  CD + VR C E +S+WL L E +H+KPV  VG 
Sbjct  184   LMRMDAGNVENASGVSDWDRVAEALIGCDAILVRSCRELESDWLDLTEKMHEKPVITVGL  243

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             +P +A D     +   D+W  I  WL++     VIYVA G+E  PSQ ELTE+A GLELS
Sbjct  244   MPPSARDR---EDDGDDTWHTISGWLNRHGKESVIYVALGTEVAPSQEELTELATGLELS  300

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PFFW LR + G ++ E + LP+GFEER K RGIV TSW PQL++L+H+SVGGFLTH G
Sbjct  301   GLPFFWALRKKEGLSEFESLELPDGFEERVKERGIVWTSWTPQLRVLAHDSVGGFLTHCG  360

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSV+E +Q  +PLV+L F  DQGLNAR LEEK +G  VPRDE DG  +R++VAESLRLV
Sbjct  361   WSSVIEGLQNGRPLVMLPFQLDQGLNARALEEKMVGIEVPRDEDDGSLSRDSVAESLRLV  420

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             + +++G +YR+K KEMK +F D+  Q+ Y D L+ YL
Sbjct  421   MADQKGQVYRDKAKEMKLIFGDKDLQEKYEDNLIEYL  457



>ref|XP_010277529.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nelumbo 
nucifera]
Length=474

 Score =   511 bits (1316),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 252/468 (54%), Positives = 328/468 (70%), Gaps = 9/468 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             ++E   LHI+M+PWLAFGHM+P+LELSK +A RGH++SFV++PRNI RLP++PP+L+  I
Sbjct  2     ENEKDNLHIVMFPWLAFGHMLPFLELSKCLAQRGHRISFVTSPRNIQRLPQIPPSLSHLI  61

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
             N V LPLPP  NLPEN EATIDLPYDK++YLK A D L+E + +FLE  SPDW+++DF  
Sbjct  62    NLVNLPLPPVDNLPENTEATIDLPYDKIQYLKKAFDGLEEPLTRFLEASSPDWVIYDFAP  121

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFF----GRLVDFAERTKAEDYTVPPKWIPFKTTV  1097
             +WL P+ +KLG+  A F+IF      F       + +   R++AE +TVPPKWIPF + +
Sbjct  122   HWLPPITNKLGLLGACFNIFNAAAQVFIVSPSSMMGEEDPRSEAEHFTVPPKWIPFPSNL  181

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLL-ENIHQK  920
             AFRL+EI RI DAV E    VSDIFR  S V   DI+A+R C EF+++WL+LL E I +K
Sbjct  182   AFRLHEIRRIFDAVQENVAGVSDIFRFESTVRGSDIIAIRSCVEFEAQWLRLLNEEICRK  241

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             P  PVG LP +  D   G +   +SW  I+ WLDKQ++  V+Y+A GSEA  S  + TE+
Sbjct  242   PNVPVGLLPPSVQDIREGDD--DESWIAIREWLDKQKSRSVVYIALGSEATLSHEDETEL  299

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             ALGLELS  PFFWVLR   G +  E   LP GFE+RT+ RG+VC  WAPQ+KIL+H SVG
Sbjct  300   ALGLELSRLPFFWVLRRPPGSSAAE--ELPTGFEDRTRSRGVVCRGWAPQMKILAHPSVG  357

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
              FLTH GWSS +EA+ +E PLVLL   + QGL AR L   KIG  +PR+E DG FTR +V
Sbjct  358   VFLTHCGWSSAIEALGWEVPLVLLPLTSTQGLCARQLAWDKIGVEIPRNEGDGSFTRNSV  417

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             AE+LRLV V ++GN  R + KEM+ +FC+ T  DGY+D    +L  H+
Sbjct  418   AETLRLVAVSEQGNALRTRAKEMRKIFCNSTLHDGYMDNFERHLKNHR  465



>ref|XP_009623232.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=466

 Score =   508 bits (1308),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 254/467 (54%), Positives = 318/467 (68%), Gaps = 10/467 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH++++PWLAFGH+IP+ EL+K IA +GHKVS++ST RNIDRLPKL   L   I+F
Sbjct  3     ETKKLHVVLFPWLAFGHLIPFFELAKQIARKGHKVSYISTSRNIDRLPKLSQKLNYSIHF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V L LP  + LPENAEAT D+P DKV+YLK A D L+  + +FL +  PDWI++DF  YW
Sbjct  63    VNLSLPLTKGLPENAEATKDVPLDKVQYLKKAFDGLESELTQFLVDSVPDWIIYDFTPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDF----AERTKAEDYTVPPKWIPFKTTVAF  1091
             L P+A KLG+S A FS F   +  FFG   D      +RTK ED+TVPPKWIPF + +AF
Sbjct  123   LPPIAGKLGISCAFFSTFNAWSSVFFGPAKDIIDGNVQRTKPEDFTVPPKWIPFPSNIAF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RLYEI R      E    VSD  R  + V  CD+  VR C++ + EWL LL  +HQKPV 
Sbjct  183   RLYEINRFFGHGQENISGVSDWHRFRASVSDCDVFLVRSCNKLEREWLDLLPQLHQKPVV  242

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP +  D  G      D+W  I  WL  Q    V+YVA G+EA PSQ ELTE+A G
Sbjct  243   PVGLLPPSVQDTEGDKR---DAWGFINNWLAMQREKSVVYVALGTEATPSQEELTELAHG  299

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFW LR +    D  L+ LPEGFEERTK RGIV TSWAPQL+IL H+SVG FL
Sbjct  300   LELSGLPFFWALRKQH---DFLLLKLPEGFEERTKNRGIVWTSWAPQLRILEHDSVGVFL  356

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW S++E ++F KPLV+L FL DQ LNAR LEEK +G  + R+E+DG  TR +VAES
Sbjct  357   THCGWGSIIEGLKFGKPLVMLPFLGDQALNARGLEEKMVGLEISRNEKDGSLTRNSVAES  416

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             L+LV+ +++G IY EK  EMK +F ++   D Y+D  + YLH +KS+
Sbjct  417   LKLVMNDEKGKIYWEKANEMKKIFGNRDLSDIYIDDFIEYLHKNKSL  463



>ref|XP_002532389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30001.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=433

 Score =   506 bits (1302),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 259/466 (56%), Positives = 318/466 (68%), Gaps = 46/466 (10%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             S LHI M+PWLAFGHMIP+LE +K +A +G                              
Sbjct  6     SNLHIAMFPWLAFGHMIPWLEFAKLLAEKG------------------------------  35

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
                     LP NAEAT+DLP  KV++LK A D LQ+ M   LE  +PDW+L DF  YW+ 
Sbjct  36    --------LPPNAEATMDLPPSKVRHLKKAVDMLQQPMTHLLESLAPDWVLFDFAPYWIP  87

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG---RLVDF-AERTKAEDYTVPPKWIPFKTTVAFRL  1085
              VA+KLG+ +A F+I T   VAF G    L++   +R K ED+TVPPKW+ F +T+A+R 
Sbjct  88    SVAAKLGIKSAFFTICTATMVAFLGPSSLLINGDDDRKKLEDFTVPPKWVTFPSTIAYRY  147

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             Y+I    D   +    VSD  R    ++  DI+ VR CSEF+ EWL+LLE+IHQK VFPV
Sbjct  148   YDIKNTFDCAEDNISGVSDFLRWGWCLKSSDIIMVRSCSEFEPEWLELLESIHQKRVFPV  207

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             GQLP TA +     +   DSW+ IK WLD QE G V+YVAFGSEAKPSQ +LTE+ALG+E
Sbjct  208   GQLPPTACET----DDKTDSWRWIKDWLDMQEKGSVVYVAFGSEAKPSQEQLTELALGIE  263

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PFFWV+R RRG AD EL  LP GFEERTKGRG+V TSWAPQLKIL+HES GGFLTH
Sbjct  264   LSGMPFFWVIRNRRGVADTELTELPPGFEERTKGRGVVWTSWAPQLKILAHESTGGFLTH  323

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGWSSVVEA+ F + L+LLTF ADQG+NARVLEEKKIGYS+PR+E DG F R +VAES++
Sbjct  324   SGWSSVVEALMFGRALILLTFYADQGINARVLEEKKIGYSIPRNEFDGSFKRNSVAESVK  383

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             LV+V +EG IYR+K KEM GLF D+ RQD YV+ +L YL  ++  K
Sbjct  384   LVMVSEEGKIYRDKAKEMSGLFGDRARQDNYVNNILSYLKGNRPTK  429



>ref|XP_002315125.2| hypothetical protein POPTR_0010s18980g [Populus trichocarpa]
 gb|EEF01296.2| hypothetical protein POPTR_0010s18980g [Populus trichocarpa]
Length=477

 Score =   506 bits (1303),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 330/469 (70%), Gaps = 14/469 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  +LHI M+PWLAFGH+IP+LEL+K IA RGHK+SF+STPRNI RLP +PPNL  RIN 
Sbjct  3     EPHELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPTIPPNLTPRINL  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V L LP  +NLP NAEAT DLP+DK+ YLK+A D LQ+++  FL   SPDWI+ DF SYW
Sbjct  63    VSLALPHVENLPNNAEATADLPFDKIPYLKIAYDRLQDSLFHFLHSSSPDWIIFDFASYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR-----LVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L  +A+KLG+S  LFSIF   T++F G      L     RT+ + +TVPPKW+ F + VA
Sbjct  123   LPEIATKLGISGVLFSIFGAWTLSFAGPSYSAILNGDDPRTEPQHFTVPPKWVTFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR++E  R +  +      V+DIFR  S +  CD++AVR C E ++++L+L+E++H KPV
Sbjct  183   FRIHEAKRFLVQIEANSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFLRLVEDLHCKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP  A  + GG     + W  I  WLDKQ  G V+Y+AFGSE   +Q E+TE+AL
Sbjct  243   IPVGLLPPPAQCSEGG---VDEKWVTISEWLDKQTQGSVVYIAFGSELTINQDEITELAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR +      + + LP+GF+ER KGRG+V TSWAPQL+I++HESVGGF
Sbjct  300   GLELSGLPFFWALRNQD-----DSVRLPDGFDERVKGRGVVWTSWAPQLRIMAHESVGGF  354

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G+SSV+EA+ F   L++L F  DQGL ARV E KK+G  VPRDE+DG FTR +VAE
Sbjct  355   LTHCGYSSVIEALSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAE  414

Query  373   SLRLVVVEKEGNIYREKIK-EMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             SLRLV+V++EG+ YRE  K +M  LF D++  D  +D  + +L  H+ +
Sbjct  415   SLRLVIVDREGSAYRENAKQQMVTLFGDKSISDRCMDQFVAFLRSHRKL  463



>gb|KFK32801.1| hypothetical protein AALP_AA6G289900 [Arabis alpina]
Length=471

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 249/463 (54%), Positives = 331/463 (71%), Gaps = 10/463 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRINFVK  1433
             KL++ M+P+LAFGHM+PYLELSK +A +GH VSF+STPRNIDRL P+LP NL+S INF+K
Sbjct  14    KLYVAMFPFLAFGHMVPYLELSKLMAQKGHTVSFISTPRNIDRLLPRLPENLSSAINFIK  73

Query  1432  LPLPP-HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             LPL      LPE  EAT DLP++ + YLK+A D L+  + +FLE   PDW+L DF  YWL
Sbjct  74    LPLSTVGDKLPEGGEATTDLPFELISYLKIAYDGLRVPVTEFLESSKPDWVLQDFAPYWL  133

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLYE  1079
              P++  LG+ TA FS F   T+    +   F E RT   D+  PPKW+PF+T VAF+L+E
Sbjct  134   PPISRHLGIKTAFFSAFNGATLGLL-KPPGFEEYRTCQADFLTPPKWVPFETPVAFKLFE  192

Query  1078  ILRIIDA--VTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
                I     V   + NV D+ R+   ++ CD++AVR C E+++EWL L++++H+KPV PV
Sbjct  193   CKDIFKGFMVETTEGNVPDVHRVAGVIDGCDVIAVRSCYEYEAEWLGLIQDLHRKPVIPV  252

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP    +     E T D+W  IKAWLD +++  V++VAFGSEAKPS TE+  IALGLE
Sbjct  253   GVLPPKPEEK---FEDT-DTWVTIKAWLDSRKSKSVVHVAFGSEAKPSHTEVDAIALGLE  308

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PFFWVL+ RRG  D E + LPEGFEERT  RG+V   W  QL+ LSH+S+G  LTH
Sbjct  309   LSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWKGWVEQLRTLSHDSIGLVLTH  368

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              GW +++EA++F KP+V+L F+ DQGLNARV+EEKKIGY +PR+E++G FT+E+VA+SLR
Sbjct  369   PGWGTIIEAVRFGKPMVMLVFVCDQGLNARVIEEKKIGYMIPREEKEGLFTKESVAKSLR  428

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             LV+ E+EG +YRE +KEMK +F D  RQD YVD  + YL  ++
Sbjct  429   LVMEEEEGKVYRENVKEMKNVFGDMDRQDRYVDDFMEYLVANR  471



>ref|XP_011015214.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Populus euphratica]
Length=477

 Score =   506 bits (1302),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 329/469 (70%), Gaps = 14/469 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  +LHI M+PWLAFGH+IP+LEL+K IA RGHK+SF+STPRNI RLP  PPNL  RIN 
Sbjct  3     EPDELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPSTPPNLTPRINL  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V L LP  +NLP NAEAT DLP+DK+ YLKLA D LQ+++  FL   SPDWI+ DF  YW
Sbjct  63    VSLALPHVENLPNNAEATADLPFDKIPYLKLAYDGLQDSIFHFLHSSSPDWIIFDFAPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L  +A+KLG+S  LFSIF   T++F G      L D   RT+ + +TVPPKW+ F + VA
Sbjct  123   LPEIATKLGISGVLFSIFGAWTISFAGPSSSAMLNDDDPRTEPQHFTVPPKWVTFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR++E  R +D +      V+DIFR  S +  CD++AVR C E ++++++L+E++H KPV
Sbjct  183   FRIHEAKRFLDQIELNSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFIRLVEDLHCKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP +A  + GG     + W  I  WLDKQ  G V+Y+AFGSE   +Q ++TE+AL
Sbjct  243   IPVGLLPPSAEFSEGG---VDEKWVAISEWLDKQTQGSVVYIAFGSELTMNQKDITELAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG  FFW LR R      + + LP+GFEER KGRG+V TSWAPQL+I++HESVGGF
Sbjct  300   GLELSGLQFFWALRNRD-----DSVRLPDGFEERVKGRGVVWTSWAPQLRIMAHESVGGF  354

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             +TH G+SSV+EA+ F   L++L F  DQGL ARV E KK+G  VPRDE+DG FTR +VAE
Sbjct  355   VTHCGYSSVIEALSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAE  414

Query  373   SLRLVVVEKEGNIYREKIK-EMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             SLRLV+V+KEG+ YRE  K +M  LF +++  D  +D  + +L  H  +
Sbjct  415   SLRLVIVDKEGSAYRENAKQQMVTLFGEKSISDRGMDQFVGFLRSHGKL  463



>gb|KDP29783.1| hypothetical protein JCGZ_18718 [Jatropha curcas]
Length=465

 Score =   504 bits (1298),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 242/466 (52%), Positives = 329/466 (71%), Gaps = 13/466 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH+ ++PWLAFGH+IPYL+++KHIA +GHK+SF+STPRNI RLPK+PPNL+S I+F
Sbjct  3     ETKKLHVALFPWLAFGHIIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSNIHF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             + LPLP   NLP +AEAT+D+P +K+ YLK+A D L+E + +FL+  +PDWI++DF +YW
Sbjct  63    ISLPLPQVDNLPPDAEATMDIPTNKIPYLKIAYDGLKEPLFQFLKTSAPDWIIYDFAAYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR-----LVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L P+ S LG+S+A FSIF+  T+AF        +    ERT+ ED+TVPPKW+PF + VA
Sbjct  123   LPPITSDLGISSAFFSIFSAWTMAFLASSSSAMINGDDERTRPEDFTVPPKWVPFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +R++E  R  +     D  +SD++RL + +   D++AVR C E +++ LKL E +H KPV
Sbjct  183   YRIHEAKRAFEHFEVNDSGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP +  D  GG + T   W  I  WLDKQ  G V+Y+AFGSE + SQ +L ++AL
Sbjct  243   LPIGLLPPSDLDVTGGDDET---WLKICGWLDKQNKGSVVYIAFGSELEVSQKDLNDLAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR ++G +      LP+GFEER KGRGIV TSW PQL+IL HESVGGF
Sbjct  300   GLELSGLPFFWTLR-KQGNS----FELPDGFEERVKGRGIVWTSWVPQLRILGHESVGGF  354

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G SSVVEA+ F   L+L     DQGLNARV EEKK+G  V R+E+DG FT+E++AE
Sbjct  355   LTHCGLSSVVEALNFGLALILFPVSIDQGLNARVFEEKKLGVEVKRNEQDGSFTKESLAE  414

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             SL L +  ++G +YRE   EM+ L  ++   +G +D  + +L  H+
Sbjct  415   SLMLAMDNEKGKLYRESTNEMRKLITNREVHNGCIDQFVEFLQTHR  460



>gb|KDP29779.1| hypothetical protein JCGZ_18714 [Jatropha curcas]
Length=465

 Score =   503 bits (1296),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 242/466 (52%), Positives = 328/466 (70%), Gaps = 13/466 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH+ ++PWLAFGH IPYL+++KHIA +GHK+SF+STPRNI RLPK+PPNL+S I+F
Sbjct  3     ETKKLHVALFPWLAFGHTIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSNIHF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             + LPLP   NLP +AEAT+D+P +K+ YLK+A D L+E + +FL+  +PDWI++DF +YW
Sbjct  63    ISLPLPQVDNLPPDAEATMDIPTNKIPYLKIAYDGLKEPLFQFLKTSAPDWIIYDFAAYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR-----LVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L P+ S LG+S+A FSIF+  T+AF        +    ERT+ ED+TVPPKW+PF + VA
Sbjct  123   LPPITSDLGISSAFFSIFSAWTMAFLASSSSAMINGDDERTRPEDFTVPPKWVPFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +R++E  R  +     D  +SD++RL + +   D++AVR C E +++ LKL E +H KPV
Sbjct  183   YRIHEAKRAFEHFEVNDSGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP +  D  GG + T   W  I  WLDKQ  G V+Y+AFGSE + SQ +L ++AL
Sbjct  243   LPIGLLPPSDLDVTGGDDET---WLKICGWLDKQNKGSVVYIAFGSELEVSQKDLNDLAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR ++G +      LP+GFEER KGRGIV TSW PQL+IL HESVGGF
Sbjct  300   GLELSGLPFFWTLR-KQGNS----FELPDGFEERVKGRGIVWTSWVPQLRILGHESVGGF  354

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G SSVVEA+ F   L+L     DQGLNARV EEKK+G  V R+E+DG FT+E++AE
Sbjct  355   LTHCGLSSVVEALNFGLALILFPVSIDQGLNARVFEEKKLGVEVKRNEQDGSFTKESLAE  414

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             SL L +  ++G +YRE   EM+ L  ++   +G +D  + +L  H+
Sbjct  415   SLMLAMDNEKGKLYRESTNEMRKLITNREVHNGCIDQFVEFLQTHR  460



>ref|XP_007208586.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
 gb|EMJ09785.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
Length=470

 Score =   502 bits (1293),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 320/465 (69%), Gaps = 11/465 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLHI ++PWLAFGH+IP+ E++KH+A RGHKVSF+STPRNI RLPK+P +L   IN 
Sbjct  6     EPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTPLINL  65

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V++PLP  +NLPENAEAT+D+PY  + YLK+A D L++ ++ FL+   PDWI+HDF  +W
Sbjct  66    VQIPLPRVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLQTHKPDWIIHDFAPHW  125

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L P+AS LG+S A FSIF   T+ F G      L  +  RT  E +TVPP+WIPF + + 
Sbjct  126   LPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTVPPEWIPFPSNLV  185

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR +E  ++ DA  +    VSD+FR+ S V+ C +  +R C E + EWL LL+ + Q PV
Sbjct  186   FRSFEAKKLFDATKQNASGVSDLFRVQSTVQGCQVYLIRSCREIEGEWLDLLQELQQFPV  245

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP              + W  I  WLDKQE G V+Y+A GSE   SQ + TE+AL
Sbjct  246   VPIGLLPPLVQT-----REDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQEDFTELAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVLR      D + + LP+GFEERTKGRG+V T+WAPQ KIL+H+S+GGF
Sbjct  301   GLELSGLPFFWVLRTPSWSGDSDSVKLPDGFEERTKGRGLVWTTWAPQTKILAHDSIGGF  360

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GWSS++EA+Q+ +PL++L FL DQGL AR   +KKIG  VPR+E DG FTR+++AE
Sbjct  361   LTHCGWSSLIEALQYGRPLIMLPFLYDQGLIARFW-DKKIGIEVPRNEEDGSFTRKSLAE  419

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             SL LVVV++EG  YR+  KE   +F D+   D Y+D  + YL  H
Sbjct  420   SLNLVVVDEEGKAYRDGAKEHGEVFKDKDLHDRYMDKCVEYLENH  464



>ref|XP_002325254.2| hypothetical protein POPTR_0018s13720g [Populus trichocarpa]
 gb|EEF03819.2| hypothetical protein POPTR_0018s13720g [Populus trichocarpa]
Length=420

 Score =   499 bits (1284),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 255/464 (55%), Positives = 319/464 (69%), Gaps = 52/464 (11%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
              SKLHI M+PWLAFGHMIPYLEL+K IA +GHK+SF+STPRN DRLPKL P+++  I FV
Sbjct  4     SSKLHIAMFPWLAFGHMIPYLELAKLIAQKGHKISFISTPRNTDRLPKLHPSISPLITFV  63

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP-DWILHDFDSYW  1259
             KL LP  +NL ++AEAT D+PYDKV+YLK A D L+E ++KFLE     D IL  F  YW
Sbjct  64    KLSLPQVENLSKDAEATADVPYDKVQYLKQACDDLKEPLSKFLETCDDLDCILFYFAPYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             L  +A+ LG+ +  FSIFT   +++        +R+K ED+T+PPKW+ F T V FRL+E
Sbjct  124   LPDIATSLGIPSVFFSIFTAAMLSYVKPASGIDDRSKPEDFTIPPKWVTFPTNVVFRLFE  183

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             +LRI    T   + VSD++R   G++ CD++AVR C EF+ EWL+LLE IH KPV PVG 
Sbjct  184   VLRIF-YQTLAGNVVSDLYRTQEGIKGCDMIAVRSCMEFEPEWLQLLEEIHGKPVIPVGV  242

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             L TT                                                  LGLELS
Sbjct  243   LATT--------------------------------------------------LGLELS  252

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PFFWVLR  RG AD ELI LPEGFEER+K +G+V TSWAPQLKIL+H+SVGGFLTHSG
Sbjct  253   GLPFFWVLRKHRGSADTELIELPEGFEERSKAQGLVWTSWAPQLKILAHDSVGGFLTHSG  312

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSVVEA+Q  + L+LLTFLADQG+NARVLE+KK+GYS+PR+E++G FTR++VAESLRLV
Sbjct  313   WSSVVEALQHARALILLTFLADQGINARVLEDKKMGYSIPRNEKNGYFTRDSVAESLRLV  372

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             + ++EG IYR+K+KEMK LF D+ RQD YVD L+ +L  H   K
Sbjct  373   MEKEEGKIYRDKVKEMKPLFADKDRQDKYVDKLVDHLRSHGRTK  416



>emb|CAN80741.1| hypothetical protein VITISV_015058 [Vitis vinifera]
Length=448

 Score =   499 bits (1285),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/471 (54%), Positives = 322/471 (68%), Gaps = 40/471 (8%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
              + +KLHI+++PWLAFGHMIPYLEL+K +A RGH VSFVSTPRNIDRLPKLPPNL   I+
Sbjct  10    QDDAKLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFIS  69

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+PLP   NLPENAEAT DLP +KV +LK A + L+E +  FL+  +PDW+LHDF +Y
Sbjct  70    FVKIPLPHVPNLPENAEATTDLPENKVPFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAY  129

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             WL P+A+KLG++    SIFT   + FF        RT+ ED+TV PKW+PF + VAFR +
Sbjct  130   WLVPIATKLGIACGFLSIFTASALCFFNPSGQ-DHRTEPEDFTVAPKWVPFPSRVAFRYF  188

Query  1081  EILRII-DAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             E+++I  +A+  +    SD+ R  + +  CD++AVR C+E + EWL+LLE ++QKPV PV
Sbjct  189   EVVKIFNNAIAGDASGTSDMHRFEACLRGCDLLAVRSCTELEPEWLRLLEQLYQKPVVPV  248

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             GQLP       GG +   ++W +IK WLDKQ  G V+YVAFGSEAKP+QTELTEIALGLE
Sbjct  249   GQLPPIL--PHGGDDDEDETWLEIKGWLDKQAGGSVVYVAFGSEAKPNQTELTEIALGLE  306

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              S  PFFW L+ +RG  D E+I L EGFEERTKGRG+                       
Sbjct  307   QSELPFFWALKLKRGPCDIEVIQLXEGFEERTKGRGV-----------------------  343

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
                     A+Q E+PL+LLTFLADQGLNA  L EK +G  +PR+E DG FTREAVA SLR
Sbjct  344   --------ALQLERPLILLTFLADQGLNASFLREKXMGXLIPRNEEDGSFTREAVARSLR  395

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLL-----HYLHCHKSIK  227
             LVVVE+    YR+K KEM+ +F D+ RQ+ YVDTL+     H  H HK+ +
Sbjct  396   LVVVEEGDKFYRDKAKEMRAVFGDRDRQNQYVDTLVSCLKEHRRHXHKAAR  446



>ref|XP_010506988.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=470

 Score =   500 bits (1287),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/466 (52%), Positives = 325/466 (70%), Gaps = 13/466 (3%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRINF  1439
             G+KLH+ M+PWLAFGH++P+L+LS  +  +GH VSF+STPRNIDRL P+LP NL+S +NF
Sbjct  12    GTKLHVAMFPWLAFGHLVPHLQLSMLMVQKGHTVSFISTPRNIDRLLPRLPENLSSALNF  71

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VKLP   H  LPE+AE+T D+P D V YLK+A D LQ  + +FLE   PDW+L DF  YW
Sbjct  72    VKLPFAGHNKLPEDAESTTDVPLDLVPYLKIAFDGLQVPLTEFLESSKPDWLLQDFAPYW  131

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLV--DFAE-RTKAEDYTVPPKWIPFKTTVAFR  1088
             L P+AS+LG+    FS       +F G L    F E RT  E +   PKW+PF+T V FR
Sbjct  132   LPPIASRLGIKNGYFSALN---CSFLGILKPPGFEEYRTSPEAFLTQPKWVPFQTPVPFR  188

Query  1087  LYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             LYEI  + + +  E  ++N+ D+ RL   ++ CDI+ VR C+E+++EW +L++++H+KPV
Sbjct  189   LYEIQPMFEDIMLEHTEENIPDMDRLAGVIDGCDIIVVRSCTEYEAEWFRLIKDLHRKPV  248

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP    +         D+W   K WLD ++T  V+Y++FGSE KPSQTEL  IAL
Sbjct  249   IPVGVLPPKPEEKFKD----TDAWLSTKKWLDSRKTNSVVYISFGSEVKPSQTELNAIAL  304

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELS  PFFWVLR RRG  D E + LPEGFEERT  RGIV   W  QL+ L+H+S+G  
Sbjct  305   GLELSRLPFFWVLRTRRGPWDTEPLELPEGFEERTAERGIVWRGWVEQLRTLNHDSIGLV  364

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GWS+++EA++F KP+V+L F+ DQG NARV EEKK+G+ +PRDE  G FT+E V++
Sbjct  365   LTHCGWSTMIEAVRFAKPMVMLGFVLDQGFNARVAEEKKVGHMIPRDETTGFFTKEDVSK  424

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             SLRLV+  +EG +YRE +K+MKG+F D   QD YVD+ L YL  H+
Sbjct  425   SLRLVMEGEEGKVYRENVKDMKGVFGDMDTQDRYVDSFLDYLFAHR  470



>gb|KGN48693.1| hypothetical protein Csa_6G498410 [Cucumis sativus]
Length=416

 Score =   498 bits (1281),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 258/455 (57%), Positives = 312/455 (69%), Gaps = 55/455 (12%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLP-KLPPNLASRINFVK  1433
             KLHI+++PW+AFGHMIP+LELSK IA +GH+VSFVSTP+NIDRLP KLPP+L+S + FVK
Sbjct  6     KLHIVIFPWIAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPTKLPPHLSSFLRFVK  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LP P   +LP +AEAT D+PYDKV                                    
Sbjct  66    LPFPQINDLPPDAEATSDVPYDKV------------------------------------  89

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
                           IFTP  + F G +     R K ED+TV P W+PF T V FR +EI+
Sbjct  90    -------------HIFTPEFLVFVGPMFG-DNRIKPEDFTVSPHWVPFPTNVVFRHFEIM  135

Query  1072  RIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
             RI D+V      VSD++R+       D+V VRGC EF  EW++LL +++ KP+FPVGQLP
Sbjct  136   RIFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPVGQLP  195

Query  892   TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGF  713
             T+ Y+ G        +W+ IK WLDKQ    V+YVAFGSEAKPSQ ELTEIALGLE S  
Sbjct  196   TSEYETGD----ENPAWERIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEKSEL  251

Query  712   PFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWS  533
              FFWV R RRG +DP+ I LPEGFEERTKGRG+V T+WAP+LKIL HES+GGFLTHSGWS
Sbjct  252   RFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPRLKILRHESMGGFLTHSGWS  311

Query  532   SVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVV  353
             SVVEAIQ EK LVLLTFLADQG+NARVLEEKK+GY VPR+E DG FTR+AVAESL+LVVV
Sbjct  312   SVVEAIQSEKALVLLTFLADQGMNARVLEEKKMGYPVPRNELDGSFTRDAVAESLKLVVV  371

Query  352   EKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             E+EG IYRE I+E K LF ++ R D  +D LL ++
Sbjct  372   EEEGKIYRETIREAKDLFVNKERDDKLIDRLLDHM  406



>ref|XP_004287868.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=478

 Score =   499 bits (1286),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/467 (53%), Positives = 326/467 (70%), Gaps = 14/467 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LH+ ++PWLAFGH+IP+LE++KHIA +GHKVSF+STPRNI RLPK+P  L   I  V++
Sbjct  11    QLHVALFPWLAFGHIIPFLEVAKHIARKGHKVSFISTPRNIQRLPKIPETLTPLITLVQI  70

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  +NLPENAEAT+D+P+D + YLK+A D L++ +++FL+  SPDWI+HDF  +WL P
Sbjct  71    PLPHVENLPENAEATMDVPHDVIPYLKIAHDGLEQGISEFLQAQSPDWIIHDFAPHWLPP  130

Query  1249  VASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A+KLG+S A FSIF   T+ F G     R+  +A R K E YT PP+WIPF + + +R 
Sbjct  131   IATKLGISNAHFSIFNASTLCFLGSTSPNRVSRYAPRKKLEQYTSPPEWIPFPSKIYYRP  190

Query  1084  YEILRIIDAV-TEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP-VF  911
             +E  R+++ + T     V+D FRL S ++ C +  +R C E + EWL LLE++H+KP V 
Sbjct  191   FEAKRLVNGILTPNASGVTDHFRLESTIQGCQVYFIRSCREIEGEWLDLLEDLHEKPVVL  250

Query  910   PVGQLPTT--AYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             P G LP +    D  GG +     W  I  WLDKQE GKV+YVAFGSE   SQ E  E+A
Sbjct  251   PTGLLPPSLPRSDEDGGKD---SDWSKIAEWLDKQEKGKVVYVAFGSELNLSQEEFNELA  307

Query  736   LGLELSGFPFFWVLRA-RRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             LGLELSG PFFWVLR    G  D + + LP+GFE+RTKGRG V T+WAPQLKILSHESVG
Sbjct  308   LGLELSGLPFFWVLRKPSNGSGDGDSVKLPDGFEDRTKGRGHVWTTWAPQLKILSHESVG  367

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
             GFLTH GWSS++E++Q+ +PL++L F+ DQGL AR   + KIG  VPRDE  G FTR  +
Sbjct  368   GFLTHCGWSSIIESLQYGRPLIMLPFMYDQGLIARFW-DNKIGAEVPRDEETGWFTRNEL  426

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             A SL+L+VV++EG  YR+   +   LF D+   D Y+D  + YL  H
Sbjct  427   ANSLKLIVVDEEGKQYRDGANDYSKLFRDKELHDRYMDECVEYLETH  473



>ref|XP_009801322.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=463

 Score =   498 bits (1283),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 248/461 (54%), Positives = 311/461 (67%), Gaps = 10/461 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH++++PWLAFGH+IP+ EL+K IA +GHKVS++ST RNIDRLPK    L   I+F
Sbjct  3     ETKKLHVVLFPWLAFGHLIPFFELAKQIARKGHKVSYISTSRNIDRLPKFSQKLNYSIHF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V L LP  + LPENAEAT D+P DKV+YLK A D L+  + +FLE+  PDWI++DF  YW
Sbjct  63    VNLSLPLTKGLPENAEATKDVPLDKVQYLKKAFDGLESELTQFLEDSVPDWIIYDFTPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDF----AERTKAEDYTVPPKWIPFKTTVAF  1091
             L P+A +LG+S A FS F   +  FFG   D      +RTK ED+TVPPKWIPF + +AF
Sbjct  123   LPPIAGRLGISRAFFSTFNAWSSVFFGPAKDVIDGNIQRTKPEDFTVPPKWIPFPSNIAF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RLYEI R      E    VSD  R    V  CD+  VR C+E + EWL LL  +HQKP+ 
Sbjct  183   RLYEINRYFGHGQENVSGVSDWHRFGESVSGCDVFLVRSCNELEREWLDLLPELHQKPIV  242

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP +  D  G       +W  I  WL  Q    V+YVA G+EA PSQ ELTE+A G
Sbjct  243   PVGLLPPSVQDTEGD---KSYAWGFINNWLAMQRKKSVVYVALGTEATPSQEELTELAHG  299

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFW LR +    D  L+ LPEGFEERTK RGIV  SWAPQL+IL H+SVG FL
Sbjct  300   LELSGLPFFWALRKQH---DFLLLKLPEGFEERTKTRGIVWMSWAPQLRILEHDSVGCFL  356

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW S++E +QF KPLV+L FL DQ LNAR LEEK +G  +PR+ERDG  TR +VAES
Sbjct  357   THCGWGSIIEGLQFGKPLVMLPFLGDQALNARCLEEKMVGLEIPRNERDGSLTRNSVAES  416

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             L+LV+ +++G IY EK  EM+ +F ++   D Y+D  + ++
Sbjct  417   LKLVMNDEKGKIYWEKANEMRKIFGNRDLCDNYIDDFIEFV  457



>ref|XP_011015202.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Populus euphratica]
Length=465

 Score =   498 bits (1283),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 327/469 (70%), Gaps = 14/469 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  +LHI M+PWLAFGH+IP+LEL+K IA RGHK+SF+STPRNI RLP +P +L  RIN 
Sbjct  3     EPDELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPSIPLDLTPRINL  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
               L LP  +NLP NAEAT DLP+DK+ YLKLA D LQ+++  FL   SPDWI+ DF  YW
Sbjct  63    ASLALPRVENLPNNAEATADLPFDKIPYLKLAYDGLQDSIFHFLHSSSPDWIIFDFAPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L  +A+KLG+   LFSIF   T++F G      L D   RT+ + +TVPPKW+ F + VA
Sbjct  123   LPEIATKLGIYGVLFSIFGAWTISFAGPSSSAMLNDDDPRTEPQHFTVPPKWVTFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR++E  R +D +      V+DIFR  S +  CD++AVR C E ++++L+L+E++H KPV
Sbjct  183   FRIHEAKRFLDQIELNSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFLRLVEDLHCKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP +A  + GG     + W  I  WLDKQ  G V+Y+AFGSE   +Q ++TE+AL
Sbjct  243   IPVGLLPPSAEFSEGG---VDEKWVAISEWLDKQTQGSVVYIAFGSELTMNQKDITELAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG  FFW LR R      + + LP+GFEER KGRG+V TSWAPQL+I++HESVGGF
Sbjct  300   GLELSGLQFFWALRNRD-----DSVRLPDGFEERVKGRGVVWTSWAPQLRIMAHESVGGF  354

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             +TH G+SSV+EA  F   L++L F  DQGL ARV E KK+G  VPRDE+DG FTR +VAE
Sbjct  355   VTHCGYSSVIEAFSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAE  414

Query  373   SLRLVVVEKEGNIYREKIK-EMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             SLRLV+V+KEG+ YRE  K +M  LF +++  D  +D  + +L  H+ +
Sbjct  415   SLRLVIVDKEGSAYRENAKQQMVTLFGEKSISDRCMDHFVAFLRSHRKL  463



>sp|Q66PF2.1|URT1_FRAAN RecName: Full=Putative UDP-rhamnose:rhamnosyltransferase 1; Short=FaRT1; 
AltName: Full=Glycosyltransferase 4; Short=FaGT4 
[Fragaria x ananassa]
 gb|AAU09445.1| putative UDP-rhamnose:rhamnosyltransferase [Fragaria x ananassa]
Length=478

 Score =   499 bits (1285),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 247/467 (53%), Positives = 325/467 (70%), Gaps = 14/467 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI ++PWLAFGH+IP+LE++KHIA +GHKVSF+STPRNI RLPK+P  L   IN V++
Sbjct  11    KLHIALFPWLAFGHIIPFLEVAKHIARKGHKVSFISTPRNIQRLPKIPETLTPLINLVQI  70

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  +NLPENAEAT+D+P+D + YLK+A D L++ +++FL+  SPDWI+HDF  +WL P
Sbjct  71    PLPHVENLPENAEATMDVPHDVIPYLKIAHDGLEQGISEFLQAQSPDWIIHDFAPHWLPP  130

Query  1249  VASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A+KLG+S A FSIF   ++ FFG     R+  +A R K E +T PP+WIPF + +  R 
Sbjct  131   IATKLGISNAHFSIFNASSMCFFGSTSPNRVSRYAPRKKLEQFTSPPEWIPFPSKIYHRP  190

Query  1084  YEILRIIDA-VTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP-VF  911
             +E  R++D  +T     V+D FRL S ++ C +  +R C E + EWL LLE++H+KP V 
Sbjct  191   FEAKRLMDGTLTPNASGVTDRFRLESTIQGCQVYFIRSCREIEGEWLDLLEDLHEKPIVL  250

Query  910   PVGQLPTT--AYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             P G LP +    D  GG +    +W  I  WLDKQE GKV+Y AFGSE   SQ    E+A
Sbjct  251   PTGLLPPSLPRSDEDGGKD---SNWSKIAVWLDKQEKGKVVYAAFGSELNLSQEVFNELA  307

Query  736   LGLELSGFPFFWVLRA-RRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             LGLELSG PFFWVLR    G  D + + LP+GFE+R KGRG+V T+WAPQLKILSHESVG
Sbjct  308   LGLELSGLPFFWVLRKPSHGSGDGDSVKLPDGFEDRVKGRGLVWTTWAPQLKILSHESVG  367

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
             GFLTH GWSS++E++Q+  PL++L F+ DQGL AR   + KIG  VPRDE  G FTR  +
Sbjct  368   GFLTHCGWSSIIESLQYGCPLIMLPFMYDQGLIARFW-DNKIGAEVPRDEETGWFTRNEL  426

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             A SL+L+VV++EG  YR+   E   LF D+   D Y+D  + YL  H
Sbjct  427   ANSLKLIVVDEEGKQYRDGANEYSKLFRDKELHDRYMDECVEYLETH  473



>ref|XP_010254573.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=483

 Score =   499 bits (1284),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 253/466 (54%), Positives = 325/466 (70%), Gaps = 17/466 (4%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
               ++LH++M+PWLAFGHM+P+LELSK +A RGH+VSFVSTPRNI RLPK+PP+L+S ++ 
Sbjct  9     NNNELHVVMFPWLAFGHMMPFLELSKRLAERGHRVSFVSTPRNIQRLPKIPPSLSSLVHL  68

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V+LPL P   LPENAEAT+DL Y KV+YLK A D L+  + +FLE  SPDWILHDF  +W
Sbjct  69    VELPLSPTDGLPENAEATVDLSYHKVQYLKKAFDGLEGPLTRFLESSSPDWILHDFAPHW  128

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG---RLV--DFAERTKAEDYTVPPKWIPFKTTVA  1094
             L+P+ +KLG+ +A FS+F    +AFFG    L+  D   RTK ED+TVPPKW+PF   +A
Sbjct  129   LSPITAKLGLPSAFFSLFNASALAFFGPPNALLGGDDDCRTKPEDFTVPPKWVPFP--LA  186

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSE--WLKLLE-NIHQ  923
             FRLYEILR++D +      VSD +R+ S V  CDIV +R C EF+SE   L+LLE  I+ 
Sbjct  187   FRLYEILRMVDGLDRNASGVSDTYRIGSAVLGCDIVVIRSCMEFESESDCLRLLEEKIYC  246

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP  A           D+  +   WLD+Q  G V+YVAFGSE   SQ ++TE
Sbjct  247   KPVIPVGLLPLAA-------PAVKDAMGEDDKWLDQQGRGSVVYVAFGSEVTLSQEDVTE  299

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             +A+GLELS  PFFWVLR        E   LP+GFEERTKGRG+VC  WAPQ +IL+H SV
Sbjct  300   LAVGLELSELPFFWVLRKPSSLTQEEWGLLPDGFEERTKGRGVVCRGWAPQQRILAHPSV  359

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GGFLTH GWSS++EA++F    +LL +LADQGLNAR+L  +K+G  + RDER G FTR +
Sbjct  360   GGFLTHCGWSSIIEALEFGHAFILLPYLADQGLNARLLAWRKLGVEIQRDERSGSFTRSS  419

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLH  245
             VAESLRLV+V  EG   R   ++M  +  ++   D YVD L+ Y+ 
Sbjct  420   VAESLRLVMVSDEGAELRANARKMAEMVGNKQLHDQYVDHLISYMQ  465



>ref|XP_002270331.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=481

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 310/467 (66%), Gaps = 14/467 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA  GH++SF+STPRNI+RLPKLPPNL   I+ VK 
Sbjct  22    KLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPNLQPLIDLVKF  81

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY  + YLK A D LQE + +FLE   PDW++HDF  +WL P
Sbjct  82    PLPNDDNLPENAEATTDLPYGNIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFAPHWLPP  141

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE----RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +A+K GVS A F IF+   + F G      E    RT+   +  PP W+ F T VA  L+
Sbjct  142   IAAKHGVSRAFFCIFSATALCFGGSTSIMMEGGDPRTELHQFAAPPPWVTFPTKVALPLF  201

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
              + R +D        VSD FR+ S +  CD++A+R C+E + EWL LL  +HQKP+FP+G
Sbjct  202   LLRRSLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLFPIG  261

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +A   G       DSW  IK WLDKQE   V+YVA G+E  P++ ELTE+A GLEL
Sbjct  262   LLPPSAPVNG-----DDDSWPPIKEWLDKQEKECVVYVALGTEVTPTEDELTELAFGLEL  316

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR R    D     LP+ FEERTKGRG+V  SWAPQL+IL H+SVGGF+TH 
Sbjct  317   SGLPFFWALRKRHDAVD-----LPDRFEERTKGRGMVWRSWAPQLRILDHDSVGGFVTHC  371

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSV+E + F + L++L    DQG+NAR  EE K+G  +PRD+ + R +R++VAE+L L
Sbjct  372   GWSSVIEGLHFGQALIMLPLWGDQGVNARTFEEMKVGVEIPRDQEEERLSRKSVAETLSL  431

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYG  221
             V+VE+ G IYR K KEM  L  D+ R   YV   + YL  H+    G
Sbjct  432   VMVEETGKIYRNKAKEMSKLLGDKHRHHRYVSDFVEYLQKHRPCVQG  478



>ref|XP_010502543.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=452

 Score =   496 bits (1277),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 249/459 (54%), Positives = 321/459 (70%), Gaps = 13/459 (3%)
 Frame = -2

Query  1594  MYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRINFVKLPLPP  1418
             M+PWLAFGH++P+LELSK +  +GH VSF+STPRNIDRL P+LP N +S INFVKLP   
Sbjct  1     MFPWLAFGHLVPHLELSKLMVQKGHTVSFISTPRNIDRLLPRLPENHSSAINFVKLPFSG  60

Query  1417  HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPVASK  1238
             H  LP++AEAT D+P+D V YLK+A D L+  + +FLE   PDW+L DF  YWL P+AS 
Sbjct  61    HNKLPQDAEATTDVPFDLVPYLKIAFDGLRVPLTEFLESSKPDWLLQDFGPYWLPPIASC  120

Query  1237  LGVSTALFSIFTPPTVAFFGRLV--DFAE-RTKAEDYTVPPKWIPFKTTVAFRLYEILRI  1067
             LG+  A FS F     A  G L    F E RT  ED+   PKW+PFKT V FRLYEI  +
Sbjct  121   LGIKNAFFSAFN---CACLGGLKPPGFEEYRTSPEDFLTQPKWVPFKTPVPFRLYEIQPM  177

Query  1066  IDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
              + +  E  +DN+ D+ R+   +  CDI+ VR C+E+++EWL LL+N+H+KPV PVG LP
Sbjct  178   FEGIMLESTEDNIPDVDRIGRVISGCDIMVVRSCNEYEAEWLGLLQNLHRKPVIPVGVLP  237

Query  892   TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGF  713
                 +         D+W   K  LD +++  V+YV+FG+EA PSQ+E   IALGLELSG 
Sbjct  238   PKLDEKFK----DTDAWLSTKKLLDSRKSNSVVYVSFGTEANPSQSEFNSIALGLELSGL  293

Query  712   PFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWS  533
             PFFWVLR RRG  D E + LPEGFEERT  RGIV   W  QL+ L+H+S+G  LTHSGWS
Sbjct  294   PFFWVLRTRRGPWDTEPLDLPEGFEERTAERGIVWRGWVEQLRTLNHDSIGLVLTHSGWS  353

Query  532   SVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVV  353
             S++EA++F KP+V+L F+ DQGLNARV EEKKIG+ +PRDE  G FT+E VA+SLRLV+ 
Sbjct  354   SMIEAVRFAKPMVMLGFVYDQGLNARVAEEKKIGHMIPRDETTGFFTKEDVAKSLRLVMD  413

Query  352   EKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              +EG +YR+ +K+MKG+F D   QD YVD+ L YL  H+
Sbjct  414   GEEGKVYRDSVKDMKGVFGDMDTQDRYVDSFLDYLVAHR  452



>emb|CAN80742.1| hypothetical protein VITISV_015059 [Vitis vinifera]
Length=481

 Score =   496 bits (1278),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 308/467 (66%), Gaps = 14/467 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA  GH++SF+STPRNI+RLPKLPPNL   I+ VK 
Sbjct  22    KLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPNLQPLIDLVKF  81

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY  + YLK A D LQE + +FLE   PDW++HDF  +WL P
Sbjct  82    PLPNDDNLPENAEATTDLPYGNIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFAPHWLPP  141

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE----RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +A+K GVS A F IF+   + F G      E    RT+   +  PP W+ F T VA  L+
Sbjct  142   IAAKHGVSRAFFCIFSATALCFGGSTSIMMEGGDPRTELHQFAAPPPWVTFPTKVALPLF  201

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
              + R +D        VSD FR+ S +  CD++A+R C+E + EWL LL  +HQKP+FP+G
Sbjct  202   LLRRSLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLFPIG  261

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +A   G       DSW  IK WLDKQE   V+YVA G+E  P++ ELTE+A GLEL
Sbjct  262   LLPPSAPVNG-----DDDSWPPIKEWLDKQEKECVVYVALGTEVTPTEDELTELAFGLEL  316

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR R    D     LP+ FEERTKGRG+V  SWAPQL+IL H+SVGGF+TH 
Sbjct  317   SGLPFFWALRKRHDAVD-----LPDRFEERTKGRGMVWRSWAPQLRILDHDSVGGFVTHC  371

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSV+E + F + L++L    DQG NAR  EE K+G  +PRD+ + R +R++VAE+L L
Sbjct  372   GWSSVIEGLHFGQALIMLPLWGDQGXNARTFEEMKVGVEIPRDQEEERLSRKSVAETLSL  431

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYG  221
             V+VE+ G IYR K KEM  L  D  R   YV   + YL  H+    G
Sbjct  432   VMVEETGKIYRNKAKEMSKLLGDXHRHHXYVSDFVEYLQKHRPCVQG  478



>gb|KDP29785.1| hypothetical protein JCGZ_18720 [Jatropha curcas]
Length=465

 Score =   494 bits (1271),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 237/466 (51%), Positives = 330/466 (71%), Gaps = 13/466 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH+ ++PWLAFGH+IPYL+++KHIA +GHK+SF+STPRNI RLPK+PPNL+S+I+F
Sbjct  3     ETKKLHVALFPWLAFGHIIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSKIHF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             + LPLP   NLP +AEAT+D+P +K  YLK+A D L++ + +FL+  +PDWI++DF ++W
Sbjct  63    ISLPLPQVDNLPPHAEATMDIPTNKTPYLKIAYDGLKDPLFQFLKISAPDWIIYDFAAHW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR----LVDF-AERTKAEDYTVPPKWIPFKTTVA  1094
             L P+ S LG+S+A  SIF+  T+ F       L++   ERT+ E +TVPPKW+PF + VA
Sbjct  123   LPPITSDLGISSAYLSIFSAWTITFLASSSSALINGDDERTRPEGFTVPPKWVPFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +R++E  R  +     D  +SD++RL + +   D++AVR C E +++ LKL E +H KPV
Sbjct  183   YRIHEAKRAFEHFEVNDSGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP +  D  GG + T   W  I  WLDKQ  G VIY+AFGSE++ +Q +L E+AL
Sbjct  243   LPIGLLPPSDLDVTGGDDET---WLKICGWLDKQNKGSVIYIAFGSESEVNQKDLNELAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR ++G +      LP+GFEER KGRGIV TSW PQL+IL HESVGGF
Sbjct  300   GLELSGLPFFWTLR-KQGNS----FELPDGFEERVKGRGIVWTSWVPQLRILGHESVGGF  354

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G+SS++EA+ F   L+L      QGLNARVLEEKK+G  V R+ +DG FT+E++AE
Sbjct  355   LTHCGFSSIIEALNFGLALILFPVSIAQGLNARVLEEKKLGVEVKRNAQDGSFTKESLAE  414

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             SL LV+  ++G +YRE   EM+ L  ++   +G +D  + +L  H+
Sbjct  415   SLMLVMDNEKGKLYRESANEMRKLITNRDVHNGCIDQFIEFLQTHR  460



>gb|KDP29780.1| hypothetical protein JCGZ_18715 [Jatropha curcas]
Length=471

 Score =   493 bits (1269),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 240/466 (52%), Positives = 321/466 (69%), Gaps = 12/466 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH+  +PWLAFGHMIP+LEL+KHIA +GHK+SF+STPRNI RLP +PPNL S INF
Sbjct  3     EPKKLHVAFFPWLAFGHMIPFLELAKHIAQKGHKISFISTPRNIRRLPIIPPNLTSNINF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             + L LP   NLP +AEATIDLP+ +V YLKLA D+L++ +  FL+  +P+W+++DF  YW
Sbjct  63    ISLSLPQVDNLPPDAEATIDLPFSQVPYLKLAYDSLKDPLLHFLKTSTPNWVIYDFFPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTVA  1094
             L  + + LG+S A FSI    T+  F   +         RT+ ED+TVPPKWIPF + VA
Sbjct  123   LPSILADLGISGAFFSIAGGWTITSFASPLSAMINGRDSRTRPEDFTVPPKWIPFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +RLYE  + +     ++   SD FRL + +  CDIVA+R C E ++++L+L+  +H KPV
Sbjct  183   YRLYEAKKTLRHHEVDNSGTSDGFRLSTVMAGCDIVAIRSCFELEADFLRLVGELHGKPV  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
             FPVG LP    D  G  +   D+W  I+ WLD+Q+ G V+Y+AFGSE   SQ E TE+AL
Sbjct  243   FPVGLLPQLTLDGNGDED---DTWLKIRDWLDEQKKGSVVYIAFGSEVDLSQQEFTELAL  299

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW +R R    D   + LP+GFEER KGRG+V TSW PQ +ILSHES+GGF
Sbjct  300   GLELSGLPFFWAIRKR----DDNKVELPDGFEERVKGRGLVWTSWVPQPRILSHESIGGF  355

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G+SS+++A+ F   L++L    D GL ARV E+KK+G  V R E DG FTR+ VA+
Sbjct  356   LTHCGYSSIIDALYFGCALIMLPIAFDHGLIARVFEDKKVGVEVTRHEDDGSFTRDLVAD  415

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             S+RLV+V++EG +YRE  KEM  LF D+  QD Y++  + +L   +
Sbjct  416   SVRLVMVDEEGKLYRENAKEMSKLFADKELQDRYINKFVVFLQTQR  461



>ref|XP_004288503.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   493 bits (1268),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 246/464 (53%), Positives = 319/464 (69%), Gaps = 9/464 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LHI ++PWLAFGH+IP+LE++KHIA RGHKVSF+STPRNI RLPK+P  L   I  V++
Sbjct  11    QLHIALFPWLAFGHIIPFLEVAKHIARRGHKVSFISTPRNIQRLPKIPETLTPLITLVQI  70

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  +NLP+NAEAT+D+PYD + YLKLA D L+  ++KFL+  +PDWI+HDF  +WL P
Sbjct  71    PLPHVENLPDNAEATMDVPYDVIPYLKLAHDGLERGLSKFLQAQTPDWIIHDFAPHWLPP  130

Query  1249  VASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A+KLGV+   FSIF   ++ FFG     R   +A R K E +TVPP+W+PF + +  R 
Sbjct  131   IATKLGVAIGHFSIFNASSLCFFGSTSADRASRYAPRKKLEHFTVPPEWVPFPSKLVMRP  190

Query  1084  YEILRII-DAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP-VF  911
             +E  RI+ D        V+D FR+IS V+ C +  +R C E + EWL LLE++HQKP V 
Sbjct  191   FEAARILEDGRKPNASGVNDWFRMISTVQGCQVYFIRTCREVEGEWLDLLEDLHQKPVVL  250

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P G LP     +    E  G  W  I  WLDKQE GKV+YVA GSE   SQ E  E+ALG
Sbjct  251   PTGLLPPFVPRSDEDEE-GGSDWSRIADWLDKQEKGKVVYVALGSELNLSQEEFNELALG  309

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR     +D + ++LP+GFEERTK RG+V  +W+PQ KIL+HES+GGFL
Sbjct  310   LELSGLPFFWVLRKPSHVSDGDSVNLPDGFEERTKDRGLVWKTWSPQPKILAHESIGGFL  369

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GWSS++EA+Q+ +PL+LL F+ DQGL AR   +KKIG  V RDE  G FTR  +A+S
Sbjct  370   THCGWSSLIEALQYGRPLILLPFMYDQGLIARFW-DKKIGIEVSRDEESGAFTRNELAKS  428

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             L LVVV++EG  YR+  KE   LF D+     Y+D  + YL  H
Sbjct  429   LNLVVVDEEGKPYRDGAKEYSELFGDKELHSRYMDKCVEYLETH  472



>ref|XP_009800982.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=489

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/476 (50%), Positives = 318/476 (67%), Gaps = 13/476 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH++M+PWLAFGH+IP+LELSK IA +GHK+SF+STP+NIDRLPKLP   ++ I FVK+
Sbjct  20    KLHVVMFPWLAFGHIIPFLELSKFIAQKGHKISFISTPKNIDRLPKLPLEFSNSITFVKI  79

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT+D+  +++ YLK A D +++ + KFLE+ SPDWI+ DF  YWLAP
Sbjct  80    PLPKVDGLPENAEATMDITTEEIIYLKKAMDGMEKEVTKFLEKNSPDWIIQDFAQYWLAP  139

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKA-----EDYTVPPKWIPFKTTVAFRL  1085
             +++KLG+S   + I     +AFFG   +            ED+ VPPKWIPF+T  A+R 
Sbjct  140   ISAKLGISRIFYCIINAWFIAFFGSTENMVNTNSGTPPTVEDFLVPPKWIPFETKAAYRR  199

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +E   ++ +  +    VSD++R    +   D    R C EF+ +WLKLLE++H  P+ P 
Sbjct  200   HEARWMVGSSQKNVSGVSDLYRNGVTMTGADATIFRHCYEFEGQWLKLLEDLHNIPMIPS  259

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G +P    +     E    SW  IK WLD++  G V+YVA GSE      ++ E+ALGLE
Sbjct  260   GLMPPMVKNID--DEKNNQSWMSIKEWLDEKPKGSVVYVALGSEVTIGLNDINELALGLE  317

Query  724   LSGFPFFWVLR--ARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LS  PFFWVLR  ++ G  DP  I LPEGFEER KGRGIV  SWAPQL ILSH+SVGGFL
Sbjct  318   LSRSPFFWVLRKPSKSGNTDP--IELPEGFEERIKGRGIVWKSWAPQLNILSHDSVGGFL  375

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GWSS++E + F  PL++L FL DQGLNAR+LE+K +G  +PR+E DG +T ++VA S
Sbjct  376   THCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEIPRNEEDGSYTSDSVANS  435

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             + LV+VE EG I REK KEM  +F ++   D Y++ L+ +L  H+  K   Q IS 
Sbjct  436   VNLVMVENEGKIIREKAKEMISIFGNKNLHDKYIENLIEFLENHR--KVSNQHISN  489



>gb|EYU30925.1| hypothetical protein MIMGU_mgv1a005472mg [Erythranthe guttata]
Length=482

 Score =   489 bits (1260),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 240/474 (51%), Positives = 325/474 (69%), Gaps = 8/474 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   LHI+M+PWLAFGH+IPYLELSK IA +GHK+SFVSTPRNIDRLPKLPP+L+S I  
Sbjct  7     EHKSLHIVMFPWLAFGHIIPYLELSKLIALKGHKISFVSTPRNIDRLPKLPPHLSSSIEL  66

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+PLP    LPENAEAT+D+   ++ YLK+A D L+  +  FLE+  PDWI+ DF  +W
Sbjct  67    VKIPLPKLDELPENAEATMDINGGQMDYLKIAFDGLESGLTSFLEDSDPDWIICDFAPHW  126

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
             L P+A++LG+S A F IF    +AFFG     ++  ++ RTK EDY VPPKW+ F+T VA
Sbjct  127   LPPIAARLGISRAFFLIFNAWFLAFFGPGAEDMISGSDYRTKREDYMVPPKWVEFETEVA  186

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +R +E   ++ +        SDI+R+   +  C+ +  R C EF+ +WL LLE +H++PV
Sbjct  187   YRGFEANWMVGSGQTNGSGYSDIYRVGKVIVGCEAILARHCHEFEPDWLTLLEELHRRPV  246

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
             FP+G +P      G   +   + W  IK WLD Q  G V+YVA GSE  PSQ +L+E+A 
Sbjct  247   FPLGLMPPRLPQDGKKDDSDEEIWVSIKKWLDVQNKGSVVYVALGSEVIPSQDQLSELAH  306

Query  733   GLELSGFPFFWVLRARRG--EADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             GLELSG PFFWVLR   G  E+D + + LP+GFEER  GRGIV  SW PQLKILSH+SVG
Sbjct  307   GLELSGVPFFWVLRKPSGLTESD-DSVELPDGFEERVNGRGIVWRSWVPQLKILSHDSVG  365

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
             GFLTH GWSS+VE + F  PL+ L FL DQGLN+RV+ EK++G  +PR+E +G +T  +V
Sbjct  366   GFLTHCGWSSIVEGLMFGHPLITLPFLVDQGLNSRVIAEKQVGVEIPRNEENGSYTSNSV  425

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGT  218
             A+S++LV++E +G  +RE+ KE+  +F D      Y+D  + +L  H+++   T
Sbjct  426   ADSVKLVMLENDGKRFRERAKEIGAIFGDTELHGRYIDNFIKFLGHHRNMSTNT  479



>ref|XP_010492649.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=469

 Score =   488 bits (1256),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 318/464 (69%), Gaps = 7/464 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRIN  1442
             +G+KLH+ M+PWLAFGH++P LELS  +  +GH VSF+STPRNIDRL P+LP NL+S IN
Sbjct  10    DGTKLHVAMFPWLAFGHLVPQLELSMLMVQKGHTVSFISTPRNIDRLLPRLPENLSSAIN  69

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVKLP   H+ LP +AEAT D+P+D V YLK+A D L+  + +FLE   PDW+L DF SY
Sbjct  70    FVKLPFAGHKKLPVDAEATTDVPFDLVPYLKIAFDGLRVPLTEFLESSKPDWLLQDFASY  129

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             WL P+AS+LG+  A F  F    +           RT  ED+   PKW+PFKT   F+LY
Sbjct  130   WLPPIASRLGIKNAYFGPFNSACLGIHKPPGYEEYRTSPEDFLTNPKWVPFKTPAPFQLY  189

Query  1081  EILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             EI  + + +  E  ++N+ D+ R+   +  C+I+ VR C+E+++EWL L +++H+KPV P
Sbjct  190   EIQNMFEGMMSESTEENIPDMERVAGVMSGCEIIVVRSCNEYEAEWLGLAQDLHRKPVIP  249

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             VG LP         +    D+W   K  LD +++  V+YV FG+EAKPSQ+E   IALGL
Sbjct  250   VGVLPPKL----DRNFKDTDAWLSAKKLLDSRKSKSVVYVTFGTEAKPSQSEFNTIALGL  305

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSG PFFWVL+ +RG+ D E + LPEGFEERT  RGIV   W  QL+ L+H+S+G   T
Sbjct  306   ELSGLPFFWVLKTQRGQWDTEPLELPEGFEERTAERGIVWRGWVEQLRTLNHDSIGLIFT  365

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             HSGW S++EA+ F KP+V+L+F+ DQG N RV EEKKIG  +PRD+  G FT+E VA+SL
Sbjct  366   HSGWGSMIEAVTFAKPMVMLSFVYDQGYNGRVAEEKKIGRMIPRDDTTGIFTKEDVAKSL  425

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             RLV+  +EG +YR+ +K+MKG+F D   QD YVD+ L YL  H+
Sbjct  426   RLVMDGEEGKVYRDNVKDMKGVFGDMDTQDRYVDSFLDYLVAHR  469



>emb|CDP01582.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/467 (51%), Positives = 318/467 (68%), Gaps = 16/467 (3%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++   LH++M+PWLAFGH IP+LELSK IA RGHKVSF+STP+NIDRLP++PP  AS I 
Sbjct  3     NKSGSLHVVMFPWLAFGHFIPFLELSKFIAQRGHKVSFISTPKNIDRLPRIPPEFASSIT  62

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVK+PLPP   LPEN EAT+DL    V  LK A D L+  + +FLE  +PDWI++DF  Y
Sbjct  63    FVKIPLPPVDGLPENVEATVDLGGLDVAVLKKAYDGLEPELTRFLEYSAPDWIIYDFAPY  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTV  1097
             W+ P+A+KL +S + F IF+  ++AFF R VD        RTK ED+TVPPKWIPF++ +
Sbjct  123   WIPPIAAKLNISKSFFCIFSAASMAFFVRSVDAMIAGTDPRTKVEDFTVPPKWIPFESKL  182

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             AF+LYE   ++     E   VSD +R+ S ++  D+  +R C EF+ +WLKLLE++ ++ 
Sbjct  183   AFKLYESRWVVQGQNLEGSGVSDSYRVGSAIKDADVTLIRYCPEFEGQWLKLLEDLLKRH  242

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V P+G +P     +        +SW  IK WLD Q  G V+YVA GSE   +Q +L+E+A
Sbjct  243   VIPLGLMPPPVEKS---IVENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELA  299

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLELSG PFFW LR   G        LPEGFE+R KGRGIV  +WAPQL +LSH+SVGG
Sbjct  300   LGLELSGVPFFWALRNPSG--------LPEGFEDRVKGRGIVWKNWAPQLNVLSHDSVGG  351

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH GWSS +E + F  PL++L F+AD GL AR+LEEK++G  +PR++ DG +T  +VA
Sbjct  352   FLTHCGWSSSIEGLMFGHPLIMLPFVADTGLIARMLEEKQVGIEIPRNDVDGSYTSHSVA  411

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              S+RL++VE EG I+++K KE+  +F DQ   D Y+   + YL   +
Sbjct  412   NSVRLIMVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYLENKR  458



>ref|XP_010506987.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=469

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/469 (51%), Positives = 323/469 (69%), Gaps = 13/469 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             + +G KLH+ M+PWLAFGH++P+LELS  +  +GH VSF+STP NI+RL P+LP NL+S 
Sbjct  8     NGDGPKLHVAMFPWLAFGHLVPHLELSMLMVQKGHNVSFISTPGNIERLLPRLPENLSSA  67

Query  1447  INFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFD  1268
             INFVKLP   H+ LP+ AEAT D+P+D V YLK+A D L+  +A+FLE   PDW+L DF 
Sbjct  68    INFVKLPFAGHKELPDAAEATTDVPFDLVPYLKIAFDGLRTPLAEFLESSKPDWLLQDFA  127

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFGRLV--DFAE-RTKAEDYTVPPKWIPFKTTV  1097
              YWL P+AS+LG+  A F  F       FG L    F E R   ED+ + PKW+PF+T V
Sbjct  128   PYWLPPIASRLGIKNAYFGAFN---CGIFGILKPPGFEEYRKSPEDFVLQPKWVPFETPV  184

Query  1096  AFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
              F+L+E   I +    E  + N+ D  R+   ++ CDI+ +R C E+++EWL+LL+++H+
Sbjct  185   FFQLFESKAIFNGAVVESTEGNIPDFDRIAGVLDGCDIIVIRSCYEYEAEWLELLQDLHR  244

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +         D+W   K WLD + T  V+YV+FG+EAKPSQ+E   
Sbjct  245   KPVIPVGVLPPKLDETF----KDTDAWLSTKKWLDSRGTNSVVYVSFGTEAKPSQSEFNS  300

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELSG PFFWVLR RRG  D E + LPEGFEERT  RG+V   W  QL+ L+H+S+
Sbjct  301   IALGLELSGLPFFWVLRTRRGPFDTEPLELPEGFEERTADRGMVWRGWVEQLRTLNHDSI  360

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G  L+HSGW++++EA++F KP+V++ F+  QG NARV EEKKIG+ + RDE  G FT+E 
Sbjct  361   GLVLSHSGWNTLIEAVRFAKPMVMIGFVYGQGFNARVAEEKKIGHMILRDETTGSFTKED  420

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA++LRLV+  +EG +YRE +K+MKG+F D   QD YVD+ L YL  H+
Sbjct  421   VAQALRLVMEGEEGKVYRESVKDMKGVFGDMETQDRYVDSFLDYLVAHR  469



>gb|KDP29791.1| hypothetical protein JCGZ_18726 [Jatropha curcas]
Length=465

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 237/466 (51%), Positives = 319/466 (68%), Gaps = 12/466 (3%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             +E  KLHI+++PWLAFGH+IP+LEL+K +A RGHK+SF+STP+NI RLPK+PPNLA+ ++
Sbjct  2     NEPKKLHIVLFPWLAFGHIIPFLELAKLLAKRGHKISFISTPKNIQRLPKIPPNLANLVH  61

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
              V L LP   +LP N+EAT D+P  KV YLK A D LQ  + +FLE  +PDWI++DF  +
Sbjct  62    LVTLTLPSEDHLPPNSEATTDIPTHKVPYLKKAYDNLQCPLLQFLETSTPDWIIYDFAPF  121

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE----RTKAEDYTVPPKWIPFKTTVA  1094
             WL  + + LG+S+A FSI+   ++ FFG           RT+ ED+TVPPKW+PF + VA
Sbjct  122   WLPRITADLGISSAFFSIYGGWSLTFFGSSSAMINGDDLRTQPEDFTVPPKWVPFPSKVA  181

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FRL+E  + +  V   D   SD+FRL S +  CD++A+R C E + ++L+L+E +H KP 
Sbjct  182   FRLHEAKKALSHVQVNDSGCSDMFRLGSVMAGCDVIAIRSCFELEGDFLRLVEQLHGKPT  241

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P G LP +  D  G  + T   W+ I  WL+ Q  G V+Y+AFGSE + SQ ELTE+A 
Sbjct  242   LPTGLLPPSDPDVNGEEDET---WRIISQWLNSQNKGSVVYIAFGSEVEVSQQELTELAF  298

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR +        + LP  FEER +GRG+V  +W PQL+ILSHESVGG 
Sbjct  299   GLELSGLPFFWTLRIKDNS-----LGLPNEFEERVQGRGLVWKTWVPQLRILSHESVGGI  353

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G+SS++EA+ F + L++L    DQGL ARV EEKK+G  + RDE+DG FTR++VAE
Sbjct  354   LTHCGYSSIIEALYFGRALIMLPIALDQGLIARVFEEKKVGVEITRDEQDGSFTRDSVAE  413

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             SLRLV+V+KEG  YR+  KEM+ L  D+   D YVD  +  L  H+
Sbjct  414   SLRLVMVDKEGKEYRDAAKEMRELLADKDLHDRYVDRFVELLQHHR  459



>ref|XP_011001966.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=435

 Score =   485 bits (1249),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 297/422 (70%), Gaps = 11/422 (3%)
 Frame = -2

Query  1468  PPNLASRI----NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEE  1301
             PP    R        K  + P +    +AEATIDLP +KV+YLK+A D +QE  AK LE 
Sbjct  11    PPKTTCRCIVYSTLRKAAVAPSRGSTPDAEATIDLPANKVQYLKIALDKVQEPFAKVLES  70

Query  1300  FSPDWILHDFDSYWLAPVASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYT  1133
               PDWI +DF  YW  P+A++LG+ +  FSI     VAF G    L+D  + R K ED+ 
Sbjct  71    LDPDWIFYDFAQYWTGPIAAQLGIKSTYFSICIAAMVAFIGPPSPLIDGDDYRKKPEDFM  130

Query  1132  VPPKWIPFKTTVAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSE  953
             +PPKW+ F+TTVA++ Y+I+   D V ++   V+D+ R    ++ CD +AVR   E + E
Sbjct  131   IPPKWVSFQTTVAYKYYDIINTFDCVEDDASGVNDLMRWGLCLQSCDFIAVRSSFEIEPE  190

Query  952   WLKLLENIHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSE  773
             WL +LE IH+KPVFPVGQLP   Y      E   D+W  +K WLD QE   V+YVAFGSE
Sbjct  191   WLHVLETIHEKPVFPVGQLPPVEY---ALEEKNSDAWSSMKKWLDMQEKSSVVYVAFGSE  247

Query  772   AKPSQTELTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAP  593
             AKP+Q +LTE+ALGLELSG PFFWVLR RRG AD +LI LP GFEERTKG+G+VCT+WAP
Sbjct  248   AKPTQAQLTELALGLELSGLPFFWVLRTRRGIADTDLIELPPGFEERTKGQGVVCTTWAP  307

Query  592   QLKILSHESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRD  413
             QL IL+HES+ GFLTHSGWSSVVEA+ F+K L+LLTF +DQG+NARVLEEKKIGYS+PR+
Sbjct  308   QLMILAHESIAGFLTHSGWSSVVEALTFQKALILLTFYSDQGINARVLEEKKIGYSIPRN  367

Query  412   ERDGRFTREAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             E DG FTR++VAESLRLV+V +EG IYR+  KEM GLF D  RQD YVD +L YL   + 
Sbjct  368   ELDGSFTRDSVAESLRLVMVSEEGKIYRDMAKEMSGLFGDTDRQDRYVDNILIYLKSQRP  427

Query  232   IK  227
             +K
Sbjct  428   VK  429



>ref|XP_004240255.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=469

 Score =   486 bits (1251),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 231/472 (49%), Positives = 321/472 (68%), Gaps = 10/472 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             +KLHI+M+PWLAFGH+IPYLELSK IA +GHK+SF+STPRNIDRLPKLP   ++ I  VK
Sbjct  3     NKLHIVMFPWLAFGHIIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPLEYSTSITLVK  62

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP    LPENAEAT+D+    + YLK A D ++  +  FLE+ SPDWI+HDF  YWLA
Sbjct  63    IPLPHVDGLPENAEATMDIHTKDIVYLKKALDGMELQLTSFLEKTSPDWIIHDFAPYWLA  122

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKA-EDYTVPPKWIPFKTTVAFR  1088
             P+ ++L ++   F +     +AF+G     L  + +     ED  V PKWIPF+T   FR
Sbjct  123   PITTRLRIARGFFRVINAWFLAFWGSTDMMLTGYTDPPPTPEDLMVMPKWIPFETKAVFR  182

Query  1087  LYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
              +E   ++DA+ +    VSDI+R  + ++  D+V +R C EF+ +WLKLLE++H +P+ P
Sbjct  183   HHEAKWVVDAMQKNVSGVSDIYRAGATIKDVDVVIIRHCYEFEGQWLKLLEDLHHRPIVP  242

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             VG +P +  ++         +W  IK WLD+Q  G V+YVA GSE      E+ E+A GL
Sbjct  243   VGLMPPSLDNSD-----NNGTWTCIKGWLDEQTKGSVVYVALGSEVTIGPREINELAYGL  297

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSG PFFWVLR        + + LP+GFEERT GRGIV  SW PQLKILSH+SVGGFLT
Sbjct  298   ELSGVPFFWVLRKLSNSGHMDYVELPDGFEERTHGRGIVWKSWVPQLKILSHKSVGGFLT  357

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GWSS++E + F  PL++L FL DQGLNARVLE+K+IG  +PR+E DG +TR++V+ S+
Sbjct  358   HCGWSSIIEGLMFGHPLIMLPFLVDQGLNARVLEDKEIGIEIPRNEEDGSYTRDSVSSSV  417

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQT  212
             +LV+VEK+G   RE+ +E+  ++ ++   D Y++ L+ +L  H+ + YG  +
Sbjct  418   KLVMVEKDGRRIREEAREISSIYGNKRLHDKYIEDLIQFLEDHRKMSYGHSS  469



>ref|XP_010518639.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=469

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 323/469 (69%), Gaps = 13/469 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             + +G+KLH+ M+PWLAFGH++P+LELS  +  +GH VSF+STP NIDRL P+LP NL+S 
Sbjct  8     NGDGTKLHVAMFPWLAFGHLVPHLELSILMVQKGHNVSFISTPGNIDRLLPRLPENLSSA  67

Query  1447  INFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFD  1268
             INFVKLP   H+ LP +AEAT D+P+D V YLK+A D L+  + +FLE   PDW+L DF 
Sbjct  68    INFVKLPFAGHKKLPVDAEATTDVPFDLVPYLKIAFDGLRVPLTEFLESLKPDWLLQDFA  127

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFGRLV--DFAE-RTKAEDYTVPPKWIPFKTTV  1097
              YWL P+A +LG+  A F  F       FG L    F E R   ED+   PKW+PF+T V
Sbjct  128   PYWLPPIARRLGIKNAYFGAFN---CGIFGILKPPGFEEYRKSPEDFVTKPKWVPFETPV  184

Query  1096  AFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
              F+L+E   I +    E  + N+ D+ R+   ++ CDI+ +R C+E+++EWL+LL+++H+
Sbjct  185   FFQLFESKAIFNGAVVESTEGNIPDLDRIAGVLDGCDIIVIRSCNEYETEWLELLQDLHR  244

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +         D+W   K WLD ++T  V+YV+FG+EAKPSQ+E   
Sbjct  245   KPVIPVGVLPPKLDETF----KDTDAWLSTKKWLDSRKTNSVVYVSFGTEAKPSQSEFNS  300

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IALGLELSG PFFW LR RRG  D E + LPEGFEERT  RG+V   W  QL+ L+H+S+
Sbjct  301   IALGLELSGLPFFWALRTRRGPWDSEPLELPEGFEERTADRGMVWRGWVEQLRTLNHDSI  360

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G  L+HSGW++++EA++F KP+V++ F+  QG NARV EEKKIG+ + R+E  G FT+E 
Sbjct  361   GLVLSHSGWNTLIEAVRFAKPMVMIGFVYGQGFNARVAEEKKIGHMILREETTGSFTKED  420

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA++LRLV+  +EG +YRE +K+MKG+F D   QD YVD+ L YL  H+
Sbjct  421   VAQALRLVMEGEEGKVYRESVKDMKGVFGDMETQDRYVDSFLDYLVTHR  469



>ref|XP_006360400.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=471

 Score =   485 bits (1248),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/470 (49%), Positives = 320/470 (68%), Gaps = 10/470 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             +KLHI+M+PWLAFGH+IPYLELSK IA +GHK+SF+STPRNIDRLPKLP   ++ I  VK
Sbjct  7     NKLHIVMFPWLAFGHIIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPLEYSTSITLVK  66

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP    LPENAEAT+D+    + YLK A D ++  +  FLE+ SPDW++HDF  YWLA
Sbjct  67    IPLPHVDGLPENAEATMDIHTKDIVYLKKALDGMELELTSFLEKTSPDWVIHDFAPYWLA  126

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKA-----EDYTVPPKWIPFKTTVAFR  1088
             P+ ++L +S   F +     +AF G        +       ED+ V PKWIPF+T VAFR
Sbjct  127   PITTRLRISRGFFRVVNAWFLAFGGSTDMMLTGSSNPPPTPEDFMVTPKWIPFETKVAFR  186

Query  1087  LYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
              +E   ++DA+ +    VSDI+R  + ++  D+V +R C EF+S+WLKLLE+++ +P+ P
Sbjct  187   HHEAKWVVDAMQKNVSGVSDIYRSGATIKDVDVVIIRHCCEFESQWLKLLEDLYHRPIVP  246

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             VG +P +  ++         +W  IK WLD+Q  G V+YVA GSE     +E+ E+A GL
Sbjct  247   VGLMPPSLDNSD-----NNGTWTCIKEWLDEQTKGSVVYVALGSEVTIGPSEINELAYGL  301

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSG  FFW LR R    + + + LP+GFEER  GRGIV  SW PQLK+LSHESVGGFLT
Sbjct  302   ELSGVAFFWALRKRPYSGNMDYVELPDGFEERIHGRGIVWKSWVPQLKLLSHESVGGFLT  361

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GWSS++E + F  PL++L FL DQGLNAR+LE+K+IG  +PR+E DG +TR++V+ S+
Sbjct  362   HCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKEIGIEIPRNEEDGSYTRDSVSSSV  421

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGT  218
             +LV+VEK+G   REK KE+  +F ++   D Y++ L+ +L  H+ +  G 
Sbjct  422   KLVMVEKDGRKIREKAKEISSIFGNRRLHDKYIEDLIQFLEDHRKMANGA  471



>ref|XP_004250157.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=474

 Score =   484 bits (1247),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 316/464 (68%), Gaps = 9/464 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH+IP+LELSK +A +GHK+SF+STPRNIDRLPK+P   ++ I FVK+
Sbjct  11    KLHIVMFPWLAFGHIIPFLELSKFLALKGHKISFISTPRNIDRLPKIPSEFSNSITFVKI  70

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LP++AEAT+D+  +++ YLK A D ++  +  FLE   PDWI+ DF  YWLAP
Sbjct  71    PLPKIDGLPKDAEATMDITSEEMTYLKKAMDGMENEVTNFLENNCPDWIIQDFAQYWLAP  130

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERT------KAEDYTVPPKWIPFKTTVAFR  1088
             ++++LG+S   +SI     ++F G   +           K ED+ VPPKWIPF+T   +R
Sbjct  131   ISTRLGISRIFYSIINAWFLSFLGSFENMINTNNCTSPPKLEDFLVPPKWIPFETKATYR  190

Query  1087  LYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             L+E   ++++  +    VSD++R    +E  D + +R C EF+ +WLKLLE++H  PV P
Sbjct  191   LHEARWMVESSQKNVSGVSDMYRNGVTIEGADAIIIRHCHEFEGQWLKLLEDLHHMPVLP  250

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
              G +P     +   HE   +SW  IK WLD++  G V+YVA GSE    Q E+ E+A GL
Sbjct  251   TGLMPPIVESSS--HE-KNESWISIKEWLDEKPKGSVVYVALGSEVTVGQNEINELARGL  307

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSG PFFWVLR   G    + I LP+GFEERTK RGIV  SWAPQLKILSHESVGGFLT
Sbjct  308   ELSGSPFFWVLRKSSGLGSIDPIVLPDGFEERTKDRGIVWKSWAPQLKILSHESVGGFLT  367

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GWSS++E + F   L++L FL DQGLNAR++E+K +G  VPR+E DG +T  +VA S+
Sbjct  368   HCGWSSIIEGLMFGHSLIMLPFLVDQGLNARIIEDKGVGIEVPRNEEDGSYTSNSVANSV  427

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +LV+V+ +G + REK KE+  +F ++   D Y++ L+++L  +K
Sbjct  428   KLVMVKNDGKLIREKAKELSSIFSNKELHDKYIENLINFLEDYK  471



>ref|XP_002270369.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=464

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/462 (53%), Positives = 306/462 (66%), Gaps = 15/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA  GH +SF+STPRNIDRLPKLP NL   I+ VK 
Sbjct  6     KLHIVMFPWLAFGHILPYLELSKLIAREGHLISFISTPRNIDRLPKLPLNLQPLIDLVKF  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY+K+ YLK A D LQE + +FLE   PDW++HDF  +WL P
Sbjct  66    PLPNIDNLPENAEATTDLPYEKIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFTPHWLPP  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE----RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +A+K GVS A F   +  T+ F G      E    RT+       P W+ F T VA  L+
Sbjct  126   IAAKHGVSRAFFCTSSATTLCFCGPTSIMMEGGDPRTELHQLATAPPWVTFPTKVASPLF  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
              + RI+     +   VSD FR+ S +  CD++A+R C+E + EWL LL  +HQKP+FP+G
Sbjct  186   LLRRILGIHQADVSGVSDKFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLFPIG  245

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +A   G       DSW  I+ WLDKQE   V+YVA G+E  P++ ELTE+A GLEL
Sbjct  246   LLPPSAPVNG-----DDDSWPPIREWLDKQEKECVVYVALGTEVTPTEDELTELAFGLEL  300

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR R    D     LP+GFEERTKGRG+V  +WAPQL+IL HESVGGF+ H 
Sbjct  301   SGLPFFWALRKRHDSVD-----LPDGFEERTKGRGMVWRTWAPQLRILDHESVGGFVIHC  355

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSV+E + F + L +L    DQGLNAR  EE K+G  +PRD+ +G  +R++VAE+L L
Sbjct  356   GWSSVIEGLHFGQALTMLPLWGDQGLNARTFEEMKVGVEIPRDQEEGWLSRKSVAETLSL  415

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V+VE+ G IYR K KEM+ L  D+ R   YV     YL  H+
Sbjct  416   VMVEEAGKIYRNKAKEMRKLL-DKHRHHRYVTDFAEYLQKHR  456



>gb|KDP29789.1| hypothetical protein JCGZ_18724 [Jatropha curcas]
Length=473

 Score =   481 bits (1239),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 237/469 (51%), Positives = 326/469 (70%), Gaps = 15/469 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  +LH+  +PWLAFGHMIP+LEL+K IA +GHK+SF+STPRNI RLPK+PPNL+S INF
Sbjct  3     EPKRLHVAFFPWLAFGHMIPFLELAKRIAQKGHKISFLSTPRNIQRLPKIPPNLSSNINF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             + LPLP   NLP +AEATIDLP+DK++YL++A D+L++ + +FLE  +P+W+++D   YW
Sbjct  63    ISLPLPQVDNLPPDAEATIDLPFDKIRYLRMAYDSLKDPLVQFLETSTPNWVIYDCFPYW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR----LVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
             L P+ + LG+S+A FSIF   T+ F+      ++D  + R   ED+TVPPKWIPF + VA
Sbjct  123   LPPILADLGISSAFFSIFGGWTLTFWASPSLAMIDGDDSRFHPEDFTVPPKWIPFPSKVA  182

Query  1093  FRLYEILRIIDAVTEEDDNV-SDIFR--LISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             +RL+E  RI      +   +   IFR  + S +   DI+A+R C E ++++L+L+  +H 
Sbjct  183   YRLHEAKRIPHRFEVDKSGIPKHIFRSSVSSVMASSDIIAIRSCFELEADFLRLVRELHG  242

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPVFPVG LP    D  G  +   D+W  I+ WLDKQE G V+Y+AFGSE   SQ E TE
Sbjct  243   KPVFPVGLLPPLTLDGNGDED---DTWLKIRDWLDKQEKGSVVYIAFGSEVDLSQNEFTE  299

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             +ALGLELSG PFFW  R R   +      LP+GFEER +GRG+  TSW PQ +ILSHESV
Sbjct  300   LALGLELSGLPFFWASRKRNDYS----AELPDGFEERVEGRGMFWTSWVPQPRILSHESV  355

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GGFLTH G+SS+++A+   + L++L    D GL ARV E+KK+G  + RDE DG +TR++
Sbjct  356   GGFLTHCGFSSIIDALYSGRALIMLPITFDHGLIARVFEDKKVGVEITRDEEDGSYTRDS  415

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VA+S++LV+VE+EG +YRE  KEM  LF ++   D Y+D  +  L  H+
Sbjct  416   VADSVKLVMVEEEGKLYRENAKEMSKLFANKELHDRYIDQFVELLQTHR  464



>emb|CDP21083.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   481 bits (1237),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 325/473 (69%), Gaps = 18/473 (4%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++   LH++M+PWLAFGH IP+LELSK IA +GHKVSF+STP+NIDRLPKLPPNLAS I 
Sbjct  3     NKSGSLHVVMFPWLAFGHFIPFLELSKFIAQKGHKVSFISTPKNIDRLPKLPPNLASSIT  62

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             F+K+PLPP   LPEN EAT+DL    V +LK A D  +  + +FLE+ +PDWI++DF  Y
Sbjct  63    FIKIPLPPVDGLPENVEATVDLGGLDVAFLKKAYDGFEPDLTRFLEDSAPDWIIYDFAPY  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTV  1097
             WL P+A+KL ++ + FSI +  TV FFG   D        R+K EDY VPPKWIPF++ V
Sbjct  123   WLPPIAAKLNIARSFFSIVSASTVVFFGPSFDAMINGTDPRSKVEDYIVPPKWIPFESKV  182

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             A++LYE   I+ A   +    SD++R+ S ++  D+V VR C EF+ +WL LLEN+ ++P
Sbjct  183   AYKLYESKWIVGASNLDGSGASDMYRVGSVIKGADVVLVRHCREFEGQWLNLLENLQRRP  242

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V P+G +P     +G     + +SW  IK WLD Q  G V+YVAFGSE   SQ EL E+A
Sbjct  243   VMPLGLMPPKVEKSG---LESNESWIAIKKWLDGQGKGSVVYVAFGSEVSMSQLELGELA  299

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLELSG PFFW LR   G        LPEGFE+R +GRGIV  +WAPQL ILSH+SVGG
Sbjct  300   LGLELSGVPFFWALRNPSG--------LPEGFEDRVEGRGIVWKNWAPQLNILSHDSVGG  351

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH GWSS +E +    PL++L F+ D GL AR+LEEK++G  +PR+  DG +TR++VA
Sbjct  352   FLTHCGWSSSIEGLMLGHPLIMLPFVIDTGLVARILEEKQVGIEIPRNPVDGSYTRDSVA  411

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGT  218
             +S+RL++ E EG  YR+K KE+  +F D+   DGY+   + YL   K+++  T
Sbjct  412   KSVRLIMEEDEGKSYRDKAKEISAVFGDRELHDGYLQRFVDYL--EKNVRKST  462



>ref|XP_006292848.1| hypothetical protein CARUB_v10019108mg [Capsella rubella]
 gb|EOA25746.1| hypothetical protein CARUB_v10019108mg [Capsella rubella]
Length=472

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 318/465 (68%), Gaps = 9/465 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRIN  1442
             +G+K+H+ M+PWLAFGH +PYLELSK +  +GH VSF+STPRNIDRL P+LP +++S IN
Sbjct  11    DGTKIHVAMFPWLAFGHFVPYLELSKLMVQKGHTVSFISTPRNIDRLLPRLPEDVSSAIN  70

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FVKLP P H  LPE+AEATID+P     YLK+A D LQ  + +FLE   PDW+L DF  Y
Sbjct  71    FVKLPFPGHNKLPEDAEATIDVPLHLGSYLKIAFDGLQVPLTEFLESSKPDWLLQDFAPY  130

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRL  1085
             WL P+AS+LG+  A FS +     A   +   F E RT  ED+   PKW+PF+T    + 
Sbjct  131   WLPPIASRLGIKNAYFSAYNCACFAIH-KPPGFEEYRTSPEDFLTSPKWVPFETPAFCQQ  189

Query  1084  YEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             +E   I +    E  + +++D+ R+   +  CDI  VR  +E+++EW  L++ ++ KPV 
Sbjct  190   FESKFIFNGFMLESSEGDIADVDRIAGVLNGCDIFVVRSSNEYEAEWFTLVQQLYGKPVI  249

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP    +         D+W   K WLD +ET  V+YV+FG+EAKPSQTEL  IALG
Sbjct  250   PVGVLPPKPEEKFKD----TDTWLATKKWLDSRETNSVVYVSFGTEAKPSQTELNAIALG  305

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR +RG  D E + LPEGFEERT  RG+V   W  QL+ LSH+S+G  L
Sbjct  306   LELSGLPFFWVLRTQRGPWDTEPLELPEGFEERTADRGMVWRGWVEQLRTLSHDSIGLVL  365

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             +HSGWS+++EA++F KP+V+L+F+ DQG N RV+EEKKIG  + RD+  G FT+E V +S
Sbjct  366   SHSGWSTIIEAVRFAKPMVMLSFVYDQGFNLRVVEEKKIGRMILRDDTTGSFTKEDVTKS  425

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             LRLV+ E+EG +YRE +K+MK +F D  +QD YVD+ L YL  H+
Sbjct  426   LRLVMDEEEGKVYRENVKDMKKVFGDMEQQDRYVDSFLDYLVAHR  470



>ref|XP_006353159.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=484

 Score =   480 bits (1235),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 230/468 (49%), Positives = 322/468 (69%), Gaps = 10/468 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH+IP+LELSK IA +GHK+SF+STPRNIDRLPK+P   ++ I FVK+
Sbjct  19    KLHIVMFPWLAFGHIIPFLELSKFIARKGHKISFISTPRNIDRLPKIPSEFSNSITFVKI  78

Query  1429  PLPPHQNLPENAEATIDL-PYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             PLP    LP++AEATID+   +++ YLK A D +++ +  FLE+  PDWI+ DF  YWLA
Sbjct  79    PLPKIDGLPKDAEATIDIITSEEMTYLKKAMDGMEKDVTNFLEKNCPDWIIQDFAQYWLA  138

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERT---KAEDYTVPPKWIPFKTTVAF  1091
             P+++KLG+S   +SIF    ++F G   ++++    T   K ED+ VPPKWIPF+T  A+
Sbjct  139   PISAKLGISRIFYSIFNAWFISFHGSFEKMINTNNCTSPPKLEDFLVPPKWIPFETKAAY  198

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RL+E   ++ +  +    VSD++R    +   D + VR C EF+ +WLKLLE++H  PV 
Sbjct  199   RLHEARWMVGSSQKNVSGVSDVYRCGVTIRGSDAIIVRHCHEFEGQWLKLLEDLHHIPVL  258

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P G +P     +    +   +SW  IK WLD++  G ++YVA GSE     +E+ E+A G
Sbjct  259   PTGLMPPLVESSS---DEKNESWISIKEWLDEKPKGSIVYVALGSEVTVGPSEINELAHG  315

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR   G  + + I L +GFEERTKG+GIV  SWAPQ+KILSH+SVGGFL
Sbjct  316   LELSGSPFFWVLRKPSGVENIDPIVLLDGFEERTKGQGIVWKSWAPQMKILSHKSVGGFL  375

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GWSS +E + F  PL++L FL DQGLNAR+LE+K +G  VPR+E +G +T  +VA S
Sbjct  376   THCGWSSTIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEVPRNEENGSYTSNSVANS  435

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             ++LV+V  +G + REK KEM+ +F ++   D Y++ L+ +L  H  +K
Sbjct  436   VKLVMVGNDGKLIREKAKEMRAIFGNKELHDRYIENLIKFLENHMKVK  483



>ref|XP_009364807.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Pyrus 
x bretschneideri]
Length=476

 Score =   479 bits (1232),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 232/464 (50%), Positives = 311/464 (67%), Gaps = 11/464 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI ++PWLAFGH+IP LE++KHIA RGHKVSF+STPRNI RLPK+PPNL   I+ V++P
Sbjct  16    LHIALFPWLAFGHIIPALEVAKHIAQRGHKVSFISTPRNIQRLPKIPPNLTPLIDLVQIP  75

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  +NLPENAEAT+D+PYD + YLKLA D L++ +  FL+  +PDWI++DF  YWL P+
Sbjct  76    LPRVENLPENAEATMDVPYDLIPYLKLAHDGLEQGITSFLQTHTPDWIIYDFAPYWLPPI  135

Query  1246  ASKLGVSTALFSIFTPPTVAFFGR-----LVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             AS LG+S A+F  F   T   FG      L  ++ RT  E +TVPP+WIPF + + FRL+
Sbjct  136   ASNLGISRAMFGGFNTYTGCAFGPTLPDVLSRYSPRTLPEHFTVPPEWIPFPSKLFFRLF  195

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E  ++ DA+      +SD FR+ S +E   +   R C E +  WL L+  +++KP  PVG
Sbjct  196   EAKKLFDALEHNASGISDWFRMKSAIEGSQVCLFRSCREIEGAWLDLVPELYRKPAIPVG  255

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +  D     +    SW  +  WLDKQE   V+YVA GSE  P+Q E TE+ALGLEL
Sbjct  256   LLPPSVQDT---EDKEDSSWSIVCQWLDKQERATVVYVALGSEINPTQEEFTELALGLEL  312

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR   G      + LP+ FE+R+KGRG+V  +WAPQ +IL+H++VGGFLTH 
Sbjct  313   SGLPFFWALRTPNGSTPGNSVKLPDEFEDRSKGRGLVWRTWAPQRQILAHKAVGGFLTHC  372

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSS++E +    PL++  FL DQGLNAR L ++K+G  VPR++ DG FT+ AVAESL L
Sbjct  373   GWSSLIEGLHCGIPLIMFPFLYDQGLNAR-LWDRKVGIEVPRNDEDGSFTKNAVAESLNL  431

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL--HCHK  236
             V+V++EG  YR+  KE   +  D+   D Y+D  + Y   + HK
Sbjct  432   VMVDEEGKAYRDGTKEYSAVIGDKDLHDRYMDKCVEYFEKNVHK  475



>ref|XP_010646446.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Vitis vinifera]
Length=462

 Score =   478 bits (1229),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 236/462 (51%), Positives = 308/462 (67%), Gaps = 14/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYL+LSK IA +GH++SF+STPRNIDRLPKLPP L   IN +KL
Sbjct  6     KLHIVMFPWLAFGHILPYLQLSKLIAQKGHRISFISTPRNIDRLPKLPPILQPLINLIKL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY+K  YLK A D LQE +  FL    PDW++HDF  +WL P
Sbjct  66    PLPKVDNLPENAEATTDLPYEKTPYLKKAFDGLQEPLTHFLINSHPDWVVHDFAPHWLPP  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             V  + GVS + FSI+   T+ F G     L     R +   + VPP W+PF + +    +
Sbjct  126   VLDEHGVSRSFFSIYGASTLCFAGSTSIMLGSGDPRKELHQFAVPPPWVPFPSNLGLPPF  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             ++ RI+         VSD +R+ S +  CD+VAVR C+E +SEWL LL  ++ KPV P+G
Sbjct  186   QMKRILGYDQPNLSGVSDSYRMGSVISACDVVAVRSCAELESEWLDLLRELYHKPVLPIG  245

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP  A  +G       DSW  I  WLDKQE   V+YVA GSEA P + ELTE+ALGLEL
Sbjct  246   LLPPLAPVSG-----EDDSWIPILEWLDKQEKASVVYVALGSEATPREDELTELALGLEL  300

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR R      + + LP+GFE+RTK RG+V  +WAPQL+IL HESVGGF+TH 
Sbjct  301   SGLPFFWALRKRH-----DSVELPDGFEDRTKDRGVVWRTWAPQLRILGHESVGGFVTHC  355

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             G SSV E + F + L++     DQG+ A+  +E K+G  +PRDE +G F+ ++VA++L L
Sbjct  356   GLSSVXEGLYFGRALIMFPLWGDQGIIAKAFQEMKVGIEIPRDEEEGWFSSKSVAQTLSL  415

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V+VE+EG IYREK KE+  LF D+  Q  Y++  + YL  H+
Sbjct  416   VMVEEEGRIYREKAKELSKLFGDKDLQQRYINDFVEYLQNHR  457



>ref|XP_004289519.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=480

 Score =   478 bits (1231),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 238/470 (51%), Positives = 317/470 (67%), Gaps = 14/470 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI ++PWLAFGHMIP+LE++KHIA RGHKVSF+STPRNI RL K+P NL   I  V++
Sbjct  11    KLHIGLFPWLAFGHMIPFLEVAKHIARRGHKVSFISTPRNIQRLSKIPQNLTPLITLVQI  70

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  +NLPE AEAT+D+P D + YLK+A D L+  +++FL+  +PDWI++DF  YWL P
Sbjct  71    PLPRVENLPEYAEATMDVPIDVIPYLKIAHDGLENGISEFLQTHAPDWIIYDFAPYWLPP  130

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLV-----DFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A KLG+  A+F  F   T+ F G         +A RTK E YTVPP+W PF + + F+ 
Sbjct  131   IAIKLGIKRAIFCTFNASTMCFLGSTAPEVTSRYAPRTKPEQYTVPPEWFPFPSKLCFKP  190

Query  1084  YEILRIIDA-VTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             +E  R++D  +T     ++D FR+ S  + C +  +R C E + EWL LL++++QKPV P
Sbjct  191   FEAKRVVDGLMTPNASGMTDWFRVESTYQGCQVYFIRSCREIEGEWLDLLQDLNQKPVVP  250

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
              G LP     +    +   +SW  I  WLDKQ+ G+V+YVAFGSE   SQ E  E+ALGL
Sbjct  251   TGLLPPPVQTS--DEDQHDNSWSRIAEWLDKQKKGEVVYVAFGSEINLSQEEFNELALGL  308

Query  727   ELSGFPFFWVLRA---RRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             EL G PFFWVLR    R G+ D   + LP+GFE+RT GRG+V T+WAPQ KIL+HESVGG
Sbjct  309   ELCGLPFFWVLRKPSHRSGDGD--TVKLPDGFEDRTNGRGLVWTTWAPQQKILAHESVGG  366

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FL+H GWSS++EA+Q+ +PL++L F+ DQGL AR L  KK G  V RDE  G FTR+ +A
Sbjct  367   FLSHCGWSSLIEALQYGRPLIMLPFMYDQGLIAR-LWNKKTGIEVSRDEESGWFTRDELA  425

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
              S+ LVVV +EG  YR+  KE + LF D+   D Y+D  + YL  +   K
Sbjct  426   RSVNLVVVHEEGKPYRDGAKEYRELFRDKELHDRYMDECVEYLESYSHHK  475



>ref|XP_011084238.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=470

 Score =   476 bits (1226),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 317/461 (69%), Gaps = 5/461 (1%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LHI + PWLAFGH+IPYLELSKHIA +GH++SF+STPRNIDRLPKLPP+L+S I  VK+
Sbjct  8     NLHIAVLPWLAFGHIIPYLELSKHIAQKGHRISFISTPRNIDRLPKLPPHLSSSIALVKI  67

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT+D+   ++  LK A DAL+  + +FLE+  PDWI++DF ++W+ P
Sbjct  68    PLPRIAELPENAEATMDIHAGQMGLLKKAFDALEPGLTRFLEDSRPDWIIYDFAAHWVPP  127

Query  1249  VASKLGVSTALFSIFTPPTVAFFG---RLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             VA +LG+S A F I     + FFG    L+  ++ RTK ED+ VPPKW+ F+T VAFR +
Sbjct  128   VAVRLGISRAFFFIINAWFLGFFGATDTLISGSDYRTKPEDFMVPPKWVKFETKVAFRRF  187

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E      A    +   SD +R+   +  C+ + +R C+EF+ EWL LLE +H +PV P+G
Sbjct  188   EAEWSDGASKSNESGFSDYYRIGKVIAGCEAILIRHCNEFEPEWLTLLEELHHRPVIPLG  247

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              +P    D    ++     W  IK WL++Q  G V+YVA GSE  PSQ ++ E+A GLEL
Sbjct  248   LMPPKVQDHSTNNDANHTVWTGIKNWLNRQNKGSVVYVALGSEVTPSQDQVVELAHGLEL  307

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFWVLR +   ++ + + LP GFEER  GRG+V  SWAPQ++IL H SVGGFL+H 
Sbjct  308   SGVPFFWVLR-KVSASESKPVELPNGFEERVSGRGMVWRSWAPQVEILKHASVGGFLSHC  366

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSS+VE + +  PL+ L FL DQGLN+RV+ EK++G  +PR+E+DG +TR+ VA+S++L
Sbjct  367   GWSSIVEGLMYGNPLITLPFLVDQGLNSRVIVEKQLGVEIPRNEQDGTYTRKWVADSVKL  426

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             V+V +EG  ++E+ +EM  +F D+     Y+DT + +L  H
Sbjct  427   VMVGEEGRKFQERAQEMSLVFGDEELHRRYIDTAIQFLQNH  467



>ref|XP_004250156.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=483

 Score =   476 bits (1225),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 313/461 (68%), Gaps = 10/461 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH+IP+LELSK IA +GHK+SF+S+PRNIDRLPK+P   ++ I FVK+
Sbjct  19    KLHIVMFPWLAFGHIIPFLELSKFIARKGHKISFISSPRNIDRLPKIPSEFSNSITFVKI  78

Query  1429  PLPPHQNLPENAEATIDL-PYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             PL     LP++AEATID+   +++ YLK A D +++ +  FLE   PDWI+ DF  YWLA
Sbjct  79    PLAKIDGLPKDAEATIDIITSEEMTYLKKAMDGMEKDVTNFLENSCPDWIIQDFAQYWLA  138

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERT------KAEDYTVPPKWIPFKTTVAF  1091
             P++++LG+S   +SI     ++F G   +           K ED+ VPPKWIPF+T   +
Sbjct  139   PISTRLGISRIFYSIINAWFLSFLGSFENMINTNNCTSPPKLEDFLVPPKWIPFETKATY  198

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             RL+E   ++++  +    VSD++R    +E  D + +R C EF+ +WLKLLE++H  PV 
Sbjct  199   RLHEARWMVESSQKNVSGVSDMYRNGVTIEGADAIIIRHCHEFEGQWLKLLEDLHHMPVL  258

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P G +P     +   HE   +SW  IK WLD++  G V+YVA GSE    Q E+ E+A G
Sbjct  259   PTGLMPPIVESSS--HE-KNESWISIKDWLDEKPKGSVVYVALGSEVTVGQNEINELARG  315

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR   G    + I LP+GFEERTK RGIV  SWAPQLKILSHESVGG L
Sbjct  316   LELSGSPFFWVLRKSSGLGSIDPIVLPDGFEERTKDRGIVWKSWAPQLKILSHESVGGLL  375

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GWSS++E + F  PL++L FL DQGLNAR+L++K +G  VPR+E  G +T ++V  S
Sbjct  376   THCGWSSIIEGLIFGHPLIMLPFLVDQGLNARILQDKGVGVEVPRNEEGGTYTSDSVVNS  435

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++LV+VE +G I REK KEM  +F ++   D Y++ L+++L
Sbjct  436   VKLVMVENDGKIIREKAKEMSAIFGNKELHDKYIENLINFL  476



>emb|CDP21820.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   475 bits (1222),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 311/458 (68%), Gaps = 16/458 (3%)
 Frame = -2

Query  1594  MYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLPLPPH  1415
             M PWLAFGH IP+LELSK +A +GHKVSFVSTP+NIDRLP++PPNLAS I FVK+PLP  
Sbjct  1     MLPWLAFGHFIPFLELSKFMAQKGHKVSFVSTPKNIDRLPRIPPNLASSITFVKIPLPRV  60

Query  1414  QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPVASKL  1235
               LPEN EAT+DL    V  LK A D L+  + +FLE  +PDWI++DF  YW+ P+A+KL
Sbjct  61    DGLPENVEATVDLGDLDVAVLKKAYDGLEPELTRFLEYSAPDWIIYDFAPYWIPPIAAKL  120

Query  1234  GVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
              +S + F IF+  ++AFF   VD        RTK ED+TVPPKWIPF++ +AF+LYE   
Sbjct  121   NISKSFFCIFSAASMAFFVPSVDAMIAGTDPRTKVEDFTVPPKWIPFESKLAFKLYESRW  180

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
             ++     +   VSD +R+ S ++  D+  +R CSEF+ +WLKLLE++ Q+ + P+G +P 
Sbjct  181   VVQGQNLDGSGVSDSYRVGSAIKGADVTLIRYCSEFEGKWLKLLEDLLQRHIIPLGLMPP  240

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
                 +        +SW  IK WLD Q  G V+YVA GSE   +Q +L+E+ALGLELSG P
Sbjct  241   PVEKS---IVENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELALGLELSGVP  297

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW LR   G        LPEGFE+R KG GIV  +WAPQL +LSH+SVGGFLTH GWSS
Sbjct  298   FFWALRNPSG--------LPEGFEDRVKGTGIVWKNWAPQLNVLSHDSVGGFLTHCGWSS  349

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
              +E + F  PL++L F+AD GL ARVLEEK++G  +PR++ DG +T  +VA S+RL++VE
Sbjct  350   SIEGLMFGHPLIMLPFVADTGLIARVLEEKQVGIEIPRNDVDGSYTSHSVANSVRLIMVE  409

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              EG I+++K KE+  +F DQ   D Y+   + YL   +
Sbjct  410   NEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYLENKR  447



>emb|CDP21084.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/462 (50%), Positives = 314/462 (68%), Gaps = 16/462 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + S LH++M PWLAFGH IP+LELSK IA RGHKVSFVSTP+NIDRLPK+PPNLAS I+F
Sbjct  4     KSSSLHVVMLPWLAFGHFIPFLELSKFIARRGHKVSFVSTPKNIDRLPKIPPNLASSISF  63

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+PLPP   LPEN EAT+DL    V  LK A D L+  + +FLE   PDWI++DF  YW
Sbjct  64    VKIPLPPVDGLPENVEATVDLGGLDVAVLKKAYDGLEPELTRFLESSVPDWIIYDFAPYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTVA  1094
             +  +A+KL +S + F IF+  ++ F    +D        RTK ED+TVPPKWIPFK+ +A
Sbjct  124   IPHIAAKLNISKSFFCIFSAASLVFSAPSLDAMVAGTDPRTKLEDFTVPPKWIPFKSKLA  183

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             F+L+E   ++ +   +   VSD++R+ S ++  D+  +R C EF+ +WLKLLE++ Q+ +
Sbjct  184   FKLHESRFVVRSKNLDGSGVSDMYRVGSAIKGADVTLIRYCPEFEGQWLKLLEDLLQRHI  243

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G +P     +        +SW  IK WLD Q  G V++VA GSE   +Q +L+E+AL
Sbjct  244   IPLGLMPPPMEKS---IVENNESWIAIKDWLDGQGKGSVVFVALGSEVSLNQLQLSELAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR   G        LPEGF++R KG GIV  +WAPQL ILSH+SVGGF
Sbjct  301   GLELSGVPFFWALRNPSG--------LPEGFDDRVKGTGIVWKNWAPQLNILSHDSVGGF  352

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GWSS +E + F  PL++L F+ D GL AR++EEK++G  +PR++ DG +T  +VA 
Sbjct  353   LTHCGWSSSIEGLMFGHPLIMLPFIIDTGLIARIMEEKQVGIEIPRNDVDGSYTSHSVAN  412

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             S+RL++VE EG I+++K KE+  +F DQ   D Y+   + YL
Sbjct  413   SVRLIMVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYL  454



>ref|XP_008338469.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Malus 
domestica]
Length=474

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 231/464 (50%), Positives = 309/464 (67%), Gaps = 11/464 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI ++PWLAFGH+IP LE++KHIA RGHKVSF+STPRNI RLPK+PPNL   I+ V++ 
Sbjct  14    LHIALFPWLAFGHIIPALEVAKHIAQRGHKVSFISTPRNIQRLPKIPPNLTPLIDLVQIX  73

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  +NLPENAEAT+D+PYD + YLKLA D L++ +  FL+  +PDWI++DF  YWL P+
Sbjct  74    LPRVENLPENAEATMDVPYDLIPYLKLAHDGLEQGITSFLQTHTPDWIIYDFAPYWLPPI  133

Query  1246  ASKLGVSTALFSIFTPPTVAFFGR-----LVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             AS LG+S A+F  F   T   FG      L  ++ RT  E +TVPP+W+PF + + FRL+
Sbjct  134   ASNLGISRAMFGGFNTYTACAFGPTLPDVLSRYSPRTLPEHFTVPPEWVPFPSKLFFRLF  193

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E  ++ DA+      +SD FR+ S VE   +   R C E + +WL L+  ++ KP  PVG
Sbjct  194   EAKKLFDALEHNASGISDWFRMKSXVEGSQVCLFRSCREIEGDWLDLVPELYHKPAIPVG  253

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +  D     +    SW  +  WLDKQE   V+YVA GSE  P+Q E TE+ALGLEL
Sbjct  254   LLPPSVQDT---EDKEDXSWSIVCEWLDKQERATVVYVALGSEINPTQEEFTELALGLEL  310

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR   G A    + LP+ FE+R KGRG+V  +WAPQ +IL+H++VGGF TH 
Sbjct  311   SGLPFFWALRTPNGSAAGNSVKLPDEFEDRNKGRGLVWRTWAPQRQILAHKAVGGFWTHC  370

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSS++E I    PL++  FL DQGLNAR L ++K+G  VPR++ DG FT++ VAESL L
Sbjct  371   GWSSLIEGIHRGIPLIMFPFLYDQGLNAR-LWDRKVGIEVPRNDEDGSFTKKEVAESLNL  429

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL--HCHK  236
             V+V++EG  YR+  KE   +  D+   D Y+D  + Y   + HK
Sbjct  430   VMVDEEGKAYRDGAKEYSAVIADKDLHDRYMDKCVEYFEKNVHK  473



>gb|AFJ53033.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=464

 Score =   468 bits (1203),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 318/462 (69%), Gaps = 6/462 (1%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             +KLHI M+PWLAFGH++P+L+L+K IAS+GHK+SF+ST +NIDRLP++   L   I FVK
Sbjct  4     TKLHIAMFPWLAFGHILPFLQLAKLIASKGHKISFISTSKNIDRLPQIRQPL---ITFVK  60

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             L LP    LP  A +T DLP + V YLK A D L+  +A FL   +PDWI+ D+  +WL 
Sbjct  61    LNLPSVDGLPPTAHSTSDLPIEDVHYLKKAYDLLKPQLADFLRSSNPDWIVFDYVPFWLP  120

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             P+A +L + T  FSIF    +AF G  V  AE R K EDYT  P+W+   +TV +R +E 
Sbjct  121   PLARELNIPTVYFSIFLASVMAFVGPPVGEAEYREKTEDYTARPRWMKLNSTVYYRRFEA  180

Query  1075  LRIIDAVTEEDD--NVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
              +   A++ + +   V +  R    +  CD++AVR C E + E+L LLE I  KPVFP+G
Sbjct  181   EKAFPAISGDGELRIVPEFHRFQQSLRGCDLIAVRSCREIELEYLDLLEEIQGKPVFPIG  240

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              L +            G  W  I+ WLD+ + G V+YVAFGSEAKPSQ ELTEIA GLE+
Sbjct  241   VLLSEDNSGSEDSISGGSDWLGIRKWLDEHKKGSVVYVAFGSEAKPSQDELTEIATGLEI  300

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFWVLR RR   DPE++ LP+GFE RT+G+G+V   WAPQ+KIL+H+SVGGFLTHS
Sbjct  301   SGLPFFWVLRTRRSPDDPEVLELPDGFEVRTQGKGVVWKGWAPQVKILTHDSVGGFLTHS  360

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSVVE++QF +PLVLLTF ADQGLN+++L+EK +GY VPRDE DGRFTREAVAES+R+
Sbjct  361   GWSSVVESLQFGRPLVLLTFYADQGLNSKLLQEKGVGYLVPRDELDGRFTREAVAESVRM  420

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             VV E++G  +R+K  EMK LF    +   YV   L YL  +K
Sbjct  421   VVDEEDGRRHRDKAGEMKELFGHVEKHRSYVGDFLRYLEANK  462



>emb|CDP04856.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   465 bits (1196),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 228/467 (49%), Positives = 318/467 (68%), Gaps = 16/467 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             +   LH++M+PWLAFGH IP+L+LSK IA RGHKVSF+STP+N+DRLPK+P   AS I +
Sbjct  4     KSGSLHVVMFPWLAFGHFIPFLDLSKFIAQRGHKVSFISTPKNVDRLPKIPLEFASSITY  63

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             VK+PLP    LPEN EAT+DL    V  LK A D L+  + +FL   +PDWI++DF  YW
Sbjct  64    VKIPLPRVDGLPENVEATVDLGGLDVAVLKKAYDGLEPELTRFLGYSAPDWIIYDFAPYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAF----FGRLVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
             L P+A+KL +S + FSI++  ++AF    F  L+  A+ RTK ED+TVPPKWIPF++ VA
Sbjct  124   LPPIAAKLNISKSFFSIYSAFSMAFLAPPFEALIAGADPRTKVEDFTVPPKWIPFESKVA  183

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             F+L+E   ++++   +   VSD++R+ S V+  D++ +R C EF+ +WLKL+E++  +P+
Sbjct  184   FKLHESRWMLESRNLDGSGVSDLYRVGSVVKGADVILMRHCHEFEGQWLKLVEDLQARPL  243

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG +P     +        +SW  IK WLD Q  G V+YVA GSE   +Q +L+E+AL
Sbjct  244   IPVGLMPPPVEKS---SLENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE SG PFFW LR   G        LP GFE+R KGRGIV  +WAPQL ILSH+SVGGF
Sbjct  301   GLESSGVPFFWALRNPSG--------LPGGFEDRVKGRGIVWKNWAPQLNILSHDSVGGF  352

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GW S +E + F  PL++L F+ D GL ARVLEEK +G  +PR++ DG +T ++VA 
Sbjct  353   LTHCGWGSSIEGLMFGHPLIMLPFVIDTGLIARVLEEKLVGIEIPRNDVDGSYTSDSVAN  412

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             S+RLV+VE EG ++++K KE+  +F DQ   + Y+   + YL  +++
Sbjct  413   SVRLVMVENEGKVFKDKAKEIGAIFGDQDLHNSYLQKSVDYLEKNRN  459



>ref|XP_008236334.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Prunus 
mume]
Length=473

 Score =   463 bits (1191),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 309/465 (66%), Gaps = 11/465 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KL I ++PWLAFGH+IP+ E++KH+A RGHKVSF+STPRNI RLPK+P +L   IN 
Sbjct  12    EPKKLQIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTPLINL  71

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V++PLP  +NLPENAEAT+D+PY  + YLK+A D L++ ++ FL    PDWI+HDF  YW
Sbjct  72    VQIPLPCVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLRTHKPDWIIHDFAPYW  131

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L P+AS LG+S A FS+F   ++ F+G      L  +  RT  E +TVP +WIPF + + 
Sbjct  132   LPPIASSLGISRAHFSVFNASSLCFYGPTSPQGLDRYGVRTLPEQFTVPAEWIPFPSNMV  191

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
              + +E   + D++ +   +VSD FR+ S ++ C +  +R C E +  WL LL+ + QKPV
Sbjct  192   LKSFEAKNLFDSMKQNASSVSDWFRVKSTIQGCQVYFIRSCRETEGAWLDLLQELQQKPV  251

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P G +P              + W  I  WLDK++   V+Y+A GSE   SQ + TE+AL
Sbjct  252   VPTGLMPPVVQA-----REDKEDWSTIAQWLDKKQKATVVYIALGSELNLSQQDFTELAL  306

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVLR      +     LP+GFEERTKGRG+V T+WAPQ +IL+H+S+GGF
Sbjct  307   GLELSGLPFFWVLRKPSWSGNGGSGKLPDGFEERTKGRGLVWTTWAPQTQILAHDSIGGF  366

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G SS+VE +Q+ +PL++L  L DQGL AR   +KK+G  VPR+E DG F+R+++AE
Sbjct  367   LTHCGASSLVEGLQYGRPLLMLPCLYDQGLIARFW-DKKVGIEVPRNEEDGSFSRKSLAE  425

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             SL L+VV++ G  YR+  +E   LF D+   D Y+D  + Y+  H
Sbjct  426   SLNLLVVDEAGKAYRDGAEEYSVLFQDKDLHDRYMDKCVEYMENH  470



>ref|XP_011073572.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=468

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 308/458 (67%), Gaps = 11/458 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH++M+PWLAFGH+IP+ ELSK IA +GHK++F+STPRNIDRLPKLPP+L S I+ VK+
Sbjct  11    KLHVVMFPWLAFGHIIPFFELSKFIAQKGHKITFISTPRNIDRLPKLPPDLVSSIDLVKI  70

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP  + LPENAEAT+D+  + V++LK A D +++ +A+FLE    D I++DF  YWLAP
Sbjct  71    PLPKLEELPENAEATMDVRPEDVEHLKKAYDGMEDGVARFLENSDADIIIYDFAPYWLAP  130

Query  1249  VASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             +A++LG+S   F IF    +AF G    L++  E R++ ED+  PP+W+ F T VA+RLY
Sbjct  131   IATRLGISRFFFCIFNAWFLAFLGTTDALINGLEGRSRQEDFLAPPEWVTFDTKVAYRLY  190

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E    + A        SD +R    +  C+ + +R C+EF+ +WLKLLE +HQK V P+G
Sbjct  191   EAKWALGAAGTNASGFSDTYRAGKAIAGCNAMIIRHCNEFEPKWLKLLEELHQKEVIPLG  250

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              +P    D    +  T ++W  IK WL       V+YVA GSE   S+ +++E+A GLEL
Sbjct  251   LMPPQVQD----NTSTNEAWVSIKNWLCTHPKESVVYVALGSEVVLSRDQISELAHGLEL  306

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PF W LR   G A    I LPEGFEERTKGRGIV  +WAPQLKIL H+ VG FLTH 
Sbjct  307   SGVPFLWALRKPAGSAT---IELPEGFEERTKGRGIVWKNWAPQLKILGHDGVGAFLTHC  363

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSS+VE + F +PLV+L F  DQGLNARVL +K++G  VPR+E+DG +TR AVAES+R 
Sbjct  364   GWSSIVEGLMFGRPLVMLPFQIDQGLNARVLGDKQVGMEVPRNEQDGTYTRNAVAESVRT  423

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V+V+  G   R+  K    +F D+   D Y+   + +L
Sbjct  424   VMVDGVGQKLRDTAKATSAMFGDKELHDRYLHNFVEHL  461



>gb|AFJ53032.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=458

 Score =   453 bits (1165),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 310/462 (67%), Gaps = 22/462 (5%)
 Frame = -2

Query  1594  MYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLPLPPH  1415
             M+PWLAFGH++P+L+L+K IA RGH +SF+STPRNIDRLPKLPP L+S I FVKLPLP  
Sbjct  1     MFPWLAFGHILPFLQLAKLIAQRGHLISFISTPRNIDRLPKLPPALSSLITFVKLPLPSS  60

Query  1414  --QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPVAS  1241
               Q LP  AEAT DL    V YLK A D LQ  ++ FL+  +PD+I+ D+  +WL P+A 
Sbjct  61    DVQGLPHAAEATSDLEARHVGYLKRAYDLLQHQLSTFLQSSNPDFIICDYAPFWLPPIAR  120

Query  1240  KLGVSTALFSIFTPPTVAFFGRLVDFAE---RTKAEDYTVPPKWIPFKTTVAF-RLYEI-  1076
             +LG+ T  FSIF    +AF     D  +   R   ED T  P+W+PF+TT  + R +E  
Sbjct  121   RLGIPTVFFSIFIASVLAFTSPPADDEDEDYRKTVEDLTEKPRWVPFETTSGYYRPFEAK  180

Query  1075  ----LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
                 + ++    +E   +    +++ G   CD VAVR C E + +WLKLLE IH+KPVFP
Sbjct  181   VSFEMAVVGGGGQEFPELHRFRQMLRG---CDFVAVRTCPELEHDWLKLLEQIHKKPVFP  237

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDK-QETGKVIYVAFGSEAKPSQTELTEIALG  731
             +G LP    +     E   D+WK IK WLD  +E G V+YVAFGSEA PSQ ELTEIA G
Sbjct  238   IGVLPNPIKEED--EEGDEDTWKSIKEWLDDGKEKGSVVYVAFGSEAIPSQEELTEIATG  295

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR+    +D     LPEGFEERT GRG+V   WAPQ+KIL HESVG   
Sbjct  296   LELSGLPFFWVLRS----SDDPRRELPEGFEERTAGRGLVWKGWAPQVKILGHESVGCMF  351

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
              HSGWSSVVEA+QF +PLVLLTF ADQGLN+++L+EK +GY VPR++ DGRF RE+VAES
Sbjct  352   CHSGWSSVVEALQFGRPLVLLTFYADQGLNSKLLQEKGLGYLVPRNDDDGRFRRESVAES  411

Query  370   LRLVVVEKEGNI-YREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             LR V++ +EG   +REK  EM+ LF D  + + YV   L  L
Sbjct  412   LRTVMLAEEGQSGHREKAAEMQTLFADTEKHESYVHDFLSSL  453



>ref|XP_011099970.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=502

 Score =   454 bits (1168),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 308/462 (67%), Gaps = 12/462 (3%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
             G +LH++M+PWLAFGHMIP+LELSK IA +GHK++F+STPRNIDRLPKLPP+L S I F 
Sbjct  40    GRQLHVVMFPWLAFGHMIPFLELSKFIAGKGHKITFISTPRNIDRLPKLPPDLVSSIAFA  99

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             K+PLP  + LPENAEAT+D+  ++V++LK A D +++ + +FLE   PD I++DF  +WL
Sbjct  100   KIPLPKLEGLPENAEATMDVLPEEVEHLKKAYDGMEDDLTQFLENSDPDIIIYDFAPHWL  159

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
               +A++L +S   F IF     AF G     +    +RT+ E++  PP+W+ F+T VA+R
Sbjct  160   PAIATRLRISRFFFCIFNAWFFAFLGNTKAMINGLDDRTRLENFLAPPEWVTFETKVAYR  219

Query  1087  LYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             LYE   I+ A        SD +R    +  C+ + +R C+EF+S+WLK+LE +HQ  V P
Sbjct  220   LYEADLILCAAVTNASGFSDFYRAGKVIAGCNAMIIRHCNEFESKWLKVLEELHQIEVIP  279

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             +G +P    D     + + ++W  I  WL  Q    V+YVA GSE   S+ +++E+A GL
Sbjct  280   LGLMPPHVQDTS---DSSNEAWVSITNWLCSQIKESVVYVALGSEVVLSRDQISELAHGL  336

Query  727   ELSGFPFFWVLRARRG--EADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             ELSG PF W  R   G  EAD E   LP+GFE R KGRG+V  +WAPQLKIL HE+VG F
Sbjct  337   ELSGLPFLWAFRKPAGSREADFE---LPDGFEGRIKGRGVVLKNWAPQLKILGHEAVGAF  393

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GWSS+VE + F  PL++L F+ DQGLNARVL E+++G  +PR+E+DG +TR AVA+
Sbjct  394   LTHCGWSSIVEGLTFGHPLIMLPFVIDQGLNARVLAERQVGVEIPRNEQDGSYTRNAVAQ  453

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             SLR V+VE EG   R+  K M  LF D+   D Y+   + YL
Sbjct  454   SLRRVMVEVEGQKLRDTAKAMSILFGDRELHDRYLHNFVEYL  495



>gb|AFJ53031.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=477

 Score =   452 bits (1163),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 310/473 (66%), Gaps = 20/473 (4%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             +    LHI M+PWLAFGH++P+L+L+K IA RGH +SF+STPRNIDRLPKLPP L+S I 
Sbjct  5     NNNKSLHIAMFPWLAFGHILPFLQLAKLIAQRGHTISFISTPRNIDRLPKLPPALSSLIT  64

Query  1441  FVKLPLPPH--QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFS---PDWILH  1277
             FVKLPLP    Q LP  AEAT DL    V YLK A D LQ  ++ FL+  S   PD+I+ 
Sbjct  65    FVKLPLPSSDVQGLPPAAEATSDLEARHVGYLKRAYDLLQHPLSTFLQSSSSHPPDFIIC  124

Query  1276  DFDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE---RTKAEDYTVPPKWIPFK  1106
             D+  +WL  VA +LG+ T  FSIF   ++AF     D  +   R  AED    P+W+PF+
Sbjct  125   DYAPFWLPAVARRLGIPTVFFSIFIASSLAFSSPPADDEDEDYRRAAEDLAEKPRWVPFE  184

Query  1105  TTVA-FRLYEILRIIDAVT--EEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLE  935
             TT   FR +E     + V          +I R    +  CD +AVR C E + +WLKLLE
Sbjct  185   TTSGYFRPFEAKASFEMVLVGGGGQEFPEIHRFRQMLRGCDYIAVRTCPELEYDWLKLLE  244

Query  934   NIHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWL-DKQETGKVIYVAFGSEAKPSQ  758
              +H+KPVFP+G LP    +     E   D+WK IK WL D +E G V+YVAFGSEA PSQ
Sbjct  245   QMHKKPVFPIGVLPNPIKEEDEKEEGDEDTWKSIKEWLNDGKERGSVVYVAFGSEAIPSQ  304

Query  757   TELTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKIL  578
              ELTEIA+GLELSG PFFWV+R+     +     LPEGFEERT GRG+V   WAPQ+KIL
Sbjct  305   EELTEIAIGLELSGLPFFWVVRSSNDHRE-----LPEGFEERTAGRGVVWKGWAPQVKIL  359

Query  577   SHESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGR  398
              HESVG    HSGWSSVVEA+QF  PLVLLTF ADQGLNA++L+EK +GY VPR++ DGR
Sbjct  360   GHESVGCLFCHSGWSSVVEALQFGHPLVLLTFYADQGLNAKLLQEKGVGYLVPRNDDDGR  419

Query  397   FTREAVAESLRLVVV--EKEGNI-YREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             F RE+VAESLR V++  E+EG   +R+K  EM+ LF D  + + YV   L  L
Sbjct  420   FRRESVAESLRAVMLAEEEEGQSGHRKKAAEMQTLFADTEKHESYVHDFLSNL  472



>ref|XP_002878624.1| At2g22590/T9I22.3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54883.1| At2g22590/T9I22.3 [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 240/477 (50%), Positives = 316/477 (66%), Gaps = 56/477 (12%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKV-----------SF---VSTPRNIDRL-  1478
             +KLH++M PWLAFGHM+PYLELSK IA +GH+            SF   +STPRNIDRL 
Sbjct  12    TKLHVVMSPWLAFGHMVPYLELSKLIAQKGHRALNFRKDLVASKSFGPALSTPRNIDRLL  71

Query  1477  PKLPPNLASRINFVKLPLPPHQN-LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEE  1301
             P+LP NL+S INFVKLPLP   N LPE+ EAT D+P++ + YLK+A + L+  + +FLE 
Sbjct  72    PRLPENLSSIINFVKLPLPVGDNKLPEDGEATTDVPFELIPYLKIAFNGLKVPVTEFLES  131

Query  1300  FSPDWILHDFDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPK  1121
               PDW+L DF ++WL P++    +STA  S F                  + +  + PPK
Sbjct  132   SKPDWVLQDFAAFWLPPISP---LSTARRSGFL----------------NRRDSKSTPPK  172

Query  1120  WIPFKTTVAFRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWL  947
             W+PF+T VAF+L+E   I      E  + N+SDI R                  +++EWL
Sbjct  173   WVPFETPVAFKLFECRYIFRGFMAETTEGNISDIHR---------------AGGYEAEWL  217

Query  946   KLLENIHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAK  767
              L++++H+KPV PVG LP    +     E T D+W  +K WLD +++  V+YVAFGSEAK
Sbjct  218   GLMQDLHRKPVIPVGVLPPKPEEK---FEDT-DTWLTVKKWLDLRKSKSVVYVAFGSEAK  273

Query  766   PSQTELTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQL  587
             PSQTEL EIALGLELSG PFFWVL+ RRG  D E + L EGFEERT  RG+V   W  QL
Sbjct  274   PSQTELNEIALGLELSGLPFFWVLKNRRGPWDTEPVELLEGFEERTADRGMVWRGWVEQL  333

Query  586   KILSHESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDER  407
             + LSH+S+G  LTH GW +++EA++F KP+ +L F+ DQGLNARV+EEKKIGY +PRDE 
Sbjct  334   RTLSHDSIGLVLTHPGWGTIIEAVRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDET  393

Query  406   DGRFTREAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +G FT+E+VA+SLRLV+ E EG +YRE +KEMKG+F D  RQD YVD+ L YL  ++
Sbjct  394   EGFFTKESVAKSLRLVMEEDEGEVYRENVKEMKGVFGDMDRQDHYVDSFLDYLVANR  450



>ref|XP_002865752.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42011.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=515

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 307/466 (66%), Gaps = 15/466 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D +   +HI M+PWLA GH++P+L LSK +A +GHK+SF+STPRNI RLPKLP NL+S I
Sbjct  3     DKKEEVMHIAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNILRLPKLPSNLSSSI  62

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV  PLP    LP ++E+++D+PY+K + LK A D LQ  + +FL   SPDWI++D+ S
Sbjct  63    TFVSFPLPSISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLTEFLRLSSPDWIIYDYAS  122

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  +A +LG+S A FS+F   T+ F G      E  R+  ED+TV P W+PFK+T+ F
Sbjct  123   HWLPSIAKELGISKAFFSLFNAATLCFMGPSSSLIEESRSTPEDFTVVPPWVPFKSTIVF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +E+ R ++   E+   VSD  R    ++  D V VR C EF+ EW  LL+++++KPVF
Sbjct  183   RYHEVSRYVEKTDEDVTGVSDSVRFGYTIDGSDAVFVRSCPEFEPEWFSLLQDLYRKPVF  242

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G LP    D     +    +W  IK WLDKQ    V+YV+ G+EA   + ELTE+ALG
Sbjct  243   PIGFLPPVIED-----DDDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREELTELALG  297

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVLR      +P+   +P+GFEER KGRG+V   W PQ+KILSHESVGGFL
Sbjct  298   LEKSETPFFWVLR-----NEPQ---IPDGFEERVKGRGMVHVGWVPQVKILSHESVGGFL  349

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+SVVE I F K  + L  L +QGLN R+L+ K +G  V RDERDG F  ++VA+S
Sbjct  350   THCGWNSVVEGIGFGKVPIFLPVLNEQGLNTRLLQGKGLGVEVLRDERDGSFGSDSVADS  409

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             +RLV+++  G   REK+K MKGLF +      YVD L+ ++   +S
Sbjct  410   VRLVMIDDAGEEIREKVKLMKGLFGNMDENIRYVDELVGFMRNDES  455



>ref|XP_010680364.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Beta 
vulgaris subsp. vulgaris]
Length=468

 Score =   447 bits (1151),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 310/465 (67%), Gaps = 14/465 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASRINFVK  1433
             +LHI+++PWLAFGHMIP+LELSKH+A + H +S+VS PRN++RL  K+P NL   I  V 
Sbjct  6     ELHIVVFPWLAFGHMIPFLELSKHLAIKRHHISYVSAPRNLERLLSKIPQNLIPFIELVP  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP-DWILHDFDSYWL  1256
             +PLP    LP NAEAT D+P+D V+ LK   D L+E +A+FLE  SP DWI++D+ SYWL
Sbjct  66    VPLPRVGKLPPNAEATSDVPFDDVELLKKTYDGLKEPLARFLEASSPIDWIIYDYPSYWL  125

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERT--KAEDYTVPPKWIPFKTTVAF  1091
              P+A +LG+     S+    + A FG   +++   + T    E+ T P +W+PF   + +
Sbjct  126   PPIADRLGIQKVFLSLMNGWSSATFGPSSKMIKDGDGTWSNPENLTSPLEWVPFNNNIVY  185

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +E    + A       VSD+FR  S V  CDI A+R C E ++E+L+LLE +H KPV 
Sbjct  186   RFHEAKNSLGAAQTNASGVSDMFRSGSSVRDCDIFAIRSCRELEAEYLQLLEELHGKPVV  245

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG +P +  +   G     D+W+ +K WLD+     V+YV+ GSE   SQ E+TE+ALG
Sbjct  246   PVGLMPVSVEE---GQRAKDDTWQSMKGWLDEHTKNSVVYVSLGSEFALSQDEITELALG  302

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELS  PFFW LR + G   PEL   P+GFEERT+GRG+V T+WAPQ ++L+H+SVG FL
Sbjct  303   LELSMLPFFWALRKQAG-TQPEL---PDGFEERTRGRGLVWTNWAPQTQLLAHDSVGAFL  358

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GWSS++E +QF +PLV+L F+ DQGLNARV+E+KK+G  +PR+ RDG F + +VA+S
Sbjct  359   THCGWSSIIEGLQFGRPLVMLPFVLDQGLNARVMEQKKVGIEIPRNNRDGSFNKISVAQS  418

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             L++V  +  G IYR++ K+M  +  D+   + Y++    YLH  +
Sbjct  419   LKVVCGDIHGTIYRDEAKKMSRMVADKNLHNQYMEEFEAYLHNKR  463



>ref|XP_009774870.1| PREDICTED: UDP-glycosyltransferase 91C1 [Nicotiana sylvestris]
Length=472

 Score =   447 bits (1150),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 308/474 (65%), Gaps = 8/474 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             ++E   LH++M+PWLA GH+IP+  LSK +A RGHKV+F+STP+NI+RL K+P ++A  +
Sbjct  2     ENERKPLHVVMFPWLAMGHIIPFFHLSKWLAQRGHKVTFISTPKNIERLDKVPSDIAHLL  61

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFS---PDWILHD  1274
             N + +PLP  +NLP++AE+++D+PY K ++LK+A D L+  +  FLE  S   PDWI++D
Sbjct  62    NIISIPLPKVENLPDHAESSMDIPYQKAQFLKIAFDLLETPLITFLENSSNPKPDWIVYD  121

Query  1273  FDSYWLAPVASKLGVSTALFSIFTPPTVAFFG--RLVDFAERTKAEDYTVPPKWIPFKTT  1100
             + S+WL   A  LGVS A FS+FT  T+AFFG  +++   ER+  EDYT+ P WIPF+T 
Sbjct  122   YASHWLPQRARDLGVSCAFFSLFTAATMAFFGPPQVLLNDERSIPEDYTIVPNWIPFETD  181

Query  1099  VAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             V +RL+EI +  +A  +E    SD  R    ++  D+V  R C EF+ EW  L+  + QK
Sbjct  182   VKYRLHEIKKNFEAPADES-GTSDGARFGGSIDGSDVVLFRTCVEFEPEWFNLVSELFQK  240

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV  +G LP +  D G G   T  +W  IK WLD Q    V+YVA G+EA  SQ EL E+
Sbjct  241   PVISIGVLPPSIEDLGRGSNDT--TWLSIKKWLDMQNQNSVVYVALGTEATLSQKELNEL  298

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             ALGLE  G PFFWV+R +      E   LP G+EER K RG++   W PQ KILSH S+G
Sbjct  299   ALGLEKCGLPFFWVIRNQPRMNQEESQMLPNGYEERVKNRGVIYRGWVPQTKILSHSSIG  358

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
             GFLTH GW+SV+EA+ F   L++   + DQGLN R+L+ K +G  +PR+E DG FT E+V
Sbjct  359   GFLTHCGWNSVIEALCFGWVLIMFPVMNDQGLNTRLLQGKGVGVEIPRNENDGLFTSESV  418

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGT  218
             AE+++  VV +EG   R   ++M+GLF D  R    +D  + YL  ++  K+ +
Sbjct  419   AETVKFAVVSEEGETLRANARQMRGLFGDSNRNRSLIDDCIGYLMENRGRKHSS  472



>ref|XP_009623239.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   446 bits (1146),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/470 (47%), Positives = 302/470 (64%), Gaps = 30/470 (6%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             +KLH++M+PWLAFGH++P+LELSK IA +GHK+SF+STPRNIDRLPKLP   ++ I F+K
Sbjct  10    NKLHVVMFPWLAFGHIVPFLELSKFIAQKGHKISFISTPRNIDRLPKLPLEFSTSITFIK  69

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             + LP    LPENAEAT+D+  +++ YLK A D +++ +  FLE+ SPDWI+ DF  YWLA
Sbjct  70    ISLPKVDGLPENAEATMDITTEEIIYLKKAMDGMEKEVTNFLEKNSPDWIIQDFAQYWLA  129

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
             P+++K              T A+ G    F   TK +          F+T  A+R +E  
Sbjct  130   PISAK--------------TTAYGG---GFLSSTKMDT---------FETKAAYRRHEAR  163

Query  1072  RIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
              I+ +  +    VSD++R    +   D    R C EF+ +WLKLLE++H  P+ P G +P
Sbjct  164   WIVGSSQKNVSGVSDLYRNGVTMIGADATIFRHCHEFEGQWLKLLEDLHNIPIIPSGLMP  223

Query  892   TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGF  713
                 +     E    SW  IK WLD++  G V+YVA GSE    + E+ E+ALGLELS  
Sbjct  224   PMVEN--NNDEKNYQSWISIKEWLDEKPKGSVVYVALGSEVTIGRNEINELALGLELSES  281

Query  712   PFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWS  533
             PFFWVLR   G    + I LPEGFEER KGRGIV  SWAPQL ILSH+SVGGFLTH GWS
Sbjct  282   PFFWVLRKPSGSGITDPIELPEGFEERIKGRGIVWKSWAPQLNILSHDSVGGFLTHCGWS  341

Query  532   SVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVV  353
             S++E + F  PL++L FL DQGLNAR+LE+K +G  +PR+E DG +T ++VA S+ LV+V
Sbjct  342   SIIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEIPRNEEDGSYTSDSVANSVNLVMV  401

Query  352   EKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             E EG I REK KEM  +F ++   D Y++ L+ +L  ++++    Q IS 
Sbjct  402   ENEGKIIREKAKEMISIFGNKNLHDKYIENLIEFLENYRNVS--NQHISN  449



>ref|XP_007018258.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY15483.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=466

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/467 (46%), Positives = 307/467 (66%), Gaps = 9/467 (2%)
 Frame = -2

Query  1618  EGSK-LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             E SK LHI+M+PWLA GH IP+  LSK +A RGH++SFVSTPRN+ +LPK+P NL+S+I 
Sbjct  2     ENSKVLHIVMFPWLAMGHFIPFFRLSKLLAQRGHRISFVSTPRNLSKLPKIPSNLSSQIT  61

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
              V  PLP   NLP  AE+++D+ +++ + LK A D LQ  +  FLE   PDWI++D+ S+
Sbjct  62    LVSFPLPEVPNLPSLAESSMDITHNQQQPLKHAFDLLQPLLTSFLESSKPDWIIYDYASH  121

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAE--RTKAEDYTVPPKWIPFKTTV  1097
             WL  VA++LGVS A F++FT   ++F G    L++  +  R+ A+D+T  PKW+PF++ +
Sbjct  122   WLPSVAAQLGVSRAFFAVFTAACLSFLGPPSALINGGDGARSTADDFTKVPKWVPFESNL  181

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             A+RL+EI + ++   E+     D  R    ++  D+V +R   EF+ +W  LL  + +KP
Sbjct  182   AYRLHEITKYVERTDEDTFGPPDTVRFGVTIQESDVVVIRSSDEFEPDWFNLLRQLFEKP  241

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP    +         + W  +K WLDKQ    V+YVA G+E   S+ EL+++A
Sbjct  242   VTPVGFLPPILEE---DEIQKDEKWVVVKEWLDKQRVNSVVYVALGTEVHLSKEELSDLA  298

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             +GLE SG PFFWVL+   G +  EL  LP+G EER KGRG V   W PQ+KILSHES+GG
Sbjct  299   MGLEKSGLPFFWVLKKSPGSSQSELDMLPDGLEERVKGRGFVHLGWVPQVKILSHESIGG  358

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH GW+SV+EA+   + L++   L DQGLNAR+L E+K+G  +PR+E DG FT + VA
Sbjct  359   FLTHCGWNSVIEALGLGRVLIMFPVLNDQGLNARLLHERKVGVEIPRNEIDGSFTSDEVA  418

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             ES+RL VVE+ G   RE ++ +K  F D+ R DGYVD  +  L  ++
Sbjct  419   ESVRLAVVEESGQSLRETVQAIKSYFGDKGRNDGYVDKFVRQLEENR  465



>ref|XP_009415710.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 226/463 (49%), Positives = 299/463 (65%), Gaps = 9/463 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             S LH++++PWLAFGH+IP+LELSK +A RGH V F+STPRNI RLPKLPP+LA  I+FV 
Sbjct  4     SSLHVVLFPWLAFGHLIPFLELSKSLAKRGHHVFFLSTPRNISRLPKLPPSLAPSIDFVP  63

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYW  1259
             +PLPP + LP+ AEAT DLP +KVKYL  A D L++++A+FL + SP   WI+HD+  YW
Sbjct  64    IPLPPCEGLPDGAEATSDLPREKVKYLNKAFDGLEQSVAEFLVQTSPKPSWIIHDYAPYW  123

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             L  +A+++GV    F+ F     AFF        +   E +T PP+WIPF T +A+R YE
Sbjct  124   LPLIATRVGVPCIFFNTFPAFVSAFFTGPGGRGMQRPVEAFTTPPEWIPFPTKLAYRAYE  183

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVER-CDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
                + D V  +D +   + R I  V + C+++AVR C+EF+ EWL LL   ++KPV PVG
Sbjct  184   ARSLSDHVKRDDVSGVSLVRRIEMVGKGCELMAVRACTEFEREWLSLLREHNEKPVIPVG  243

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +  D  G     G +  DI  WL  Q  G V+ +A GSE   S   L E+A G+E 
Sbjct  244   LLPPSIKDRSG-EANQGANTGDIFLWLRDQAPGSVLXIALGSEVALSAELLRELAFGVEQ  302

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
              G PF W LR        ++  LPEGFEER KGRG+V   W PQL++L+HESVGGFLTH 
Sbjct  303   GGLPFLWALRR-----PDDMEALPEGFEERLKGRGVVAFGWIPQLQVLAHESVGGFLTHC  357

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GW S++E + F +PLVLL    DQGLNAR++EEK +G  + RDE DG FTREAVA ++ L
Sbjct  358   GWGSLIEGLAFGRPLVLLPIAFDQGLNARLMEEKSLGVEIGRDEEDGSFTREAVAHAIGL  417

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             V+VE+ G   R+  KEMK +F D    + YVD  + YL  H +
Sbjct  418   VMVEEAGKTIRDAAKEMKDVFGDTECHEKYVDEFVQYLQHHNN  460



>ref|XP_010934404.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=491

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/461 (50%), Positives = 309/461 (67%), Gaps = 6/461 (1%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI ++PWLAFGHM+P+L+LSK +A RGH++ F+STPRNI RLPK+PP+LA  I+FV LP
Sbjct  31    LHIAVFPWLAFGHMLPFLQLSKSLAKRGHRIYFLSTPRNIQRLPKIPPHLAPLIDFVSLP  90

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYWLA  1253
             LP  + LPENAEAT DLP  +V+YLK+A D L   +  FLEE SP  DWI+ DF  +W+ 
Sbjct  91    LPKVEGLPENAEATPDLPKYQVQYLKVAFDRLGGPLENFLEEASPKPDWIILDFACHWVP  150

Query  1252  PVASKLGVSTALFSIFTPPTVAFF--GRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
              +ASK GV  ALFS+FT P +AF+     +        E++T PPK I F+T+V+FRL+E
Sbjct  151   KLASKFGVPCALFSVFTAPFLAFWRPSESLSRGGDDVLEEFTSPPKGISFETSVSFRLHE  210

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
               R+I         V D  RL+  +E C +VA R C E  S+WL  L+ +++KPV P+G 
Sbjct  211   ARRVIHGYENNASGVCDADRLLLTIEGCRVVAPRSCRELHSDWLCYLQELYKKPVIPIGL  270

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             LP  A D G G + T D   ++  WLDKQ  G V+YVAFGSE   S   L E+A GLELS
Sbjct  271   LPP-APDDGAGVDATSDE-SNVFHWLDKQAPGSVVYVAFGSETVLSTEILHELAFGLELS  328

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
               PF W +R     A      LPEGFE+RT+  G++   W  QLK+L+H SVGG LTHSG
Sbjct  329   QVPFLWAIRKPVDVAGEGKEVLPEGFEDRTRDHGVIAMGWIDQLKVLAHASVGGCLTHSG  388

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             WSSV+E++QF  PL++L F+ DQG+ ARV+EE++IG  VPR+E DG F+RE +A+++RLV
Sbjct  389   WSSVIESLQFGHPLIMLPFIVDQGIIARVMEERRIGIEVPRNEEDGSFSREDLAKAIRLV  448

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +VE+EGN +R +  E+K +F ++   + YV+  + YL   K
Sbjct  449   MVEEEGNQFRSEATELKEIFGNKDYHERYVEEFILYLRNQK  489



>ref|XP_009623131.1| PREDICTED: UDP-glycosyltransferase 91C1 [Nicotiana tomentosiformis]
Length=476

 Score =   440 bits (1131),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 217/465 (47%), Positives = 299/465 (64%), Gaps = 7/465 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             ++E   LHI+M+PWLA GH+IP+  LSK +A RGH+V+F+STPRN++RL K+P +L   +
Sbjct  2     ENERKPLHIVMFPWLAMGHIIPFFHLSKCLAQRGHRVTFISTPRNLERLGKVPSDLTPLL  61

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFS---PDWILHD  1274
             N V +PLP  +NLP+ AE+++D+PY K ++LK+A D L+  +  FLE  S   PDWI++D
Sbjct  62    NIVSIPLPKVENLPDQAESSMDIPYQKAQFLKIAFDLLETPLITFLENLSNPKPDWIVYD  121

Query  1273  FDSYWLAPVASKLGVSTALFSIFTPPTVAFFG--RLVDFAERTKAEDYTVPPKWIPFKTT  1100
             + S+WL   A  LGVS A FS+FT  T+AFFG  R +   ER+  EDYTV P WI F+T 
Sbjct  122   YASHWLPHRARDLGVSCAFFSLFTAATMAFFGPPRALLNDERSIPEDYTVVPNWISFETD  181

Query  1099  VAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             V +RL+EI +  +A   E    SD  R    ++  D V  R C EF+ EW  L+  + QK
Sbjct  182   VKYRLHEIKKNFEAPANES-GTSDGARFGGSIDGSDFVLFRTCVEFEPEWFNLVSELFQK  240

Query  919   PVFPVGQLPTTAYDAGG-GHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             PV  +G LP +  D    G      +W  IK WLDKQ    V+YVA G+E+  SQ EL E
Sbjct  241   PVISIGVLPPSIEDNEDLGRSSNNTTWLSIKKWLDKQNQNSVVYVALGTESTLSQKELNE  300

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             +ALGLE  G PFFWV+R +      E   LP+G+EER K RG++   W PQ KILSH S+
Sbjct  301   LALGLEKCGLPFFWVIRNQPKLNQEESQILPDGYEERVKNRGVIYRGWVPQAKILSHLSI  360

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GGFLTH GW+SV+EA+ F + L++   + DQGLN R+L+ K +G  +PR+E DG FT E+
Sbjct  361   GGFLTHCGWNSVIEALCFGRVLIMFPVMNDQGLNTRLLQCKGVGVEIPRNENDGLFTSES  420

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             VAE+++  VV +EG   R   ++M+GLF D+ R    +D  + YL
Sbjct  421   VAETVKFAVVSEEGKTLRANARQMRGLFGDRNRNGELIDDCVGYL  465



>ref|XP_004233155.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Solanum lycopersicum]
Length=479

 Score =   439 bits (1130),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/466 (46%), Positives = 309/466 (66%), Gaps = 8/466 (2%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             ++E  KLH++M+PWLA GH+IP+  LSK +A RGH+V+F+STPRNI+R+  K+P +LA  
Sbjct  2     ENEKDKLHVVMFPWLAMGHIIPFFHLSKCLARRGHRVTFISTPRNIERVVNKVPSDLAHL  61

Query  1447  INFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFS---PDWILH  1277
             ++ V   LP  +NLP++AE+++D+PY K ++LK+A D+L+  +  +LE  S   PDWI++
Sbjct  62    LHIVWFQLPKVENLPDDAESSMDIPYQKAQFLKIAFDSLEIPLTNYLESSSNPKPDWIVY  121

Query  1276  DFDSYWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKT  1103
             D+ S+WL  +A KLGVS A FS+FT  T++F+G        ER+ AEDYTV PKWIPF+T
Sbjct  122   DYASHWLPQIAGKLGVSRAFFSLFTAATMSFYGPPCALLNDERSIAEDYTVVPKWIPFET  181

Query  1102  TVAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
              V +RL+EI +  +A  +E    SD  R  + ++  D++  R C EF+SEW  L+  ++Q
Sbjct  182   KVVYRLHEIKKNFEAPADES-GTSDGARFGASIDASDVILFRNCVEFESEWFSLVSELYQ  240

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KP+  +G LP +        +    SW  IK+WLDK     V+YVA G+EA  +Q EL E
Sbjct  241   KPIISIGVLPPSVVVDQEQDDSNDASWSGIKSWLDKHNQDSVVYVALGTEATLNQQELNE  300

Query  742   IALGLELSGFPFFWVLRAR-RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHES  566
             +ALGLE  G PF WVLR + +       I LP+G+E+R K RG++   W PQ KILSH S
Sbjct  301   LALGLEKCGLPFVWVLRDQPKHNQQDSCIQLPDGYEDRVKNRGVIYKGWVPQTKILSHSS  360

Query  565   VGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTRE  386
             VGGFLTH GW+SV+EA+ F + LV+   L DQGLN R+L+EK +G  +PR+E+DG FT +
Sbjct  361   VGGFLTHCGWNSVIEALCFGRVLVMFPVLNDQGLNTRLLQEKGVGVEIPRNEKDGFFTSD  420

Query  385   AVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +VAE+++  VV +EG + R   ++M  LF D+ R +  +D  + Y 
Sbjct  421   SVAEAVKFGVVSEEGELLRANARQMSCLFGDRKRNEQLIDDCVGYF  466



>ref|XP_006282295.1| hypothetical protein CARUB_v10028581mg [Capsella rubella]
 gb|EOA15193.1| hypothetical protein CARUB_v10028581mg [Capsella rubella]
Length=458

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/465 (48%), Positives = 299/465 (64%), Gaps = 13/465 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D     +HI M+PWLA GH++P+L LSK +A +GHK+SF+STPRNI RLPKLPPNL+S I
Sbjct  3     DKREEGMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNIQRLPKLPPNLSSSI  62

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV  PLP    L   +E+++D+PY+K + LK A D LQ  + +FL   SPDWI++D+ S
Sbjct  63    TFVSFPLPLISGLSPTSESSMDVPYNKQQSLKAAFDLLQPPLKEFLLVSSPDWIVYDYAS  122

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             +WL  +A++LG+S A FS+F   T+ F G    L+D   RT  +D+TV P W+PFK+ + 
Sbjct  123   HWLPSIAAELGISKAFFSLFNAATLCFQGPSSSLID-EVRTTPDDFTVVPPWVPFKSNIV  181

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR +E+ R ++   ++   VSD FR    +E  D V VR C +F+ EW  LL+ ++QKPV
Sbjct  182   FRYHEVARYVEKTDKDVTGVSDSFRFGYSIEGSDAVFVRSCPKFEPEWFGLLKVLYQKPV  241

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
             FP G LP    D     +    +W  IK WLDKQ    V+YV+ G+EA   + E+TE+AL
Sbjct  242   FPTGFLPPVIVDEDEDEDEDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREEVTELAL  301

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE S  PFFWVLR +           P+GFEER KGRG+V   W PQ+KIL HESVGGF
Sbjct  302   GLEKSETPFFWVLRNKP--------KFPDGFEERVKGRGMVHVGWVPQVKILRHESVGGF  353

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GW+SVVE + F K  + L  L +QGLN R+L  K +G  V RDERDG F   +VAE
Sbjct  354   LTHCGWNSVVEGLGFGKVPIYLPVLNEQGLNTRLLHGKGLGVEVLRDERDGSFDSYSVAE  413

Query  373   SLRLVVVEKE-GNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHC  242
             S+RLV+V+ E G   R+K K MKGLF +     GYVD ++ ++  
Sbjct  414   SVRLVMVDDEKGESIRDKAKVMKGLFGNMDENSGYVDEIVGFMRT  458



>ref|XP_011020572.1| PREDICTED: UDP-glycosyltransferase 91C1 [Populus euphratica]
Length=473

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 306/469 (65%), Gaps = 5/469 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             +G++L ++M+PWLA GH+IP+L LSK +A +GHK+ FVSTPRN++RLPK+P  L+S I  
Sbjct  3     DGNRLQVVMFPWLATGHLIPFLRLSKLLAEKGHKIYFVSTPRNLNRLPKIPKQLSSEIIL  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V  P P   NLP  AE++ D+PY K + LK   D L+  +  FLE   PDWI +D+ S+W
Sbjct  63    VSFPFPHVPNLPSCAESSTDVPYTKQQLLKKGFDLLEPPLTTFLESSKPDWIFYDYASHW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAE-RTKAEDYTVPPKWIPFKTTVAF  1091
             L+ VA++LG+S A FS+FT   +++ G    L++  + R+KAED+TV PKWIPF++ + F
Sbjct  123   LSSVAARLGISCAFFSLFTAACLSYIGPPSTLMNIGDSRSKAEDFTVVPKWIPFESDIVF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLL-ENIHQKPV  914
             RL+E+ + ++   E++   SD  R        D+V +R   EF+ EW  LL + +++KP+
Sbjct  183   RLHEVTKYVEKTEEDETGPSDSIRFGFAAGGSDVVIIRSSPEFEPEWFNLLHDQLYKKPI  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP             G  W +IK WLDKQ+   V+YVA G+EA  S  EL E+AL
Sbjct  243   IPVGFLPPIVEHNEEDDTKDGLKWGNIKEWLDKQKANSVVYVALGTEASLSGEELKELAL  302

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE S  PFFWVL    G     L  LP+GF+ER K RGIV   WAPQ+KILSH+SVGGF
Sbjct  303   GLENSTLPFFWVLNKIPGSTKNALDMLPDGFQERVKNRGIVHGGWAPQVKILSHDSVGGF  362

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             +TH GW+S++E + F + L+LL  L DQGLN+R+L  KK+G  +PR E+DG FT  +VAE
Sbjct  363   MTHCGWNSIIEGLTFGRVLILLPILNDQGLNSRLLHGKKLGLEIPRKEQDGSFTWASVAE  422

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             S+R  +V+  G  +R + +E++ LF D  R + +V  L++YL  +K  +
Sbjct  423   SMRTAMVDDSGVPWRNRAREIRCLFGDVDRNNCFVARLVNYLAENKKAR  471



>ref|NP_199780.1| UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
 sp|Q9LTA3.1|U91C1_ARATH RecName: Full=UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
 dbj|BAA98157.1| anthocyanidin-3-glucoside rhamnosyltransferase-like [Arabidopsis 
thaliana]
 dbj|BAC41828.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
 gb|AAO63454.1| At5g49690 [Arabidopsis thaliana]
 gb|AED95845.1| UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
Length=460

 Score =   437 bits (1125),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 217/463 (47%), Positives = 298/463 (64%), Gaps = 14/463 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D     +H+ M+PWLA GH++P+L LSK +A +GHK+SF+STPRNI+RLPKL  NLAS I
Sbjct  3     DKREEVMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSI  62

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV  PLPP   LP ++E+++D+PY+K + LK A D LQ  + +FL   SPDWI++D+ S
Sbjct  63    TFVSFPLPPISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLKEFLRRSSPDWIIYDYAS  122

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  +A++LG+S A FS+F   T+ F G      E  R+  ED+TV P W+PFK+ + F
Sbjct  123   HWLPSIAAELGISKAFFSLFNAATLCFMGPSSSLIEEIRSTPEDFTVVPPWVPFKSNIVF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +E+ R ++   E+   VSD  R    ++  D V VR C EF+ EW  LL+++++KPVF
Sbjct  183   RYHEVTRYVEKTEEDVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVF  242

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G LP    D     +    +W  IK WLDKQ    V+YV+ G+EA     E+TE+ALG
Sbjct  243   PIGFLPPVIED----DDAVDTTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALG  298

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVLR      +P+   +P+GF+ R KGRG+V   W PQ+KILSHESVGGFL
Sbjct  299   LEKSETPFFWVLR-----NEPK---IPDGFKTRVKGRGMVHVGWVPQVKILSHESVGGFL  350

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+SVVE + F K  +    L +QGLN R+L  K +G  V RDERDG F  ++VA+S
Sbjct  351   THCGWNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVADS  410

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHC  242
             +RLV+++  G   R K K MK LF +      YVD L+ ++  
Sbjct  411   IRLVMIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRS  453



>ref|XP_010440988.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Camelina sativa]
Length=497

 Score =   438 bits (1126),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 223/456 (49%), Positives = 297/456 (65%), Gaps = 19/456 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             +HI M+PWLA GH++P+L LSK +A +GHK+SF+STPRN++RLPKLP NL+S I FV  P
Sbjct  45    MHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITFVSFP  104

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP    L   +E+++D+PY+K + LK A D LQ  + +FL   SPDWI++D+ S+WL  +
Sbjct  105   LPLISGLSPTSESSMDVPYNKQQSLKAAFDLLQAPLKEFLLRSSPDWIIYDYASHWLPSI  164

Query  1246  ASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             A++LG+S A FS+F   T+ F G    L+D   RT  ED+TV P W+PFK+ VAFR +E+
Sbjct  165   AAELGISKAFFSLFNAATLCFLGPSSSLID-EFRTTPEDFTVVPPWVPFKSNVAFRYHEV  223

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              R ++   E+   VSD  R    +   D V VR C EF+SEW  LL++++QKPVFP G L
Sbjct  224   TRYVEKTDEDVTGVSDSVRFGYSIGESDAVFVRSCPEFESEWFGLLKDLYQKPVFPTGFL  283

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P    D          +W  IK WLDKQ    V+YV+ G+EA   + E+TE+ALGLE S 
Sbjct  284   PPVIED-------DDTTWVRIKEWLDKQRVNSVVYVSLGTEASLCREEVTELALGLEKSE  336

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWVLR             P+GFEER KGRG+V   W PQ+KIL HESVGGFLTH GW
Sbjct  337   TPFFWVLRNEP--------LTPDGFEERVKGRGMVHVGWVPQVKILRHESVGGFLTHCGW  388

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             +SVVE + F K  + L  L +QGLN R+L  K IG  V RDERDG F   +VA+S+RLV+
Sbjct  389   NSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADSVRLVM  448

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V++EG   R+K K MKGLF +      +VD ++ ++
Sbjct  449   VDEEGESIRDKAKLMKGLFGNMDENIRHVDEIVSFM  484



>ref|XP_010430764.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=440

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/468 (46%), Positives = 300/468 (64%), Gaps = 40/468 (9%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + + +KLH+ M+PWLAFGH++P+LELS  +  +GH                         
Sbjct  8     NRDETKLHVAMFPWLAFGHLVPHLELSMLMVEKGH-------------------------  42

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
                 LP   H+NLPE AEAT D+P+D V YLK+A D L+  + +FL+   PDW+L DF  
Sbjct  43    ---TLPFAGHKNLPEAAEATTDVPFDLVPYLKIAFDGLRAPLTEFLKSSKPDWLLQDFAP  99

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLV--DFAE-RTKAEDYTVPPKWIPFKTTVA  1094
             YWL P+AS+LG+  A F  F      FFG L    F E R   ED+   PKW+PF+T V 
Sbjct  100   YWLPPIASRLGIKNAFFGAF---NCGFFGILKPPGFEEYRKSPEDFVTMPKWVPFETPVF  156

Query  1093  FRLYEILRIIDAVTEE--DDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             F+L+E     +    E  + N+ D+ R+   ++ CDI+ +R C+E+++EWL+LL+++H+K
Sbjct  157   FQLFESKAFFNGAVVESTEGNIPDLDRIAGVLDGCDIIVIRSCNEYETEWLELLQDLHRK  216

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV PVG LP    +         D+W   K WLD ++T  V+YV+FG+EAKPSQ+E   I
Sbjct  217   PVIPVGVLPPKLDETF----KDTDAWLSTKKWLDSRKTNSVVYVSFGTEAKPSQSEFNSI  272

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             ALGLELSG PFFWVLR RRG  D E + LPEGFEERT  RG+V   W  QL+ L+H+S+G
Sbjct  273   ALGLELSGLPFFWVLRTRRGPLDTEPLELPEGFEERTADRGMVWRGWVEQLRTLNHDSIG  332

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
               L+HSGW++++EA++F KP+V++ F+  QG NARV EEKKIG+ + RDE  G FT+E V
Sbjct  333   LVLSHSGWNTLIEAVRFAKPMVMIGFVYGQGFNARVAEEKKIGHMILRDETTGSFTKEDV  392

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             A++LRLV+  +EG +YRE +K+MKG+F D   QD YVD+ L YL  H+
Sbjct  393   AKALRLVMDGEEGKVYRESVKDMKGVFGDMDTQDRYVDSFLDYLVTHR  440



>emb|CDP00929.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/476 (46%), Positives = 303/476 (64%), Gaps = 10/476 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M+PWLA GH+IP+  LSK +A +GHK+SF+STPRN+ RLPK+P  LAS+I  V +P
Sbjct  7     LHVVMFPWLAMGHLIPFFRLSKLLAGKGHKISFISTPRNLQRLPKIPQELASQIELVSIP  66

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEF--SPDWILHDFDSYWLA  1253
             LP   NLP+  E + D+P++K ++LK+A D L+  +A FLE     PDWI+HD+ S+WL 
Sbjct  67    LPEVDNLPKQGETSTDIPHEKDQFLKIAFDLLRSPIASFLENTRPKPDWIIHDYASHWLP  126

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
              +A++ GVS A FS+FT   ++F GR    L     R+ AED+TV PKWIPF +  A+RL
Sbjct  127   EIAAQNGVSAAFFSLFTAAALSFLGRPSALLSGEDGRSTAEDFTVVPKWIPFPSNCAYRL  186

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +E+ + I+  +  +   SD  R  + ++R D+V  R   EF+ EW  L+  ++QKPV  +
Sbjct  187   HEVRKNIEDASGNESGASDFVRFAASIDRSDLVIFRTSVEFEPEWFNLVRELYQKPVVSL  246

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP +  D       T + W+ I+ WLDKQ   KV+YVA G+EA  SQ E+ ++A+GLE
Sbjct  247   GVLPPSLDDDD--ELETDEKWQKIQNWLDKQTASKVVYVALGTEATISQKEVQDLAIGLE  304

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEER--TKGRGIVCTSWAPQLKILSHESVGGFL  551
              S  PFFWVLR   G        LPEGF ER    G+G+V T W PQ+KILSH ++GG+L
Sbjct  305   QSELPFFWVLRKPPGSKKDVTDMLPEGFRERINANGQGVVYTEWVPQVKILSHPAIGGYL  364

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+SV+EA+ F + L+L   + DQGLNAR+LE KK+G  +PR   DG FT  AVAE+
Sbjct  365   THCGWNSVIEALGFGRVLILFPVMNDQGLNARLLEGKKVGVEIPRAAEDGLFTSTAVAET  424

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             LR  VV +EG   R   ++M  LF +  R   Y+DT +  L   K   +   T ++
Sbjct  425   LRYAVVSEEGEPMRANARQMTSLFGNGKRNQDYIDTFVRCLEERKISNFLASTSTS  480



>ref|XP_002303861.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE78840.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=473

 Score =   436 bits (1120),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 307/469 (65%), Gaps = 5/469 (1%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             +G++L ++M+PWLA GH+IP+L+LSK +A +GHK+ FVSTPRN++RLPK+P  L+S I  
Sbjct  3     DGNRLQVVMFPWLATGHLIPFLQLSKLLAEKGHKIFFVSTPRNLNRLPKIPKQLSSEIIL  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V  P P   NLP  AE++ D+PY K + LK   D L+  +  FLE   PDWI +D+ S+W
Sbjct  63    VSFPFPHVPNLPSCAESSTDVPYTKQQLLKKGFDLLEPPLTTFLESSKPDWIFYDYASHW  122

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAE-RTKAEDYTVPPKWIPFKTTVAF  1091
             L  VA++LG+S A FS+FT   +++ G    L+   + R+KAED+TV PKWIPF++ + F
Sbjct  123   LPSVAARLGISCAFFSLFTAACLSYIGPPSALMTIGDPRSKAEDFTVVPKWIPFESDLVF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLL-ENIHQKPV  914
             RL+E+ + ++   E++   SD+ R        D+V +R   EF+ EW  LL + +++KP+
Sbjct  183   RLHEVTKYVEKTEEDETGPSDLIRFGFAAGGSDVVIIRSSPEFEPEWFNLLHDQLYKKPI  242

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP             G  W +IK WLDKQ+   V+YVA G+EA  S  EL E+AL
Sbjct  243   IPVGFLPPIVEHNEEDDNIDGHEWSNIKEWLDKQKVHSVVYVAIGTEASLSGEELKELAL  302

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE S  PFFWVL    G     L  LP+GF+ER K RGI+   WAPQ+KILSH+SVGGF
Sbjct  303   GLENSTLPFFWVLNKIPGSTKNALDMLPDGFQERVKNRGIIHGGWAPQVKILSHDSVGGF  362

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             +TH GW+S++E + F + L+LL  L +QGLN+R+L  KK+G  +PR E+DG FT  +VAE
Sbjct  363   MTHCGWNSIIEGLTFGRVLILLPILNEQGLNSRLLHGKKLGLEIPRKEQDGSFTWASVAE  422

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             S+R  +V+  G  +R + +E++ LF D  R + +V +L++YL  +K  +
Sbjct  423   SMRTAMVDDSGVSWRNRAREIRYLFGDVDRNNCFVASLVNYLTENKKAR  471



>ref|XP_010934416.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=465

 Score =   434 bits (1117),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 222/464 (48%), Positives = 304/464 (66%), Gaps = 7/464 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             EG  L I+ +PWLAFGHM+P+L+LSK +A RGH++SF+STPRN+ RLPK+PP+LA  I+F
Sbjct  2     EGGSLRIVFFPWLAFGHMLPFLDLSKSLAKRGHRISFLSTPRNLQRLPKIPPDLAPLIHF  61

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDS  1265
             V LPLP  + LPE AE+T D+  D+V++LK A D L    +KFLEE SP  DWI+HDF  
Sbjct  62    VSLPLPKVEGLPEAAESTTDVRPDEVQFLKKAFDGLAIPFSKFLEESSPKPDWIIHDFGH  121

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAF  1091
             +WL P+AS   +  A  SI     +AF G   +   + R   E +T PP+WI F T+VA+
Sbjct  122   HWLPPIASGFHIPCAFLSILPASFIAFVGPPSEMKRSSRRTPEQFTKPPEWISFPTSVAY  181

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
              L+E   +++A       ++D+ R    VE C  VA R C EF+S+WL+LLE +++KPV 
Sbjct  182   HLHEAKWMVEAFKANASGIADLQRFCLTVEGCHFVAFRSCFEFESDWLRLLEELYKKPVI  241

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP    + G   +  G +   I  WLD Q    V+YVA GSEA  S   L E+ALG
Sbjct  242   PVGLLPPQVQE-GSPDDVHGKA--RIFEWLDTQAPKSVVYVALGSEAMLSIELLHELALG  298

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELS  PF W LR   G A  +   LPEGFEERT+G+G+V   W PQ+K+L+H SVGGFL
Sbjct  299   LELSKVPFLWALRKPAGMAGDDADILPEGFEERTEGQGVVAKGWIPQIKVLAHASVGGFL  358

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW S++E ++F   L+LL    DQGLNAR++ EKKIG  + R+E DG F RE+VA++
Sbjct  359   THCGWGSIIEGLRFGHGLMLLPIAVDQGLNARIMGEKKIGLEIQRNEVDGSFNRESVAKA  418

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             +R V+VE+EG  +R K +E++ +F D+  Q+ Y++  + +L  H
Sbjct  419   IRSVMVEEEGEPFRFKAQELQHVFADKDSQERYMENFIRHLRDH  462



>emb|CDP00928.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   435 bits (1118),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 308/474 (65%), Gaps = 11/474 (2%)
 Frame = -2

Query  1618  EGSK-LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             E SK LH++M+PWLA GH+IP+L LSK +A +GHK+SF+STPRN+ R+PK+P +LAS I 
Sbjct  2     ENSKFLHVVMFPWLAMGHLIPFLRLSKCLAQKGHKISFISTPRNLQRIPKVPHDLASLIE  61

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFD  1268
              V +PLP   NLP+  E+++D+P++K ++LK+A D LQ  +A FLE  +P  DWIL+D+ 
Sbjct  62    MVSIPLPEGDNLPKQGESSMDVPHEKEQFLKIAFDLLQSPIATFLENTTPKPDWILYDYA  121

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTT  1100
             S+WL  +A+K G++ A FS+FT  T+A+ G     L +   R+ AE +T  PKWIPF   
Sbjct  122   SHWLPEIAAKNGIARAYFSLFTAATMAYIGPPSILLNEVDGRSTAEAFTRVPKWIPFPLN  181

Query  1099  VAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             +A+RL+E+ + I+  +  +   SD+ R  + +E  D+V  R C EF+ EW  L+  +++K
Sbjct  182   IAYRLHEVAKHIEDSSGNESGTSDVIRFAAAIEGSDLVVFRTCVEFEPEWFDLVCELYKK  241

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV  +G LP +  +       T ++W  IK WLDKQ   +V+YVA G+E    QTE+ E+
Sbjct  242   PVISLGVLPPSLDEDD--ELETDETWLSIKDWLDKQSVSRVVYVALGTEVALGQTEVHEL  299

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEER--TKGRGIVCTSWAPQLKILSHES  566
             ALGLE S  PFFWVLR   G        LPEGF ER    GRG++ T W PQ+KILSH +
Sbjct  300   ALGLEQSELPFFWVLRKSPGSTKDVSQMLPEGFTERINANGRGVIYTEWVPQVKILSHPA  359

Query  565   VGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTRE  386
             +GG+LTH GW+SV+EA+ F + L+L   + DQGLNAR+LE KK+G  +PR+  DG FT  
Sbjct  360   IGGYLTHCGWNSVIEALGFGRVLILFPVMNDQGLNARLLEGKKVGVEIPREAEDGSFTST  419

Query  385   AVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKY  224
             AVAE+LRL VV ++G   R    +MK LF D      Y+D+ +  L   K I +
Sbjct  420   AVAETLRLAVVSEDGESMRANALKMKNLFGDGNANQSYLDSFVRSLEEKKHILF  473



>ref|XP_010442438.1| PREDICTED: UDP-glycosyltransferase 91C1 [Camelina sativa]
Length=465

 Score =   433 bits (1114),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/456 (48%), Positives = 297/456 (65%), Gaps = 16/456 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             +HI M+PWLA GH++P+L LSK +A +GHK+SF+STPRN++RLPKLP NL+S I FV  P
Sbjct  10    MHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITFVSFP  69

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP    L   +E+++D+PY+K + LK A D LQ  + +FL   SPDWI+ D+ S+WL  +
Sbjct  70    LPLISGLSPTSESSMDVPYNKQQSLKAAFDLLQAPLKEFLGRSSPDWIIFDYASHWLPSI  129

Query  1246  ASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             A++LG+S A FS+F   T+ F G    L+D   RT  ED+TV P W+PFK+ +AFR +E+
Sbjct  130   AAELGISKAFFSLFNAATLCFLGPSSSLID-ELRTTPEDFTVVPPWVPFKSNIAFRYHEV  188

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              R ++   E+   VSD  R    +   D V VR C EF+ EW  LL++++QKPVFP G L
Sbjct  189   TRYVEKTDEDVTGVSDSVRFGYSIGESDAVFVRSCPEFEPEWFGLLKDLYQKPVFPSGFL  248

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P    +     +    +W  IK WLDKQ    V+YV+ G+EA   + E+TE+ALGLE S 
Sbjct  249   PPVIEED----DDDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALGLEKSE  304

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWVLR           H+P+GFEE  KGRG+V   W PQ+KIL HESVGGFLTH GW
Sbjct  305   TPFFWVLRNEP--------HIPDGFEETVKGRGMVHVGWVPQVKILRHESVGGFLTHCGW  356

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             +SVVE + F K  + L  L +QGLN R+L  K IG  V RDERDG F   +VA+S+RLV+
Sbjct  357   NSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADSVRLVM  416

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V++EG   R+K K MKGLF +      +VD ++ ++
Sbjct  417   VDEEGESIRDKAKLMKGLFGNMDENIRHVDEIVSFM  452



>ref|XP_008788945.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=464

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/467 (48%), Positives = 305/467 (65%), Gaps = 10/467 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   L I+ +PWLAFGHM+P+LELSK +A RGH++SF+ST RN+ RLPK+P +LA  I+F
Sbjct  3     EDGSLRIVFFPWLAFGHMLPFLELSKSLAKRGHRISFLSTRRNLKRLPKIPHDLAPFIHF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDS  1265
             V LPLP  + L   AE+T D+  D+V++LK A D L    ++FLEE SP  DWI+HDF  
Sbjct  63    VYLPLPKVEGLRAAAESTTDVLPDEVQFLKKAFDGLDIPFSEFLEEASPKPDWIIHDFGH  122

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             +WL P+ASK  +  A   I     +AF G    + D + RT AE +T PP+WI F ++VA
Sbjct  123   HWLPPIASKFNIPCAFLCIVPASFIAFIGPPSEMKDSSRRT-AEQFTKPPQWISFPSSVA  181

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             +RL+E   I+++       ++DI R    VE C+ +A R C EF+S+WL+LLE +++KPV
Sbjct  182   YRLHEARLIVESFKANASGIADIRRFCLTVEGCNFIAFRSCFEFESDWLRLLEELYEKPV  241

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP    +  G  +  G++   I  WLDKQ    V Y A GSEA  S   L E+AL
Sbjct  242   IPVGLLPPQVQE--GSDDVHGNA--RIFEWLDKQAPNTVAYAALGSEAMLSVELLHELAL  297

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELS  PF W LR     A  +   LPEGF ERT G+GIV   W PQ+K+L+H SVGGF
Sbjct  298   GLELSKVPFLWALRKPASMAGDDADILPEGFLERTGGQGIVAMGWIPQIKVLAHASVGGF  357

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTHSGW S++E ++F   LVLL    DQGLNAR++EEKKIG  + R+E DG F RE+VA+
Sbjct  358   LTHSGWGSIIEGLRFGHGLVLLPISVDQGLNARIMEEKKIGLEIQRNEEDGSFNRESVAK  417

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             ++RLV+VE+EG ++R K  E++ LF D+  Q+ YV+  + +L  H+ 
Sbjct  418   AIRLVMVEEEGELFRCKAMELQRLFADRDSQERYVEDFILHLRYHRG  464



>ref|XP_009108218.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Brassica rapa]
Length=473

 Score =   433 bits (1114),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 305/469 (65%), Gaps = 9/469 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   LH+ M+PWLA GH++P+L +SK +A +GHKVSF+STPRNI+RLPKLPPNL+S I F
Sbjct  11    EDETLHVAMFPWLAMGHLLPFLNISKLLAQKGHKVSFISTPRNIERLPKLPPNLSSSITF  70

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V LPLPP  NLP ++E+++D+PY   + LK A D LQ  + +FL   SPDWI++D+ S+W
Sbjct  71    VSLPLPPIPNLPPSSESSMDVPYINQQSLKSAFDLLQLPVTEFLRRSSPDWIIYDYTSHW  130

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAFRL  1085
             L PVA++LG+  A FS+F    + F G      E  RT  +D+TV P WIPF++ V FR 
Sbjct  131   LPPVATELGIKKAFFSLFNASALCFMGPPSSLIEDARTTPDDFTVVPPWIPFESDVVFRY  190

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +E+ R ++   E+   +SD  R    +   D V VR C EF+ EW  LL +++QKPVFP 
Sbjct  191   HEVARYVEKTEEDVTGISDSVRFGYSIGESDAVFVRSCPEFEPEWFVLLRDLYQKPVFPT  250

Query  904   GQLPTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             G LP    +    HE  GD +W  IK WLDKQ    V+YV+ G+EA   + EL E+ALGL
Sbjct  251   GFLPPPVSE---DHEDDGDATWARIKEWLDKQRVNSVVYVSLGTEASLPREELAELALGL  307

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             E S  PF W LR     ++P    +P+GFEER  GRG+V   W PQ+KILSHESVGGFLT
Sbjct  308   EKSKVPFLWALRNEPTRSEP---LIPDGFEERVGGRGMVHVGWVPQVKILSHESVGGFLT  364

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GW+SVVE + F +  + L  L +QGLN R+L  K IG  +PR+ERDGRF  ++VA+++
Sbjct  365   HCGWNSVVEGLGFGRVPIFLPVLNEQGLNTRLLRGKDIGVEIPRNERDGRFWSDSVADTV  424

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYG  221
             RL +++  G + R K+K MKGLF ++     YVD L+ Y+    S   G
Sbjct  425   RLAMIDDAGELKRTKVKMMKGLFGNRDENILYVDELIDYMKSKGSSHVG  473



>ref|XP_010482257.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X1 [Camelina 
sativa]
 ref|XP_010482258.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X2 [Camelina 
sativa]
Length=461

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/461 (48%), Positives = 298/461 (65%), Gaps = 16/461 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             +HI M+PWLA GH++P+L LSK +A +GHK+SF+STPRN++RLPKLP NL+S I FV  P
Sbjct  10    MHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITFVSFP  69

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP    L   +E+++D+PY K + LK A D LQ  + +FL   SPDWI+ D+ S+WL  +
Sbjct  70    LPLISGLSPTSESSMDVPYIKQQSLKAAFDLLQAPLKEFLGRSSPDWIIFDYASHWLPSI  129

Query  1246  ASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             A++LG+S A FS+F   T+ F G    L+D   RT  ED+TV P W+PFK+ VAFR +E+
Sbjct  130   AAELGISKAFFSLFNAATLCFLGPSSSLID-ELRTTPEDFTVVPPWVPFKSNVAFRYHEV  188

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              R ++   E+   VSD  R    +   D V VR C EF+ EW  LL++++QKPVFP G L
Sbjct  189   TRYVEKTDEDVTGVSDSVRFGYSIGESDAVFVRSCPEFEPEWFGLLKDLYQKPVFPTGFL  248

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P    D  G  + T  +W  IK WLDKQ    V+YV+ G+EA   + E+TE+ALGLE S 
Sbjct  249   PPVIED--GDDDDT--TWVCIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALGLEKSE  304

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWVLR           H+P+GFE+  KGRG+V   W PQ+KIL HESVGGFLTH GW
Sbjct  305   TPFFWVLRNEP--------HIPDGFEKTVKGRGMVHVGWVPQVKILRHESVGGFLTHCGW  356

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             +SVVE + F K  + L  L +QGLN R+L  K IG  V RDERDG F   +VA+S+RLV+
Sbjct  357   NSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADSVRLVM  416

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             +++EG   R+  K MKGLF +      +VD ++ ++    S
Sbjct  417   MDEEGESIRDTAKLMKGLFGNMDENIRHVDEIVSFMTSKGS  457



>emb|CAN73977.1| hypothetical protein VITISV_022298 [Vitis vinifera]
Length=438

 Score =   432 bits (1111),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 289/462 (63%), Gaps = 38/462 (8%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA +GH++SF+STPRNIDRLPKLPP L   IN +KL
Sbjct  6     KLHIVMFPWLAFGHILPYLELSKLIAQKGHRISFISTPRNIDRLPKLPPILQPLINLIKL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY+K+ YLK A D LQE + +FL    PDW++HDF  +WL P
Sbjct  66    PLPKVDNLPENAEATTDLPYEKIPYLKKAFDGLQEPVTRFLINSHPDWVVHDFAPHWLPP  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             V  + GVS + FSIF   T+ F G     + D   R +   + VPP W+PF + +    +
Sbjct  126   VLDEHGVSRSFFSIFGASTLCFLGSXSIMMGDGDPRKELHQFAVPPPWVPFPSNLGLPPF  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             ++  ++         VSD +R+ S +  CD+VAVR C+E +SEWL LL  ++ KPV P+G
Sbjct  186   QMKTVLGYDQPNLSGVSDSYRMGSVISACDVVAVRSCAELESEWLDLLRELYHKPVLPIG  245

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP  A  +G       DSW  I  WLDKQE   V                        L
Sbjct  246   LLPPLAPVSG-----EDDSWIPILEWLDKQEKASV------------------------L  276

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PFFW LR R      + + LP+GFE+RTK RG+V  +WAPQL+IL HESVGGF+TH 
Sbjct  277   SGLPFFWALRKRH-----DSVELPDGFEDRTKDRGVVWRTWAPQLRILGHESVGGFVTHC  331

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             G SSVVE + F + L +     DQG+ A+  +E K+G  +PRDE +G F+ ++VA++L L
Sbjct  332   GLSSVVEGLXFGRALXMFPLWGDQGIIAKAFQEMKVGIEIPRDEEEGWFSSKSVAQTLSL  391

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             V+VE+ G IYREK KE+  LF D+  Q  Y++  + YL  H+
Sbjct  392   VMVEEXGRIYREKAKELSKLFGDKDLQQRYINDFVEYLQNHR  433



>ref|XP_010910495.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=472

 Score =   433 bits (1113),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 298/459 (65%), Gaps = 6/459 (1%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++++PWLAFGHM+P+LELSK +A RGH++SF+STPRNI RLP +PP +AS ++ V LP
Sbjct  6     LHVVVFPWLAFGHMLPFLELSKSLAKRGHRISFLSTPRNIRRLPNIPPQIASLVDLVSLP  65

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYWLA  1253
             LP    LPE+AEAT DLP  +V+YLK A D L E  A+FL+E SP  DWI+HDF  +W++
Sbjct  66    LPKVDGLPEDAEATTDLPPPEVQYLKKAFDGLDEPFARFLQEVSPKPDWIIHDFCHHWIS  125

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDF---AERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             P+AS+  V  A FSI    ++ F G   +      R   E +T PP+WI F ++ AFRL+
Sbjct  126   PIASRSKVPCAFFSIIPSSSLVFLGPPSEMKLGGLRRTPEQFTKPPEWISFPSSAAFRLH  185

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP-VFPV  905
             E    ++   +     SDI RL   ++ C++VA+R C EF+S+WL LLE +++K  V PV
Sbjct  186   EARVFMEHYRDNASGFSDIQRLERIIQGCELVAIRSCKEFESDWLALLEELYEKKTVVPV  245

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP    +              +  WL+ Q  G V+YVA GSEA  S   + E+ALGLE
Sbjct  246   GLLPPHVQERIEDVHTNTTGAAQVFEWLNGQTPGSVVYVALGSEAMLSVELMHELALGLE  305

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LS  PF W LR   G    ++  LPEGFE+RT+G G+V   W PQL +L+H SVGGFLTH
Sbjct  306   LSEVPFVWALRKPAGMGAGDVEILPEGFEDRTRGLGVVAKGWIPQLSVLAHPSVGGFLTH  365

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              GWSS++E +QF   L+LL    DQGL AR++EEKKIG  VPR+E DG F++E VA+++R
Sbjct  366   CGWSSIIEGLQFGHALILLPLFVDQGLIARIMEEKKIGLEVPRNEEDGSFSKEGVAKAIR  425

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             L++VE+E   +R K  ++K +F D   Q+ YVD  +  L
Sbjct  426   LIMVEEEAEPFRCKAGDLKEVFSDNGSQERYVDNFVRCL  464



>ref|XP_006353004.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Solanum tuberosum]
Length=474

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/468 (46%), Positives = 313/468 (67%), Gaps = 13/468 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRL-PKLPPNLASR  1448
             ++E  +LH++M+PWLA GH+IP+  LSK +A RGH+V+F+STPRNI+R+  K+P +LA  
Sbjct  2     ENEKERLHVVMFPWLAMGHIIPFFHLSKCLAQRGHRVTFISTPRNIERVVNKVPSDLAPL  61

Query  1447  INFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFS---PDWILH  1277
             ++ +  PLP  +NLP +AE+++D+PY K ++LK+A D L+  +  FLE  S   PDWI++
Sbjct  62    LHILSFPLPKVENLPNDAESSMDIPYQKAQFLKIAFDLLEIPLTNFLESSSNPKPDWIVY  121

Query  1276  DFDSYWLAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFK  1106
             D+ S+WL  +A KLGVS A FS+FT  T++F+G    L++  +R+  EDYTV PKWIP +
Sbjct  122   DYASHWLPQIAGKLGVSRAFFSLFTAATMSFYGPPWALLN-DDRSIPEDYTVIPKWIPLE  180

Query  1105  TTVAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIH  926
             T V +RL+EI +  +A  +E    SD  R  + ++  D++  R C EF+ EW  L+  ++
Sbjct  181   TKVVYRLHEIKKNFEAPADES-GTSDGVRFGASIDGSDVILFRNCVEFEPEWFSLVCELY  239

Query  925   QKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELT  746
             QKPV  +G LP +  +     +    +W  IK WLDKQ    V+YVA G+EA  +Q EL 
Sbjct  240   QKPVISIGVLPPSVVE-NEKFDSNDTTWLGIKNWLDKQNQDSVVYVALGTEATLNQEELN  298

Query  745   EIALGLELSGFPFFWVLRAR--RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSH  572
             E+ALGLE  G PF WVLR +    + D   I LP+G+E+R K RG++   W PQ KILSH
Sbjct  299   ELALGLEKCGLPFIWVLRDQPIHNQEDSR-IQLPDGYEDRVKNRGVIYKGWVPQTKILSH  357

Query  571   ESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFT  392
              SVGGFLTH GW+SV+EA+ F + L++   L DQGLN R+L+EK +G  +PR+E+DG FT
Sbjct  358   LSVGGFLTHCGWNSVIEALCFGRVLIMFPVLNDQGLNTRLLQEKGVGVEIPRNEKDGFFT  417

Query  391   REAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              ++VAE+++  VV +EG + R+  ++M GLF D+ R +  +D  + YL
Sbjct  418   SDSVAEAVKFGVVSEEGELLRDNARQMSGLFGDRKRNEELIDDCVGYL  465



>ref|XP_010547586.1| PREDICTED: UDP-glycosyltransferase 91B1 [Tarenaya hassleriana]
Length=466

 Score =   430 bits (1105),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 297/469 (63%), Gaps = 20/469 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH++++PWLAFGHMIP+LELS  IA +GH VSF+STPRNI RL ++P   ++ + FV L
Sbjct  8     KLHVVVFPWLAFGHMIPFLELSNRIAMKGHTVSFISTPRNICRLSQIPSLSSTPVTFVAL  67

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLPP  +LPENAEAT DLP   V +LK A D + E  ++FLE   PDW++ DF  +W+ P
Sbjct  68    PLPPVDHLPENAEATTDLPETHVGFLKKAFDGMSEAFSEFLEASRPDWVIFDFVQHWVPP  127

Query  1249  VASKLGVSTALFSIFTPPTVAFFG----RLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A KLGVS A FS F   T+   G     ++D  + R  A D TVPP W+PF+T V FRL
Sbjct  128   IAEKLGVSRAFFSTFNAATICIIGGPSSDMIDGRDPRKTAMDLTVPPPWVPFETHVLFRL  187

Query  1084  YEILRIID----AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             +E  +I++     VT  D N  D +R        D++A+R C E + EW++LL  +H KP
Sbjct  188   FEARKIMEYPTAGVTGSDLN--DNYRAGLACTGSDVIAIRTCMELEPEWIQLLGKLHDKP  245

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V   G L      AG    P   +W+DI  WLDKQ+   V+YVA G+E   +  E+  +A
Sbjct  246   VILTGLL-----SAGPVDNPDDRTWQDISGWLDKQQRNSVVYVALGTEVTVTPEEIQGLA  300

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELSG PF W LR +R EA  +L  LP GFEER  G+GIV T W PQ KILSH S+GG
Sbjct  301   HGLELSGLPFLWALR-KRTEASGQL--LPHGFEERVNGQGIVWTGWVPQTKILSHGSIGG  357

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             F+TH GW S VE + F +PL++     DQ L AR L    +G  +PRDE+DG FT  +VA
Sbjct  358   FVTHCGWGSAVEGLSFGRPLIMFPCNLDQPLVARFLAGMNVGVEIPRDEKDGSFTIGSVA  417

Query  376   ESLRLVVVEKEGNIYREK-IKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             E++R VV E++G IYRE    + K +F ++T QD YV+T + +L  H++
Sbjct  418   ETIRKVVTEEDGKIYRENAASQQKRVFGNKTLQDQYVNTFVEFLVNHRA  466



>gb|KFK29804.1| hypothetical protein AALP_AA7G181400 [Arabis alpina]
Length=457

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/458 (46%), Positives = 296/458 (65%), Gaps = 17/458 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI M+PWLA GH++P+L LSK +A +GHK+S++STPRNI RLPKLP  L+S I F+  P
Sbjct  9     LHIAMFPWLAMGHLLPFLNLSKSLAQKGHKISYISTPRNIQRLPKLPSTLSSSITFISFP  68

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LPP   L  + E+++D+PY+K + LK A D LQ  +  FL   SPDWI++D+ S+WL  +
Sbjct  69    LPPFPGLSPSFESSMDIPYNKQQSLKSAFDLLQTPIKNFLLRSSPDWIIYDYASHWLPSI  128

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
             A++LG+S A FS+F   ++ F G      +  R+K ED+TV P W+PF++ + FR +E+ 
Sbjct  129   ATELGISKAFFSLFNAASLCFMGPPSSLIQETRSKPEDFTVVPSWVPFESNIVFRYHEVA  188

Query  1072  RIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
             R ++   E+   VSD  R    +   D+V VR C EF+ EW +LL +++QKPVFP G LP
Sbjct  189   RYVEKTEEDVTGVSDSVRFGYSIGESDVVIVRSCVEFEPEWFRLLLDLYQKPVFPTGFLP  248

Query  892   TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGF  713
               +   G        +W  IK WLDKQ    V+YVA G+EA   + EL E+ LGLE+S  
Sbjct  249   PVSEGEGDDDA----TWVCIKEWLDKQRVNSVVYVALGTEASLPKEELAELGLGLEISNV  304

Query  712   PFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWS  533
              FFWVLR          + +P+GFEER + RG+V   W PQ+KILSHESVGGFLTH GW+
Sbjct  305   SFFWVLRNE--------LEIPDGFEERVEERGMVHVGWVPQVKILSHESVGGFLTHCGWN  356

Query  532   SVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVV  353
             SVVE +   +  +LL  L +QGLNAR+L+ K +G  + RDERDG F  ++VA S+RL ++
Sbjct  357   SVVEGLGLGRVPILLPVLNEQGLNARLLQGKGLGVEIVRDERDGTFDSDSVASSVRLAMM  416

Query  352   EKEGNIY---REKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             + + + Y   + K+K MK LF ++ +   YVD L+ YL
Sbjct  417   DDDVDAYESRKGKVKLMKDLFGNKDKSICYVDELVRYL  454



>ref|XP_006396998.1| hypothetical protein EUTSA_v10028640mg [Eutrema salsugineum]
 gb|ESQ38451.1| hypothetical protein EUTSA_v10028640mg [Eutrema salsugineum]
Length=466

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 301/466 (65%), Gaps = 12/466 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + EGS LH+ M+PWLA GH++P+L LSK +A +GHK+SF+STPRNI+RLPKLP NL+S I
Sbjct  9     EKEGS-LHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLPSNLSSSI  67

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV  PLPP  NLP ++E+++D+PY   + LK A D L+  + +FL   SPDWI++D+ S
Sbjct  68    TFVSFPLPPFPNLPPSSESSMDVPYINQQSLKSAFDLLKLPVTEFLRRSSPDWIIYDYAS  127

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  +A +LG+S A FS+F    + F G      E  R+  ED+TV P WIPF++ + F
Sbjct  128   HWLPSIAMELGISKAFFSLFNASALCFMGPPSSLIEDFRSTPEDFTVVPLWIPFESKIVF  187

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +E+ R ++   E+   VSD  R    +   D V VR C EF+ EW  LL++++QKP+F
Sbjct  188   RYHEVTRYVEKTEEDVTGVSDSVRFGYSISESDAVFVRSCPEFEPEWFGLLQDLYQKPIF  247

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P G LP  + D  G  E    +W  IK WLDKQ    V+YV+ G+EA   Q EL E+ALG
Sbjct  248   PTGFLPPVSEDVDGEEEDA--TWVCIKEWLDKQRVNSVVYVSLGTEASLPQEELVELALG  305

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVLR        E   + +GFEER KGRG+V   W PQ+KILSHESVGGFL
Sbjct  306   LEKSKVPFFWVLRN-------EETLILDGFEERVKGRGMVQVGWVPQVKILSHESVGGFL  358

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+SVVE + F +  + L  L +QGLN R+LE K IG  VPR+ERDG F  ++VA+S
Sbjct  359   THCGWNSVVEGLGFGRVPIFLPVLNEQGLNTRLLEGKGIGVEVPRNERDGSFDSDSVADS  418

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             +RL +V+  G   R   K MKGLF ++     YVD L+ Y+    S
Sbjct  419   VRLAMVDGGGESKRANAKMMKGLFGNKDENIRYVDELVGYMRSKGS  464



>ref|XP_008788932.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=494

 Score =   429 bits (1102),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 222/465 (48%), Positives = 293/465 (63%), Gaps = 9/465 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++++PWLAFGHM+P+LELSK +A RGH++SF+STPRNI RLPK+P  +AS ++ V LP
Sbjct  29    LHVVVFPWLAFGHMLPFLELSKSLAKRGHRISFLSTPRNIQRLPKIPSQIASLVDLVSLP  88

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYWLA  1253
             LP    LPE+AEAT D+P   V+YL  A D L E   +FL E SP  DWI+HDF  +W+ 
Sbjct  89    LPKVDGLPEDAEATTDIPPPMVQYLMKAFDGLDEPFTRFLREASPKPDWIIHDFSHHWIP  148

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDF---AERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             P+AS   V  A FSIF   T+ F G   +      R   E +T PP+WI F ++ AFRLY
Sbjct  149   PIASMFEVPCAFFSIFPSSTLVFIGPPSEMKLGGLRRTPEQFTKPPEWISFPSSAAFRLY  208

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK-PVFPV  905
             E         +     S+  RL   ++RC +VAVR C EF+S+WL LLE +++K PV P 
Sbjct  209   EARLFTAHYRDNASGFSEFRRLELVIQRCKLVAVRSCKEFESDWLPLLEELYEKKPVVPA  268

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP    +              +  WL+ Q  G V+ V  GSEA  S   + E+ALGLE
Sbjct  269   GLLPPHLQERIEDVHTNTTGVAQVFGWLNGQTLGSVVCVVLGSEATLSVELVHELALGLE  328

Query  724   LSGFPFFWVLRARRGEA-DPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             LS  PF W LR   G A D E+  LP+GFE RT+G G+V   W PQL +L+H SVGGF T
Sbjct  329   LSKVPFVWALRKPAGMASDVEI--LPKGFEVRTRGLGVVAMGWIPQLSVLAHPSVGGFFT  386

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GWSS++E +QF  PL+LL   AD GLNAR++E+K+IG  VPRDE DG F RE VA+ +
Sbjct  387   HCGWSSIIEGLQFGHPLILLPIFADHGLNARIMEDKRIGLEVPRDEEDGSFGREGVAKVI  446

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             RL++VE+EG  +R K  ++K +F D+  Q+ YVD L+  L  H +
Sbjct  447   RLIMVEEEGKPFRCKAGKLKEVFSDKESQERYVDNLVRCLQDHGA  491



>ref|XP_010535333.1| PREDICTED: UDP-glycosyltransferase 91C1 [Tarenaya hassleriana]
Length=461

 Score =   426 bits (1096),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 210/461 (46%), Positives = 299/461 (65%), Gaps = 11/461 (2%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
              E   +H++M+PWLA GH++P+L LSK +A +GH++SFVSTPRNI RLPKLPP+L + I 
Sbjct  4     EEIKTMHVVMFPWLAMGHLLPFLRLSKLLARKGHRISFVSTPRNISRLPKLPPDLTTMIT  63

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             FV   LPP   LP +AE+++D+PY+  + LK A D LQ  + +FL   SP+W+++D+ S+
Sbjct  64    FVPFTLPPVSGLPLDAESSMDVPYNTQQRLKAAFDLLQIPVTEFLRRSSPEWVVYDYASH  123

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAFR  1088
             WL  +A+++GVS A FSIF   ++ FFG   +     RT  ED+TV P W+PF++ +AFR
Sbjct  124   WLPKIAAEIGVSKAYFSIFNAASMCFFGPPEELIADSRTSPEDFTVVPTWVPFESDIAFR  183

Query  1087  LYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             ++EI + ++   E++  VSD  R    +   D V VR C EF+ EW  LL +++ KPV P
Sbjct  184   IHEITKYVEKTEEDETGVSDAVRFGYSIGESDAVLVRSCPEFEPEWFGLLLDLYGKPVVP  243

Query  907   VGQLPTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
              G LP    +         D +W  IK WLD+Q    V+YVA G+EA+ ++ EL E+ALG
Sbjct  244   TGFLPLVMEEEVFVENNDEDTTWIGIKKWLDEQRVNSVVYVALGTEARVTRKELGEMALG  303

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVLR            LP+G+ ER KGRG+V   W PQ+KILSH+SVGGF+
Sbjct  304   LEKSALPFFWVLRNES--------KLPDGYMERVKGRGLVHFGWVPQVKILSHDSVGGFV  355

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GWSSV+E +   +  +L   + DQGLNAR+L+ K +G  +PRDERDG F+ ++VA+S
Sbjct  356   THCGWSSVIEGLGLGRVPILFPVVNDQGLNARLLQGKGLGVEIPRDERDGSFSCDSVADS  415

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +R  + ++     R K+KEMK LF ++     +VD L+ YL
Sbjct  416   IRSAMADESDEPVRAKVKEMKSLFGNKDTDMRHVDELVRYL  456



>gb|ACE87855.1| UDP-glucosyltransferase [Stevia rebaudiana]
Length=473

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/459 (48%), Positives = 298/459 (65%), Gaps = 16/459 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LH+  +PWLAFGH++PYL+LSK IA +GHKVSF+ST RNI RL     +++  IN V+L
Sbjct  13    QLHVATFPWLAFGHILPYLQLSKLIAEKGHKVSFLSTTRNIQRLSS---HISPLINVVQL  69

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP  Q LPE+AEAT D+  + + YLK A D LQ  + +FLE+ SPDWI++D+  YWL  
Sbjct  70    TLPRVQELPEDAEATTDVHPEDIPYLKKASDGLQPEVTRFLEQHSPDWIIYDYTHYWLPS  129

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFA-----ERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A+ LG+S A FS+ TP  +A+ G   D        RT  ED T PPKW PF T V +R 
Sbjct  130   IAASLGISRAHFSVTTPWAIAYMGPSADAMINGSDGRTTVEDLTTPPKWFPFPTKVCWRK  189

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +++ R+   V  +   +SD +R+   ++  D +  +   EF ++WL LLE +HQ PV PV
Sbjct  190   HDLARL---VPYKAPGISDGYRMGLVLKGSDCLLSKCYHEFGTQWLPLLETLHQVPVVPV  246

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP        G E   ++W  IK WLD ++ G V+YVA GSE   SQTE+ E+ALGLE
Sbjct  247   GLLPPEV----PGDE-KDETWVSIKKWLDGKQKGSVVYVALGSEVLVSQTEVVELALGLE  301

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PF W  R  +G A  + + LP+GF ERT+ RG+V TSWAPQL+ILSHESV GFLTH
Sbjct  302   LSGLPFVWAYRKPKGPAKSDSVELPDGFVERTRDRGLVWTSWAPQLRILSHESVCGFLTH  361

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              G  S+VE + F  PL++L    DQ LNAR+LE+K++G  +PR+E DG  T+E+VA SLR
Sbjct  362   CGSGSIVEGLMFGHPLIMLPIFGDQPLNARLLEDKQVGIEIPRNEEDGCLTKESVARSLR  421

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              VVVEKEG IY+   +E+  ++ D   +  YV   + YL
Sbjct  422   SVVVEKEGEIYKANARELSKIYNDTKVEKEYVSQFVDYL  460



>gb|AAM53963.1|AF515727_1 UDP-glucosyltransferase [Stevia rebaudiana]
Length=473

 Score =   425 bits (1092),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 297/459 (65%), Gaps = 16/459 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LH+  +PWLAFGH++P+L+LSK IA +GHKVSF+ST RNI RL     +++  IN V+L
Sbjct  13    QLHVATFPWLAFGHILPFLQLSKLIAEKGHKVSFLSTTRNIQRLSS---HISPLINVVQL  69

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP  Q LPE+AEAT D+  + ++YLK A D LQ  + +FLE+ SPDWI++DF  YWL  
Sbjct  70    TLPRVQELPEDAEATTDVHPEDIQYLKKAVDGLQPEVTRFLEQHSPDWIIYDFTHYWLPS  129

Query  1249  VASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A+ LG+S A F + TP T+A+        + D   RT  ED T PPKW PF T V +R 
Sbjct  130   IAASLGISRAYFCVITPWTIAYLAPSSDAMINDSDGRTTVEDLTTPPKWFPFPTKVCWRK  189

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +++ R+      E   +SD +R+    +  D +  +   EF ++WL LLE +HQ PV PV
Sbjct  190   HDLARM---EPYEAPGISDGYRMGMVFKGSDCLLFKCYHEFGTQWLPLLETLHQVPVVPV  246

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP        G E   ++W  IK WLD ++ G V+YVA GSEA  SQTE+ E+ALGLE
Sbjct  247   GLLPPEI----PGDE-KDETWVSIKKWLDGKQKGSVVYVALGSEALVSQTEVVELALGLE  301

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PF W  R  +G A  + + LP+GF ERT+ RG+V TSWAPQL+ILSHESV GFLTH
Sbjct  302   LSGLPFVWAYRKPKGPAKSDSVELPDGFVERTRDRGLVWTSWAPQLRILSHESVCGFLTH  361

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              G  S+VE + F  PL++L    DQ LNAR+LE+K++G  +PR+E DG  T+E+VA SLR
Sbjct  362   CGSGSIVEGLMFGHPLIMLPLFGDQPLNARLLEDKQVGIEIPRNEEDGCLTKESVARSLR  421

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              VVVE EG IY+   +E+  ++ D   +  YV   + YL
Sbjct  422   SVVVENEGEIYKANARELSKIYNDTKVEKEYVSQFVDYL  460



>ref|XP_004287416.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   423 bits (1088),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 307/469 (65%), Gaps = 21/469 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPP--NLASRINFV  1436
             +LH++++PWLA GH+IP+  LSK IA +GHKVSF+STPRN+ RLPK+PP  +L+S I  V
Sbjct  12    RLHLVVFPWLAMGHLIPFFHLSKLIAQKGHKVSFISTPRNLQRLPKIPPHSSLSSLITLV  71

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
              LPLP  +NLP++AE++ D+PY+K + LK A D L+  MA FLE  +PDW+++D+ S+WL
Sbjct  72    PLPLPHVENLPDDAESSNDVPYNKQQLLKKAFDLLESPMADFLESSAPDWVVYDYASHWL  131

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG---RLVDFAE-RTKAEDYTVPPKWIPFKTTVAFR  1088
              P+A+KLGVS A F +FT   +A  G    L+D  + RTK ED+TV   WIPFK+ +AFR
Sbjct  132   PPLAAKLGVSRAYFCLFTAACMAVIGPPSLLIDGQDKRTKTEDFTVVSPWIPFKSDMAFR  191

Query  1087  LYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK--PV  914
              +E+ +    V E +    D  R    V   D+V +R   EF+ EW +LL  ++ +  PV
Sbjct  192   YHEVAKY---VHENESGTPDTVRFGIAVRDSDVVLMRSSEEFEPEWFELLRELYGRSIPV  248

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP    +     +PT      +K WLD+Q    V+YVA G+EA  SQ ELTE+AL
Sbjct  249   LPVGFLPPLVEE-----KPT-----RVKDWLDEQRVNSVVYVALGTEATLSQGELTELAL  298

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLE SG PFFWVLR            LP+GF ER + RG+V   WAPQ+ ILSH+SVGGF
Sbjct  299   GLERSGLPFFWVLRDPPESTRAVSEMLPDGFLERVRDRGMVHFGWAPQVWILSHDSVGGF  358

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GW+S++E + F K L+L   L DQGLNAR+   K +G  +PR+E DG FTR+AVAE
Sbjct  359   LTHCGWNSMIEGLGFGKVLILFPMLNDQGLNARLANGKGLGVEIPRNELDGSFTRDAVAE  418

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
              +RL +VE+EG + R ++KE+KG+F D+ R     +  + +L  ++  K
Sbjct  419   FVRLAMVEEEGEMVRRRVKEIKGIFGDRNRNSRLENEFICFLEENRPNK  467



>gb|AHL38585.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=920

 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/463 (47%), Positives = 298/463 (64%), Gaps = 14/463 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D     +H+ M+PWLA GH++P+L LSK +A +GHK+SF+STPRNI+RLPKL  NLAS I
Sbjct  3     DKREEVMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSI  62

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV  PLPP   LP ++E+++D+PY+K + LK A D LQ  + +FL   SPDWI++D+ S
Sbjct  63    TFVSFPLPPISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLKEFLRRSSPDWIIYDYAS  122

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  +A++LG+S A FS+F   T+ F G      E  R+  ED+TV P W+PFK+ + F
Sbjct  123   HWLPSIAAELGISKAFFSLFNAATLCFMGPSSSLIEEIRSTPEDFTVVPPWVPFKSNIVF  182

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +E+ R ++   E+   VSD  R    ++  D V VR C EF+ EW  LL+++++KPVF
Sbjct  183   RYHEVTRYVEKTEEDVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVF  242

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G LP    D     +    +W  IK WLDKQ    V+YV+ G+EA     E+TE+ALG
Sbjct  243   PIGFLPPVIED----DDAVDTTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALG  298

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVLR      +P+   +P+GF+ R KGRG+V   W PQ+KILSHESVGGFL
Sbjct  299   LEKSETPFFWVLR-----NEPK---IPDGFKTRVKGRGMVHVGWVPQVKILSHESVGGFL  350

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+SVVE + F K  +    L +QGLN R+L  K +G  V RDERDG F  ++VA+S
Sbjct  351   THCGWNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVADS  410

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHC  242
             +RLV+++  G   R K K MK LF +      YVD L+ ++  
Sbjct  411   IRLVMIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRS  453


 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/463 (47%), Positives = 298/463 (64%), Gaps = 14/463 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D     +H+ M+PWLA GH++P+L LSK +A +GHK+SF+STPRNI+RLPKL  NLAS I
Sbjct  463   DKREEVMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSI  522

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV  PLPP   LP ++E+++D+PY+K + LK A D LQ  + +FL   SPDWI++D+ S
Sbjct  523   TFVSFPLPPISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLKEFLRRSSPDWIIYDYAS  582

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  +A++LG+S A FS+F   T+ F G      E  R+  ED+TV P W+PFK+ + F
Sbjct  583   HWLPSIAAELGISKAFFSLFNAATLCFMGPSSSLIEEIRSTPEDFTVVPPWVPFKSNIVF  642

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R +E+ R ++   E+   VSD  R    ++  D V VR C EF+ EW  LL+++++KPVF
Sbjct  643   RYHEVTRYVEKTEEDVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVF  702

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G LP    D     +    +W  IK WLDKQ    V+YV+ G+EA     E+TE+ALG
Sbjct  703   PIGFLPPVIED----DDAVDTTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALG  758

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LE S  PFFWVLR      +P+   +P+GF+ R KGRG+V   W PQ+KILSHESVGGFL
Sbjct  759   LEKSETPFFWVLR-----NEPK---IPDGFKTRVKGRGMVHVGWVPQVKILSHESVGGFL  810

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+SVVE + F K  +    L +QGLN R+L  K +G  V RDERDG F  ++VA+S
Sbjct  811   THCGWNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVADS  870

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHC  242
             +RLV+++  G   R K K MK LF +      YVD L+ ++  
Sbjct  871   IRLVMIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRS  913



>gb|AIE12480.1| UGT3 [Panax ginseng]
Length=471

 Score =   423 bits (1087),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 304/460 (66%), Gaps = 12/460 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M+PWLA GH+IP+L+LSK +A +GH+VSF+STPRNI+RLPK+PP+L+  IN V  P
Sbjct  7     LHVVMFPWLAIGHLIPFLQLSKILALKGHRVSFISTPRNIERLPKIPPDLSPMINLVTFP  66

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEE--FSPDWILHDFDSYWLA  1253
              P   NLP+ A +++D+P+ K ++LK+A D L+  +  FL+     PDWI++D+ S+WL 
Sbjct  67    FPKVHNLPDEAGSSMDIPHHKAQFLKIAFDLLKSPLVDFLKNTRLKPDWIVYDYASHWLP  126

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG--RLVDFAE--RTKAEDYTVPPKWIPFKTTVAFRL  1085
              +A +LG+S   FS+F+   +AF G   L+   E  R K ED+T+ PKWIPF++ V +RL
Sbjct  127   SIAGELGISRGYFSLFSAACMAFLGPPSLLVSGEDGRLKGEDFTIVPKWIPFQSDVVYRL  186

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +E+++ +D     +   SD  R  + +   D+V  R   EF+ EW  L+  +++KPV PV
Sbjct  187   HEVIKYVDGSAGNESGASDSVRFGASIGGSDLVLFRTSVEFEPEWFNLVCQLYRKPVVPV  246

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP    D G       + W  IK WLDKQ    V+YVA GSEA  S+ EL+E+ALGLE
Sbjct  247   GVLPPDNDDFG-----NEEKWVFIKEWLDKQMVDSVVYVALGSEAILSRDELSELALGLE  301

Query  724   LSGFPFFWVLRARRGEA-DPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
               G PFFWVLR   G   D   + LP+GF ER K RG+V   W PQ+KILSH +VGGFLT
Sbjct  302   QCGLPFFWVLRMPPGSTQDESQLLLPDGFVERVKSRGVVHQGWVPQVKILSHSAVGGFLT  361

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GW+SVVEA+ + + L+L   + DQGLNAR+L+ KK+G  +PR+ERDG FT ++VA+S+
Sbjct  362   HCGWNSVVEALGYGRVLILFPVMNDQGLNARLLKGKKVGVEIPRNERDGAFTSDSVADSV  421

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             R+ +V +EG   R   +EM+GLF    R D  +D  + +L
Sbjct  422   RIAMVSQEGESVRATAREMRGLFGHGIRNDNCIDNFVSHL  461



>gb|AAR06918.1| UDP-glycosyltransferase 91D1 [Stevia rebaudiana]
Length=485

 Score =   423 bits (1087),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 296/459 (64%), Gaps = 16/459 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LH+  +PWLAFGH++P+L+LSK IA +GHKVSF+ST RNI RL     +++  IN V+L
Sbjct  25    QLHVATFPWLAFGHILPFLQLSKLIAEKGHKVSFLSTTRNIQRLSS---HISPLINVVQL  81

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP  Q LPE+AEAT D+  + ++YLK A D LQ  + +FLE+ SPDWI++DF  YWL  
Sbjct  82    TLPRVQELPEDAEATTDVHPEDIQYLKKAVDGLQPEVTRFLEQHSPDWIIYDFTHYWLPS  141

Query  1249  VASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             +A+ LG+S A F + TP T+A+        + D   RT  ED T PPKW PF T V +R 
Sbjct  142   IAASLGISRAYFCVITPWTIAYLAPSSDAMINDSDGRTTVEDLTTPPKWFPFPTKVCWRK  201

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +++ R+      E   +SD +R+    +  D +  +   EF ++WL LLE +HQ PV PV
Sbjct  202   HDLARM---EPYEAPGISDGYRMGMVFKGSDCLLFKCYHEFGTQWLPLLETLHQVPVVPV  258

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP        G E   ++W  IK WLD ++ G V+YVA GSEA  SQTE+ E+ALGLE
Sbjct  259   GLLPPEI----PGDE-KDETWVSIKKWLDGKQKGSVVYVALGSEALVSQTEVVELALGLE  313

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PF W  R  +G A  + + LP+GF ERT+ RG+V TSWAPQL+ILSHESV GFLTH
Sbjct  314   LSGLPFVWAYRKPKGPAKSDSVELPDGFVERTRDRGLVWTSWAPQLRILSHESVCGFLTH  373

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              G  S+VE + F  PL++L    DQ LNAR+LE+K++G  +PR+E DG  T+E+VA SLR
Sbjct  374   CGSGSIVEGLMFGHPLIMLPIFCDQPLNARLLEDKQVGIEIPRNEEDGCLTKESVARSLR  433

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              VVVE EG IY+   + +  ++ D   +  YV   + YL
Sbjct  434   SVVVENEGEIYKANARALSKIYNDTKVEKEYVSQFVDYL  472



>ref|XP_006415140.1| hypothetical protein EUTSA_v10007607mg [Eutrema salsugineum]
 gb|ESQ33493.1| hypothetical protein EUTSA_v10007607mg [Eutrema salsugineum]
Length=452

 Score =   419 bits (1076),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 216/461 (47%), Positives = 290/461 (63%), Gaps = 20/461 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             +H+ M+PWLA GH++P+L LSK +A +GHKV F+STPRNI RLPKLP NL+S I FV  P
Sbjct  8     MHVAMFPWLAMGHLLPFLRLSKLLAQKGHKVLFISTPRNIKRLPKLPSNLSSSITFVSFP  67

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP        +E ++D+ ++K + LK + D LQ  + KFL + SPDW+++D+ S+WL  V
Sbjct  68    LPAFPGSTPGSECSMDVSFNKQQSLKSSFDLLQLPLTKFLRDSSPDWVVYDYASHWLPQV  127

Query  1246  ASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             A++LG+S A FS+F   ++ F G    L+D   R+K ED+TV P WIPF + +A+R +EI
Sbjct  128   AAELGISKAFFSLFNAASLCFLGPPSLLID-NFRSKPEDFTVVPPWIPFHSNIAYRYHEI  186

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
               + D   ++   VSD  R    +  CD V V    EF+ EWL LL+ ++QKPVFP G L
Sbjct  187   TLVGDKKEKDTTGVSDPVRFGYSISNCDAVFVHSSPEFEPEWLGLLQELYQKPVFPTGFL  246

Query  895   PTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             PT A       E  GD +W  IK WLD Q    V+YVA G+EA     ELTE+A GLE S
Sbjct  247   PTDA-------EVEGDTTWIAIKKWLDMQRVNSVVYVALGTEAILCPEELTELAHGLEKS  299

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
               PFFWVLR            +P+GFEER +GRG+V   WAPQ+ ILSH+SVGGFLTH G
Sbjct  300   DVPFFWVLRNES--------QVPDGFEERVEGRGMVHFGWAPQVNILSHDSVGGFLTHCG  351

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
             W+S+VE +   +  +    L +QGLN R+LE K +G  +PRDE+DG F  ++VA S+RL 
Sbjct  352   WNSLVEGLGLGRVPIFFPVLNEQGLNTRLLEGKGLGVEIPRDEKDGAFDSDSVAYSVRLA  411

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +++  G   R K K MKGLF +      YVD LL Y+   K
Sbjct  412   MIDDAGESIRAKAKLMKGLFGNIDENSRYVDELLGYMTSKK  452



>ref|XP_008811282.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=466

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 226/462 (49%), Positives = 291/462 (63%), Gaps = 15/462 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+++PWLAFGH+IP+LELSK +A RGH + F+STPRNI RLP +P  L   I+F+ +P
Sbjct  6     LHIVLFPWLAFGHLIPFLELSKSLAKRGHHIFFISTPRNIHRLPNIPLPLLPLIDFISIP  65

Query  1426  LPPHQNLPE-NAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYWL  1256
             LPP  +LP+ +AEAT DLP  KV +LK A D L + +A+FLE+ SP  DWI+ DF  YWL
Sbjct  66    LPPSDDLPDHDAEATADLPPHKVPHLKKAFDKLDQPVAEFLEQASPKPDWIICDFAPYWL  125

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
              P+ASKL    A F+ F   + AF       A +   E  T  P+WIPF T VA+RL+E 
Sbjct  126   PPIASKLNTPCAYFNTFPSFSSAFSA-----AWQRSPEQLTATPEWIPFPTKVAYRLHEA  180

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
                   V +    VSD +R  S V  CD++AVRGC EFD EWL +L  +++KP+ P+G L
Sbjct  181   RSFAKLVHDSASGVSDEYRFNSVVRCCDLMAVRGCMEFDGEWLNVLPELYEKPIVPLGLL  240

Query  895   PTTAYDAGGGHEPTG---DSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             P +A D   G    G       ++  WL+KQ    V+YV+ GSEA  S   + E+A GLE
Sbjct  241   PPSADDRPDGENTNGMANTGHGNVVKWLNKQTPESVVYVSLGSEATLSNELVHELAFGLE  300

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PF W LR +R E +     LP+GFE+R  GRG++   W PQL+IL+  SVGGF TH
Sbjct  301   LSGLPFLWALRRKREEVE----LLPKGFEDRIAGRGVIAMGWMPQLEILACSSVGGFFTH  356

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              GWSSVVE + F  PL+LL    DQG+NARV+ EKK+G  V RDE  G FTREAVA  +R
Sbjct  357   CGWSSVVEGLAFGHPLILLPVFGDQGINARVMVEKKLGLEVERDEETGSFTREAVANVVR  416

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
              V+VE EG   RE  K M+ +F +      YVD  +HYL  H
Sbjct  417   SVMVEDEGKKLRETAKRMREVFSNNDIHGRYVDAFVHYLRDH  458



>ref|XP_007222833.1| hypothetical protein PRUPE_ppa005106mg [Prunus persica]
 gb|EMJ24032.1| hypothetical protein PRUPE_ppa005106mg [Prunus persica]
Length=477

 Score =   418 bits (1075),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/461 (46%), Positives = 297/461 (64%), Gaps = 11/461 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++++PWLA GH+IP+  LSK IA +GH VSF+STPRNI RLPK+P +L+S IN V LP
Sbjct  10    LHVVVFPWLAMGHLIPFFHLSKLIAQKGHSVSFISTPRNILRLPKIPSHLSSLINLVSLP  69

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFL--EEFSPDWILHDFDSYWLA  1253
             LP   NLP +AE++ D+PY+K + LK A D L+  +  FL   E  PDW+++D+ S+WL 
Sbjct  70    LPRLDNLPNDAESSTDVPYNKQQLLKRAFDLLELPLTDFLGSSESKPDWVIYDYASHWLP  129

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYTVPPKWIPFKTTVAFRL  1085
             PVA++  +S A FS F+   +A+ G    L++  + RT AED+T+ P+W+PF++ +A+RL
Sbjct  130   PVAARFDISRAFFSCFSAACLAYIGPPAPLINGQDFRTNAEDFTLVPEWVPFESDMAYRL  189

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK--PVF  911
             +EI + +   +E +    D  R    +   ++V +R   EF+ EW  LL  ++ K  PV 
Sbjct  190   HEIAKYLQRSSENESVTPDTVRFGFAINESEVVFIRSSDEFEPEWFNLLRELYGKGKPVV  249

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G LP    +     +    +W  I  WLDKQ    VIY+A G+EA  S+ ELTE+ALG
Sbjct  250   PIGFLPPLINEQVDEFD---TNWVGINEWLDKQRVNSVIYIAVGTEATLSREELTELALG  306

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR            LP GF ER +GRG+V   WAPQ++ILSH+SVGGFL
Sbjct  307   LELSGVPFFWVLRNPPESTQSVFEMLPHGFVERVEGRGVVHLGWAPQVRILSHDSVGGFL  366

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+S++E + F + L+L   + DQGLNAR+   K +G  +PR  +DG FTR++VA+ 
Sbjct  367   THCGWNSMIEGLGFGRVLILFPMVNDQGLNARLGNNKGLGVEIPRIAQDGSFTRDSVAKL  426

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +RL +VE  G   R + KEMKGLF D+ R +   D  + +L
Sbjct  427   VRLAMVEDSGESLRIRAKEMKGLFGDRNRNNQIADEFICFL  467



>ref|XP_011084237.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Sesamum indicum]
Length=465

 Score =   417 bits (1073),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/465 (45%), Positives = 307/465 (66%), Gaps = 19/465 (4%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
             G  LHI+M+PWLA GH+ P+L LS  +A +GH++SF+STPRN+ R  K+P +L+  IN +
Sbjct  5     GKVLHIVMFPWLAIGHLRPFLRLSICLAQKGHRISFISTPRNLHRAVKVPQDLSHLINVI  64

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEF--SPDWILHDFDSY  1262
               PLP  ++LP +AE+++D+P+ K + LK+A D L+  ++ FL+     PDWI++D+ S+
Sbjct  65    AFPLPEVEHLPPHAESSMDVPHVKQQLLKVAFDLLRPLVSDFLDNVRPKPDWIVYDYASH  124

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGR---LVDFA-ERTKAEDYTVPPKWIPFKTTVA  1094
             WL  +A ++G+S A FS+FT   +AF G    L+D    R+ A D+T+ P+WIPF + +A
Sbjct  125   WLPKLAEEMGISRAFFSLFTAAFMAFLGSPSALMDQKYSRSTAADFTIVPEWIPFPSDMA  184

Query  1093  FRLYEILRIIDA---VTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             FRL+E+ + ++      E D   SD  R    ++  +IV  R C EF+ EW  L+  ++Q
Sbjct  185   FRLHEMSKNMEKDADGNEYDSGTSDSIRFGLSIDGSEIVIFRSCVEFEPEWFDLVRQLYQ  244

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    +         + W  IK WLD Q+   ++YVA G+EA  SQTE  E
Sbjct  245   KPVIPVGILPVEDEEHD-----NNEEWLKIKQWLDAQKDDSLVYVALGTEAALSQTEAQE  299

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             +ALGLE  G PFFWVL        PE+  LP+GF++R   RG+V T WAPQ+KILSH +V
Sbjct  300   LALGLEQCGLPFFWVLNRNYL---PEM--LPDGFQDRVANRGMVYTEWAPQIKILSHPAV  354

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             G FLTH GW+S  EA+ F + L+L   + DQGLNAR+L+EKK+G  +PR+E+DG FTR++
Sbjct  355   GAFLTHCGWNSATEALGFGRVLILFPVMNDQGLNARLLQEKKVGVEIPRNEKDGSFTRDS  414

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V+E++RLV+V +EG   RE  ++MK LF D++R   YVD+L+ ++
Sbjct  415   VSETVRLVLVSEEGRKVRENARKMKELFGDKSRSSSYVDSLVQHM  459



>ref|XP_008219240.1| PREDICTED: UDP-glycosyltransferase 91C1 [Prunus mume]
Length=477

 Score =   417 bits (1073),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 212/461 (46%), Positives = 296/461 (64%), Gaps = 11/461 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++++PWLA GH+IP+  LSK IA +GH VSF+STPRNI RLPK+P +L+S IN V LP
Sbjct  10    LHVVVFPWLAMGHLIPFFRLSKLIAQKGHTVSFISTPRNILRLPKIPSHLSSLINLVSLP  69

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFL--EEFSPDWILHDFDSYWLA  1253
             LP   NLP +AE++ D+PY+  + LK A D L+  +  FL   E  PDW+++D+ S+WL 
Sbjct  70    LPRLDNLPNDAESSTDVPYNGQQLLKRAFDLLELPLTDFLGSSESKPDWVIYDYASHWLP  129

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYTVPPKWIPFKTTVAFRL  1085
             PVA++  +S A FS F+   +A+ G    LV+  + RT AED+T+ P+W+PF++ +A+RL
Sbjct  130   PVAARFDISRAFFSCFSAACLAYIGPPAPLVNGQDFRTNAEDFTLVPEWVPFESDMAYRL  189

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK--PVF  911
             +EI + +   +E +    D  R    +   ++V +R   EF+ EW  LL  I+ K  PV 
Sbjct  190   HEIAKYLQRSSENESVTPDTVRFGFAINESEVVFIRSSDEFEPEWFNLLREIYGKGKPVV  249

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G LP    +     +    +W  IK WLDKQ    VIY+A G+EA  SQ ELTE+ALG
Sbjct  250   PIGFLPPPIDEQVDEFD---TNWVGIKEWLDKQRVNSVIYIAVGTEAILSQEELTELALG  306

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR            LP GF ER +GRG+V   WAPQ++ILSH+SVGGFL
Sbjct  307   LELSGVPFFWVLRNPPESTQYVFEMLPHGFVERVEGRGVVHLGWAPQVRILSHDSVGGFL  366

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+S++E + F + L+L   + DQGLNAR+   K +G  +PR  +DG FTR++VA+ 
Sbjct  367   THCGWNSMIEGLGFGRVLILFPMVNDQGLNARLGNNKGLGVEIPRIAQDGSFTRDSVAKL  426

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +R  +VE  G   R + KEMKGLF D+ R +   D  + +L
Sbjct  427   VRFAMVEDSGESLRNRAKEMKGLFGDRNRNNQIADEFICFL  467



>ref|XP_002532391.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30003.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=454

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/465 (48%), Positives = 305/465 (66%), Gaps = 45/465 (10%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLH+ ++PWLAFGH+IPYL+L++ IA +GHK+SF+ST RNI RLP++   L+S I  
Sbjct  26    EPKKLHVALFPWLAFGHIIPYLDLAQLIAQKGHKISFISTSRNIQRLPQVSSKLSSSIKL  85

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             + L LP  +NLP +AE+T+DLPYD V YLK A D LQ+ +  FL+  +PDWI++DF  +W
Sbjct  86    ISLTLPQVENLPHDAESTMDLPYDHVPYLKKAYDLLQDQLLHFLQTSAPDWIIYDFSPHW  145

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFGR----LVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
             L P+A+ LG+S A FSIF   ++ F G     +++  + RTKAE  TVPP W+PF + VA
Sbjct  146   LPPIAANLGISGAFFSIFGAWSLTFLGSSSSAMINGDDPRTKAEHLTVPPDWVPFSSKVA  205

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FRL+E  R +D +   +                                     +H KPV
Sbjct  206   FRLHEAKRALDHLGMNNSG----------------------------------QLHGKPV  231

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP +A D+    +   D+W +I +WLDK   G V+Y+AFGSE+ PSQ EL E+AL
Sbjct  232   LPVGILPPSALDSS---DDKDDTWIEISSWLDKHNKGSVVYIAFGSESAPSQEELEELAL  288

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFW LR R  +   + I LP+GFEER KGRG+V  SWAPQ+KIL+HESVGGF
Sbjct  289   GLELSGLPFFWTLRKRNND---DSIKLPDGFEERVKGRGLVWMSWAPQVKILAHESVGGF  345

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G+SS++EA+ F + L++     DQGL ARV EEKK+G  + RDE +G FT+++VAE
Sbjct  346   LTHCGYSSIIEALHFGRALIMFPLSLDQGLIARVFEEKKVGVEIKRDEENGWFTKDSVAE  405

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             SL+LV+V+ EGN+YR+K KEMK +F ++   D Y+   + +L  H
Sbjct  406   SLKLVMVKTEGNVYRDKAKEMKKVFGNKELHDRYMGHFVEFLQNH  450



>ref|XP_006451091.1| hypothetical protein CICLE_v10010307mg [Citrus clementina]
 gb|ESR64331.1| hypothetical protein CICLE_v10010307mg [Citrus clementina]
Length=467

 Score =   416 bits (1069),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 305/463 (66%), Gaps = 12/463 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++P+ +++  +A +GH VS++STP+NIDRLP++P NL+SR+++++L
Sbjct  8     KLHIAMFPWLAYGHIMPFFQVAMFLAEKGHHVSYISTPKNIDRLPQIPTNLSSRLSYIQL  67

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE AE+T +LP  KV YLK A D LQ  +  FL++   +WI+HDF S+WL P
Sbjct  68    PLPQLDGLPEGAESTAELPIHKVPYLKKAHDLLQLPLTNFLQDSRVNWIIHDFISHWLPP  127

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  FSI++  T+ F G   D     R K ED+TV P+WI F++ +AF+ YE 
Sbjct  128   VAAQLGVNSVFFSIYSAATLCFTGPPSDVIAGRRQKPEDFTVVPEWIDFQSNLAFKPYET  187

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             L   D +   DD+VSD  R    ++ C +V +R C+EF+ + L+LL  + QKPV PVG L
Sbjct  188   LINQDGM---DDSVSDYLRAAFVLQDCRVVILRSCAEFEPDALRLLGKMLQKPVLPVGLL  244

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
               +  D+       G+ W  +K WLD +E   V+Y AFG+E   SQ  L E+A GLE SG
Sbjct  245   APSLQDSAA-----GEHWPVLKDWLDSKENNSVVYAAFGTEMTLSQELLHELAYGLEKSG  299

Query  715   FPFFWVLRAR-RGEADPELIH-LPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
              PF W+++ R   E +  L H LP GF++R  G G+V T WAPQL+IL+H S+GGFLTHS
Sbjct  300   LPFIWIIKNRPLVEGESGLDHLLPPGFQDRVSGTGLVWTDWAPQLRILAHPSIGGFLTHS  359

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSV+EA+   +PL+LL   +D GL AR++  +++G  V R+E+DG FTR++VA+ +R 
Sbjct  360   GWSSVIEALGLGRPLILLPGSSDTGLVARLMHSRRLGLEVERNEQDGSFTRDSVADCIRR  419

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             VVV++EG   R   + ++ +F        ++D    ++  + +
Sbjct  420   VVVDQEGEPLRANARAVRDIFGSTHLSYKHLDEFTRFIENYTA  462



>gb|EYU37211.1| hypothetical protein MIMGU_mgv1a018729mg, partial [Erythranthe 
guttata]
Length=466

 Score =   415 bits (1067),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 300/470 (64%), Gaps = 17/470 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + EG  LHI+M+PWLA GH+ P+  LS+ +A +GH++SF+STPRN+ R+ K+P  L+  I
Sbjct  3     EEEGKFLHIVMFPWLAIGHIRPFFRLSECLARKGHRISFISTPRNLQRIVKVPRELSHLI  62

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEF--SPDWILHDF  1271
             N +  PLP  +NLP NAE+++D+P+ K + LK+A D LQ  +  FLE     PDWI++D+
Sbjct  63    NLIAFPLPEVENLPPNAESSMDVPHVKQQLLKVALDLLQPCVRSFLERARPKPDWIVYDY  122

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFG--RLVDFAE---RTKAEDYTVPPKWIPFK  1106
              S+WL P+A + G+S   FS+FT   ++F G    + F E   R  AEDYTV P+W+PF 
Sbjct  123   ASHWLPPLAEEFGISRGYFSLFTAAFMSFLGPTDALIFGEKYGRLTAEDYTVVPEWVPFP  182

Query  1105  TTVAFRLYEILRIIDA---VTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLE  935
             + VAFRL+E+ + ++      E D   SD  R    +   +IV  R   EF+ EW  L++
Sbjct  183   SDVAFRLHEMTKNMEKDAEGNEYDSGTSDSIRFGLSINGSEIVIFRSYVEFEPEWFDLIQ  242

Query  934   NIHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQT  755
              ++QKP+ P+G LP    +     +     W  IK WLD Q+   ++YVA G+EA  SQ 
Sbjct  243   QLYQKPIIPIGVLPIEDDEREDEFDNDDTEWPTIKEWLDSQKQNSIVYVALGTEATLSQK  302

Query  754   ELTEIALGLELSGFPFFWVL-RARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKIL  578
             E  E+ALGLE SG PFFWVL R    E       LP GF ER K RG+V T WAPQ+KIL
Sbjct  303   EAHELALGLEQSGLPFFWVLNRNHLSEM------LPHGFIERVKNRGMVYTKWAPQIKIL  356

Query  577   SHESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGR  398
             SH +VGGFLT  GW+SV EA+ F + L+L   + DQGLNAR+L +KK+G  +PR+E+DG 
Sbjct  357   SHSAVGGFLTRCGWNSVTEALGFGRVLILFPIMNDQGLNARLLHDKKVGIEIPRNEKDGS  416

Query  397   FTREAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             FT E+VA++++L +V ++G   RE   +MK LF D++R +  +D+L+  +
Sbjct  417   FTSESVAKTVKLALVSEDGREVRENALKMKDLFGDKSRNNSCIDSLVRQM  466



>ref|XP_008779257.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1, partial 
[Phoenix dactylifera]
Length=423

 Score =   413 bits (1061),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 210/423 (50%), Positives = 278/423 (66%), Gaps = 5/423 (1%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D+ G+ LHI ++PWLAFGHM+P+L+LSK +A RGH++SF++TPRNI RLPK+PP+LA  I
Sbjct  2     DNNGA-LHIAVFPWLAFGHMLPFLQLSKSLAMRGHRISFLATPRNIQRLPKIPPHLAPLI  60

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDF  1271
             +FV +PLP  + LPENAEAT DLP D+V+YLK+A D L   +  FL+E SP  DWI+ DF
Sbjct  61    DFVSMPLPKVEGLPENAEATPDLPKDQVQYLKVAFDRLGGALESFLDEASPKPDWIILDF  120

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFF--GRLVDFAERTKAEDYTVPPKWIPFKTTV  1097
               +W+  +AS  GV  A FS+F  P +AF+     +        E+ T PPK I F+T+V
Sbjct  121   ACHWVPKLASMFGVPCAFFSVFAAPFLAFWRPSESISRGGDNVLEELTAPPKGISFETSV  180

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             AFRL+E  R+I         V D  RL+  VE C +VA R C E  S+WL  L+ ++ KP
Sbjct  181   AFRLHEARRVIRGYVNNASGVCDADRLLLTVEGCKVVAPRSCWELHSDWLCYLQELYGKP  240

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP    D G G + T     +   WLDKQ  G V+Y AFGSE   S   L E+A
Sbjct  241   VIPVGLLPPATDDGGAGVDATSRESNNALRWLDKQAPGSVVYAAFGSETVLSTEMLHELA  300

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELS  PF WV+R     AD     LPEGFE+RT+ RG++   W  QL++L+H SVGG
Sbjct  301   FGLELSQVPFLWVIRKPVDIADEGREILPEGFEDRTRDRGVIAMGWIDQLEVLAHASVGG  360

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
              LTHSGWSSV+E++Q    L++L F+ DQG+ ARV+EE++IG  VPR+E DG F RE +A
Sbjct  361   CLTHSGWSSVIESLQLGHLLIMLPFIVDQGIIARVMEERRIGIEVPRNEEDGSFNREELA  420

Query  376   ESL  368
             +++
Sbjct  421   KAI  423



>gb|KDP41496.1| hypothetical protein JCGZ_15903 [Jatropha curcas]
Length=481

 Score =   415 bits (1066),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 208/458 (45%), Positives = 294/458 (64%), Gaps = 11/458 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LH++++PWLA GH+IPY   S  +A +GHKVSFVSTPRN+  LPK+PP L+S I+ + L
Sbjct  7     QLHVVVFPWLAMGHLIPYHRFSILLAQKGHKVSFVSTPRNLLNLPKIPPKLSSNISLISL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LP NAE T D+PY K + LK A D L+  +  FL++  PDW+++D+ S+WL  
Sbjct  67    PLPSIPALPPNAETTTDIPYVKQQLLKKAFDFLRSPLIAFLQKVKPDWVIYDYASHWLPS  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFG---RLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLY  1082
             + ++LG+STA FS+F   T++F G    L++  + R  AED+TV PKW+PF++ +A+R++
Sbjct  127   IVAELGISTAFFSLFNAATLSFIGPPSMLMNGGDLRLTAEDFTVVPKWVPFESNIAYRVH  186

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E+ + ++   E++  ++D  R    +   D+V VR   E + EW  L   + Q+P  P+G
Sbjct  187   EVTKYVEKTEEDETGLTDSVRFGFAIGNADLVIVRSSPELEPEWFDLFGKLSQRPNIPIG  246

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP    +     +  G  W DIK WLDK E   V+YVA G+E+  ++ E+ E+ LGLE 
Sbjct  247   FLPPLVEEENNNADVGG--WADIKEWLDKHEAKSVVYVALGTESALTKKEVRELGLGLEK  304

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             S  PFFWVLR         L  LP+GF+ER K RGIV T WAPQ+ ILSHESVG FLTH 
Sbjct  305   SSSPFFWVLRNSPESTQNVLEMLPDGFQERVKDRGIVYTRWAPQVNILSHESVGTFLTHC  364

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GW+SVVE + F K L+L   L DQGLNAR+L  KK+G  +PR+E DG FT ++VAE   L
Sbjct  365   GWNSVVEGLSFGKVLILFPMLNDQGLNARLLHGKKLGLEIPRNELDGAFTSDSVAE---L  421

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             V   K G+   +    ++GLF D+ R D  ++ ++HYL
Sbjct  422   VRKSKVGSA--DLADPIRGLFGDRGRNDRLLEGVVHYL  457



>ref|XP_009408288.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   414 bits (1064),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 209/467 (45%), Positives = 298/467 (64%), Gaps = 11/467 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LHI+M PWLAFGH++P++ELSK +A  GH+VS + T RNI RLP++PP+L+S + FV+L
Sbjct  5     SLHIVMLPWLAFGHLLPFMELSKRMAQHGHRVSLLVTKRNIQRLPRVPPHLSSLLQFVEL  64

Query  1429  PLPPHQNLPENAEATIDLPYDKVK-YLKLARDALQETMAKFLEEF---SPDWILHDFDSY  1262
             P+P  ++LPENAEA+IDLP D+++ YL+ A D  Q  ++ FL +     PDWIL D+ +Y
Sbjct  65    PMPSIEHLPENAEASIDLPSDELRPYLRQAFDTFQHQLSSFLRQTLPRVPDWILFDYAAY  124

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDF----AERTKAEDYTVPPKWIPFKTTVA  1094
             W   VA++ GV  A   +F    ++FFG           R   E +   P+W+PF++TV 
Sbjct  125   WAPRVAAEFGVPCAYLGLFNAAVLSFFGPSASLMGCEGARETPEQFMELPEWVPFESTVF  184

Query  1093  FRLYEILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             F+ YE   +    V  +   VS+ +R    +E C +++VR C EF+ +W  LL  +H++P
Sbjct  185   FKPYEARELFKPGVLPDASGVSEAYRFGRTLEDCQLISVRSCPEFEPDWFHLLGKLHKRP  244

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG  P +  ++    E +   W+ I  WL KQ+   V+YVAFGSE K + +++ EIA
Sbjct  245   VIPVGFFPPSPQESDTDEE-SDRRWRSIFQWLAKQKPESVVYVAFGSEVKLTSSQVHEIA  303

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLE S  PF W LRA   ++      LPEGFEERT+GRG+VC  W PQ ++L+H S+GG
Sbjct  304   LGLEGSQLPFVWALRAP-ADSHGSPAALPEGFEERTQGRGLVCLGWVPQARLLAHPSMGG  362

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH+GW+S+VE +    P+VL+  + DQGLNAR L E+KI   VPR+E DG FT E +A
Sbjct  363   FLTHAGWNSIVEGLALGLPVVLMPLMFDQGLNARNLVERKISVEVPRNEEDGSFTGEGIA  422

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              +LRLV+VE++G   R K KE + +F D+   D +V   L YL  H+
Sbjct  423   TTLRLVMVEEQGQPLRAKAKEYREVFGDEKLNDRHVWEFLKYLIEHR  469



>ref|XP_008789644.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=464

 Score =   413 bits (1062),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 227/467 (49%), Positives = 293/467 (63%), Gaps = 14/467 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             EGS LHI+++PWLAFGH++P+L LSK +A RGH +SF+STPRNI RLPKLPP+LA  I F
Sbjct  3     EGS-LHIVVFPWLAFGHLLPFLGLSKSLAKRGHHISFLSTPRNILRLPKLPPSLAPLIEF  61

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDS  1265
             + + LPP  +LP NAEAT DL  D V+YLK A D L + +AKFLE+ SP  DWI+ DF  
Sbjct  62    IPIRLPPSDHLPNNAEATTDLLPDDVQYLKKAFDGLDQPIAKFLEQASPKPDWIIQDFTP  121

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLV---DFAE-RTKAEDYTVPPKWIPFKTTV  1097
             YWL P+A+KL +  A+F+ F     A+F   V   D A  R   E  TV P+WIPF TT 
Sbjct  122   YWLPPIAAKLHIPCAMFNTFP----AYFSAFVWGEDGARMRGPPERLTVVPEWIPFPTTA  177

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
               RL+E  +    +  +   VS   R    V RC ++A+R C E D + L  +  +   P
Sbjct  178   VLRLFEARQFDYMLQVDASGVSAADRFEMVVRRCKLMALRSCMELDRQVLSTMSELFNMP  237

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP +  +  GG +    S  +I  WLDKQ    V+YV+ GSEA  S   + E+A
Sbjct  238   VVPVGLLPPSVDE--GGEKIASTSSMNIFRWLDKQTPRSVVYVSLGSEATLSSELVHELA  295

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELSG PF W LR   G    E+  LPEGFE+R  G G+V   WAPQ +IL+HESVGG
Sbjct  296   FGLELSGQPFLWALRRPAGMPK-EVELLPEGFEDRIAGNGMVTMDWAPQTEILAHESVGG  354

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH GW S+VE + F  PLV L    DQ +NARV+ EK+IG  V  DE DG F R+AVA
Sbjct  355   FLTHGGWGSLVEGLGFGHPLVFLPVFGDQPINARVMVEKEIGVEVRSDEEDGSFKRDAVA  414

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             ++LRLV+VE+EG   R +  +MK +F ++  Q+  +D  + YL  HK
Sbjct  415   QALRLVMVEEEGKKIRNEANKMKLIFGNKELQERCIDEFVRYLRDHK  461



>ref|XP_008378603.1| PREDICTED: UDP-glycosyltransferase 91C1 [Malus domestica]
Length=487

 Score =   413 bits (1061),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 296/465 (64%), Gaps = 11/465 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++++PWLA GH+IP+  LS  IA RGH VSFVSTPRN+ RLPK+P +L+S +N V  P
Sbjct  20    LHVVVFPWLAMGHLIPFFHLSTLIAQRGHTVSFVSTPRNLSRLPKIPSHLSSLVNLVSFP  79

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP   NLP +AE++ D+P+ K + LK A D LQ  +  FLE   PDW+++D+  +WL  +
Sbjct  80    LPRLPNLPNDAESSTDVPFHKQQLLKTAFDMLQTPLTAFLESSRPDWVIYDYAPHWLPAI  139

Query  1246  ASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             A++LGV+ A F       +A+ G    L+   + RTKAED+TV PKW+PF++ +A+RL+E
Sbjct  140   AARLGVAHAFFFCVNAACLAYLGPPSVLISGQDGRTKAEDFTVVPKWVPFESDMAYRLHE  199

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK----PVF  911
             + + + A +  +    D  R    +E  D+V VR   EF+ EWL L+  ++++    PV 
Sbjct  200   VAKWVQASSGNESGTPDTVRFGVAIEESDVVFVRSSDEFEPEWLNLVRELYREVKVKPVV  259

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP    +     + T   W  IK WLDKQ    V+Y+A G+EA  SQ ELTE+ALG
Sbjct  260   PVGFLPPNIEEEASEFDET---WGGIKGWLDKQRVNSVVYIALGTEATLSQEELTELALG  316

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELSG PFFWVLR            LP GF ER KGRG+V   WAPQ++ILSH+S GGFL
Sbjct  317   LELSGVPFFWVLRNPPESTQSVSEMLPPGFLERVKGRGVVDLGWAPQVRILSHDSXGGFL  376

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH GW+S++E + F + L+    + DQGLNAR+   K +G  +PR+ERDG FTR++VAE 
Sbjct  377   THCGWNSMIEGLMFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFTRDSVAEF  436

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +RL +V+  G   R + KEMK LF D+ + +  V   + +L  ++
Sbjct  437   VRLAMVDDSGESMRIRAKEMKDLFGDRNKNNRIVGEFICFLEENR  481



>ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF35043.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=470

 Score =   412 bits (1058),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 204/463 (44%), Positives = 291/463 (63%), Gaps = 9/463 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             SKLH+ ++PWLA GH+IP+L  S  +A +GH VSF+STP N+ RLPK+PP L+S I+ + 
Sbjct  5     SKLHVAVFPWLAMGHLIPFLRFSNLLAQKGHLVSFISTPGNLHRLPKIPPQLSSHISLIS  64

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LPLP    LP NAE T D+PY K + LK A D L+  +A FLE   PDW+++D+ S+WL 
Sbjct  65    LPLPSVPGLPSNAETTTDVPYTKQQLLKKAFDLLESPLATFLETKKPDWVIYDYASHWLP  124

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG----RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
              +ASK+G+S+A FS+FT  T++F G     +     R  AED+T+ P+W+PF++ + + +
Sbjct  125   SIASKVGISSAFFSLFTAATLSFIGPPSLTMNGGDLRLTAEDFTIVPRWVPFESNIKYCI  184

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             +E+ + I+   E++   +D  R        D+V +R   EF+ EW  L   + +KP+ P+
Sbjct  185   HEVTKYIEKTEEDETGPNDTVRFAFASGGADVVIIRSSPEFEPEWFDLYSKMSEKPIIPL  244

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP    +           W DI  WLDK+E   V+YVA G+EA  ++ E+ E+ALGLE
Sbjct  245   GFLPPLEVEEEDDDI-DVKGWADIIEWLDKKEAESVVYVALGTEAALTRQEVRELALGLE  303

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              S  PF WVL+   G     L  L +G+EER K RG++   W PQ+KILSHESVGGFLTH
Sbjct  304   KSRSPFIWVLKNPPGTTQNALEMLQDGYEERVKDRGMIYCGWVPQVKILSHESVGGFLTH  363

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              GW+SVVE + F + L+L   L DQGLNAR+L  KKIG  VPR+E DG FT ++VAE +R
Sbjct  364   CGWNSVVEGLSFGRVLILFPVLNDQGLNARLLHGKKIGLEVPRNESDGAFTSDSVAELVR  423

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
                V+   ++     KEM+ LF D+ R +   + ++HYL  ++
Sbjct  424   KAKVDDPADL----AKEMRNLFGDRDRNNRLAEGVVHYLEENR  462



>ref|XP_003547595.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Glycine 
max]
Length=479

 Score =   410 bits (1053),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 292/466 (63%), Gaps = 18/466 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M+PWLA GH+ P  E+SK +A +GH V+ VSTP+ IDRLPKLP  L+  +   KL 
Sbjct  21    LHVVMFPWLAMGHVYPCFEVSKILAQKGHYVTLVSTPKIIDRLPKLPQTLSPFVKLTKLL  80

Query  1426  LPPH---QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             L PH    +LP++A++T+D+P +K+ YLKLA DALQE + + L+  +PDW+ +DF + W+
Sbjct  81    LSPHIDKNHLPQDADSTMDIPSNKLYYLKLAYDALQEPVFEVLKTSNPDWVFYDFAASWI  140

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG----RLVDFA--ERTKAEDYTVPPKWIPFKTTVA  1094
               +A  L + +A FS     T+ FF     +L D A   R+  EDY  PPKW+PF T + 
Sbjct  141   PQLAKTLKIHSAYFSPCPAWTICFFDTPKQQLGDAAAANRSNPEDYYGPPKWVPFPTKIG  200

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
              R YE+ ++++ +   +   S +F L +    CD+  +R   + + EWL  L   + KPV
Sbjct  201   LRPYEVRKLLEDIKVNETGASPVFDLNTANSGCDMFVIRSSRDLEQEWLDYLAEFYHKPV  260

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP      G   E     W  IKAWLD Q+   V+Y+AFGSE K SQ  L E+AL
Sbjct  261   VPVGLLPPLR---GSDEEDNSPDWLQIKAWLDTQKGSSVVYIAFGSEVKLSQENLNELAL  317

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             G+ELSG  FFWVLR    E       L EGFE+RTK RG+V  +WAPQ KIL+H SVGG 
Sbjct  318   GIELSGLSFFWVLRKGSVE------FLREGFEDRTKDRGVVWKTWAPQPKILAHASVGGC  371

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G  S++E + F   LV+L FL DQ L +RV+EEKK+G  +PR+E+DG FTR +VA+
Sbjct  372   LTHCGSGSMIENLIFGHVLVMLPFLLDQALYSRVMEEKKVGIEIPRNEQDGSFTRSSVAK  431

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +LRL +VE+EG+ YR   KE+   F ++   D Y++  +  LH HK
Sbjct  432   ALRLAMVEEEGSAYRNNAKELGKKFSNKELDDQYIEDFIASLHNHK  477



>gb|KHN33503.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=471

 Score =   409 bits (1051),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 292/466 (63%), Gaps = 18/466 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M+PWLA GH+ P  E+SK +A +GH V+ VSTP+ IDRLPKLP  L+  +   KL 
Sbjct  13    LHVVMFPWLAMGHVYPCFEVSKILAQKGHYVTLVSTPKIIDRLPKLPQTLSPFVKLSKLL  72

Query  1426  LPPH---QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             L PH    +LP++A++T+D+P +K+ YLKLA DALQE + + L+  +PDW+ +DF + W+
Sbjct  73    LSPHIDKNHLPQDADSTMDIPSNKLYYLKLAYDALQEPVFEVLKTSNPDWVFYDFAASWI  132

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG----RLVDFA--ERTKAEDYTVPPKWIPFKTTVA  1094
               +A  L + +A FS     T+ FF     +L D A   R+  EDY  PPKW+PF T + 
Sbjct  133   PQLAKTLKIHSAYFSPCPAWTICFFDTPKQQLGDAAAANRSNPEDYYGPPKWVPFPTKIG  192

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
              R YE+ ++++ +   +   S +F L +    CD+  +R   + + EWL  L   + KPV
Sbjct  193   LRPYEVRKLLEDIKVNETGASPVFDLNTANSGCDMFVIRSSRDLEQEWLDYLAEFYHKPV  252

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              PVG LP      G   E     W  IKAWLD Q+   V+Y+AFGSE K SQ  L E+AL
Sbjct  253   VPVGLLPPLR---GSDEEDNSPDWLQIKAWLDTQKGSSVVYIAFGSEVKLSQENLNELAL  309

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             G+ELSG  FFWVLR    E       L EGFE+RTK RG+V  +WAPQ KIL+H SVGG 
Sbjct  310   GIELSGLSFFWVLRKGSVE------FLREGFEDRTKDRGVVWKTWAPQPKILAHASVGGC  363

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH G  S++E + F   LV+L FL DQ L +RV+EEKK+G  +PR+E+DG FTR +VA+
Sbjct  364   LTHCGSGSMIENLIFGHVLVMLPFLLDQALYSRVMEEKKVGIEIPRNEQDGSFTRSSVAK  423

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +LRL +VE+EG+ YR   KE+   F ++   D Y++  +  LH HK
Sbjct  424   ALRLAMVEEEGSAYRNNAKELGKKFSNKELDDQYIEDFIASLHNHK  469



>ref|XP_006353274.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=288

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/274 (70%), Positives = 225/274 (82%), Gaps = 3/274 (1%)
 Frame = -2

Query  1048  EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPTTAYDAGG  869
             E++NVSD FR+    E  D + VR C E++ EWLK++ +IH+KPVFPVGQLPTT Y+   
Sbjct  17    EEENVSDAFRMHKTFELTDFLLVRSCLEYEPEWLKVVGDIHRKPVFPVGQLPTTMYEEDN  76

Query  868   GHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFPFFWVLRA  689
                   D+W++IK WLD+QE GKVIYVAFGSE  PSQ ELTE+ALGLELSG PFFW LR 
Sbjct  77    ---TKIDAWREIKLWLDEQEKGKVIYVAFGSEVNPSQNELTELALGLELSGLPFFWALRT  133

Query  688   RRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSSVVEAIQF  509
             +RGE D ELI LPEGFE+RTKGRGIVCTSWAPQLKILSH+SVG FLTHSGWSSVVEAIQF
Sbjct  134   KRGEYDDELIQLPEGFEDRTKGRGIVCTSWAPQLKILSHDSVGVFLTHSGWSSVVEAIQF  193

Query  508   EKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVEKEGNIYR  329
             EKPLVLLTFLADQGLNAR+LE+KK+ YS+PRD+RDG F R++VA+SL LV+VEKEG IYR
Sbjct  194   EKPLVLLTFLADQGLNARLLEKKKMAYSIPRDDRDGSFNRDSVAKSLSLVLVEKEGEIYR  253

Query  328   EKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             +KIKE K LFCD+TRQ+ YV+ LL YL  +K  K
Sbjct  254   KKIKEAKNLFCDETRQNNYVENLLSYLQNYKKAK  287



>ref|XP_007148435.1| hypothetical protein PHAVU_006G208400g [Phaseolus vulgaris]
 gb|ESW20429.1| hypothetical protein PHAVU_006G208400g [Phaseolus vulgaris]
Length=474

 Score =   407 bits (1046),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 205/462 (44%), Positives = 286/462 (62%), Gaps = 15/462 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH++M+PWLA GH+ P  E+SK +A +GH  + VSTP+ IDRLPKLP  L+  +   KLP
Sbjct  17    LHVVMFPWLAMGHVFPCFEVSKILAQKGHYATLVSTPKIIDRLPKLPQTLSPFLKLTKLP  76

Query  1426  LPPH---QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             L PH    NLP++A++T+D+P +K+ YLKLA DALQ+ M + L+  +PDW+ +DF + W+
Sbjct  77    LSPHIDQNNLPQDADSTMDIPSNKLYYLKLAYDALQQPMTQILKTSNPDWVFYDFAASWI  136

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG----RLVDFA-ERTKAEDYTVPPKWIPFKTTVAF  1091
               +A  L +  A FS     ++ FF     +L D A  RT  EDY  PPKW+PF T +  
Sbjct  137   PQLAKSLHIPCAYFSPCPAWSICFFDTPKQQLGDAAASRTNPEDYYGPPKWVPFPTNIGL  196

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             R YE+ ++++ V   +   S +F L      CD+  +R C + + EWL  L   + KPV 
Sbjct  197   RPYEVRKLLEDVKVNETGASPVFDLNEANSGCDMFVIRSCRDLEPEWLDYLGEFYHKPVV  256

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP          E     W  IKAWLD Q+   V+Y+AFGSE K SQ  L E+ALG
Sbjct  257   PVGLLPPVQV-MDSEEEDNNPDWVQIKAWLDTQKASSVVYIAFGSEVKLSQENLNELALG  315

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             +ELSG PFFWVLR    E       LP+GFE+R K  G+V  +WAPQ KIL+H+S+GG L
Sbjct  316   IELSGLPFFWVLRKGSVEL------LPDGFEDRIKDCGVVWKTWAPQAKILAHDSIGGCL  369

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
             TH G  S++E + F   LV+L FL DQ L +RV+EEKK+G  +PR+  DG F R +V+++
Sbjct  370   THCGSGSMIENLYFGHVLVMLPFLLDQALYSRVMEEKKVGIEIPRNPEDGSFRRSSVSKA  429

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLH  245
             +RL +VE+EG+ YRE  KE+   F ++  Q+ Y+   +  L 
Sbjct  430   VRLAMVEEEGSAYRENAKELGKKFSNKHFQNQYIQHFILSLQ  471



>ref|XP_009151459.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Brassica rapa]
Length=453

 Score =   405 bits (1042),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 205/458 (45%), Positives = 285/458 (62%), Gaps = 16/458 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             +H+ M+PWLA GH++P+  +SK +A +GHKVSF+STPRNI+RLP LP +L+S I FV  P
Sbjct  8     MHVAMFPWLAMGHLLPFFRMSKLLAQKGHKVSFISTPRNIERLPNLPSSLSSFITFVSFP  67

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             L P       +E ++D+ Y K   LK A D LQ+ + +FL+E SPDW+++D+ ++WL PV
Sbjct  68    LVPFPGSTPGSECSMDVTYSKQPSLKSAFDLLQKPLTEFLQEESPDWVIYDYAAHWLPPV  127

Query  1246  ASKLGVSTALFSIFTPPTVAFFG--RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
             A++LG+S A FSIF   ++ F G   L+    R+  ED+TV P WIPF++ +A+R +E+ 
Sbjct  128   AAELGISKAFFSIFNAASLCFLGPPSLLLEGVRSTPEDFTVVPPWIPFQSNMAYRYHEVT  187

Query  1072  RIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
              + D   ++ + VSD  R    +   D V V   + F+ EWL LL+++++KPVFP G LP
Sbjct  188   LVGDKRGKDTNGVSDSARFGYSISESDAVFVHTSTGFEPEWLGLLKDLYRKPVFPTGFLP  247

Query  892   TTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             T   D     E  GD +W  IK WLDKQ    V+YVA G+EA     E TE+A GLE S 
Sbjct  248   TDTED-----EVEGDKTWVGIKKWLDKQSINSVVYVALGTEASLPPAEFTELAHGLEKSE  302

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
              PFFWV+R            + +G+ ER  GRG+V   W PQ+KILSH SVGGFLTH GW
Sbjct  303   VPFFWVIRNES--------QILDGYVERVAGRGMVNVGWVPQVKILSHSSVGGFLTHCGW  354

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
             +S+VE + F +  +L   L +QGLN R+LE K +G  +PRDE  G F  ++VA S+RL +
Sbjct  355   NSLVEGLGFGRVPILFPVLNEQGLNTRLLEGKGLGVEIPRDEEKGSFDSDSVAHSVRLAM  414

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHC  242
             V+  G   R K K M GLF +      YVD L+ Y+  
Sbjct  415   VDDAGESIRAKTKLMMGLFGNMDENSRYVDELIGYMRS  452



>ref|XP_010942592.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=465

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 222/466 (48%), Positives = 296/466 (64%), Gaps = 16/466 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+++PWLAFGH+IP+LELSK +A RGH + F+ST RNI RLP +P  L   I+ + +P
Sbjct  6     LHIVLFPWLAFGHLIPFLELSKSLAKRGHHIFFISTSRNIHRLPNIPLPLLPLIDLISIP  65

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYWLA  1253
             LPP  +LP++AEAT DLP  KV +LK A D L + +A+FLE  SP  DWI+ DF  +WL 
Sbjct  66    LPPSHDLPDDAEATTDLPPHKVPFLKKAFDKLDQPIAEFLERASPKPDWIICDFAPHWLP  125

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
             P+ASKL +  A F+ F     +FF      A +   E  TV P+WIPF T VA RL+E  
Sbjct  126   PIASKLNIPCAYFNTFP----SFFSAFA--AGQRSPEQLTVTPEWIPFPTKVAHRLHEAR  179

Query  1072  RIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
              +   +++ +   VSD +R  S V+ C ++A+RGC EFD EWL LL  +++KP+ P+G L
Sbjct  180   SLAKLLSDVNASGVSDNYRFNSVVKGCHLMAMRGCMEFDGEWLTLLPELYKKPIVPLGLL  239

Query  895   PTTA---YDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             P  A    D G  +        ++  WL KQ     +YV+ GSEA  S   + E+A GLE
Sbjct  240   PPLADERPDGGNTNGMANTGHGNVVKWLTKQTPESTVYVSLGSEATLSNELVHELAFGLE  299

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PF W LR R+GE   E+  LP+GFE+R   RG+V   W PQL+IL+  SVGGF TH
Sbjct  300   LSGLPFLWALR-RKGE---EVELLPKGFEDRIAARGMVAVDWMPQLEILACSSVGGFFTH  355

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             SGWSS++E + F  PL+LL    DQG+NARV+ EKK+G  V RDE  G FTREAVA+ LR
Sbjct  356   SGWSSLIEGLAFGHPLILLPIFGDQGINARVMVEKKVGLEVERDEETGSFTREAVAKVLR  415

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIK  227
             LV+VE+EG   RE  K M+ +F ++     Y+D  +HYL  H   +
Sbjct  416   LVMVEEEGKKLRETAKRMREVFGNKDIHGRYMDAFVHYLKDHMRCR  461



>ref|XP_009112190.1| PREDICTED: UDP-glycosyltransferase 91B1 [Brassica rapa]
Length=455

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 216/473 (46%), Positives = 287/473 (61%), Gaps = 38/473 (8%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH+ ++PWLA GHMIPYL+LSK IA++GH VSF+STPRNI RLPK P      INFV L
Sbjct  7     KLHVAVFPWLALGHMIPYLQLSKLIATKGHTVSFISTPRNIARLPKTP-----SINFVSL  61

Query  1429  PLP--PHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             PLP     NLPENAE+T D+P   + YLK A D L E  ++FL+   PDWI++D   YW+
Sbjct  62    PLPHAVDNNLPENAESTTDVPETHIAYLKKAFDGLSEPFSQFLQASKPDWIVYDILHYWV  121

Query  1255  APVASKLGVSTALFSIFT---------PPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKT  1103
              P+A KLGV  ALF  F          P ++   GR      R   ED   PP W+PF+T
Sbjct  122   PPIAEKLGVRRALFCTFNAASIIVIDGPSSIMINGR----DPRKTVEDLMDPPPWVPFET  177

Query  1102  TVAFRLYEILRIIDAVTE--EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENI  929
              + +R +E  RI++  T       ++D +R        +++A+R C+E + EW++LL  I
Sbjct  178   NIVYRAFEARRILEYPTAGVTGAELNDSYRTGLASAGSEVIAIRTCTELEPEWIQLLGEI  237

Query  928   HQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTEL  749
               KPV P+G LP  A D         D   DI  WLD+Q    V+YVA G+E   ++ E+
Sbjct  238   QGKPVIPIGLLPAKATDD--------DVDDDIIEWLDRQRAKSVVYVALGTEVTVNEKEI  289

Query  748   TEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHE  569
               +A GLELSG PFFW +R          + LP+GFEER KGRG+V   W PQ +ILSH 
Sbjct  290   QGLAHGLELSGLPFFWTIRKAS-------VFLPDGFEERVKGRGVVRAEWVPQGRILSHG  342

Query  568   SVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTR  389
             SVGGF+TH GW SVVE + F  PL++     DQ L AR+L    IG  +PR+ERDG FT 
Sbjct  343   SVGGFVTHCGWGSVVEGLSFGVPLIMFPCNLDQPLVARMLAGMNIGREIPRNERDGSFTS  402

Query  388   EAVAESLRLVVVEKEGNIYREKIKEM-KGLFCDQTRQDGYVDTLLHYLHCHKS  233
              +V E++RLVVVE+EG IYR+  + M K +F ++  QD YVD+ + +L  H++
Sbjct  403   VSVVETIRLVVVEEEGKIYRDNAESMQKNVFGNRRLQDQYVDSFIKFLENHRA  455



>ref|XP_007206476.1| hypothetical protein PRUPE_ppa019000mg [Prunus persica]
 gb|EMJ07675.1| hypothetical protein PRUPE_ppa019000mg [Prunus persica]
Length=363

 Score =   400 bits (1027),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 248/363 (68%), Gaps = 10/363 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E  KLHI ++PWLAFGH+IP+ E++KH+A RGHKVSF+STPRNI RLPK+P +L   IN 
Sbjct  6     EPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTPLINL  65

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V++PLP  +NLPENAEAT+D+PY  + YLK+A D L++ ++ FL+   PDWI+HDF  +W
Sbjct  66    VQIPLPRVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLQTHKPDWIIHDFAPHW  125

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVA  1094
             L P+AS LG+S A FSIF   T+ F G      L  +  RT  E +TVPP+WIPF + + 
Sbjct  126   LPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTVPPEWIPFPSNLV  185

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR +E  ++ DA  +    VSD+FR+ S V+ C +  +R C E + EWL LL+ + Q PV
Sbjct  186   FRSFEAKKLFDATKQNASGVSDLFRVQSTVQGCQVYLIRSCREIEGEWLDLLQELQQFPV  245

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP              + W  I  WLDKQE G V+Y+A GSE   SQ + TE+AL
Sbjct  246   VPIGLLPPLVQT-----REDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQEDFTELAL  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLELSG PFFWVLR      D + + LP+GFEERTKGRG+V T+WAPQ KIL+H+S+GGF
Sbjct  301   GLELSGLPFFWVLRTPSWSGDSDSVKLPDGFEERTKGRGLVWTTWAPQTKILAHDSIGGF  360

Query  553   LTH  545
             LTH
Sbjct  361   LTH  363



>ref|XP_010060107.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 91C1-like 
[Eucalyptus grandis]
Length=473

 Score =   404 bits (1037),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 211/468 (45%), Positives = 284/468 (61%), Gaps = 19/468 (4%)
 Frame = -2

Query  1621  HEG-SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             H+G   LHI M+PWLA GH+IP+  LSKH+A RGHK+SF+STPRN+ RLPK+P NL+  I
Sbjct  8     HQGHDSLHIAMFPWLAMGHLIPFFHLSKHLAQRGHKISFISTPRNLQRLPKIPQNLSPLI  67

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
             N + LP P   NL  +AE++ID  + K + LK+A D LQ  +  FLE    DWI++DF S
Sbjct  68    NLIPLPFPHIPNLTPHAESSIDTSFSKQQLLKIAIDKLQPAITCFLESSQLDWIIYDFAS  127

Query  1264  YWLAPVASKLGV--------STALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPF  1109
             +WL   A++LG+        + A+  +  PPTV   G       RT  ED+   P+WIPF
Sbjct  128   HWLPSTAAELGIHRCFCGLFNAAVLCLIGPPTVLIGGS----DPRTTIEDFLRVPEWIPF  183

Query  1108  KTTVAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENI  929
             ++ + FR YEI R+    +E      D  R+   +   ++VAVR C EF+ EW+ LL ++
Sbjct  184   ESDIVFRSYEITRLXQHSSEYISETPDTVRMGVTIRDSEVVAVRTCVEFEPEWIDLLRDL  243

Query  928   HQKPVFPVGQLPTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTE  752
             +QKP+ P+G LP    D     E   D  W  IKAWLD+Q    V+YVA G+E   SQ E
Sbjct  244   YQKPLVPIGFLPPCMED----DEDVNDMKWVSIKAWLDEQRLNSVVYVALGTEGVLSQEE  299

Query  751   LTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSH  572
             +TE+ALGLE S   FFWVLR         +  LP GF +  +GRG+VCT WAPQ++ILSH
Sbjct  300   VTELALGLEKSELSFFWVLRNPPESTQKAIDMLPNGFLQGVEGRGMVCTDWAPQVQILSH  359

Query  571   ESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFT  392
             +SVGGFLTH GW+S++E + F + L+L     DQG NAR+L+ K +G  V R E DG FT
Sbjct  360   DSVGGFLTHCGWNSIIEGLAFGRVLMLFPMTTDQGPNARLLQGKGLGIEVTRKE-DGMFT  418

Query  391   REAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              +AVAE LR  +V+  G+  R   KE K L  D+      +D  + YL
Sbjct  419   SDAVAELLRFAMVDDFGSSLRASAKEAKKLLGDRETNQRCMDEFIQYL  466



>ref|XP_006852904.1| hypothetical protein AMTR_s00033p00224400 [Amborella trichopoda]
 gb|ERN14371.1| hypothetical protein AMTR_s00033p00224400 [Amborella trichopoda]
Length=467

 Score =   403 bits (1036),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/462 (45%), Positives = 298/462 (65%), Gaps = 7/462 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH+ +  + AFGH+IP+LELSK +A +GHKVSF+STPRNIDRLPK+PPNLA+ IN VK  
Sbjct  6     LHVAVLSFSAFGHLIPFLELSKILAQKGHKVSFISTPRNIDRLPKIPPNLATLINLVKFE  65

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LPP   LPENAEAT+DLP +K+++L  A D L E +  F+ E SPDW++HD  + W   +
Sbjct  66    LPPTHGLPENAEATMDLPIEKLQFLTAAYDKLHEPIENFVSEESPDWLIHDLFAPWAPCL  125

Query  1246  ASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             A+K G+ +   S+FT  T+ FFG    LV   +R   E Y   P+W+PF + VA R++E 
Sbjct  126   AAKFGIPSCFCSVFTASTLVFFGPPDGLVGAHQRLTPESYAKAPEWVPFPSIVALRMHEA  185

Query  1075  LRIIDAVTE-EDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
              R+     + E   +S   R    +E CD VAVR C EF+ ++L+LL  ++ KPV P G 
Sbjct  186   ARVSQLGNKVEASGMSSHQRFAMTIEGCDFVAVRSCYEFEGKYLELLRELYGKPVLPFGL  245

Query  898   LPTTAYDA-GGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             +P+   +  G G    G+ +  I +WLD++  G +++V FG+E + S  E+ E+A GLEL
Sbjct  246   VPSPPVEKRGAGEGGNGNEYSRIFSWLDEKAKGSIVFVGFGTETRLSMDEVHEMAFGLEL  305

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PF W+L+ +  E    +  LP+GFE R   RG+V   WAPQ ++L+H ++GG L HS
Sbjct  306   SGLPFVWLLK-KPQEGCEGMDLLPQGFETRISNRGVVHVGWAPQAQLLAHPAIGGCLFHS  364

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GW SV+EA+Q+   L++L F+ DQGLNA++L EK I   + R+ +DG FT+EAVA+ LR 
Sbjct  365   GWGSVIEALQWGHTLIVLPFVFDQGLNAKLLVEKGIALEIERN-KDGSFTKEAVAKGLRQ  423

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              +VE+EG   R K +E + +F D+   D Y++  + YL  H+
Sbjct  424   AMVEEEGEPLRVKAREAEAIFADRGLHDRYMNDFIKYLQDHR  465



>ref|XP_007134314.1| hypothetical protein PHAVU_010G036800g [Phaseolus vulgaris]
 gb|ESW06308.1| hypothetical protein PHAVU_010G036800g [Phaseolus vulgaris]
Length=438

 Score =   400 bits (1029),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 299/459 (65%), Gaps = 33/459 (7%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+++PWLAFGHM+P+LEL+K IA +GHK+SF+STPRNI RLPK+P NL   ++ ++L
Sbjct  7     KLHIVVFPWLAFGHMLPFLELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPLVDLIEL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT+D+P+  + YLKLA D L++ + KFLE   P WI++DF  YWL P
Sbjct  67    PLPRVDKLPENAEATVDIPHHIIPYLKLAFDGLEQPLTKFLERSKPHWIIYDFAPYWLPP  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             ++SKLG+S   F IF+   +  F    DF  R ++E  +   K IP              
Sbjct  127   ISSKLGISCVSFCIFSASGMYSFS---DFFTRKESE--SPRSKGIP--------------  167

Query  1069  IIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
               +   E D++ VSD+FR++       ++A R C E + E LKL E+I++K V PVG LP
Sbjct  168   --EEHNENDESGVSDMFRVLRTSNGAQVIASRSCMEIEGEPLKLCESIYRKTVIPVGLLP  225

Query  892   TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGF  713
              +   +   ++   ++W  I  WLDKQE G VIYVAFGSE   S  + TEI +G+E+SGF
Sbjct  226   PSLQFSEDSND---ENWNTILNWLDKQEKGSVIYVAFGSEVTLSDEDFTEITMGIEMSGF  282

Query  712   PFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWS  533
             PFFWVL+ ++  +  EL    +       G+G+V T+WAPQ++ILSH+S+GGFLTH GWS
Sbjct  283   PFFWVLK-KQNTSSVEL----QDVVVNNSGKGMVWTTWAPQMRILSHKSIGGFLTHCGWS  337

Query  532   SVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVV  353
             SV+E++Q   PLV+L F  +Q + AR++EEKK+G+ V R+E  G+FTRE++A +LR V++
Sbjct  338   SVIESLQIGCPLVMLPFQNEQFIVARLMEEKKVGFKVERNEHHGKFTRESLAIALRSVML  397

Query  352   EKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             E+    YR + +EM  +F D+     Y+D  + Y+  H+
Sbjct  398   EE---TYRSEAQEMSKIFGDKELHQKYIDHFVDYMEIHR  433



>ref|XP_007134315.1| hypothetical protein PHAVU_010G036900g [Phaseolus vulgaris]
 gb|ESW06309.1| hypothetical protein PHAVU_010G036900g [Phaseolus vulgaris]
Length=437

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/458 (44%), Positives = 295/458 (64%), Gaps = 32/458 (7%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+++PWLAFGH++P+ EL+K IA +GHK+SF+STPRNI RLPK+P NL   ++ ++L
Sbjct  7     KLHIVVFPWLAFGHILPFFELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPLVDLIEL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT+D+PY  + YLKLA D L++ + KFLE   P WI++DF  YWL P
Sbjct  67    PLPRVDKLPENAEATVDIPYHIIPYLKLAFDGLEQPLTKFLERCKPHWIIYDFAPYWLPP  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             ++SKLG+S   F+IF+   + +F    D   R ++E      K+IP +            
Sbjct  127   ISSKLGISCVSFNIFSASCMYYFS---DIFTRKESESSR---KYIPEEHN----------  170

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
                     +  VSD+FR+++       +A R C E + E LKL E+I++K V PVG LP 
Sbjct  171   -----ENNESGVSDVFRVLTTFNGAQFIASRSCMEIEGEPLKLCESIYRKTVIPVGLLPP  225

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +   +   ++   ++W  I  WLDKQE G VIYVAFGSE   S  + TEI +G+E+SGFP
Sbjct  226   SLQFSEDSND---ENWNTILNWLDKQEKGSVIYVAFGSEVTLSDEDFTEITMGIEMSGFP  282

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFWVL+ ++  +  EL    +       G+G+V T+WAPQ++ILSH+S+GGFLTH GWSS
Sbjct  283   FFWVLK-KQNTSSVEL----QDVVVNNSGKGMVWTTWAPQVRILSHKSIGGFLTHCGWSS  337

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E++Q   PLV+L F +DQ +NA  +EEK++G  V R++  G+FTRE++A +LR V++E
Sbjct  338   VIESLQIGCPLVMLPFQSDQFINAGFMEEKRVGVKVQRNKHCGKFTRESLAIALRSVMLE  397

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             K    YR + ++M  +F D+     Y+D  + Y+  H+
Sbjct  398   K---TYRSEAQKMSKIFGDKELHQKYIDHFVDYMENHR  432



>ref|XP_010927293.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=462

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 301/466 (65%), Gaps = 15/466 (3%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             + +  HI+M PWLAFGH+ P+ ELSK +A RGH++SF+ST RN+ RLP +PP+L+  I F
Sbjct  3     DATTFHIVMLPWLAFGHLHPFFELSKSLAKRGHQISFISTTRNLRRLPDVPPHLSPLIRF  62

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDS  1265
             V LPLP    LP++AEAT DLP    +YLK A D L++   +F+ + SP  DWI+HDF +
Sbjct  63    VPLPLPHVDGLPDSAEATCDLPQSSFQYLKKAFDGLEQLFVQFINQSSPRADWIIHDFAA  122

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDY-TVPPKWIPFKTTVAFR  1088
             YW    ASK GV    +S F   T+AFFGR  D  +   +    T P K +PF TTVA+R
Sbjct  123   YW----ASKAGVPCIFYSTFPASTLAFFGRPSDMGKGGGSLKGLTGPSKRVPFPTTVAYR  178

Query  1087  LYEILRI-IDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
              +E +R+ +D +      V D  R    +E   +VA R C++F+++W ++L +I+ KPV 
Sbjct  179   YHEAIRLALDCLQPNASGVPDWLRTKLSLENSKLVAPRSCTDFEADWFQVLLDIYDKPVV  238

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG LP    ++G   +      + +  +LD Q  G VIYVA GSEA     +L E+ALG
Sbjct  239   PVGLLPPQLPESGQRRD------EKVFNFLDTQTPGSVIYVALGSEATIGGEQLHELALG  292

Query  730   LELSGFPFFWVLRARRGEADPELIHL-PEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             LELSG PF W LR      +   I L PEGFE RT+GRG+V   W PQ+ +L+HE+VGGF
Sbjct  293   LELSGLPFLWALRKPTSTVETGGIGLLPEGFEGRTQGRGLVAMGWVPQVDVLAHEAVGGF  352

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             LTH GW S++E ++F +PLV+L   ADQGLNAR + EKK+G  V RDE +G F REAVA+
Sbjct  353   LTHCGWGSLIEGLEFGRPLVMLPVFADQGLNARAMGEKKLGLEVERDEENGFFVREAVAK  412

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             ++++V+VE+EG + R K KEM+G+F D+ RQ+ YVD  +  L  H+
Sbjct  413   AVKVVMVEEEGEVIRSKAKEMRGIFGDKERQERYVDGFVKCLAIHR  458



>ref|XP_010938322.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=469

 Score =   399 bits (1025),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 210/461 (46%), Positives = 284/461 (62%), Gaps = 10/461 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LHI M PWLAFGHMIP+L L+  +A+ G +VSF+STPRNI RLPK+PP+L S I F++L
Sbjct  5     RLHIAMLPWLAFGHMIPFLHLAVALATAGLRVSFLSTPRNIQRLPKIPPHLTSLITFIQL  64

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LP+ AEAT+DLP D+V  LK+A D LQ ++ KFL E SPD+++HDF  YW A 
Sbjct  65    PLPRVDGLPDQAEATVDLPTDEVPLLKIAYDLLQNSVKKFLAEESPDYVIHDFLQYWAAA  124

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE------RTKAEDYTVPPKWIPFKTTVAFR  1088
              A  +GV +  FS+++  T+AFFG      E      R   E  T PP W+P  +TVAFR
Sbjct  125   AARDMGVQSIFFSVYSAATLAFFGPPEALTEDGRRKLRPTPESLTSPPDWLPSGSTVAFR  184

Query  1087  LYEILRIIDAV-TEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
               E      A  T     ++DI R    VE C  VA+R C E++ E+L+++  +++KPV 
Sbjct  185   RREAEVFYSAAFTMNSSGITDIDRFRLVVESCTAVAIRTCPEYEGEYLEIVRRLYRKPVI  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG +  +   A G  E   D W  +  WLD Q    V++V+FGSE K  + EL E+A G
Sbjct  245   PVGLILPSPLAASG--EEGDDRWARVIRWLDAQTPMSVVFVSFGSEYKMERRELHELAHG  302

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LEL+  PF WVLR        +   LP GF +RTKGRG +C  WAPQL+IL+H S+GG L
Sbjct  303   LELANVPFLWVLRRPSWCNGSDEEALPAGFIDRTKGRGTLCFGWAPQLEILAHPSIGGSL  362

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
              HSGW S++E+++    LV+L  + DQ LNAR+L EK I   V R + DG FTR+ + ++
Sbjct  363   FHSGWGSIIESLRHGHALVVLPCMVDQSLNARLLVEKGIAVEVER-QGDGSFTRDGIVKA  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             L + +V  +G   R K ++M  LF DQ   D YV   + YL
Sbjct  422   LDMAMVSGQGEELRTKTRKMATLFADQELDDKYVREFVDYL  462



>ref|XP_007134322.1| hypothetical protein PHAVU_010G037600g [Phaseolus vulgaris]
 gb|ESW06316.1| hypothetical protein PHAVU_010G037600g [Phaseolus vulgaris]
Length=441

 Score =   397 bits (1021),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 289/460 (63%), Gaps = 28/460 (6%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+++PWLAFGHM+P+ EL+K IA +GHK+SF+STPRNI RLPK+P NL   ++ ++L
Sbjct  7     KLHIVVFPWLAFGHMLPFFELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPLVDLIEL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT+D+P+  + YLKLA D L++ + KFLE     WI++DF  YWL P
Sbjct  67    PLPRVDKLPENAEATVDIPHHIIPYLKLAFDGLEQPLTKFLERCKAHWIIYDFAPYWLPP  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             ++SKLG+S   FSIF        G  +   + T+    +V  K  P +   A        
Sbjct  127   ISSKLGISCIFFSIFNAS-----GLCLILGDYTRKASKSVQNKGFPKEHYEA--------  173

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
                     +  VSD+FRL+       + A+R C E + E LKL E+IH K + PVG LP 
Sbjct  174   -------NESGVSDVFRLLRISNGAQVFALRSCMEIEGEPLKLCESIHGKTMIPVGLLPP  226

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +   +    +   ++W  I  WLDKQE G VIYVAFG+E   S  + TEI +G+E+SGFP
Sbjct  227   SLEFS---EDSNDENWNTILNWLDKQEKGSVIYVAFGTEMTLSDEDFTEITMGIEMSGFP  283

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFWVL+ ++  +  EL    +       G G+V  +WAPQ++ILSH+S+GGFLTH GWSS
Sbjct  284   FFWVLK-KQNTSSVEL----QDVVVNNSGNGMVWRTWAPQMRILSHKSIGGFLTHCGWSS  338

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E++Q   PLV+L F  DQ + +R++EEK +G  V R E +G+F+RE++A +LR V++E
Sbjct  339   VIESLQIGCPLVMLPFQNDQFIVSRLMEEKGVGIKVQRSEDEGKFSRESLANALRSVMLE  398

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             +EG  YR + ++M  +F ++  Q  Y D  + Y+  H+ I
Sbjct  399   EEGKTYRSQAEKMSKVFGNKELQKKYADEFVDYMETHRPI  438



>ref|XP_007012761.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY30380.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=542

 Score =   401 bits (1031),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 299/460 (65%), Gaps = 16/460 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++P+LE+SK +A +GH++S++STP+NI RLPKLP +L+S I+F+++
Sbjct  80    KLHIAMFPWLAYGHIMPFLEVSKFLAQKGHRISYISTPKNISRLPKLPAHLSSNISFIEI  139

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP    LP   E+T ++P  KV YLK A D L+  + +FL+    +WI+HDF  +WL  
Sbjct  140   SLPQVHGLPPGVESTAEIPIQKVPYLKKACDKLEVPLTEFLKTSHVNWIIHDFMPHWLPG  199

Query  1249  VASKLGVSTALFSIFTPPTVAFFG--RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA   G++   FSIF    +AFFG    +    R + ED+TV P+WI +   +AF+L+E+
Sbjct  200   VAIPFGINLVFFSIFNATLLAFFGPPSALIGDHRKRPEDFTVVPEWIDYPCNIAFKLHEM  259

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +    +  E  D+VSD  RL   ++ C  V +R C+EF+S+ ++LL+ ++QKPV PVG L
Sbjct  260   V----SHQECMDDVSDSQRLGQVIQGCQFVILRSCTEFESDQIQLLKKLYQKPVVPVGLL  315

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P +        E + +SW+DIK WLD++    V YVA GSE   SQ  + E+A G+  S 
Sbjct  316   PPS---LPSNEEKSHESWEDIKKWLDRKGEKSVFYVALGSEVSLSQESMHELAFGIYKSN  372

Query  715   FPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              PF WV+R R    G+   ++I  P+GFEER   RG+V   WAPQL+IL+H SVGGFLTH
Sbjct  373   LPFIWVVRNRPLVEGQMGQDII--PQGFEERVSDRGLVLKDWAPQLRILAHSSVGGFLTH  430

Query  544   SGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
              GWSS++EA++F +PL+L +   +DQGLNAR+L  KK+G  + R+E DG FT + VA+++
Sbjct  431   CGWSSIIEALKFGRPLILFSGASSDQGLNARLLHGKKVGLEIERNELDGSFTSDLVAQTI  490

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             R V+VE EG   R     M+ + C++   + Y+D    ++
Sbjct  491   RQVMVEPEGEPVRANAWAMRDI-CNEELSENYLDEFTRFI  529



>ref|XP_007134316.1| hypothetical protein PHAVU_010G037000g [Phaseolus vulgaris]
 gb|ESW06310.1| hypothetical protein PHAVU_010G037000g [Phaseolus vulgaris]
Length=438

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 206/458 (45%), Positives = 296/458 (65%), Gaps = 33/458 (7%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHIM++PWLAFGH++P+ EL+K IA +GHK+SF+STPRNI RLPK+P NL   ++ ++L
Sbjct  7     KLHIMVFPWLAFGHIVPFFELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPLVDLIEL  66

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPENAEAT+D+P+  + YLKLA D L++ + KFLE   P WI++DF  YWL P
Sbjct  67    PLPRVDKLPENAEATVDIPHHIIPYLKLAFDGLEQPLTKFLERSKPHWIIYDFAPYWLPP  126

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             ++SKLG+S   F IF+   +  F    DF  R ++E  +   K IP              
Sbjct  127   ISSKLGISCVSFCIFSASGMYSFS---DFFTRKESE--SPRSKGIP--------------  167

Query  1069  IIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP  893
               +   E D++ VSD+FR ++      ++A R C E + E LKL E+I++K V PVG LP
Sbjct  168   --EEHNENDESGVSDVFRFLTTFNGAQVIASRSCMEIEGEPLKLCESIYRKTVIPVGLLP  225

Query  892   TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGF  713
              +   +   ++   ++W  I  WLDKQE G VIYVAFG+E   S  + TEI +G+E+SGF
Sbjct  226   PSLQFSEDSND---ENWNTILNWLDKQEKGSVIYVAFGTEVTLSDEDFTEITMGIEMSGF  282

Query  712   PFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWS  533
             PFFWVL+ ++  +  EL    +       G+G+V T+WAPQ++ILSH+S+GGFLTH GWS
Sbjct  283   PFFWVLK-KQNTSRVEL----QDVVVNNSGKGMVWTTWAPQVRILSHKSIGGFLTHCGWS  337

Query  532   SVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVV  353
             SV+E++Q   PLV+L F +DQ +NA  +EEK++G  V R+E  G+FTRE++A +LR V++
Sbjct  338   SVIESLQIGCPLVMLPFQSDQFINAGFMEEKRVGVKVQRNEHCGKFTRESLAIALRSVML  397

Query  352   EKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             E+    YR + +EM  +F D+     Y+D  + Y+  H
Sbjct  398   EE---TYRSEAQEMSKIFGDKELHQKYIDHFVDYMEIH  432



>ref|XP_010938324.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=469

 Score =   398 bits (1023),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 211/461 (46%), Positives = 283/461 (61%), Gaps = 10/461 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             +LHI M PWLAFGHMIP+L L+  +A+ G +VSF+STPRNI RLPK+PP+L S I F++L
Sbjct  5     RLHIAMLPWLAFGHMIPFLHLAVALATAGLRVSFLSTPRNIQRLPKIPPHLTSLITFIQL  64

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LP+ AEAT+DLP D+V  LK+A D LQ ++ KFL E SPD+++HDF  YW A 
Sbjct  65    PLPRVDGLPDQAEATVDLPTDEVPLLKIAYDLLQNSVKKFLAEESPDYVIHDFLQYWAAA  124

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAE------RTKAEDYTVPPKWIPFKTTVAFR  1088
              A  +GV +  FS+++  T+AFFG      E      R   E  T PP W+P  +TVAFR
Sbjct  125   AARDMGVQSIFFSVYSATTLAFFGPPEALTEDGRRKLRPTPESLTSPPDWLPSGSTVAFR  184

Query  1087  LYEILRIIDAV-TEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
               E      A  T     ++DI R    VE C  VA+R C E++ ++L+++  +++KPV 
Sbjct  185   RREAEVFYSAAFTMNSSGITDIDRFRLVVESCTAVAIRTCPEYEGDYLEIVRRLYRKPVI  244

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             PVG +  +   AGG  E   D W  +  WLD Q    V++V+FGSE K  + EL E+A G
Sbjct  245   PVGLILPSPPAAGG--EEGDDRWARVFRWLDSQTPKSVVFVSFGSEYKMERRELHELAHG  302

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LEL+  PF WVLR        +   LP GF +RTK RG +C  WAPQL+IL+H SVGG L
Sbjct  303   LELANVPFLWVLRRPSWCNGSDEEALPAGFIDRTKSRGTLCFGWAPQLEILAHPSVGGSL  362

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
              HSGW S++E ++    LV+L  + DQ LNAR+L EK I   V R + DG FTR+ + ++
Sbjct  363   FHSGWGSIIETLRHGHTLVVLPCMVDQSLNARLLVEKGIAVEVERQD-DGSFTRDGIVKA  421

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             L + +V  +G   R K +EM  LF DQ   D YV   + YL
Sbjct  422   LDVAMVSGQGEELRTKTREMATLFADQELDDKYVREFVDYL  462



>ref|XP_004485549.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Cicer arietinum]
 gb|AGU14124.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   397 bits (1019),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/474 (42%), Positives = 293/474 (62%), Gaps = 13/474 (3%)
 Frame = -2

Query  1624  DHEGSK-LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASR  1448
             D++ +K LH++M+PWLA GHM P  E+SK +A  G  V+ +STP  I+RLPKLP  L+  
Sbjct  2     DNKNNKPLHVVMFPWLAMGHMYPCFEVSKILAQNGFFVTILSTPSIINRLPKLPQTLSQF  61

Query  1447  INFVKLPLPPH---QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILH  1277
             I+ +KLPL PH    +LP+NA++T D+P +K+ YLK A D+LQ++++  L+  +PDW+  
Sbjct  62    IHLIKLPLSPHIDTNHLPQNADSTSDIPSNKLYYLKQAYDSLQQSVSDVLKNSNPDWVFF  121

Query  1276  DFDSYWLAPVASKLGVSTALFSIFTPPTVAFFG----RLVDFAE-RTKAEDYTVPPKWIP  1112
             DF + WL  +A  + +S A FS     ++ FF     +L D    R   EDY  PPKWIP
Sbjct  122   DFAACWLPQIARSMNISCAYFSPCPAWSICFFDTPKQQLGDVESIRKNDEDYYGPPKWIP  181

Query  1111  FKTTVAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLEN  932
             F T +  R YE+ ++++ V   +   S +F L      CD+  +R   + + EWL  L  
Sbjct  182   FPTKIGLRSYEVKKLLEDVKVNETGASPVFDLNKTNSGCDMFVIRSSRDLEPEWLDFLGE  241

Query  931   IHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTE  752
              + KPV PVG LP +   +          W  IK WLD Q+   V+Y+AFG+E K SQ  
Sbjct  242   FYNKPVIPVGLLPPSMQISDFDEVDNSPDWIQIKEWLDTQKGSSVVYIAFGAEVKLSQEN  301

Query  751   LTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSH  572
             + E+ALG+ELSG PFFWVLR  +  +    I LP GFE RTK  G+V  +WAPQ KIL+H
Sbjct  302   INELALGIELSGLPFFWVLRDVKNGS----IELPNGFEHRTKDHGLVWKNWAPQPKILAH  357

Query  571   ESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFT  392
              SVGG LTH G  S++E++ F   LV+L FL DQ L +RV++EKK+G  + R+E+DG FT
Sbjct  358   GSVGGCLTHCGSGSMIESLYFGHVLVMLPFLLDQALYSRVMQEKKVGIEIVRNEQDGSFT  417

Query  391   REAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
             R +VA++LR  +V++EG+ YR+  KEM   + ++   + Y++  +  L+ H+ +
Sbjct  418   RNSVAKALRFAMVDEEGSAYRKNAKEMGKKYSNKDLHNQYIENFISSLYKHRHV  471



>ref|NP_201358.1| UDP-glycosyltransferase 91B1 [Arabidopsis thaliana]
 sp|Q9LSM0.1|U91B1_ARATH RecName: Full=UDP-glycosyltransferase 91B1 [Arabidopsis thaliana]
 dbj|BAA98174.1| anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis thaliana]
 gb|ABH04468.1| At5g65550 [Arabidopsis thaliana]
 gb|AED98070.1| UDP-glycosyltransferase 91B1 [Arabidopsis thaliana]
 gb|AHL38568.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=466

 Score =   396 bits (1017),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 278/463 (60%), Gaps = 19/463 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH+ ++PWLA GHMIPYL+LSK IA +GH VSF+ST RNI RLP +  +L+  +NFV L
Sbjct  7     KLHVAVFPWLALGHMIPYLQLSKLIARKGHTVSFISTARNISRLPNISSDLS--VNFVSL  64

Query  1429  PLPPH-QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             PL     +LPENAEAT D+P   + YLK A D L E   +FLE   P+WI++D   +W+ 
Sbjct  65    PLSQTVDHLPENAEATTDVPETHIAYLKKAFDGLSEAFTEFLEASKPNWIVYDILHHWVP  124

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
             P+A KLGV  A+F  F   ++   G      +     R  AED  VPP W+PF+T + +R
Sbjct  125   PIAEKLGVRRAIFCTFNAASIIIIGGPASVMIQGHDPRKTAEDLIVPPPWVPFETNIVYR  184

Query  1087  LYEILRIIDAVTEEDDNV--SDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             L+E  RI++  T     V  +D  RL       +++ +R C E + EW++LL  +  KPV
Sbjct  185   LFEAKRIMEYPTAGVTGVELNDNCRLGLAYVGSEVIVIRSCMELEPEWIQLLSKLQGKPV  244

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP T  D          +W DI+ WLD+ +   V+YVA G+E   S  E+  +A 
Sbjct  245   IPIGLLPATPMDDADDE----GTWLDIREWLDRHQAKSVVYVALGTEVTISNEEIQGLAH  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLEL   PFFW LR R   +    + LP+GF+ER K RG++ T W PQ KILSH SVGGF
Sbjct  301   GLELCRLPFFWTLRKRTRAS----MLLPDGFKERVKERGVIWTEWVPQTKILSHGSVGGF  356

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             +TH GW S VE + F  PL++     DQ L AR+L    IG  +PR+ERDG FT  +VAE
Sbjct  357   VTHCGWGSAVEGLSFGVPLIMFPCNLDQPLVARLLSGMNIGLEIPRNERDGLFTSASVAE  416

Query  373   SLRLVVVEKEGNIYREK-IKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++R VVVE+EG IYR     + K +F ++  QD Y D  + +L
Sbjct  417   TIRHVVVEEEGKIYRNNAASQQKKIFGNKRLQDQYADGFIEFL  459



>ref|XP_007148434.1| hypothetical protein PHAVU_006G208300g [Phaseolus vulgaris]
 gb|ESW20428.1| hypothetical protein PHAVU_006G208300g [Phaseolus vulgaris]
Length=478

 Score =   396 bits (1018),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 198/457 (43%), Positives = 279/457 (61%), Gaps = 4/457 (1%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI M PWLA GH+ PY E++K +A +GH V+F+++P+NIDR+PK P  L   I  V+LP
Sbjct  21    LHIAMLPWLAMGHIYPYFEVAKILAQKGHHVTFINSPKNIDRIPKAPKTLRPFITLVRLP  80

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  Q+LPE AE+T+D+P  K  +LK A + LQ+ +A+ L+   PDW+ +DF + W+ P+
Sbjct  81    LPHVQHLPEGAESTMDIPSTKNCFLKKAYEGLQDPVAELLKTSKPDWVFYDFAAAWVTPI  140

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILRI  1067
             A  L +  A ++I       FF    D  +    E    PP W+PF TT+  R YE LR 
Sbjct  141   AKSLNIPCAHYNITPAYNKVFFDPPKDKMKDYSIETICGPPTWLPFPTTLRLRPYEFLRA  200

Query  1066  IDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPTT  887
             +    +++      F L      CD+  +R   E + EWL  L   ++ PV PVG LP +
Sbjct  201   LQRNRDQETGEKADFDLNKAYSSCDLFLLRTSRELEGEWLDYLAGNYKVPVVPVGLLPPS  260

Query  886   AYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFPF  707
                     E     W  IK WLD +E+  V+Y+ FGSE K SQ +LTE+A G+ELSG PF
Sbjct  261   MQIRDAEEEDENPDWVTIKEWLDAKESSSVVYIGFGSELKLSQEDLTELANGIELSGLPF  320

Query  706   FWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSSV  527
             FW L+  +      ++ LPEGFEERTK RG+V  SWAPQLKIL+H ++GG ++H G  SV
Sbjct  321   FWALKNLK----EGVLELPEGFEERTKDRGVVWKSWAPQLKILAHGAIGGCMSHCGSGSV  376

Query  526   VEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVEK  347
             +E + F   LV L +L DQ L +RVLEEKK+   VPR E+DG FTR++VA++LR  +V++
Sbjct  377   IEKLHFGHALVTLPYLLDQALFSRVLEEKKVAIEVPRSEKDGSFTRDSVAKTLRFAIVDE  436

Query  346   EGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             EG+  R+  KEM  LF  +   + Y+D L+  LH ++
Sbjct  437   EGSSLRKNAKEMGKLFSSEELHNHYIDDLIAALHKYR  473



>ref|XP_002323718.1| hypothetical protein POPTR_0017s07030g [Populus trichocarpa]
 gb|EEF03851.1| hypothetical protein POPTR_0017s07030g [Populus trichocarpa]
Length=465

 Score =   396 bits (1017),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/464 (43%), Positives = 286/464 (62%), Gaps = 8/464 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
              SK H+ M+PW AFGH++PYLE SK +A++G  +SF+STPRNI RLP +P N++ +  F+
Sbjct  2     ASKSHVFMFPWFAFGHILPYLEFSKQLAAKGIHISFISTPRNIKRLPSIPQNISGKFKFI  61

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             ++ LP    LPEN EATIDL  ++++YLK A DAL+      +++ +P+ IL DF + W+
Sbjct  62    EIQLPIVDGLPENCEATIDLSPEQIQYLKQAYDALKVPFESLVQKEAPEMILFDFAACWI  121

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
               +A++ G+++  FS  +  + A+ G    L  F  RT+ EDY   P+WIPF + VA+R 
Sbjct  122   PAIAARYGITSVFFSPLSAASSAYLGPPDELHSFRLRTRPEDYARAPEWIPFPSLVAYRP  181

Query  1084  YEILRIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
              +  R +  V   D   +S   R    +  CD+VAVR C EF+  +L +LE I+QKPV P
Sbjct  182   DQGTRYMQHVYIPDVSGISTGQRRAKTLAECDMVAVRSCREFEDSYLNVLEEIYQKPVLP  241

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             +G LP    +    H P   ++     WLDKQE   V++V FGSE K     + E+A G+
Sbjct  242   IGLLPPNFVENKTSH-PESSNFSSTFKWLDKQEQKSVVFVGFGSEYKMPVETIHELAYGI  300

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSG PF W+L+   G    +L  LP GF  R   RGIV   WAPQL+IL+H S+GG L 
Sbjct  301   ELSGLPFMWILKKPEGIDSQDL--LPTGFVSRISDRGIVSFGWAPQLEILAHPSIGGCLF  358

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             HSGW S++E++ F  PL+L+  + DQ LNA++L EK  G+ VPR+ +DG F R+ VA+S+
Sbjct  359   HSGWGSIIESLGFGHPLILMPMVNDQTLNAKLLVEKSAGFEVPRN-KDGSFNRDMVAKSM  417

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             RLV+V+KEG   R K  E++ +F  Q  QD Y+   + Y    K
Sbjct  418   RLVMVDKEGEPIRLKTSELQAIFSSQHLQDDYISKFIRYTSSFK  461



>dbj|BAC43110.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
Length=466

 Score =   395 bits (1016),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 278/463 (60%), Gaps = 19/463 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH+ ++PWLA GHMIPYL+LSK IA +GH VSF+ST RNI RLP +  +L+  +NFV L
Sbjct  7     KLHVAVFPWLALGHMIPYLQLSKLIARKGHTVSFISTARNISRLPNISSDLS--VNFVSL  64

Query  1429  PLPPH-QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             PL     +LPENAEAT D+P   + YLK A D L E   +FLE   P+WI++D   +W+ 
Sbjct  65    PLSQTVDHLPENAEATTDVPETHIAYLKKAFDGLSEAFTEFLEASKPNWIVYDILHHWVP  124

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
             P+A KLGV  A+F  F   ++   G      +     R  AED  VPP W+PF+T + +R
Sbjct  125   PIAEKLGVRRAIFCTFNAASIIIIGGPASVMIQGHDPRKTAEDLIVPPPWVPFETNIVYR  184

Query  1087  LYEILRIIDAVTEEDDNV--SDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             L+E  RI++  T     V  +D  RL       +++ +R C E + EW++LL  +  KPV
Sbjct  185   LFEAKRIMEYPTAGVTGVELNDNCRLGLAYVGSEVIVIRSCMELEPEWIQLLSKLQGKPV  244

Query  913   FPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              P+G LP T  D          +W DI+ WLD+ +   V+YVA G+E   S  E+  +A 
Sbjct  245   IPIGLLPATPMDDADDE----GTWLDIREWLDRHQAKSVVYVALGTEVTISNEEIQGLAH  300

Query  733   GLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGF  554
             GLEL   PFFW LR R   +    + LP+GF+ER K RG++ T W PQ KILSH SVGGF
Sbjct  301   GLELCRLPFFWTLRKRTRAS----MLLPDGFKERVKERGVIWTEWVPQTKILSHGSVGGF  356

Query  553   LTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             +TH GW S VE + F  PL++     DQ L AR+L    IG  +PR+ERDG FT  +VAE
Sbjct  357   VTHCGWGSAVEGLSFGVPLIMFPCNLDQPLVARLLSGMNIGLEIPRNERDGLFTSASVAE  416

Query  373   SLRLVVVEKEGNIYREK-IKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++R VVVE+EG IYR     + K +F ++  QD Y D  + +L
Sbjct  417   TIRHVVVEEEGKIYRNNGASQQKKIFGNKRLQDQYADGFIEFL  459



>emb|CBI40856.3| unnamed protein product [Vitis vinifera]
Length=1373

 Score =   418 bits (1075),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 273/458 (60%), Gaps = 74/458 (16%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA  GH++SF+STPRNI+RLPKLPPNL   I+ VK 
Sbjct  73    KLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPNLQPLIDLVKF  132

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY  + YLK A D LQE + +FLE   PDW++HDF  +WL P
Sbjct  133   PLPNDDNLPENAEATTDLPYGNIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFAPHWLPP  192

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             +A+K GVS A F IF+   + F G                                   R
Sbjct  193   IAAKHGVSRAFFCIFSATALCFGGST---------------------------------R  219

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
              +D        VSD FR+ S +  CD++A+R C+E + EWL LL  +HQKP+FP+G LP 
Sbjct  220   SLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLFPIGLLPP  279

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +A                                       P++ ELTE+A GLELSG P
Sbjct  280   SA------------------------------------PVTPTEDELTELAFGLELSGLP  303

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW LR R    D     LP+ FEERTKGRG+V  SWAPQL+IL H+SVGGF+TH GWSS
Sbjct  304   FFWALRKRHDAVD-----LPDRFEERTKGRGMVWRSWAPQLRILDHDSVGGFVTHCGWSS  358

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E + F + L++L    DQG+NAR  EE K+G  +PRD+ + R +R++VAE+L LV+VE
Sbjct  359   VIEGLHFGQALIMLPLWGDQGVNARTFEEMKVGVEIPRDQEEERLSRKSVAETLSLVMVE  418

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             + G IYR K KEM  L  D+ R   YV   + YL  H+
Sbjct  419   ETGKIYRNKAKEMSKLLGDKHRHHRYVSDFVEYLQKHR  456


 Score =   411 bits (1057),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 277/469 (59%), Gaps = 77/469 (16%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA  GH +SF+STPRNIDRLPKLP NL   I+ VK 
Sbjct  771   KLHIVMFPWLAFGHILPYLELSKLIAREGHLISFISTPRNIDRLPKLPLNLQPLIDLVKF  830

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY+K+ YLK A D LQE + +FLE   PDW++HDF  +WL P
Sbjct  831   PLPNIDNLPENAEATTDLPYEKIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFTPHWLPP  890

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             +A+K GVS A F   +  T+ F G                 P  I  +  V+        
Sbjct  891   IAAKHGVSRAFFCTSSATTLCFCG-----------------PTSIMMEADVS--------  925

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
                        VSD FR+ S +  CD++A+R C+E + EWL LL  +HQKP+FP+G LP 
Sbjct  926   ----------GVSDKFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLFPIGLLPP  975

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +A                                       P++ ELTE+A GLELSG P
Sbjct  976   SA------------------------------------PVTPTEDELTELAFGLELSGLP  999

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW LR R    D     LP+GFEERTKGRG+V  +WAPQL+IL HESVGGF+ H GWSS
Sbjct  1000  FFWALRKRHDSVD-----LPDGFEERTKGRGMVWRTWAPQLRILDHESVGGFVIHCGWSS  1054

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E + F + L +L    DQGLNAR  EE K+G  +PRD+ +G  +R++VAE+L LV+VE
Sbjct  1055  VIEGLHFGQALTMLPLWGDQGLNARTFEEMKVGVEIPRDQEEGWLSRKSVAETLSLVMVE  1114

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQTIST  203
             + G IYR K KEM+ L  D+ R   YV     YL  H+       +IS+
Sbjct  1115  EAGKIYRNKAKEMRKLL-DKHRHHRYVTDFAEYLQKHRPCSQRLSSISS  1162


 Score =   211 bits (537),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 134/202 (66%), Gaps = 4/202 (2%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M+PWLAFGH++PYLELSK IA +GH++SF+STPRNIDRLPKLPP L   IN +KL
Sbjct  483   KLHIVMFPWLAFGHILPYLELSKLIAQKGHRISFISTPRNIDRLPKLPPILQPLINLIKL  542

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLPENAEAT DLPY+++ YLK A D LQE +  FL    PDW++HDF  +WL P
Sbjct  543   PLPKVDNLPENAEATTDLPYEEIPYLKKAFDGLQEPLTHFLINSHPDWVVHDFAPHWLPP  602

Query  1249  VASKLGVSTALFSIFTPPTVAFFGR----LVDFAERTKAEDYTVPPKWIPFKTTVAFRLY  1082
             V  + GVS + FSI+   T+ F G     L     R +   + VPP W+PF + +    +
Sbjct  603   VLDEHGVSRSFFSIYGASTLCFAGSTSIMLGSGDPRKELHQFAVPPPWVPFPSNLGLPPF  662

Query  1081  EILRIIDAVTEEDDNVSDIFRL  1016
             ++ RI+         VSD +R+
Sbjct  663   QMKRILGYDQPNLSGVSDSYRM  684


 Score =   171 bits (433),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 128/232 (55%), Gaps = 46/232 (20%)
 Frame = -2

Query  931   IHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTE  752
             ++ KPV P+G LP  A  +G       DSW  I  WLDKQE   V +             
Sbjct  1183  LYHKPVLPIGLLPPLAPVSG-----EDDSWIPILEWLDKQEKASVRH-------------  1224

Query  751   LTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSH  572
                                         + + LP+GFE+RTK RG+V  +WAPQL+IL H
Sbjct  1225  ----------------------------DSVELPDGFEDRTKDRGVVWRTWAPQLRILGH  1256

Query  571   ESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFT  392
             ESVGGF+TH G SSVVE + F + L++     DQG+ A+  +E K+G  +PRDE +G F+
Sbjct  1257  ESVGGFVTHCGLSSVVEGLNFGRALIMFPLWGDQGIIAKSFQEMKVGIEIPRDEEEGWFS  1316

Query  391   REAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              ++VA++L LV+VE+EG IYREK KE+  LF D+  Q  Y++  + YL  H+
Sbjct  1317  SKSVAQTLSLVMVEEEGRIYREKAKELSKLFGDKDLQQRYINDFVEYLQNHR  1368



>ref|XP_008242170.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Prunus mume]
Length=469

 Score =   393 bits (1010),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 201/467 (43%), Positives = 297/467 (64%), Gaps = 15/467 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + +  KLHI M+PWLA+GH++P+LE+SK +A +GH+VSF+STP+NI RLPK   + +  I
Sbjct  3     NKDNQKLHIAMFPWLAYGHIMPFLEVSKFLAQKGHRVSFISTPKNIQRLPK--SSQSPLI  60

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV+LPLP  + LP+  E+T +LP  KV YLK A D LQ  +A FL+    +W++HDF  
Sbjct  61    TFVELPLPAIEGLPQCTESTSELPIHKVPYLKKAYDLLQPPLAHFLQHSDVNWVIHDFIC  120

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  VA++LG+++  F+IF+  T+AF G   +    +R + ED+TV PKW+ F + VAF
Sbjct  121   HWLPRVATQLGINSVYFNIFSATTLAFLGPPSELRGGQRQRPEDFTVVPKWVDFTSNVAF  180

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             +L+E++   D +   D+ VSD  R    ++ C++V  R   EF+S+ + LL  ++ KPV 
Sbjct  181   KLHEMVSHWDCM---DNEVSDFQRFADAIQYCNLVTTRSTPEFESDSVSLLRKLYGKPVV  237

Query  910   PVGQLPTTAYDA--GGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             P+G LP ++     GG  +   + W+ ++ WLD ++   VIY+A G+E   SQ  + E+A
Sbjct  238   PLGLLPPSSVPCQHGGADDQVDEKWEVLREWLDNKKEKSVIYIALGTEVTLSQELIHELA  297

Query  736   LGLELSGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHES  566
              G+E SG PF WV+  R    G    ++I  P GFE R   RG+V   WAPQLKIL H S
Sbjct  298   YGIEKSGLPFIWVVNNRPLVEGMLGADII--PPGFETRVDNRGLVWRGWAPQLKILGHSS  355

Query  565   VGGFLTHSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTR  389
             +GGFLTH GWSSV+EA+ F + L+L +   +DQGL AR+L  K++G  +PRDE+DG FT 
Sbjct  356   IGGFLTHCGWSSVIEALGFGRVLILFSGANSDQGLVARLLHGKRVGLEIPRDEQDGSFTS  415

Query  388   EAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++VAE  R V+V+KEG   R     MK +F ++   +  +D    +L
Sbjct  416   DSVAELTRRVMVDKEGESLRSNAWAMKDIFGNKELNNKCLDEFTRFL  462



>ref|XP_006852901.1| hypothetical protein AMTR_s00033p00222830 [Amborella trichopoda]
 gb|ERN14368.1| hypothetical protein AMTR_s00033p00222830 [Amborella trichopoda]
Length=469

 Score =   393 bits (1010),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 285/469 (61%), Gaps = 9/469 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   +H++M PWLAFGHMIP+ ELSK +A +G  VSF+STPRN+ RLP  PP LA +IN 
Sbjct  2     ERENVHVVMVPWLAFGHMIPFFELSKALAQKGITVSFISTPRNLQRLPPTPPELAPQINL  61

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V  PLP  + LP+NAEAT D+P  KV YLK A D L+    + + + SPDWI+ DF  YW
Sbjct  62    VGFPLPSVEGLPKNAEATTDIPLKKVPYLKKAYDGLRAPFEELVAKVSPDWIVVDFAPYW  121

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
                +ASK GV    F+  +     F G    L      T  ++  V P+WI F +T+AFR
Sbjct  122   ATSIASKYGVPCCWFNAVSTAFTVFLGPPHSLKGLCRTTTVDELMVVPEWITFPSTIAFR  181

Query  1087  LYEILRIIDAVTEEDDN---VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
              +E    +  V     N   VSD +R+ S +E C +VA R   EFD +++ L E +++K 
Sbjct  182   RHEAQAFLQQVLTNLHNGSGVSDWYRVQSILEGCRVVAFRTGKEFDGDYIDLFEKLYEKS  241

Query  916   VFPVGQLPTTAYDAGGGHEPTGD--SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             VFP+G LP +  +  G      D   W     WLD Q    V++V FGSE + S  ++ E
Sbjct  242   VFPLGFLPPSQAEREGNDNSWIDENKWSTAFEWLDAQPLRSVVFVGFGSECRLSIEQVHE  301

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IA GLELS  PF W LR +  E    L  LP+GFE RT+ +GI+C  WAPQ +I +H S+
Sbjct  302   IAYGLELSKLPFVWALR-KPFETHDGLEILPKGFEGRTERQGIICIGWAPQQRIFAHPSI  360

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GG L HSGW S++EA+     L+LL F+ DQG+NAR+L EKK+G+ V R+E DG FT+ +
Sbjct  361   GGCLFHSGWGSIIEALSHGLALILLPFIIDQGINARLLGEKKLGFEVERNEDDGSFTKVS  420

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +A++LR V+VE+EG   R K +EMK +F ++   D Y+D   ++L  +K
Sbjct  421   IAKALRFVMVEEEGEPLRVKAREMKPIFGNKELSDMYLDGFANFLKNNK  469



>ref|XP_009361645.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Pyrus x bretschneideri]
Length=469

 Score =   392 bits (1008),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/462 (43%), Positives = 300/462 (65%), Gaps = 15/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+R+     + +  I+FV+L
Sbjct  8     KLHIAMFPWLAYGHLVPFLEVSKFLAQKGHQISFISTPKNINRIRS--SSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+AE+T +LP +KV YLK A D L+ ++  F++    +W++HDF  YW+  
Sbjct  66    PLPAVDGLPESAESTSELPINKVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  F+I    T+AFFG   +    +R + ED+TV P+W+ + +  AF+L+E+
Sbjct  126   VATQLGVNSVYFNITNATTLAFFGPPSELLSDKRWRPEDFTVVPEWVNYPSNGAFKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D +   DD VSD  R+   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VSHWDCM---DDEVSDFHRVAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  242

Query  895   P--TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             P  +     G   +   ++W  ++ WL+ ++   V+Y+AFG+E  PSQ  + E+A G+E 
Sbjct  243   PPGSVPQQQGVADDRGDETWGVLRGWLENKKPNSVVYIAFGTEVTPSQELMHELADGIEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G    ++I  P GF+ R + RG+V   WAPQLKIL H SVGGFL
Sbjct  303   SGLPFIWVVNNRPLVEGVLGADII--PPGFQTRVEDRGLVWRGWAPQLKILGHISVGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+   + L+L +   ADQGLNAR++++K++G  +PRDERDG FT ++VAE
Sbjct  361   THCGWSSVVEALGHGRALILFSGANADQGLNARLMQDKRVGLEIPRDERDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              +R V+VEKEG   R     MK +F +    +  +D     L
Sbjct  421   LIRRVMVEKEGESIRSNAWAMKEIFGNVELNNRCLDEFTRTL  462



>ref|XP_004489091.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Cicer arietinum]
Length=456

 Score =   392 bits (1006),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/468 (44%), Positives = 298/468 (64%), Gaps = 19/468 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             +++ +KLHI ++PWLAFGH++PY  LSK +A +GHK+SF+STPRNI RLPKLP NL + +
Sbjct  2     ENQPTKLHIAVFPWLAFGHILPYFHLSKLLAQKGHKISFISTPRNIKRLPKLPTNLQTSL  61

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
               ++L LP   +LP++AEAT+D+P     YL+ A D L+E + KFLE  +PD I++DF  
Sbjct  62    EMIELQLPRIDHLPDHAEATLDIPRHITPYLRKAFDGLKEPLTKFLETSTPDCIIYDFTP  121

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
             YWL  ++SKLG+    FSIF   ++ FF  L       +  D +           VA + 
Sbjct  122   YWLPQISSKLGIFQVHFSIFCGLSLYFFANLFVMKSGERHFDKSK-------LKAVALKP  174

Query  1084  YEILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
             +E   + D   E +++ VSD FR    +   D++ VR C E + E L LLEN+++KPV P
Sbjct  175   FEEKYLCDKHLENNESGVSDAFRFQQTLFGADLLVVRSCMEIEGESLTLLENLYKKPVIP  234

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             VG LP +  D         D+W  I  WLDK E   VIYVAFGS+   S  + TE+ +GL
Sbjct  235   VGLLPPS-LDFSEDISNDDDNWCKISKWLDKHEKNSVIYVAFGSQVVISDEDFTELTMGL  293

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSGFPF +VL+ +  + +       + F++R+   G+V T+W PQL+IL+HESVGGFLT
Sbjct  294   ELSGFPFLFVLKKKNSDDNRH-----DWFKKRS-NNGLVWTNWVPQLRILAHESVGGFLT  347

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             H GWSSV+E+++   PL++L    +QGLNA V+EEK +G  V R++ DG+F R++VA++L
Sbjct  348   HCGWSSVIESLEVGCPLIMLPLENEQGLNAIVMEEKMVGVKVARNDHDGKFNRDSVAKAL  407

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQ----DGYVDTLLHYLHCHK  236
             R V+ ++EG +YR K++EM  +F D   Q    DG+VD+L  ++H  K
Sbjct  408   RSVMDKEEGKVYRSKVEEMSKIFGDMELQDKYIDGFVDSLKFHMHASK  455



>ref|XP_008242383.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Prunus mume]
Length=469

 Score =   391 bits (1005),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 201/467 (43%), Positives = 299/467 (64%), Gaps = 15/467 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + +  KLHI M+PWLA+GH++P+LE+SK +A +GH+VSF+STP+NI RLPK   +L+  I
Sbjct  3     NKDNQKLHIAMFPWLAYGHIMPFLEVSKFLAQKGHRVSFISTPKNIQRLPK--SSLSPLI  60

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
              FV+LPLP  + LP++ E+T +LP  KV YLK A D LQ  +A FL+    +W++HDF  
Sbjct  61    TFVELPLPAIEGLPQSTESTSELPIHKVPYLKKAYDLLQPPLAHFLQHSDVNWVIHDFIC  120

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAF  1091
             +WL  VA++LG+++  F+I    ++AFFG   +    +R + E++TV PKW+ F + VAF
Sbjct  121   HWLPRVATQLGINSVYFNISNATSLAFFGPPSELRGGQRQRPEEFTVVPKWVDFPSNVAF  180

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             +L+E++   D +   DD VSD  RL   ++ CD+V +R   EF+S+ + LL  ++ KPV 
Sbjct  181   KLHEMVSHWDCM---DDEVSDFQRLADAIQYCDLVTMRSSHEFESDSVSLLRKLYGKPVV  237

Query  910   PVGQLPTTAYDA--GGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             P+G L  ++     GG  +   + W+ ++ WLD ++   VIY+A G+E   SQ  + E+A
Sbjct  238   PLGLLSPSSVPCQHGGAEDQVDEKWEVLREWLDNKKEKSVIYIALGTEVTLSQELMHELA  297

Query  736   LGLELSGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHES  566
              G+E SG PF WV+  R    G    ++I  P GFE R   RG+V   WAPQLK+L H S
Sbjct  298   HGIEKSGLPFIWVINNRPLVEGMLGADII--PPGFETRVDNRGLVWRGWAPQLKMLGHPS  355

Query  565   VGGFLTHSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTR  389
             VGGFLTH GWSSV+EA+ F + L+L +   +DQGL AR+L  K++G  +PRDE+DG FT 
Sbjct  356   VGGFLTHCGWSSVIEALGFGRVLILFSGANSDQGLIARLLHGKQVGLEIPRDEQDGSFTS  415

Query  388   EAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++VAE  R V+V++EG   R     MK +F ++   +  +D    +L
Sbjct  416   DSVAELTRRVMVDEEGESLRSNAWAMKEIFGNKELNNKCLDEFTRFL  462



>ref|XP_007012764.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY30383.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=465

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/460 (43%), Positives = 294/460 (64%), Gaps = 16/460 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++P+LE+SK +A +GH++S++STP+NI RLPKLP +L+S I+F+++
Sbjct  6     KLHIAMFPWLAYGHIMPFLEVSKFLARKGHRISYISTPKNISRLPKLPAHLSSNISFIEI  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
              LP    LP   E+T ++P  KV YLK A D L+  + +FL+    +WI+HDF  +WL  
Sbjct  66    SLPQVHGLPPGVESTAEIPIQKVPYLKKACDKLEVPLTEFLKTSHVNWIIHDFMPHWLPG  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFG--RLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA   G++   FSI     +AF G    +    R + ED+TV PKWI +   +  +L+E+
Sbjct  126   VAIPFGINLVFFSICNATLLAFLGPPSALIGDHRKRPEDFTVVPKWIDYPCNIVLKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +    +  E  ++VSD  R+   ++ C  V +R C EF+S+ ++LL+ ++QKPV PVG L
Sbjct  186   V----SHQECMEDVSDFQRIGQVIQGCQFVTLRSCVEFESDQIQLLKKLYQKPVVPVGLL  241

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P +        E + +SW+DIK WLD++    V YVA GSE   SQ  + E+A G+  S 
Sbjct  242   PPS---LPSNEEKSHESWEDIKKWLDRKGEKSVFYVALGSEVSLSQESMHELAFGIYKSN  298

Query  715   FPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              PF WV+R R    G+   ++I  P+GFEER   RG+V   WAPQL+IL+H SVGGFLTH
Sbjct  299   LPFIWVVRNRPLVEGQMGQDII--PQGFEERVSDRGLVLKDWAPQLRILAHSSVGGFLTH  356

Query  544   SGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
              GWSS++EA++F +PL+L +   +DQGLNAR+L  KK+G  + R+E DG FT + VA+++
Sbjct  357   CGWSSIIEALKFGRPLILFSGASSDQGLNARLLHGKKVGLEIERNELDGSFTSDLVAQTI  416

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             R V+VE EG   R     M+ + C++   + Y+D    ++
Sbjct  417   RQVMVEPEGEPVRANAWAMRDI-CNEELSNNYLDEFTRFI  455



>ref|XP_003593143.1| UDP-glucosyltransferase [Medicago truncatula]
 gb|ACT34897.1| GT2 [Medicago truncatula]
 gb|AES63394.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=471

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 205/475 (43%), Positives = 290/475 (61%), Gaps = 17/475 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + +   LH++M+PW+A GHM P  E+SK ++  GH V+ +STP  IDRLPKL   L+   
Sbjct  3     NKKNKPLHVVMFPWIAMGHMYPCFEVSKILSQNGHFVTLISTPSIIDRLPKLSQTLSPFF  62

Query  1444  NFVKLPLPPH---QNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHD  1274
             N +KLPL  +    +LP NA++T+D+P +K+ YLKLA D+LQE++A+ L+  +PDW+ +D
Sbjct  63    NLIKLPLSSYIDKNHLPTNADSTMDIPSNKLYYLKLAYDSLQESVAEILKTSNPDWVFYD  122

Query  1273  FDSYWLAPVAS--KLGVSTALFSIFTPPTVAFFG----RLVD--FAERTKAEDYTVPPKW  1118
             F + WL  +A    L +S   FS     ++ FF     +L D   A RT AEDY  PPKW
Sbjct  123   FAASWLPQLAKGLNLNISCCYFSPCPAWSICFFDTPKKQLGDDSAAIRTNAEDYYGPPKW  182

Query  1117  IPFKTTVAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLL  938
             I F T +  R YE+ ++++ +   +   S +F L      CD+  +R   + + EWL  L
Sbjct  183   ISFPTKIGLRPYEVRKLLEDIKVNETGASPVFDLNRANSDCDMFVIRSSRDLEGEWLDFL  242

Query  937   ENIHQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQ  758
                + KPV PVG LP    D+    E + D W  IKAWLD Q++  V+Y+AFGSE K SQ
Sbjct  243   GEFYNKPVIPVGLLPPRR-DSSDEVEDSPD-WIQIKAWLDTQKSSSVVYIAFGSEVKLSQ  300

Query  757   TELTEIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKIL  578
               L E+ALG+E S  PFFWVLR  +       + LP GFE+RTK  GIV  SWAPQ KIL
Sbjct  301   ENLNELALGIENSKLPFFWVLRDLKNG----FVELPNGFEDRTKDHGIVWKSWAPQPKIL  356

Query  577   SHESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGR  398
              H SVGG LTH G  S++E + F   LV+L FL DQ L +RV++EKK+G  + R+E DG 
Sbjct  357   GHGSVGGCLTHCGSGSMIENLYFGHVLVMLPFLLDQALYSRVMQEKKVGIEIVRNEEDGS  416

Query  397   FTREAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             FTR +VA++LR  +V++EG+ YR+  KE+   F ++   + Y++  +  L  H S
Sbjct  417   FTRNSVAKALRFTMVDEEGSDYRKNAKEIGKKFSNKELHNQYIENFISSLQNHNS  471



>dbj|BAJ84800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   390 bits (1002),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/477 (44%), Positives = 282/477 (59%), Gaps = 17/477 (4%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++G K+H++M PWLAFGH++P+ E +K +A +GH+V+ +S PRN  RL  +PP LA  I 
Sbjct  4     NDGGKMHVVMLPWLAFGHVLPFTEFAKRVARQGHRVTLLSAPRNTRRLIDIPPGLAGLIR  63

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVK-YLKLARDA-LQETMAKFL-EEFSPDWILHDF  1271
              V +PLP    LPE+AEATIDLP D ++  L+ A DA  +  +++ L EE  PDW+L D+
Sbjct  64    VVHVPLPRVDGLPEHAEATIDLPSDHLRPCLRRAFDAAFERELSRLLQEEAKPDWVLVDY  123

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFGR---LVDFAERTKAE--DYTVPPKWIPFK  1106
              SYW    A++ GV  A  S+F    ++FFG    L+      K E    TV P+++PF 
Sbjct  124   ASYWAPTAAARHGVPCAFLSLFGAAALSFFGTPETLLGIGRHAKTEPAHLTVVPEYVPFP  183

Query  1105  TTVAFRLYEILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENI  929
             TTVA+R YE   + +  +  +D  VS+ +R    +E C +V +R  SEF+ EWL+LL  +
Sbjct  184   TTVAYRGYEARELFEPGMVPDDSGVSEGYRFAKTIEGCQLVGIRSSSEFEPEWLRLLGEL  243

Query  928   HQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTEL  749
             ++KPV PVG  P    D   GHE T         WLD Q    V+Y AFGSE K +  +L
Sbjct  244   YRKPVIPVGLFPPAPQDDVAGHEAT-------LRWLDGQAPSSVVYAAFGSEVKLTGAQL  296

Query  748   TEIALGLELSGFPFFWVLRA-RRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSH  572
               IALGLE SG PF W  RA    E       LPEGFEER  GRG+VC  W PQ+K L+H
Sbjct  297   QRIALGLEASGLPFIWAFRAPTSTETGAASGGLPEGFEERLAGRGVVCRGWVPQVKFLAH  356

Query  571   ESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFT  392
              SVGGFLTH+GW+S+ E +     LVLL  + +QGLNAR + +K IG  V RDE+DG F 
Sbjct  357   ASVGGFLTHAGWNSIAEGLAHGVRLVLLPLVFEQGLNARNIVDKNIGVEVARDEQDGSFA  416

Query  391   REAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYG  221
                +A +LR V+VE EG  +  K+KE+  +F D    D  V   L +L  H     G
Sbjct  417   AGDIAAALRRVMVEDEGEGFGAKVKELAKVFGDDEVNDQCVREFLMHLSDHSKKNQG  473



>ref|XP_008378602.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=487

 Score =   390 bits (1001),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 210/473 (44%), Positives = 298/473 (63%), Gaps = 11/473 (2%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             + LH++++PWLA GH IP+  LS  IA +GH VSFVSTPRN+ RLP++P +L+S IN V 
Sbjct  18    AALHVVVFPWLAMGHXIPFFHLSTLIAQKGHTVSFVSTPRNLSRLPRIPFHLSSLINLVS  77

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LPLP   NLP +AE++ D+P+ K + LK A D LQ  +  FLE   PDW+++D+  +WL 
Sbjct  78    LPLPRLPNLPNDAESSTDVPFHKQQLLKTAFDMLQPPLTAFLESSRPDWVIYDYTPHWLP  137

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG---RLVDFAE-RTKAEDYTVPPKWIPFKTTVAFRL  1085
               A++LGVS A F  F    +++ G    L++  + RTKAED+TV PKW+P ++ +A+RL
Sbjct  138   ATAARLGVSRAFFCCFNAACMSYIGPPSLLINGQDGRTKAEDFTVVPKWVPLESDMAYRL  197

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK----P  917
             +EI + ++  + ++    D  R    +E  D+V +R   E + EWL L+  ++++    P
Sbjct  198   HEIAKWVEISSGDESITPDTVRFGVAIEESDVVFIRSSEELEPEWLNLMRQLYREVKVKP  257

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP    +     + T   W  IK WLDKQ    V+YVA G+EA  SQ ELTE+A
Sbjct  258   VVPVGFLPPNIEEEASEFDET---WGGIKEWLDKQRVNSVVYVALGTEATLSQEELTELA  314

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             LGLELSG PFFWVLR            LP GF ER KGRG+V   WAPQ++ILSH+SVGG
Sbjct  315   LGLELSGVPFFWVLRNPPESTQSVSEMLPPGFVERVKGRGVVHLGWAPQVRILSHDSVGG  374

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH GW+S++E + F + L+    + DQGLNAR+   K +G  +PR+ERDG F  ++VA
Sbjct  375   FLTHCGWNSMIEGLVFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFAGDSVA  434

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGT  218
             E +RL +V+  G   R + KEM+ LF  + +    VD  L +L  ++  ++ T
Sbjct  435   ELVRLAMVDDSGESLRTRAKEMRDLFXXRNKNSRMVDEFLCFLEENRPPRFTT  487



>ref|XP_010661830.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=473

 Score =   389 bits (1000),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 208/466 (45%), Positives = 283/466 (61%), Gaps = 14/466 (3%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
              K+H++M PW AFGHMIP+  L+  IA  G +VS VSTPRNI RLPK PPNL+S I FV+
Sbjct  3     GKMHVVMLPWSAFGHMIPFFHLAIAIAKAGIRVSLVSTPRNIQRLPKPPPNLSSLIKFVE  62

Query  1432  LPLPPHQN---LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             LP P  +N   LPE AEAT+D+P++K++YLK A D LQ    +++ + SPDWI+ DF S+
Sbjct  63    LPFPVMENGSILPEGAEATVDMPFEKIQYLKAALDLLQHPFKQYVADTSPDWIIIDFFSH  122

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAE------RTKAEDYTVPPKWIPFKTT  1100
             W++ +A + GV    FS+F+  T+AF G             R   E  T PP+WI F ++
Sbjct  123   WVSSIAREHGVPLVYFSVFSASTLAFLGPAYSLVGDGRRRLRPSPESMTSPPEWISFPSS  182

Query  1099  VAFRLYEILRIIDAV-TEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ  923
             VAF+ YE   +     T+     +D  R +  +  C  VAVR C E++ E+L LL N+  
Sbjct  183   VAFKGYEAKAVYSGFFTDNASGTTDAARYVEIINSCQAVAVRSCVEYEGEYLNLLGNLMG  242

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV PVG LP    + G   +    SW +   WL++Q+   V++V FGSE K ++ ++ E
Sbjct  243   KPVIPVGLLPPEKPE-GREIQINDGSWGENFKWLNEQKPKSVVFVGFGSECKLTKDQVHE  301

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             IA GLELS  PF W LR +   A  +   LP GF +RT GRG+VC  WAPQ++IL H S+
Sbjct  302   IAYGLELSELPFLWALR-KPNWAIEDADALPSGFSDRTSGRGMVCMGWAPQMEILEHPSI  360

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GG L HSGW SV+E +QF   LV+L  + DQGLNAR+L EK +   V R E DG F+RE 
Sbjct  361   GGSLFHSGWGSVIETLQFAHCLVVLPIIIDQGLNARLLVEKGLAVEVERRE-DGTFSRED  419

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCD-QTRQDGYVDTLLHYL  248
             + +SLRL +V +EG   R   K    +F D +  QD Y+   + YL
Sbjct  420   ITKSLRLAMVSEEGEKLRIHAKGAAAIFGDPKLHQDHYIGGFVEYL  465



>ref|XP_010671540.1| PREDICTED: UDP-glycosyltransferase 91C1 [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   389 bits (999),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 288/463 (62%), Gaps = 17/463 (4%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             S L ++M PWLA GH+IP+LELSK +A++G  V F+STP+NI RLPK+P NL+S I+ + 
Sbjct  5     SPLKVVMIPWLAMGHLIPFLELSKCLANKGITVYFISTPKNITRLPKIPANLSSYIHLII  64

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             +PLP    +P++AE+++D+P      LK   D LQ  +  FLE+   DWIL+DF SYW+ 
Sbjct  65    IPLPHLDRVPDDAESSMDVPSTMQPLLKSRFDLLQHPITVFLEKVRADWILYDFTSYWIP  124

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAE--RTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             P+ASK+G   A  ++F   T++F G   +     RT  ED+T+ P WIPF++ +A+RL+E
Sbjct  125   PLASKMGCCCAYIALFNAATLSFMGPPSELIANTRTSPEDFTIVPDWIPFESDIAYRLHE  184

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLEN-IHQKPVFPVG  902
             ++++I +V + D    D  R    +  CD+V +R   EF+  WL LL N +++K + P+G
Sbjct  185   VMKLIHSV-DADIATPDTVRFGYSIAGCDVVGIRTSPEFEPTWLHLLANKLYEKTILPIG  243

Query  901   QL-PTTAYDAGGGHEPTGDSWKD---IKAWLDKQETGKVIYVAFGSEAKPSQTELTEIAL  734
              L P    D         D   D   ++ WLD+Q++  V+YVA GSE+  +Q EL E+A 
Sbjct  244   SLFPHYLVD--------NDEESDCILLRKWLDQQKSDSVLYVALGSESILTQNELEELAF  295

Query  733   GLELSGFPFFWVLRAR-RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
             GLEL G PF  VLR    G     L  LP+GFE R   RG+V   WAPQ+KILSH S  G
Sbjct  296   GLELCGLPFLLVLRNHEHGLCKNVLEMLPKGFENRVADRGLVHLGWAPQMKILSHPSTRG  355

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
             FLTH GW+S++E +   + +VL   + DQGL AR+L  K +G  + RDERDG   REAV 
Sbjct  356   FLTHCGWNSIIEGLGLGRIMVLFPVMNDQGLIARLLVGKGLGVEITRDERDGSLRREAVV  415

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++++L +V K+G   R + + MKG+F D+   D Y++  +HYL
Sbjct  416   KAVQLAMVHKDGEALRIRCRSMKGVFGDKNLNDHYIEGFIHYL  458



>emb|CDO97382.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   389 bits (998),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 198/461 (43%), Positives = 281/461 (61%), Gaps = 8/461 (2%)
 Frame = -2

Query  1603  HIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLPL  1424
             H+MM+PWLAFGH++P+LE SK +A++G K+SFVSTP+N+ RLP +P +L+ RI  + +PL
Sbjct  7     HLMMFPWLAFGHLLPFLEFSKKLATKGVKISFVSTPKNLCRLPPIPADLSDRIKLLAVPL  66

Query  1423  PPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPVA  1244
             P    LPEN EATID+  ++ ++LK A D L E M K L++ SPD IL DF + W+   A
Sbjct  67    PLVDGLPENCEATIDVQPEQTQFLKKAYDRLAEPMEKLLQQESPDLILVDFAAGWIPETA  126

Query  1243  SKLGVSTALFSIFTPPTVAFF---GRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEIL  1073
             +K G+S A FS +T  T+AF    G L+    R  AE +T PP W  F + VA R +   
Sbjct  127   AKFGISVAFFSAYTAATLAFLGPPGELISGTLRKTAEHFTRPPDWFTFPSLVAHRPHYAP  186

Query  1072  RIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
                  +   D   +S   R+   V  C  VAV+ C EF+ E++ L+E ++Q+PV P+G L
Sbjct  187   TAFKNLHIPDLSGLSSGQRIAKVVRGCSFVAVKSCKEFEGEYINLVEELYQRPVLPIGVL  246

Query  895   PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
             P         H     SW     WLDKQ+   V++V FGSE K    ++ E+A  +ELSG
Sbjct  247   PPPPETIQESHSDNDSSWSTTFQWLDKQKPKSVVFVGFGSEYKMPIEQIHELAFAVELSG  306

Query  715   FPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGW  536
               F W+LR    +    +  LP GF +RT  +GIVC  W PQ++IL+H ++GG L HSGW
Sbjct  307   LAFIWILRKPLADT---VNLLPPGFLDRTSNQGIVCLGWVPQIEILAHPAIGGCLFHSGW  363

Query  535   SSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVV  356
              S++E + F  PL+L+  + DQ LNA++L EK++GY VPRD  DG F+RE VA S+R V+
Sbjct  364   GSIIECLGFGHPLILMPMVYDQTLNAKLLAEKEVGYEVPRD-IDGSFSRECVAASIRRVM  422

Query  355   VEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             VE EG   R K  +MK +F +Q   D Y++  + +L   K+
Sbjct  423   VEAEGEQIRVKAAQMKNVFGNQDLHDNYINKFIQHLERFKN  463



>ref|XP_008388229.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=465

 Score =   389 bits (998),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/460 (43%), Positives = 295/460 (64%), Gaps = 13/460 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KL I M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+RL     + +  I+FV+L
Sbjct  8     KLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+ E+T +LP +KV YLK A D L+ ++  F++    +W++HD   YW+  
Sbjct  66    PLPAVDGLPESVESTSELPINKVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDIICYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             VA++LGV++  F+I+   T+AFFG   +     + ED+TV P W+ + + VAF+L+E++ 
Sbjct  126   VATQLGVNSVCFNIYNATTLAFFGPPSELLXCRRPEDFTVVPDWVDYPSNVAFKLHEMVS  185

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLP-  893
               D +   +D VSD  RL   ++ C+ V +R C+EF+S  + LL  I+ KPV P+G LP 
Sbjct  186   HWDCM---NDEVSDFKRLAGSIQDCNFVTMRSCTEFESVAVSLLRKIYGKPVVPLGLLPP  242

Query  892   -TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSG  716
              +T Y  G  ++   + W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A G+E SG
Sbjct  243   GSTPYQHGVANDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELAHGIEKSG  302

Query  715   FPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
              PF WV+  R    G   P++I  P GF+ R + RG+V   WAPQLKIL H SVGGFLTH
Sbjct  303   LPFIWVVNNRPLVEGVFGPDVI--PLGFQTRVEDRGLVLRGWAPQLKILGHPSVGGFLTH  360

Query  544   SGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
              GWSSVVEA+ F + L+L +   +DQGL AR++ EK++G  +PRDERDG FT ++VAE  
Sbjct  361   CGWSSVVEALGFGRVLILFSGANSDQGLIARLMHEKRVGLEIPRDERDGSFTSDSVAEVT  420

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             R V+VE+EG   R     MK +F +    +  +D     L
Sbjct  421   RRVMVEREGESIRSNAWAMKEIFGNVELNNACLDEFTRVL  460



>ref|XP_009351089.1| PREDICTED: UDP-glycosyltransferase 91C1-like, partial [Pyrus 
x bretschneideri]
Length=443

 Score =   387 bits (995),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/442 (44%), Positives = 292/442 (66%), Gaps = 15/442 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+R+     + +  I+FV+L
Sbjct  8     KLHIAMFPWLAYGHLVPFLEVSKFLAQKGHQISFISTPKNINRIRS--SSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+AE+T +LP +KV YLK A D L+ ++ +F++    +WI+HDF SYW+  
Sbjct  66    PLPAVDGLPESAESTSELPINKVPYLKKAYDLLKPSVTQFIQHSGVNWIVHDFSSYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++  V++  FSI    ++AF G   +    +R + ED+TV P+W+ + +  AF+L+E+
Sbjct  126   VATQFRVNSVYFSIVNANSLAFIGPPSELLGNKRRRPEDFTVVPEWVNYPSNGAFKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D +   DD VSD  R+   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VSHWDCM---DDEVSDFHRVAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  242

Query  895   P--TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             P  +     G   +   ++W  ++ WL+ ++   V+Y+AFG+E  PSQ  + E+A G+E 
Sbjct  243   PPGSVPQQQGVADDRGDETWGVLRGWLENKKPNSVVYIAFGTEVTPSQELMHELADGIEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G    ++I  P GF+ R + RG+V   WAPQLKIL H SVGGFL
Sbjct  303   SGLPFIWVVNNRPLVEGVLGADII--PPGFQTRVEDRGLVWRGWAPQLKILGHISVGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+   + L+L +   ADQGLNAR++++K++G  +PRDERDG FT ++VAE
Sbjct  361   THCGWSSVVEALGHGRALILFSGANADQGLNARLMQDKRVGLEIPRDERDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMK  308
              +R V+VEKEG   R     MK
Sbjct  421   LIRRVMVEKEGESIRSNAWAMK  442



>ref|XP_004485550.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Cicer arietinum]
 gb|AGU14092.1| UDP-glycosyltransferase [Cicer arietinum]
Length=478

 Score =   389 bits (998),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 288/463 (62%), Gaps = 7/463 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             E   LH++M PWLA GH+ PY E++K +A +GH V+ +++P+NID +PK P  L   I  
Sbjct  14    EHKPLHVVMLPWLAMGHIYPYFEVAKILAQKGHTVTLINSPKNIDHIPKTPKTLQPFIKL  73

Query  1438  VKLPLPPHQNLPENAEATIDL-PYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
             VKLPLP  +NLP+  E+T+D+  ++  +YLKLA + LQ  + + L+   PDW+ +DF S 
Sbjct  74    VKLPLPQIENLPQGVESTMDITSHNMNRYLKLAYEGLQHDVTEILKTSKPDWVFYDFASG  133

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFAERT-KAEDYTVPPKWIPFKTTVAFRL  1085
             WLAP+A  L +S A ++I       FF    D  + + K ED   PPK++PF+TT+  + 
Sbjct  134   WLAPIAKSLNISCAHYNITPAWNKCFFDPPKDQVKSSFKLEDMCGPPKFVPFETTIHLKP  193

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPV  905
             YEI+R   A+ +E   ++  F L      CD+  +R   E + EWL  + + ++ PV PV
Sbjct  194   YEIIRAFTALKDESGGMAG-FDLNKAYSSCDLFLLRTSRELEGEWLDYISDRYEVPVVPV  252

Query  904   GQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLE  725
             G LP +        E     W  IK WLD +E+  V+Y+ FGSE K SQ +LTE+A G+E
Sbjct  253   GLLPPSMQIRDDEEEENDPDWVKIKDWLDTRESSSVVYIGFGSELKLSQQDLTELAYGIE  312

Query  724   LSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTH  545
             LSG PFFW L+  +       + LPEGFE+RTK RGIV  +WAPQLKIL+H ++GG ++H
Sbjct  313   LSGLPFFWALKNLKEGT----LELPEGFEDRTKERGIVWKTWAPQLKILAHGAIGGCMSH  368

Query  544   SGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
              G  SV+E + F   LV L +L DQ L +RVL EK++   VPR E+DG FTR++VA +LR
Sbjct  369   CGSGSVIEKLHFGHVLVTLPYLLDQCLFSRVLVEKEVAIEVPRSEQDGSFTRDSVAHTLR  428

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             L +V++EG+ YR+  KEM  +F  +   + YVD L+  LH ++
Sbjct  429   LAIVDEEGSAYRDNAKEMGKVFRSKDLHNHYVDDLIAALHKYR  471



>ref|XP_004489092.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Cicer arietinum]
Length=456

 Score =   388 bits (996),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 206/461 (45%), Positives = 291/461 (63%), Gaps = 19/461 (4%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             +KLHI ++P+LAFGH+ P   LSK +A +GH++SF+STPRNI RLPKLP NL + +  ++
Sbjct  6     TKLHIAVFPYLAFGHITPAFHLSKLLAQKGHRISFISTPRNIKRLPKLPTNLQTSLEIIE  65

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             L LP   NLP++AEAT+D+P   V YLK A D L+E + KFLE  +PD I++DF  YWL 
Sbjct  66    LKLPHVDNLPDHAEATMDIPTHIVPYLKKALDGLKEPLTKFLETSTPDCIIYDFGPYWLP  125

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRL--VDFAERTKAEDYTVPPKWIPFKTTVAFRLYE  1079
             P+ SKLG+     SI++     FF  L      ER   E  T           VA + +E
Sbjct  126   PILSKLGIFHIYVSIYSGFGSYFFANLFVTKSGERHFDESKT---------KAVALKPFE  176

Query  1078  ILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
                + D   E++++ VSD FR    +   D++ VR C E + E L LLEN+++KPV P+G
Sbjct  177   EKYLGDKHLEKNESGVSDAFRFQQTLFGADLLLVRSCMEIEGESLTLLENLYKKPVIPIG  236

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP++  D         D+W  I+ WLD  E   VIYVAFGSEA  S  + TEIALGLEL
Sbjct  237   LLPSS-LDFSEDKSNDDDNWCKIRKWLDTHEKNSVIYVAFGSEAFISDEDFTEIALGLEL  295

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SGFPF +V++ +  + +       + F+ R    G+V T+W PQL+IL+HESVGGFLTH 
Sbjct  296   SGFPFLFVIKNKNSDDNRH-----DWFKNRL-NNGLVWTNWVPQLRILAHESVGGFLTHC  349

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             GWSSV+E++Q   PL++L    +QGL AR++EEK +G  V R++ DG+F R++VA++LR 
Sbjct  350   GWSSVIESVQVGCPLIMLPLANEQGLIARLMEEKMVGVKVARNDHDGKFNRDSVAKALRS  409

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCH  239
             V+ ++EG +YR K++EM  +F D   QD Y+D  +  +  H
Sbjct  410   VMDKEEGKVYRSKVEEMSKIFGDMELQDKYIDDFVDSVKFH  450



>dbj|BAJ99561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   388 bits (996),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/477 (44%), Positives = 281/477 (59%), Gaps = 17/477 (4%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++G K+H++M PWLAFGH++P+ E +K +A +GH+V+ +S PRN  RL  +PP LA  I 
Sbjct  4     NDGGKMHVVMLPWLAFGHVLPFTEFAKRVARQGHRVTLLSAPRNTRRLIDIPPGLAGLIR  63

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVK-YLKLARDA-LQETMAKFL-EEFSPDWILHDF  1271
              V +PLP    LPE+AEATIDLP D ++  L+ A DA  +  +++ L EE  PDW+L D+
Sbjct  64    VVHVPLPRVDGLPEHAEATIDLPSDHLRPCLRRAFDAAFERELSRLLQEEAKPDWVLVDY  123

Query  1270  DSYWLAPVASKLGVSTALFSIFTPPTVAFFGR---LVDFAERTKAE--DYTVPPKWIPFK  1106
              SYW    A++ GV  A  S+F    ++FFG    L+      K E    TV P+++PF 
Sbjct  124   ASYWAPTAAARHGVPCAFLSLFGAAALSFFGTPETLLGIGRHAKTEPAHLTVVPEYVPFP  183

Query  1105  TTVAFRLYEILRIID-AVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENI  929
             TTVA+R YE   + +  +  +D  VS+ +R    +E C +V +R  SEF+ EWL+LL  +
Sbjct  184   TTVAYRGYEARELFEPGMVPDDSGVSEGYRFAKTIEGCQLVGIRSSSEFEPEWLRLLGEL  243

Query  928   HQKPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTEL  749
             ++KPV PVG  P    D   GHE T         WLD Q    V+Y AFGSE K +  +L
Sbjct  244   YRKPVIPVGLFPPAPQDDVAGHEAT-------LRWLDGQAPSSVVYAAFGSEVKLTGAQL  296

Query  748   TEIALGLELSGFPFFWVLRA-RRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSH  572
               IALGLE SG PF W  RA    E       LPEGFEER  GRG+VC  W PQ+K L+H
Sbjct  297   QRIALGLEASGLPFIWAFRAPTSTETGAASGGLPEGFEERLAGRGVVCRGWVPQVKFLAH  356

Query  571   ESVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFT  392
              SVGGFLTH+GW+S+ E +     LVLL  + +QGLNAR + +K IG  V RDE+DG F 
Sbjct  357   ASVGGFLTHAGWNSIAEGLAHGVRLVLLPLVFEQGLNARNIVDKNIGVEVARDEQDGSFA  416

Query  391   REAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYG  221
                +A +LR V+VE EG  +  K+KE+  +F D    D  V     +L  H     G
Sbjct  417   AGDIAAALRRVMVEDEGEGFGAKVKELAKVFGDDEVNDQCVREFFMHLSDHSKKNQG  473



>ref|XP_007148436.1| hypothetical protein PHAVU_006G208500g [Phaseolus vulgaris]
 gb|ESW20430.1| hypothetical protein PHAVU_006G208500g [Phaseolus vulgaris]
Length=476

 Score =   387 bits (995),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/462 (43%), Positives = 282/462 (61%), Gaps = 12/462 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI M PWLA GH+ PY EL+K +A +GH V+F+STP+NIDR+PK+P  L   I  V+LP
Sbjct  19    LHIAMLPWLAAGHVNPYSELAKILAQKGHFVTFISTPKNIDRMPKIPQPLQPFIKLVRLP  78

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  ++LPE AE+T+D+P  K+ +LKLA + LQ+ + + L+   PDW+ +DF + WL  +
Sbjct  79    LPQTEHLPEGAESTMDIPKSKICHLKLAYEGLQDPVLELLKTSRPDWVFYDFATEWLPEI  138

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVP----PKWIPFKTTVAFRLYE  1079
             A  L +  A +++    T A+     D  +  +   + +     PKW+PF+TT+  R YE
Sbjct  139   AKSLSIPCAHYNL----TAAWNKVFYDPPKEARTSSFNIQDMCNPKWLPFQTTLHLRPYE  194

Query  1078  ILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQ  899
             I+R + +  ++D      F L      CD+  +R   E + EWL  L   +  PV PVG 
Sbjct  195   IIRAMRSRRDDDTGRCASFDLAKVYSSCDMFLLRTSRELEGEWLDYLSQRYDMPVIPVGL  254

Query  898   LPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
             +P +      G E     W  IK WLD QE   V+Y+AFGSE K SQ ++TE+A G+E+S
Sbjct  255   VPPSIQIKDVGEEDENPDWLRIKEWLDSQECSSVVYIAFGSELKLSQEDVTELAHGIEIS  314

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
               PFFW  R  + ++    + LPEGFEERT+ RG V  SWAPQ KIL H ++GG +TH G
Sbjct  315   KLPFFWAFRNMKEDS----LELPEGFEERTEDRGFVWKSWAPQSKILGHAAIGGCVTHCG  370

Query  538   WSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLV  359
              +S+VE + F   LV L +L DQ L +RVLEEKK+   V R E DG FTRE+VA++LRL 
Sbjct  371   TNSLVEMLNFGHVLVTLPYLLDQALFSRVLEEKKVAIEVARSEEDGSFTRESVAKTLRLA  430

Query  358   VVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             VVE+EG+ YR+  KEM  +F  +  Q+ Y+D  +  L  + +
Sbjct  431   VVEEEGSSYRKNAKEMGKVFSCRDLQNQYIDDCILALQNYNA  472



>ref|XP_010061561.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=493

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 283/471 (60%), Gaps = 12/471 (3%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             + LH+ M+PWLA GH IP+L L+  +A RGH+VSF+STP N+ +LP++P +L+S +  V 
Sbjct  15    APLHVAMFPWLAVGHFIPFLRLATLLARRGHRVSFLSTPHNLSKLPRIPAHLSSLVALVP  74

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             LP P    LP  A+++ D+P    + LK A DAL   +  FL+   PDWIL+D+ S+WL 
Sbjct  75    LPFPDTPALPPLAQSSADVPNRHQQLLKPAFDALLPALRSFLQSSRPDWILYDYASHWLP  134

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAE--------DYTVPPKWIPFKTTV  1097
              +A++L V  A  S+F    ++FFG   + A   + +        D+T  P WIP  + +
Sbjct  135   ALAAELRVPHAFLSLFAAAVLSFFGSPRELASGRRFQPGGGGDGGDFTAVPPWIPAGSGL  194

Query  1096  AFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIH-QK  920
             AF  +E+ R+ +      +   D  R    +   D V VR C EF+ EWL LL  ++  K
Sbjct  195   AFLPHEVARVAERSEARVETTEDGVRFGVSIGESDAVVVRTCEEFEPEWLGLLRELYGDK  254

Query  919   PVFPVGQLPTTAYDAGGGHEPTG--DSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELT  746
             PV PVG LP T        +      +W+ IK WLD QE    +YVAFG+EA  +  EL 
Sbjct  255   PVLPVGLLPPTDEGDDDESDDVEGRGTWEFIKDWLDGQEANSAVYVAFGTEATLTGAELV  314

Query  745   EIALGLELSGFPFFWVLRARRG-EADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHE  569
              +ALGLE+SG PFFWVLR   G + D  L  LP GF ER KGRG++ + WAPQ KIL HE
Sbjct  315   GLALGLEMSGLPFFWVLRRPPGSDRDEGLGSLPRGFVERVKGRGLIHSGWAPQAKILRHE  374

Query  568   SVGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTR  389
             SVGGFLTH G++S+VE +   + L+    + +QGLNAR+L  K +   VPRDE DG FT 
Sbjct  375   SVGGFLTHCGYNSIVEGLSLGRVLITFPVMNEQGLNARLLRAKGVAVEVPRDEMDGSFTG  434

Query  388   EAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             E+VA ++RL +V++ G   R   +EMKG+F ++ + DGYVD  + YL  H+
Sbjct  435   ESVAGAVRLAMVDEAGEPARAAAREMKGVFGNKEKNDGYVDEFVRYLKEHR  485



>ref|XP_003593142.1| Glucosyltransferase [Medicago truncatula]
 gb|ACT34899.1| GT4 [Medicago truncatula]
 gb|AES63393.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=473

 Score =   387 bits (994),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/458 (41%), Positives = 282/458 (62%), Gaps = 6/458 (1%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+M PWLA GH+ PY E++K +AS+GH V+F+++P+NID++PK P  +   I  V+LP
Sbjct  14    LHIVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKTPKTIEPFIKLVRLP  73

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  + LP  AE T+D+P +  KYL+LA   LQ+ + + L+   PDW+ +D+ + WLAP+
Sbjct  74    LPHIEQLPPGAENTMDIPINMNKYLELAYQGLQDDVTEILKTSKPDWVFYDYGTVWLAPI  133

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVD-FAERTKAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             A  L +++  +SI     + FF R  D      + +D   P KW+PF+TT+  + YE++R
Sbjct  134   AKSLNIASVHYSITPAWNICFFDRPKDQIKTNFEIQDICGPHKWLPFQTTIHLKPYELIR  193

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
                A+ +E  N+ D   L +    CD++ +R   E + EWL  +   +  PV PVG +P 
Sbjct  194   AFTALRDESGNMPD-SGLNNAYSSCDLLLLRTSRELEGEWLDYISEQYNVPVVPVGLIPP  252

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +        E     W  IK WLD +E+  V+Y+ FGSE K SQ +LTE+A G+ELSG  
Sbjct  253   SMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQEDLTELAYGIELSGLS  312

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW L+  +       + LPEGFEERTK RGIV  +WAPQLKIL+H ++GG ++H G  S
Sbjct  313   FFWTLKNLKEGT----LELPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHCGSGS  368

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E + F   LV L +L DQ L +R L EK++   VPR E DG FTR++VA SLRL +V+
Sbjct  369   VIEKVHFGHVLVTLPYLLDQCLFSRALVEKEVAVEVPRSEEDGSFTRDSVAHSLRLAIVD  428

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +EG+ +R   KE+  +F  +   + Y+D  +  L+ ++
Sbjct  429   EEGSSFRNNAKELGKVFSSKDIHNQYIDDFIAALYKYR  466



>ref|XP_011043118.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=465

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/464 (42%), Positives = 283/464 (61%), Gaps = 8/464 (2%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
              SK H+ M+PWLAFGH++PYLE SK +A++G  +SF+STP NI R P +P +++ R  F+
Sbjct  2     ASKSHVFMFPWLAFGHILPYLEFSKQLAAKGIHISFISTPINIKRFPSIPQDISGRFKFI  61

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             ++ LP    LPEN EATIDL  ++++YLK A DAL+      +++ +P  IL DF + W+
Sbjct  62    EIQLPIVDGLPENCEATIDLSPEQIQYLKQAYDALKVPFESLVQKEAPQMILFDFAACWI  121

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFRL  1085
               +A++ G+++  FS  +  + A+ G    L  F  RT+ EDY   P+WIPF + VA+R 
Sbjct  122   PAIAARYGITSVFFSPLSAASSAYLGPPDELRSFRLRTRPEDYARAPEWIPFPSLVAYRP  181

Query  1084  YEILRIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFP  908
              +  R +  V   D   +S   R    +  CD+VAVR C EF+  +L +LE I+QKPV P
Sbjct  182   DQGTRFMQHVYIPDVSGISTGQRRAKTLAECDLVAVRSCREFEDSYLNVLEEIYQKPVLP  241

Query  907   VGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGL  728
             +G LP    +    +  + + +   K WLDKQE   V++V FGSE K     + E+A G+
Sbjct  242   IGLLPPNFVENKTSYPESSNFYGAFK-WLDKQEQKSVVFVGFGSEYKMPVETIHELAYGI  300

Query  727   ELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLT  548
             ELSG PF W+L+   G    +L  LP GF  R   RGIV   WAPQ +IL+H S+GG L 
Sbjct  301   ELSGLPFMWILKKPEGIDSQDL--LPTGFVSRISDRGIVSFGWAPQQEILAHPSIGGCLF  358

Query  547   HSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESL  368
             HSGW S++E++ F  PL+L+  + DQ LNA++L EK  G+ VPR+ +DG F R+ VA+S+
Sbjct  359   HSGWGSIIESLGFGHPLILMPMVNDQTLNAKLLVEKSAGFEVPRN-KDGSFNRDMVAKSM  417

Query  367   RLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             RLV+V +EG   R K  E++ +F  Q  QD Y+   + Y    K
Sbjct  418   RLVMVAEEGETIRRKTSELQAIFASQHLQDDYISKFIRYTSSFK  461



>ref|XP_009361641.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Pyrus x bretschneideri]
Length=469

 Score =   386 bits (991),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 196/462 (42%), Positives = 297/462 (64%), Gaps = 15/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++ +LE+SK +A +GH++SF+STP+NI+R      + +  I+FV+L
Sbjct  8     KLHIAMFPWLAYGHLMSFLEVSKFLAQKGHQISFISTPKNINR--HRSSSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE AE+T +LP +KV YLK A D L+ ++  F++    +W++HDF  YWL  
Sbjct  66    PLPAVDGLPETAESTSELPINKVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWLPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFAERT--KAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++ LFS+    T+AFFG   +       + ED+TV P+W+ + + VAF+L+E+
Sbjct  126   VANQLGVNSVLFSVTNATTMAFFGPPSELLSDKLRRPEDFTVVPEWVDYPSNVAFKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D +   D+ VSD  R    ++ C+ V +R C+EF+S+ + LL  ++ KP+ P+G L
Sbjct  186   VSHWDCM---DNEVSDFQRAAGAIQDCNFVTMRSCTEFESDAVSLLRKMYGKPIVPLGLL  242

Query  895   P--TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             P  +  +  G   +   + W+ ++ WL+ ++   V+Y+AFG+E  PSQ  + E+A G+E 
Sbjct  243   PPNSAPHQHGVADDRRDEKWEFLREWLESKKPNSVVYIAFGTEVTPSQELMHELAHGMEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G    +++  P GF+ R K RG+V   WAPQLKIL H SVGGFL
Sbjct  303   SGLPFIWVVNDRPLVEGVLGADIV--PLGFQTRVKDRGLVWRGWAPQLKILGHASVGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLT-FLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA++F + L+L +   +DQ LNAR++ +K++G  +PRDERDG FT ++VAE
Sbjct  361   THCGWSSVVEALRFGRVLILFSGAYSDQPLNARLMHDKRVGLEIPRDERDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              +R V+VEKEG   R     MK +F +    +  +D     L
Sbjct  421   LIRRVMVEKEGESIRSNAWAMKEIFGNVELNNMCLDEFTRVL  462



>ref|XP_004287583.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Fragaria vesca 
subsp. vesca]
Length=532

 Score =   388 bits (996),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 194/458 (42%), Positives = 294/458 (64%), Gaps = 13/458 (3%)
 Frame = -2

Query  1621  HEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRIN  1442
             ++   LHI+++PWLA+GH++P+L++S  +A +GH++SF+STP+N+ RLP    +L+  IN
Sbjct  68    NQNKPLHIVVFPWLAYGHLMPFLQVSNFLAQKGHRISFISTPKNLHRLPT--SSLSPLIN  125

Query  1441  FVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSY  1262
              ++LPLP    LP +AE+T D+P +KV YLK A D L+  + +FLE    +WI+HDF S+
Sbjct  126   LIELPLPAVDGLPHSAESTADIPINKVPYLKKAYDKLELPLTEFLEHCDVNWIVHDFASH  185

Query  1261  WLAPVASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKT-TVAF  1091
             WL  V ++LG+++  F+IF   T+AF G   +     R + ED+TV PKWI F    V F
Sbjct  186   WLPRVVTRLGINSVFFTIFNATTMAFAGPPSEILSGGRQRPEDFTVVPKWINFPNYNVVF  245

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             +L+E++   D +   +D VSD  R  + +E CD V  R C  FD++ L L+  ++ KPV 
Sbjct  246   KLHEMVSHWDCM---EDEVSDFQRFAAAIEGCDFVVTRTCPVFDADSLSLVNKLYSKPVL  302

Query  910   PVGQLPTTA--YDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             P+G LP      D     E    +W+ ++ WLD ++   V+Y+A G+E   S+  + E+A
Sbjct  303   PLGMLPPVLPDTDHSADDESEHGTWQSLREWLDGKKEKSVVYIALGTEVTLSRDSIHELA  362

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              G+E SG  F WVL  R+    P +I  P GFE+R + RG+V   WAPQL++L+H +VGG
Sbjct  363   RGIEKSGLCFIWVLGHRQEAGAPNMI--PVGFEKRVEDRGLVWRGWAPQLRVLAHTAVGG  420

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
             FLTH GWSSV+EA+ F + LVL +   ADQGL AR++  K++G  +PRD+RDG F+ E V
Sbjct  421   FLTHCGWSSVIEALGFGRALVLFSGASADQGLIARLMHGKRVGLEIPRDDRDGSFSSEVV  480

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVD  266
             AES+R V+VE+EG + RE    M+ +F + +  + Y++
Sbjct  481   AESIRRVMVEEEGEVLRENAWAMREVFGNLSLNNKYLE  518



>ref|XP_010277530.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=481

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 203/464 (44%), Positives = 290/464 (63%), Gaps = 13/464 (3%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             + LH+++ PWLAFGH+IP+L+LS  +A  G +VSF+STPRN+ RLPK+PPNLA+ + FV+
Sbjct  4     NNLHVVIVPWLAFGHLIPFLQLSMALAKAGIRVSFISTPRNVQRLPKVPPNLAALVRFVE  63

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
             L LP  + LP  AEAT+D+  D++++LK A D L+  + +F+   SPDWI+ DF  +W+A
Sbjct  64    LRLPTVEGLPLGAEATVDVSMDEIQHLKTAYDLLRHQVKQFVANESPDWIIQDFIPFWVA  123

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGRLVDFAER-------TKAEDYTVPPKWIPFKTTVA  1094
              +A + GV    FS+++  T+ F G L D+          T  E    PP+W+ F ++VA
Sbjct  124   EIAREYGVPLITFSVYSAATLGFHGPL-DYLTNDGHAKYWTSPESMMFPPEWVTFPSSVA  182

Query  1093  FRLYEILRIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             FR +E          ++  +++D  R++  VE C  VA+R C+E++ ++L L+E I ++P
Sbjct  183   FRRHEANAAFAGFFGQNASSITDNERVVVAVEACQAVAIRSCTEYEPDYLNLVEKIWRRP  242

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP  A  +    E  G+ W  I  WLD ++   V++VAFGSE K S+ ++ EIA
Sbjct  243   VIPVGLLP-PAPSSTEAKEREGE-WGKIFKWLDGEKPRTVVFVAFGSECKLSRDQVYEIA  300

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELS  PF W LR      D E   LP  F  RT+GRG+VC  WAPQL+IL H S+GG
Sbjct  301   HGLELSNLPFLWALRKPTWAVD-EDDALPSEFRRRTEGRGVVCMGWAPQLEILGHPSIGG  359

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
              L HSGW S++E +Q    LV+L F+ADQGLNAR L EK +   V R E DGRF    VA
Sbjct  360   SLFHSGWGSIIETLQHGHALVVLPFVADQGLNARQLVEKGLAVEVERSEEDGRFEGSDVA  419

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCD-QTRQDGYVDTLLHYL  248
             E+L+ V+V++ G   R +   M+ +F D +  QD Y+  L+ YL
Sbjct  420   EALKKVMVDEGGESLRARAASMRAVFGDVKLHQDHYIGGLVQYL  463



>ref|XP_002275824.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=465

 Score =   384 bits (986),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 283/463 (61%), Gaps = 14/463 (3%)
 Frame = -2

Query  1615  GSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFV  1436
                +H++M PWLAFGHMIP+L+L+  +A  G  VSF+STPRNI RLPKL P L   IN V
Sbjct  2     AGNMHVVMVPWLAFGHMIPHLQLAIALAEAGIHVSFISTPRNIQRLPKLSPTLLPLINLV  61

Query  1435  KLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
              LPLP    LPE  EAT++LP++K+KYLK+A   L++ + +FLE  SPDW++ D    W 
Sbjct  62    ALPLPAVLGLPEGCEATVELPFEKIKYLKIAYALLKQPLKRFLEGASPDWMIVDLPVDWA  121

Query  1255  APVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERT---KAEDYTVPPKWIPFKTTVA  1094
             A  A +  V    F++FT  +  FFG    L    +R      E  T PP+W+ F + VA
Sbjct  122   AEAARECAVPLLAFTMFTSASNVFFGPPEYLTGDGQRRVRPSPESMTTPPEWVTFPSLVA  181

Query  1093  FRLYEILRIIDAVTEEDDN-VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             +R +E          ++ +  +D  R+ + +  CD VA+R C EF+ E+L + + + +KP
Sbjct  182   YREFEARGAHPGFYGDNSSGTTDADRIATTLSACDAVAIRSCREFEGEYLSIYQKMLRKP  241

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP       G HE T  +W+ I  WLD+Q+   V++V FGSE K SQ ++ EIA
Sbjct  242   VIPVGLLPRE-----GSHEITNQAWRKIFKWLDEQKPKSVVFVGFGSECKLSQDQVHEIA  296

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELS   F W LR +   A  ++  LP G+ +RT GRG+VC  WAPQ++IL+H S+GG
Sbjct  297   YGLELSELTFLWALR-KPNWAIEDVDALPSGYSDRTSGRGVVCMEWAPQMEILAHPSIGG  355

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
              L HSGW S +E +QF    ++L F+ DQGLNAR+L EK +   + R + DG F+R+ +A
Sbjct  356   SLFHSGWGSAIETMQFGHCPIVLPFVIDQGLNARLLVEKGMAVEIERGD-DGSFSRDDIA  414

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             +SLRL +V +EG   R + +E+  +F DQ     Y+D L+ YL
Sbjct  415   KSLRLAMVMEEGEKLRIRAREVAMIFGDQKLHQSYIDELVKYL  457



>gb|KHN27169.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=464

 Score =   384 bits (985),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 205/463 (44%), Positives = 283/463 (61%), Gaps = 11/463 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI M PWLA GH+ PYLELSK +A +GH V+F+STP+NID +PK+P  L   I  V+LP
Sbjct  3     LHIAMLPWLAVGHVNPYLELSKILAQKGHFVTFISTPKNIDGMPKIPETLQPSIKLVRLP  62

Query  1426  LPP---HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             LP    H +LPE+AE+T+D+P +K  YLKLA +ALQ  +++ L+   PDW+ +DF + WL
Sbjct  63    LPHTDHHHHLPEDAESTMDIPSNKSYYLKLAYEALQGPVSELLKTSKPDWVFYDFATEWL  122

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAFRLY  1082
              P+A  L +  A +++       F     D+        +D  +PP W+PF TTV  R +
Sbjct  123   PPIAKSLNIPCAHYNLTAAWNKVFIDPPKDYQLNNSITLQDMCLPPTWLPFTTTVHLRPH  182

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             EI R   ++ + D      F L      CD+  +R C E + EWL  L + ++ PV PVG
Sbjct  183   EIRRATSSIKDSDTGRMANFDLRKAYSSCDMFLLRTCRELEGEWLDYLAHKYKVPVVPVG  242

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              +P +        E     W  IK WLDKQE+  V+Y+ FGSE + SQ ++TE+A G+EL
Sbjct  243   LVPPSIQIRDVEEEDNNPDWVKIKDWLDKQESSSVVYIGFGSELRLSQQDVTELAHGIEL  302

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG  FFW LR  + E       LP GFEERTK RGIV  SWAPQ+KIL H ++GG +TH 
Sbjct  303   SGLRFFWALRNLQKE------DLPHGFEERTKERGIVWKSWAPQIKILGHAAIGGCITHC  356

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             G +S+VE + F   LV L +L DQ L +RVLEEKK+G  VPR E+DG FTR+ VA++L+L
Sbjct  357   GTNSLVEMLNFGHVLVTLPYLLDQALFSRVLEEKKVGIEVPRSEKDGSFTRDDVAKTLKL  416

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
              +V++EG+ YR+  KEM  +F        Y+D  +  L  +K+
Sbjct  417   AIVDEEGSDYRKNAKEMGKVFSSTDLHSRYIDNCIVALQKYKT  459



>ref|XP_003593144.1| Glucosyltransferase [Medicago truncatula]
 gb|AES63395.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=472

 Score =   384 bits (986),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/459 (42%), Positives = 280/459 (61%), Gaps = 6/459 (1%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+M PWLA GH+ PY E++K +AS+GH V+F+++P+NID++PK P  +   I  V+LP
Sbjct  13    LHIVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKTPKTIEPFIKLVRLP  72

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  + LP  AE T+D+  +  ++LK A + LQ+ + + L+   PDW+ +DF S WLAP+
Sbjct  73    LPHIEQLPPGAENTMDIQPNMNRFLKQAYEGLQDDVTEILKTSKPDWVFYDFASGWLAPI  132

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERT-KAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             A  L ++ A ++I       FF    D  +   K ED   PPKW+PF+TT+  + YEI+R
Sbjct  133   AKSLNIAAAHYNITPAWNKCFFDPPKDQVKTNFKLEDMCGPPKWVPFQTTIHLKPYEIIR  192

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
                A+  E   ++  F L      CD+  +R   E + EWL  +   ++ PV PVG LP 
Sbjct  193   AFTALRNESGGIAG-FDLNKAYSSCDLFLLRTSRELEGEWLDYISEQYKVPVVPVGLLPP  251

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +        E     W  IK WLD +E+  V+Y+ FGSE K SQ +LTE+A G+ELSG  
Sbjct  252   SMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQNDLTELAHGIELSGLS  311

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW L+  +       + LPEGFEERTK RGIV  +WAPQLKIL+H ++GG ++H G  S
Sbjct  312   FFWALKNLKEGT----LELPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHCGSGS  367

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E + F   LV L +L DQ L +R L EK +   VPR E DG FTR++VA SLRL +V+
Sbjct  368   VIEKVHFGHVLVTLPYLLDQCLFSRALVEKGVAVEVPRSEEDGSFTRDSVAHSLRLAIVD  427

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             +EG+ +R   KE+  +F  +   + Y+D L+  L+ +++
Sbjct  428   EEGSSFRNNAKELGKVFSSKDIHNQYIDDLIAALYKYRN  466



>ref|XP_003535899.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Glycine 
max]
Length=464

 Score =   383 bits (984),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 205/463 (44%), Positives = 283/463 (61%), Gaps = 11/463 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI M PWLA GH+ PYLELSK +A +GH V+F+STP+NID +PK+P  L   I  V+LP
Sbjct  3     LHIAMLPWLAVGHVNPYLELSKILAQKGHFVTFISTPKNIDGMPKIPETLQPSIKLVRLP  62

Query  1426  LPP---HQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             LP    H +LPE+AE+T+D+P +K  YLKLA +ALQ  +++ L+   PDW+ +DF + WL
Sbjct  63    LPHTDHHHHLPEDAESTMDIPSNKSYYLKLAYEALQGPVSELLKTSKPDWVFYDFATEWL  122

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAFRLY  1082
              P+A  L +  A +++       F     D+        +D  +PP W+PF TTV  R +
Sbjct  123   PPIAKSLNIPCAHYNLTAAWNKVFIDPPKDYQLNNSITLQDMCLPPTWLPFTTTVHLRPH  182

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             EI R   ++ + D      F L      CD+  +R C E + EWL  L + ++ PV PVG
Sbjct  183   EIRRATSSIKDSDTGRMANFDLRKAYSSCDMFLLRTCRELEGEWLDYLAHKYKVPVVPVG  242

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              +P +        E     W  IK WLDKQE+  V+Y+ FGSE + SQ ++TE+A G+EL
Sbjct  243   LVPPSIQIRDVEEEDNNPDWVKIKDWLDKQESSSVVYIGFGSELRLSQQDVTELAHGIEL  302

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG  FFW LR  + E       LP GFEERTK RGIV  SWAPQ+KIL H ++GG +TH 
Sbjct  303   SGLRFFWALRNLQKE------DLPHGFEERTKERGIVWKSWAPQIKILGHAAIGGCITHC  356

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             G +S+VE + F   LV L +L DQ L +RVLEEKK+G  VPR E+DG FTR+ VA++L+L
Sbjct  357   GTNSLVEMLNFGHVLVTLPYLLDQALFSRVLEEKKVGIEVPRSEKDGSFTRDDVAKTLKL  416

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
              +V++EG+ YR+  KEM  +F        Y+D  +  L  +K+
Sbjct  417   AIVDEEGSDYRKNAKEMGKVFSSTDLHSRYIDDCIVALQKYKT  459



>gb|AFK37289.1| unknown [Medicago truncatula]
Length=472

 Score =   384 bits (985),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/459 (42%), Positives = 280/459 (61%), Gaps = 6/459 (1%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+M PWLA GH+ PY E++K +AS+GH V+F+++P+NID++PK P  +   I  V+LP
Sbjct  13    LHIVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKTPKTIEPFIKLVRLP  72

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  + LP  AE T+D+  +  ++LK A + LQ+ + + L+   PDW+ +DF S WLAP+
Sbjct  73    LPHIEQLPPGAENTMDIQPNMNRFLKQAYEGLQDDVTEILKTSKPDWVFYDFASGWLAPI  132

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERT-KAEDYTVPPKWIPFKTTVAFRLYEILR  1070
             A  L ++ A ++I       FF    D  +   K ED   PPKW+PF+TT+  + YEI+R
Sbjct  133   AKSLNIAAAHYNITPAWNKCFFDPPKDQVKTNFKLEDMCGPPKWVPFQTTIHLKPYEIIR  192

Query  1069  IIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
                A+  E   ++  F L      CD+  +R   E + EWL  +   ++ PV PVG LP 
Sbjct  193   AFTALRNESRGIAG-FDLDKAYSSCDLFLLRTSRELEGEWLDYISEQYKVPVVPVGLLPP  251

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             +        E     W  IK WLD +E+  V+Y+ FGSE K SQ +LTE+A G+ELSG  
Sbjct  252   SMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQNDLTELAHGIELSGLS  311

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW L+  +       + LPEGFEERTK RGIV  +WAPQLKIL+H ++GG ++H G  S
Sbjct  312   FFWALKNLKEGT----LELPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHCGSGS  367

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             V+E + F   LV L +L DQ L +R L EK +   VPR E DG FTR++VA SLRL +V+
Sbjct  368   VIEKVHFGHVLVTLPYLLDQCLFSRALVEKGVAVEVPRSEEDGSFTRDSVAHSLRLAIVD  427

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKS  233
             +EG+ +R   KE+  +F  +   + Y+D L+  L+ +++
Sbjct  428   EEGSSFRNNAKELGKVFSSKDIHNQYIDDLIAALYKYRN  466



>ref|XP_011036928.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=466

 Score =   383 bits (984),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 207/468 (44%), Positives = 288/468 (62%), Gaps = 15/468 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M PW+AFGHMIP+ +LS  +A  G KVSFVSTPRNI RLPK+PP+LA  + FV+ 
Sbjct  4     KLHIVMLPWIAFGHMIPFFQLSIDLAKAGIKVSFVSTPRNIKRLPKIPPSLADLVTFVEF  63

Query  1429  PLPPHQN--LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             PLP   N  LPE+ EAT+D+P +K++YLK++ D LQ  + +F+ +  PDWI+ D   YW+
Sbjct  64    PLPSLDNDILPEDGEATVDIPAEKIEYLKISFDLLQHPLKQFIADQLPDWIIIDMIPYWM  123

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGR---LVDFAERTKAEDYTV---PPKWIPFKTTVA  1094
               +A +  V    FS+F+     F G    LV   +R     +T     P+W+ F ++VA
Sbjct  124   VEIAREKKVPLIHFSVFSAVAYVFLGHPECLVGDGQRRLRPSWTSMTSKPEWVDFPSSVA  183

Query  1093  FRLYEILRIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKP  917
             +R  E + + + +   +   ++D  R+   +  C   AVR C+EF+ ++L L E +  KP
Sbjct  184   YRNQEAVGVFEGIYGGNASGITDSERVSKILHGCQAFAVRSCAEFEGDYLNLFERLIGKP  243

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V PVG LP    +     E T   W +I  WLD Q+   V++V FGSE K ++ ++ EIA
Sbjct  244   VIPVGLLPQEKPER---KEFTDGRWGEIFKWLDDQKPKSVVFVGFGSEYKLTRDQVYEIA  300

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
              GLELSG PF W LR + G A+ +L  LP GF ERT  RGIVC  WAPQ++IL H S+GG
Sbjct  301   HGLELSGLPFLWALR-KPGWANDDLDALPSGFGERTSDRGIVCMGWAPQMEILGHPSIGG  359

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
              L HSGW SV+E++QF   L+LL F+ DQ LNAR L EK +G  V R E DG FTR+ +A
Sbjct  360   SLFHSGWGSVIESLQFGHTLILLPFIVDQPLNARYLVEKALGVEVQRGE-DGSFTRDGIA  418

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQT-RQDGYVDTLLHYLHCHK  236
             ++L+L +V +EG   REK  E   +F +Q   QD Y+   + +L   K
Sbjct  419   KALKLAMVSEEGKSLREKASEAAAIFGNQKLHQDYYIGKFVDFLKKKK  466



>ref|XP_009351087.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Pyrus x bretschneideri]
Length=469

 Score =   383 bits (983),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 201/467 (43%), Positives = 300/467 (64%), Gaps = 15/467 (3%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             + +  KL I M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+RL     + +  I
Sbjct  3     NKDQKKLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLI  60

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDS  1265
             +FV+LPLP    LPE+AE+T +LP +KV YLK A D L+ ++  F++    +W++HDF  
Sbjct  61    DFVELPLPAVDGLPESAESTSELPINKVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFIC  120

Query  1264  YWLAPVASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAF  1091
             YW+  VA++LGV++  F+I    T+AFFG   +    +R + ED TV P+W+ + + VA+
Sbjct  121   YWMPRVATQLGVNSVYFNITNATTLAFFGPPSELLSDKRWRPEDLTVVPEWVDYPSNVAY  180

Query  1090  RLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
             +L+E++   D +   DD V D  RL   +E C++V +R C+EF+S+ + LL  I+ KPV 
Sbjct  181   KLHEMVSPWDGM---DDEVLDFQRLGRTIEDCNVVTMRSCTEFESDAVSLLRKIYGKPVV  237

Query  910   PVGQL-PTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             P+G L P +A    G  +  GD  W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A
Sbjct  238   PLGLLPPVSAPQQHGVADDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELA  297

Query  736   LGLELSGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHES  566
              G+E SG PF WV+  R    G    ++I  P GFE R + RG+V   WAPQLKIL H S
Sbjct  298   HGIEKSGLPFIWVVNNRPLVEGVLGSDII--PFGFETRVEDRGLVLRGWAPQLKILGHIS  355

Query  565   VGGFLTHSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTR  389
             VGGFLTH GWSSVVEA+ + + L+L +   ADQGLNAR++++K++G  +PRDERDG F  
Sbjct  356   VGGFLTHCGWSSVVEALGYGRALILFSGANADQGLNARLMQDKRVGLEIPRDERDGSFMS  415

Query  388   EAVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             ++VAE  R V+VEKEG   R     MK +F +    +  +D     L
Sbjct  416   DSVAEVTRRVMVEKEGESIRSNAWAMKEIFGNVELNNKCLDEFTRVL  462



>ref|XP_008362978.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X2 [Malus 
domestica]
Length=467

 Score =   382 bits (982),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 200/462 (43%), Positives = 298/462 (65%), Gaps = 15/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KL I M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+RL     + +  I+FV+L
Sbjct  8     KLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+ E+T +LP +KV YLK A D L+ ++  F++    +W++HDF  YW+  
Sbjct  66    PLPAVDGLPESVESTSELPINKVPYLKKAYDLLKPSVMHFIQHSGVNWVVHDFICYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  F+I    T+AFFG   +    +R   ED+TV P+W+ + + VAF+L+E+
Sbjct  126   VATQLGVNSVYFNITNATTLAFFGPPSELLGNKRRGPEDFTVVPEWVDYPSNVAFKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D + +E   VSD  RL   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VTHWDCMXDE---VSDFQRLGRTIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  242

Query  895   -PTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              P +A    G  +  GD +W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A G+E 
Sbjct  243   PPVSAPQQHGVADDRGDETWEVLRGWLENKKPNSVVYIALGTEVTLSQELMHELAHGIEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G   P++I  P GF+ R + RG+V   WAPQLKIL H SVGGFL
Sbjct  303   SGLPFIWVVNNRPLVEGVFGPDVI--PLGFQTRVEDRGLVLRGWAPQLKILGHPSVGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+ F + L+L +   +DQGL AR++ EK++G  +PRDERDG FT ++VAE
Sbjct  361   THCGWSSVVEALGFGRVLILFSGANSDQGLIARLMHEKRVGLEIPRDERDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
               R V+VE+EG   R     MK +F +    +  +D     L
Sbjct  421   VTRRVMVEREGESIRSNAWAMKEIFGNVELNNACLDEFTRVL  462



>ref|XP_011092703.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=470

 Score =   382 bits (982),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/473 (41%), Positives = 284/473 (60%), Gaps = 8/473 (2%)
 Frame = -2

Query  1618  EGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINF  1439
             EG K HIMM+PWLAFGHMIP+LELSK +A++G  VS+VSTPRN+ RLP +  NL  ++  
Sbjct  2     EGGKYHIMMFPWLAFGHMIPFLELSKRLAAKGIFVSYVSTPRNLQRLPPIALNLEGKVKL  61

Query  1438  VKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYW  1259
             V++P+P    LPEN EAT+D+  +++ YLK A D L E   + L+   PD IL DF  YW
Sbjct  62    VEIPMPQVDGLPENCEATVDIQLEQIPYLKKAYDRLAEPFERLLQTVRPDLILIDFAPYW  121

Query  1258  LAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
             +  +A+K G+ TA FS++T  T+A+ G    L     R   E +T PP WIPF + +A R
Sbjct  122   ILEIAAKFGIRTAFFSVYTAATLAYLGPPAELKSGKRRPTPEHFTRPPDWIPFPSLIAHR  181

Query  1087  LYEILRIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVF  911
                  R++      D   +S   R    +E C  V VR     + E++ L++ ++++PV 
Sbjct  182   PDYAPRMMRNTHFPDASGMSSGQRAAKILEECSFVVVRSSEAVEGEYIGLIQELYKRPVL  241

Query  910   PVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALG  731
             P+G L     +    +     SW     WL+ Q+   V++V FGSE K    ++ E+A  
Sbjct  242   PIGVLAPVP-EENKNNTAINSSWSHTHQWLEGQKPKSVLFVGFGSEYKMPVEQIHELAYS  300

Query  730   LELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             LELS  PF W+LR  +G    +L  LP GF  RT  +G+V   WAPQL+IL+H ++GG L
Sbjct  301   LELSRLPFLWILRKPQGVDSSDL--LPPGFANRTLSQGVVLLGWAPQLEILAHPAIGGCL  358

Query  550   THSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAES  371
              HSGW +++E++ F  PLVLL  +ADQGLNA++L EK++GY VPR+E DG F+R+ VAES
Sbjct  359   FHSGWGTIIESLGFGHPLVLLPMIADQGLNAKLLVEKEVGYEVPRNE-DGSFSRDVVAES  417

Query  370   LRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSIKYGTQT  212
             +R VV+  EG   R +   M+ +F +   QD Y++  + +L  +  +K   Q 
Sbjct  418   IRRVVIAPEGEQLRLRAAHMRSVFDNHESQDNYINKFIEHLGKYDDLKGKKQA  470



>ref|NP_001240857.1| soyasaponin III rhamnosyltransferase [Glycine max]
 sp|D4Q9Z5.1|SGT3_SOYBN RecName: Full=Soyasaponin III rhamnosyltransferase; AltName: 
Full=Soyasaponin glycosyltransferase 3; AltName: Full=UDP-rhamnose:soyasaponin 
III-rhamnosyltransferase [Glycine max]
 dbj|BAI99585.1| UDP-rhamnose:soyasaponin III-rhamnosyltransferase [Glycine max]
 gb|KHN26727.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=472

 Score =   382 bits (982),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 281/462 (61%), Gaps = 14/462 (3%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH+ M PWLA GH+ PY E++K +A +GH V+F+++P+NIDR+PK P +L   I  VKLP
Sbjct  15    LHVAMLPWLAMGHIYPYFEVAKILAQKGHFVTFINSPKNIDRMPKTPKHLEPFIKLVKLP  74

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  ++LPE AE+T+D+P  K  +LK A + LQ  ++K L+  +PDW+L+DF + W+ P+
Sbjct  75    LPKIEHLPEGAESTMDIPSKKNCFLKKAYEGLQYAVSKLLKTSNPDWVLYDFAAAWVIPI  134

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTV-----PPKWIPFKTTVAFRLY  1082
             A    +  A ++I TP     F ++     + K +DY++     PP W+PF TT+  R Y
Sbjct  135   AKSYNIPCAHYNI-TPA----FNKVFFDPPKDKMKDYSLASICGPPTWLPFTTTIHIRPY  189

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E LR  +   +E+      F L      CD+  +R   E + +WL  L   ++ PV PVG
Sbjct  190   EFLRAYEGTKDEETGERASFDLNKAYSSCDLFLLRTSRELEGDWLDYLAGNYKVPVVPVG  249

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              LP +        E     W  IK WLD QE+  V+Y+ FGSE K SQ +LTE+A G+EL
Sbjct  250   LLPPSMQIRDVEEEDNNPDWVRIKDWLDTQESSSVVYIGFGSELKLSQEDLTELAHGIEL  309

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             S  PFFW L+  +      ++ LPEGFEERTK RGIV  +WAPQLKIL+H ++GG ++H 
Sbjct  310   SNLPFFWALKNLK----EGVLELPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHC  365

Query  541   GWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             G  SV+E + F   LV L +L DQ L +RVLEEK++   VPR E+DG FTR  VA++LR 
Sbjct  366   GSGSVIEKVHFGHVLVTLPYLLDQCLFSRVLEEKQVAVEVPRSEKDGSFTRVDVAKTLRF  425

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
              +V++EG+  RE  KEM  +F  +   + Y+   +  L  ++
Sbjct  426   AIVDEEGSALRENAKEMGKVFSSEELHNKYIQDFIDALQKYR  467



>ref|XP_008362977.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X1 [Malus 
domestica]
Length=467

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 200/462 (43%), Positives = 297/462 (64%), Gaps = 15/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KL I M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+RL     + +  I+FV+L
Sbjct  8     KLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+ E+T +LP +KV YLK A D L+ ++  F++    +W++HDF  YW+  
Sbjct  66    PLPAVDGLPESVESTSELPINKVPYLKKAYDLLKPSVMHFIQHSGVNWVVHDFICYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  F+I    T+AFFG   +    +R   ED+TV P+W+ + + VAF+L+E+
Sbjct  126   VATQLGVNSVYFNITNATTLAFFGPPSELLGNKRRGPEDFTVVPEWVDYPSNVAFKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D + +E   VSD  RL   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VTHWDCMXDE---VSDFQRLGRTIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  242

Query  895   -PTTAYDAGGGHEPTGD-SWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              P +A    G  +  GD  W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A G+E 
Sbjct  243   PPVSAPQQHGVADDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELAHGIEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G   P++I  P GF+ R + RG+V   WAPQLKIL H SVGGFL
Sbjct  303   SGLPFIWVVNNRPLVEGVFGPDVI--PLGFQTRVEDRGLVLRGWAPQLKILGHPSVGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+ F + L+L +   +DQGL AR++ EK++G  +PRDERDG FT ++VAE
Sbjct  361   THCGWSSVVEALGFGRVLILFSGANSDQGLIARLMHEKRVGLEIPRDERDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
               R V+VE+EG   R     MK +F +    +  +D     L
Sbjct  421   VTRRVMVEREGESIRSNAWAMKEIFGNVELNNACLDEFTRVL  462



>ref|XP_002320817.1| hypothetical protein POPTR_0014s08440g [Populus trichocarpa]
 gb|EEE99132.1| hypothetical protein POPTR_0014s08440g [Populus trichocarpa]
Length=467

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 206/469 (44%), Positives = 288/469 (61%), Gaps = 16/469 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI+M PW+AFGHMIP+ +LS  +A  G KVSFVSTPRNI RLPK+PP+LA  + FV+ 
Sbjct  4     KLHIVMLPWIAFGHMIPFFQLSIDLAKAGIKVSFVSTPRNIKRLPKIPPSLADLVKFVEF  63

Query  1429  PLPPHQN--LPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWL  1256
             PLP   N  LPE+ EAT+D+P +K++YLK+A D LQ  + +F+ +  PDWI+ D   YW+
Sbjct  64    PLPSLDNDILPEDGEATVDIPAEKIEYLKIAYDLLQHPLKQFIADQLPDWIIIDMIPYWM  123

Query  1255  APVASKLGVSTALFSIFTPPTVAFFGR-----LVDFAERTKAE--DYTVPPKWIPFKTTV  1097
               +A    V    FS+F+     F G      + D  +R +      T  P+W+ F ++V
Sbjct  124   VEIARDKKVPLIHFSVFSAVAYVFLGHPECLLVGDGQKRLRPSWTSMTSKPEWVDFPSSV  183

Query  1096  AFRLYEILRIIDAVTEED-DNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             A+R +E + + + + + +   ++D  R+   +  C  +AVR C+EF+ ++L L E +  K
Sbjct  184   AYRNHEAVGVFEWIYKGNASGITDGERVSKILHGCQALAVRSCAEFEGDYLNLFERVIGK  243

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV PVG LP    +     E T   W +I  WLD Q+   V++V FGSE K ++ ++ EI
Sbjct  244   PVIPVGLLPQEKPER---KEFTDGRWGEIFKWLDDQKPKSVVFVGFGSEYKLTRDQVYEI  300

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             A GLELSG PF W LR + G A+ +L  LP GF ERT  RGIVC  WAPQ++IL H S+G
Sbjct  301   AHGLELSGLPFLWALR-KPGWANDDLDALPSGFGERTSDRGIVCMGWAPQMEILGHPSIG  359

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAV  380
             G L HSGW S++E++QF   L+LL F+ DQ LNAR L EK +G  V R E DG FTR+ V
Sbjct  360   GSLFHSGWGSIIESLQFGHTLILLPFIIDQPLNARYLVEKGLGVEVQRGE-DGSFTRDGV  418

Query  379   AESLRLVVVEKEGNIYREKIKEMKGLFCDQT-RQDGYVDTLLHYLHCHK  236
             A++L L ++  EG   REK  E   +F +Q   QD Y+   + +L   K
Sbjct  419   AKALNLAMISAEGKGLREKASEAAAIFGNQKLHQDYYIGKFVDFLKKKK  467



>gb|EPS70335.1| hypothetical protein M569_04423, partial [Genlisea aurea]
Length=461

 Score =   380 bits (977),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 290/462 (63%), Gaps = 18/462 (4%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LHI+M+PW A GH+ P+  LSK +A RGH++SF+STPRNI RL ++P +L+  I+FV  P
Sbjct  6     LHIVMFPWFAAGHLRPFFRLSKTLARRGHRISFISTPRNIQRLGEIPDDLSHLIDFVVFP  65

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSP--DWILHDFDSYWLA  1253
             +P  ++L  + E+++D+P+ K + LK+A D L+  +  FL+E SP  DWIL+D+ S+WL 
Sbjct  66    MPTVEHLAPDCESSMDVPHQKQQLLKIALDLLENPIRNFLQEMSPRPDWILYDYASHWLP  125

Query  1252  PVASKLGVSTALFSIFTPPTVAFFG-----RLVDFAERTKAEDYTVPPKWIPFKTTVAFR  1088
              VA ++G+S A FS+F    +AF G      L     R  AEDYTV P WIPFK+ +AFR
Sbjct  126   RVAQEIGISKAFFSLFPAAFMAFLGPTSSGLLDQNCSRVTAEDYTVVPHWIPFKSNMAFR  185

Query  1087  LYEILRII--DAVTEEDDN--VSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIH-Q  923
             L+E+ + +  DA  E   N   SD  R    ++  DI+ +R C+ F+ EW +L+ +++ Q
Sbjct  186   LHEMTKNMEKDAAGENAYNSGTSDSVRFGLTIQGSDIMILRSCTAFEPEWFELIHHLYNQ  245

Query  922   KPVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTE  743
             KPV P G LP    D       + + W  I+ WL+KQ+   ++YVA G+EA  +  E+ E
Sbjct  246   KPVIPTGVLPVE-LDEEVAEFDSDEDWIQIRDWLNKQKDDSLVYVALGTEAVLTHEEVQE  304

Query  742   IALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESV  563
             +A GLE SG PF WVL   RG    ++  LP GF +R + RG V + WAPQ  ILS   V
Sbjct  305   LAFGLEQSGLPFLWVLN--RGN---QIETLPNGFAKRVEERGRVYSKWAPQATILSRPCV  359

Query  562   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GGFLTH GW+SV E++ + + L+L   + DQGL AR+L +K++G  +PR+E DG F+R  
Sbjct  360   GGFLTHCGWNSVTESLCYGRVLILFPVMNDQGLIARLLVDKRVGVEIPRNENDGSFSRHQ  419

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLL  257
             VA++L++ +V   G   R+   +MK LF D    + Y+D+L+
Sbjct  420   VADALKMAMVSDRGRSLRDNAGKMKALFGDARINEEYMDSLI  461



>ref|XP_008354446.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=469

 Score =   380 bits (976),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 194/456 (43%), Positives = 293/456 (64%), Gaps = 15/456 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++ Y E+SK +A +GH++SF+STP+NI RL     + +  I+ V+L
Sbjct  8     KLHIAMFPWLAYGHLMSYXEVSKFLAQKGHRISFISTPKNITRLRS--SSFSPLIDXVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+AE+T +LP +KV YLK A D L+ ++  F+E    +WI+HDF+ YW+  
Sbjct  66    PLPTVDGLPESAESTSELPINKVPYLKKANDLLKPSVTHFIEHSGVNWIVHDFNCYWVPQ  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  FS+    ++AF G   +    +R + ED+TV P+W+ + + VAF+L+E+
Sbjct  126   VATQLGVNSVYFSVTNANSLAFGGPPSELLGNKRRRPEDFTVVPEWVDYPSNVAFKLHEV  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D +   DD VSD  RL   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VSHWDCM---DDEVSDFXRLAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  242

Query  895   P--TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             P  +  +  G   +   ++W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A G+E 
Sbjct  243   PPVSAPHQHGVADDRGDETWEVLRGWLENKKPNSVVYIALGTEVTLSQELMHELAHGIEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G    ++I  P GFE R + RG+V   WAPQL IL H SVGGFL
Sbjct  303   SGLPFIWVVNNRPLVEGLLGSDII--PLGFETRVENRGLVLRGWAPQLNILGHISVGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+ + + L+L +   +DQGL +R++ EK++G  +PRDE+DG FT ++VAE
Sbjct  361   THCGWSSVVEALGYGRALILFSGANSDQGLISRLMHEKRVGLEIPRDEQDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVD  266
               R V+VEKEG   R     MK +F +    +  +D
Sbjct  421   LTRRVMVEKEGESIRSNAWAMKEIFGNVELNNKCLD  456



>ref|XP_008342850.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=468

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 295/462 (64%), Gaps = 16/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KL I M+PWLA+GH++P+LE+SK +A +GH++SF+STP+NI+RL     + +  I+FV+L
Sbjct  8     KLQIAMFPWLAYGHLMPFLEVSKFLAQKGHQISFISTPKNINRLRS--SSFSPLIDFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+ E+T +LP +KV YLK A D L+ ++  F++    +W++HDF  YW+  
Sbjct  66    PLPAVDGLPESVESTSELPINKVPYLKKAYDLLKPSVTHFIQHSGVNWVVHDFICYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  F+I    T+AFFG   +    +R + ED+TV P+W+ + + VAF+L+E+
Sbjct  126   VATQLGVNSVYFNITNATTLAFFGPPSELLGDKRKRXEDFTVVPEWVDYPSNVAFKLHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D +    D VSD  RL   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VSHWDCM----DEVSDFQRLSGAIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  241

Query  895   P--TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             P  +  +  G   +   + W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A G+E 
Sbjct  242   PLGSAXHQHGVADDRGDEKWEVLREWLENKKPNSVVYIALGTEVTLSQELMHELARGIEK  301

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G    ++I  P GF+ + + RG+V   WAPQLKIL H SVGGFL
Sbjct  302   SGLPFIWVVNNRPLVEGVLGSDII--PFGFQTQVEDRGLVLRGWAPQLKILGHPSVGGFL  359

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+ F + L+L +   ADQGL +R++ EK++G  +PRDE+DG FT ++VAE
Sbjct  360   THCGWSSVVEALGFGRALILFSGANADQGLISRLMHEKRVGLEIPRDEQDGSFTSDSVAE  419

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
               R V+VEKEG   R     MK +F +    +  +D     L
Sbjct  420   VTRRVMVEKEGESIRSNAWAMKEIFGNLELNNTCLDEFTRVL  461



>ref|XP_008388212.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=467

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 295/462 (64%), Gaps = 15/462 (3%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLHI M+PWLA+GH++P+ E+SK +A  GH++SF+STP+NI+RL     + +  INFV+L
Sbjct  8     KLHIAMFPWLAYGHLMPFXEVSKFLAQXGHQISFISTPKNINRLRS--SSFSPLINFVEL  65

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LPE+ E+T +LP +KV YLK A D L+ ++  F++  S +W++HD   YW+  
Sbjct  66    PLPAVDGLPESVESTSELPINKVPYLKKAYDLLKPSVXHFIQHSSVNWVVHDIICYWMPR  125

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDFA--ERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
             VA++LGV++  F+I    T+AF G   +    +R + ED+TV P+W+ + + VAF+ +E+
Sbjct  126   VATQLGVNSVYFNITNASTLAFLGPPXELLGDKRRRPEDFTVVPEWVDYPSNVAFKQHEM  185

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             +   D +   DD VSD  RL   ++ C+ V +R C+EF+S+ + LL  I+ KPV P+G L
Sbjct  186   VSHWDCM---DDEVSDFQRLAGSIQDCNFVTMRSCTEFESDAVSLLRKIYGKPVVPLGLL  242

Query  895   P--TTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
             P  +  +  G  ++   D W+ ++ WL+ ++   V+Y+A G+E   SQ  + E+A G+E 
Sbjct  243   PPGSAPHQHGVANDRGDDKWEVLRKWLENKKPNSVVYIALGTEVTLSQELMHELAHGIEK  302

Query  721   SGFPFFWVLRAR---RGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFL  551
             SG PF WV+  R    G    ++I  P GFE R + RG+V   WAPQLKIL H S+GGFL
Sbjct  303   SGLPFIWVVNNRPLVEGVLGSDII--PLGFETRVEDRGLVLRGWAPQLKILGHISIGGFL  360

Query  550   THSGWSSVVEAIQFEKPLVLLTFL-ADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAE  374
             TH GWSSVVEA+ + + L+L +   +DQGL AR++ +K++G  +PRDE+DG FT ++VAE
Sbjct  361   THCGWSSVVEALGYGRALILFSGANSDQGLIARLMHDKQVGLEIPRDEQDGSFTSDSVAE  420

Query  373   SLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              +  V+VEKEG   R   + MK +F +    +  +D     L
Sbjct  421   LIGRVMVEKEGESIRSNARAMKEIFGNVELNNKCLDEFTRVL  462



>dbj|BAJ89368.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/472 (43%), Positives = 285/472 (60%), Gaps = 7/472 (1%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRI  1445
             D    +L ++++PWLAFGHMIP+LELSKH+A+RGH V+FVSTPRN+ RLP +P  L++R+
Sbjct  7     DAGAGELEVVVFPWLAFGHMIPFLELSKHLAARGHAVAFVSTPRNLARLPPVPAGLSTRL  66

Query  1444  NFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFS-PDWILHDFD  1268
              FV LPLP  + LPE AEAT DLP DKV  LK A D L + +A FL     PDWILHDF 
Sbjct  67    RFVPLPLPAVEGLPEGAEATSDLPPDKVGLLKKAMDGLADPLAAFLAAGRRPDWILHDFC  126

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFG-RLVDFAE-RTKAEDYTVPPKWIPFKTTVA  1094
              +W+ P+A +  V++A F IF    + F G R  + A  RT+ E +  PP+WIPF +T  
Sbjct  127   HHWVPPIADQHKVASATFLIFQAAFLVFVGPRWANTAHPRTEPEHFAEPPRWIPFPSTTF  186

Query  1093  FRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPV  914
             FR +E   I DA       VSD+ R    +E   +   R C E +   L LL ++ +KP 
Sbjct  187   FRRHETQWITDAFRTNASGVSDMDRWWQVLEHSRLTIHRSCEELEPRMLGLLSDLFRKPA  246

Query  913   FPVGQL---PTTAYDAGGGHEPTGDSWK-DIKAWLDKQETGKVIYVAFGSEAKPSQTELT  746
              P G L   P    D       +G   +  +  WLD Q    VIY+A GSEA  +     
Sbjct  247   VPAGILLPGPPDGLDEDQWQSSSGGVARPQVLRWLDDQPPKSVIYIALGSEAPLTPENAH  306

Query  745   EIALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHES  566
             E+ALGLEL+G  F W LR   G    + + LP GFEERT+ RG+VCT W PQ++ L+H +
Sbjct  307   ELALGLELAGVRFLWALRKPAGTGSDDELLLPAGFEERTRDRGVVCTGWVPQVEALAHCA  366

Query  565   VGGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTRE  386
              G FL+H GW S +E++    PLV+L F+ DQ L AR + E+ IG  V RDE DG F R+
Sbjct  367   TGAFLSHCGWGSTIESLSIGIPLVMLPFVVDQPLIARAMAERGIGVEVARDENDGSFDRD  426

Query  385   AVAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHKSI  230
              VA ++R V+VE++G ++   +K+++ +  DQ RQ+ ++D L  +L  ++ +
Sbjct  427   GVAVAVRRVMVEEQGKVFATNVKKLQEILVDQRRQEHHIDELEEHLRRYRDV  478



>ref|XP_009376199.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 91C1-like 
[Pyrus x bretschneideri]
Length=464

 Score =   380 bits (975),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 274/463 (59%), Gaps = 34/463 (7%)
 Frame = -2

Query  1612  SKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVK  1433
             + LH++++PWLA GH+IP+  LS  IA +GH VSFVSTPRN+ RLPK+P +L+S +N V 
Sbjct  18    AALHVVVFPWLAMGHLIPFFHLSTLIAQKGHTVSFVSTPRNLSRLPKIPSHLSSLVNLVS  77

Query  1432  LPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLA  1253
              PLP   NLP +AE++ D+P+ K + LK A D LQ  +  FLE   PDW+++D+  +WL 
Sbjct  78    FPLPRLPNLPNDAESSTDVPFHKQQLLKTAFDMLQTPLTAFLESSRPDWVIYDYAPHWLP  137

Query  1252  PVASKLGVSTALFSIFTPPTVAFFGR---LVDFAE-RTKAEDYTVPPKWIPFKTTVAFRL  1085
              +A++LGVS A F       +A+ G    L+   + RTKAED+TV PKW+PF++ +A+RL
Sbjct  138   AIAARLGVSHAFFCCVNAACLAYLGPPSVLISGQDGRTKAEDFTVVPKWVPFESDLAYRL  197

Query  1084  YEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQ----KP  917
             +EI + + A +  +    D  R    +E  D V VR   EF+ EWL L+  +++    KP
Sbjct  198   HEIAKWVQASSGNESGTHDTVRFGVAIEGSDAVFVRSSDEFEPEWLNLVRELYREVKVKP  257

Query  916   VFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIA  737
             V P    P    +A    E    +W  IK WLDKQ    V+Y+A G              
Sbjct  258   VVPXFLPPNIEEEASEYDE----TWDGIKGWLDKQRVNSVVYIALG--------------  299

Query  736   LGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGG  557
                     PFFWVLR       P    LP GF ER KGRG+V   WAPQ++ILSH+ VGG
Sbjct  300   --------PFFWVLRNPPESTQPVSEMLPPGFVERVKGRGVVHLGWAPQVRILSHDLVGG  351

Query  556   FLTHSGWSSVVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVA  377
              LTH GW+S++E + F + L+    + DQGLNAR+   K +G  +PR+ERDG FTR++V 
Sbjct  352   LLTHCGWNSMIEGLVFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFTRDSVV  411

Query  376   ESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             E +RL VV+  G   R + KEMK LF D+ + +  VD  + +L
Sbjct  412   EFVRLAVVDDSGESLRTRAKEMKDLFRDRNKNNRIVDEFICFL  454



>ref|XP_010047534.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=460

 Score =   380 bits (975),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/465 (44%), Positives = 290/465 (62%), Gaps = 20/465 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPK-LPPNLASR  1448
             D+E  KLH+ M+PWLA+GH++P+LE++  +A +GH+VSF+STP+N+ + P  LPP++   
Sbjct  2     DNEEKKLHVAMFPWLAYGHLMPFLEVATFLAQKGHRVSFISTPKNLQKFPADLPPSM---  58

Query  1447  INFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFD  1268
                V+LPLP    LP++AE+T +LP++ V YLK A D L+  +A+FL     DW++ DF 
Sbjct  59    -TLVELPLPRVHGLPDSAESTSELPHNMVPYLKKAYDMLEPAVAEFLANSDVDWVIQDFV  117

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTK-AEDYTVPPKWIPFKTT  1100
             S+WL   A ++GV +A F IF    + F G    L+D   R K AED TV P+W+ + T 
Sbjct  118   SFWLPQKARRVGVKSAFFCIFNATALVFAGPPSLLIDSQARVKTAEDLTVVPEWVTYPTK  177

Query  1099  VAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             VA+RL+E++   D + + D N S + RL   +  CDIVAVR CSEF++E L LL+ +H  
Sbjct  178   VAYRLHEVINEED-IVDSDSNTSGLERLGRSILGCDIVAVRACSEFEAEPLSLLKKLHAS  236

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV P+G LP         HE  G  W ++K WLD ++   V YVA G+E   SQ  + E+
Sbjct  237   PVVPMGLLPPQNKRR---HEGDG-RWSELKQWLDDRKEKSVFYVALGTEVALSQESMHEL  292

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             A G+E S  PF WV+  +   A P  I  P GFE R  GRG V   WAPQL IL+H SVG
Sbjct  293   ACGIEKSDLPFVWVVGPK---ASPGTI--PSGFESRVLGRGFVWVGWAPQLDILAHPSVG  347

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLT-FLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GFLTH GWSS++EA+   + L+L +   +DQGL AR+++E+++G+ V RD RDG FT ++
Sbjct  348   GFLTHCGWSSIIEALGHGRALILFSGGFSDQGLMARLMDERRVGWEVLRDSRDGSFTSDS  407

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
             VAE++R V+VE EG   R     M+ +F +      Y++     L
Sbjct  408   VAETIRRVMVEPEGKEVRANAWAMREIFGNVELGRKYLEGFARAL  452



>gb|KCW79477.1| hypothetical protein EUGRSUZ_C00864, partial [Eucalyptus grandis]
Length=446

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 201/450 (45%), Positives = 286/450 (64%), Gaps = 20/450 (4%)
 Frame = -2

Query  1624  DHEGSKLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPK-LPPNLASR  1448
             D+E  KLH+ M+PWLA+GH++P+LE++  +A +GH+VSF+STP+N+ + P  LPP++   
Sbjct  2     DNEEKKLHVAMFPWLAYGHLMPFLEVATFLAQKGHRVSFISTPKNLQKFPADLPPSM---  58

Query  1447  INFVKLPLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFD  1268
                V+LPLP    LP++AE+T +LP++ V YLK A D L+  +A+FL     DW++ DF 
Sbjct  59    -TLVELPLPRVHGLPDSAESTSELPHNMVPYLKKAYDMLEPAVAEFLANSDVDWVIQDFV  117

Query  1267  SYWLAPVASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTK-AEDYTVPPKWIPFKTT  1100
             S+WL   A ++GV +A F IF    + F G    L+D   R K AED TV P+W+ + T 
Sbjct  118   SFWLPQKARRVGVKSAFFCIFNATALVFAGPPSLLIDSQARVKTAEDLTVVPEWVTYPTK  177

Query  1099  VAFRLYEILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQK  920
             VA+RL+E++   D + + D N S + RL   +  CDIVAVR CSEF++E L LL+ +H  
Sbjct  178   VAYRLHEVINEED-IVDSDSNTSGLERLGRSILGCDIVAVRACSEFEAEPLSLLKKLHAS  236

Query  919   PVFPVGQLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEI  740
             PV P+G LP         HE  G  W ++K WLD ++   V YVA G+E   SQ  + E+
Sbjct  237   PVVPMGLLPPQNKRR---HEGDG-RWSELKQWLDDRKEKSVFYVALGTEVALSQESMHEL  292

Query  739   ALGLELSGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVG  560
             A G+E S  PF WV+  +   A P  I  P GFE R  GRG V   WAPQL IL+H SVG
Sbjct  293   ACGIEKSDLPFVWVVGPK---ASPGTI--PSGFESRVLGRGFVWVGWAPQLDILAHPSVG  347

Query  559   GFLTHSGWSSVVEAIQFEKPLVLLT-FLADQGLNARVLEEKKIGYSVPRDERDGRFTREA  383
             GFLTH GWSS++EA+   + L+L +   +DQGL AR+++E+++G+ V RD RDG FT ++
Sbjct  348   GFLTHCGWSSIIEALGHGRALILFSGGFSDQGLMARLMDERRVGWEVLRDSRDGSFTSDS  407

Query  382   VAESLRLVVVEKEGNIYREKIKEMKGLFCD  293
             VAE++R V+VE EG   R     M+ +F +
Sbjct  408   VAETIRRVMVEPEGKEVRANAWAMREIFGN  437



>gb|KCW79472.1| hypothetical protein EUGRSUZ_C00857, partial [Eucalyptus grandis]
Length=453

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/459 (44%), Positives = 287/459 (63%), Gaps = 18/459 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
             KLH+ M+PWLA+GH++P+LE++  +A +GH++SF+STP+N   L KLP NL S I  V+L
Sbjct  6     KLHVAMFPWLAYGHLMPFLEVATFLARKGHRISFISTPKN---LQKLPANLPSSITLVEL  62

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP    LP++AE+T +L  + V YLK A D L+  +A+FL     +W++ DF S+WL  
Sbjct  63    PLPRVHGLPDSAESTSELLQNMVPYLKKAYDMLEPAVAEFLVNSDVNWVIQDFMSFWLPQ  122

Query  1249  VASKLGVSTALFSIFTPPTVAFFG---RLVDFAERTK-AEDYTVPPKWIPFKTTVAFRLY  1082
              A +LGV +  FSIF    +AF G    L+D   R K AED TV P+W+ + T +AFRL+
Sbjct  123   KARQLGVKSVFFSIFNASILAFIGPPSLLIDNQARAKTAEDLTVVPQWVTYPTKIAFRLH  182

Query  1081  EILRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVG  902
             E+L   D V +   N+S   R    ++ CDIVA+R CSEF++E L LL+  + +PV P+G
Sbjct  183   EVLNEEDFV-DPKSNMSVFERFGRSIQGCDIVAIRTCSEFEAEPLSLLKKFYARPVVPMG  241

Query  901   QLPTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLEL  722
              L          HE  G  W ++K WLD +E   V YVA G+E   SQ  + E+A G+E 
Sbjct  242   LLSPQNKSR---HEGDG-RWSELKQWLDGKEGKSVFYVALGTEVALSQELMHELARGIEK  297

Query  721   SGFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHS  542
             SG PF WV+  + G +      +P GFE R  GRG+V   WAPQL IL+H S+GGFLTH 
Sbjct  298   SGLPFVWVISRKAGPSS-----IPSGFESRVSGRGLVWVGWAPQLDILAHPSIGGFLTHC  352

Query  541   GWSSVVEAIQFEKPLVLLT-FLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLR  365
             GWSSV+EA+   + L+L +   +DQGL AR+++E+++G  VPRD RDG FT ++VAE+++
Sbjct  353   GWSSVIEALGQGRALILFSGGSSDQGLMARLMDERRVGSEVPRDSRDGSFTSDSVAETIK  412

Query  364   LVVVEKEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYL  248
              V+VE EG   R     M+ +F +   Q  Y++     L
Sbjct  413   WVMVEPEGEEVRANAWAMREIFGNVESQLKYLEEFARAL  451



>ref|XP_010051441.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=461

 Score =   378 bits (971),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 204/452 (45%), Positives = 272/452 (60%), Gaps = 20/452 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LHI M+PWLA GH+ P+LELSK ++ RGH +SF+STP NI RL +  P L   +  V  
Sbjct  8     SLHIAMFPWLAHGHITPFLELSKFLSLRGHAISFLSTPNNIARLARSHPELPPSVRLVSF  67

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLP +AE+T DL  D V YLK A D L+  + +FL     DW++HDF S+WL  
Sbjct  68    PLPRVPNLPSSAESTSDLDIDLVPYLKKAYDLLEPALTRFLSGSRVDWVIHDFASHWLPG  127

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
              A++LGV++  FS F   ++AF G   +       K ED T  P WIP+++T   RL+EI
Sbjct  128   AAARLGVTSVFFSTFNATSLAFLGPPSELISGRCQKPEDLTCVPAWIPYESTACLRLHEI  187

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             L+    + EE   VSD+ R    ++ CD V VR C EF+SE L LL+ I+QKP  PVG L
Sbjct  188   LKHQRCMDEE---VSDLCRFGHTIDGCDFVIVRSCREFESEPLSLLQQIYQKPAIPVGLL  244

Query  895   -PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
              P    D G   E     WK +K+WL  +    V+Y+A G+E   S     E+A G+E S
Sbjct  245   TPAVRQDEGDDDE----KWKALKSWLHTKREKSVLYIALGTEVILSHELTNELAAGIEKS  300

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PF WV+  R G   P       GFE+R  GRG +   WAPQ +IL+HE++GGFLTH G
Sbjct  301   GLPFVWVV--RNGLVAP-------GFEQRVSGRGFIWAGWAPQTRILAHEAIGGFLTHCG  351

Query  538   WSSVVEAIQFEKPLVLLT-FLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             W+S +EA+    PLVL +   +DQGL AR L EK++G+ VPRDE DG FT + VAES+R 
Sbjct  352   WNSTIEALGRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGLFTGDVVAESIRR  411

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVD  266
             V+VE EG   R   + MK +F +   Q+ Y++
Sbjct  412   VMVEHEGEPIRATARAMKEVFGNIELQNEYLE  443



>gb|KEH32398.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   378 bits (971),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/458 (42%), Positives = 278/458 (61%), Gaps = 11/458 (2%)
 Frame = -2

Query  1606  LHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKLP  1427
             LH+ M PWLA GH++PY EL+K +A  GH V+F+++P+NID++PK P  +   IN VK P
Sbjct  14    LHVAMLPWLAMGHVLPYFELAKILAQNGHTVTFINSPKNIDQIPKPPKTIQPFINLVKSP  73

Query  1426  LPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAPV  1247
             LP  + L +  E+  ++P + + YLKLA D LQ+ +   L+   PDW+ +D  + WL  +
Sbjct  74    LPHIEQL-QGEESMQNIPKNMIGYLKLAYDGLQDNVTDILKTSKPDWVFYDCAADWLPAI  132

Query  1246  ASKLGVSTALFSIFTPPTVAFFGRLVDFAERTKAEDYTVPPKWIPFKTTVAFRLYEILRI  1067
             A  L +  A +SI     V FF        R +A +   PPKW+PF+T V  + YE++RI
Sbjct  133   AKSLNIPCAHYSILAALNVCFFN-----PPRDQAVNMCSPPKWLPFETIVYLKPYEMMRI  187

Query  1066  IDAVTEEDDNVSDIFRLISGV-ERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQLPT  890
              ++V  E    +      S V    D+  +R   E +  WL  L + ++ PV PVG LP 
Sbjct  188   KESVKNESGGKTVTTADTSKVFTSADMFLIRTSRELEGPWLDYLSHRYKVPVLPVGVLPP  247

Query  889   TAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELSGFP  710
             + +     H+     W  IKAWLD +E+  V+Y+ FGSE+K  Q +LTE+A G+ELSG P
Sbjct  248   SLHIRDDQHDENNPDWVHIKAWLDSKESSSVVYIGFGSESKLDQQDLTELAHGIELSGLP  307

Query  709   FFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSGWSS  530
             FFW L+ R+         LP+GFEERTK RGIV  +W PQ+KIL+H S+GG ++H G SS
Sbjct  308   FFWALKDRKDGVS----ELPQGFEERTKERGIVWKTWVPQIKILAHPSIGGCMSHCGGSS  363

Query  529   VVEAIQFEKPLVLLTFLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRLVVVE  350
             VVE +     LV L ++ DQ L AR+LEEKK+   VPR E+DG FTR++VA++LRLV+V+
Sbjct  364   VVEMLHLGHVLVTLPYILDQCLYARLLEEKKVAVEVPRSEQDGSFTRDSVAKTLRLVIVD  423

Query  349   KEGNIYREKIKEMKGLFCDQTRQDGYVDTLLHYLHCHK  236
             +EG+  R+  K+M  +F  +   + Y+  L+  L  H+
Sbjct  424   EEGSTCRKNAKDMGKIFSSKDLHNQYIKDLIAALQKHR  461



>gb|KCW82044.1| hypothetical protein EUGRSUZ_C03414, partial [Eucalyptus grandis]
Length=451

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 204/452 (45%), Positives = 272/452 (60%), Gaps = 20/452 (4%)
 Frame = -2

Query  1609  KLHIMMYPWLAFGHMIPYLELSKHIASRGHKVSFVSTPRNIDRLPKLPPNLASRINFVKL  1430
              LHI M+PWLA GH+ P+LELSK ++ RGH +SF+STP NI RL +  P L   +  V  
Sbjct  8     SLHIAMFPWLAHGHITPFLELSKFLSLRGHAISFLSTPNNIARLARSHPELPPSVRLVSF  67

Query  1429  PLPPHQNLPENAEATIDLPYDKVKYLKLARDALQETMAKFLEEFSPDWILHDFDSYWLAP  1250
             PLP   NLP +AE+T DL  D V YLK A D L+  + +FL     DW++HDF S+WL  
Sbjct  68    PLPRVPNLPSSAESTSDLDIDLVPYLKKAYDLLEPALTRFLSGSRVDWVIHDFASHWLPG  127

Query  1249  VASKLGVSTALFSIFTPPTVAFFGRLVDF--AERTKAEDYTVPPKWIPFKTTVAFRLYEI  1076
              A++LGV++  FS F   ++AF G   +       K ED T  P WIP+++T   RL+EI
Sbjct  128   AAARLGVTSVFFSTFNATSLAFLGPPSELISGRCQKPEDLTCVPAWIPYESTACLRLHEI  187

Query  1075  LRIIDAVTEEDDNVSDIFRLISGVERCDIVAVRGCSEFDSEWLKLLENIHQKPVFPVGQL  896
             L+    + EE   VSD+ R    ++ CD V VR C EF+SE L LL+ I+QKP  PVG L
Sbjct  188   LKHQRCMDEE---VSDLCRFGHTIDGCDFVIVRSCREFESEPLSLLQQIYQKPAIPVGLL  244

Query  895   -PTTAYDAGGGHEPTGDSWKDIKAWLDKQETGKVIYVAFGSEAKPSQTELTEIALGLELS  719
              P    D G   E     WK +K+WL  +    V+Y+A G+E   S     E+A G+E S
Sbjct  245   TPAVRQDEGDDDE----KWKALKSWLHTKREKSVLYIALGTEVILSHELTNELAAGIEKS  300

Query  718   GFPFFWVLRARRGEADPELIHLPEGFEERTKGRGIVCTSWAPQLKILSHESVGGFLTHSG  539
             G PF WV+  R G   P       GFE+R  GRG +   WAPQ +IL+HE++GGFLTH G
Sbjct  301   GLPFVWVV--RNGLVAP-------GFEQRVSGRGFIWAGWAPQTRILAHEAIGGFLTHCG  351

Query  538   WSSVVEAIQFEKPLVLLT-FLADQGLNARVLEEKKIGYSVPRDERDGRFTREAVAESLRL  362
             W+S +EA+    PLVL +   +DQGL AR L EK++G+ VPRDE DG FT + VAES+R 
Sbjct  352   WNSTIEALGRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGLFTGDVVAESIRR  411

Query  361   VVVEKEGNIYREKIKEMKGLFCDQTRQDGYVD  266
             V+VE EG   R   + MK +F +   Q+ Y++
Sbjct  412   VMVEHEGEPIRATARAMKEVFGNIELQNEYLE  443



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5168388588226