BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25013_g1_i2 len=627 path=[10728:0-179 11570:180-201 10078:202-203
10104:204-290 6269:291-472 11776:473-474 350:475-487 11778:488-505
11311:506-508 10168:509-553 11357:554-626]

Length=627
                                                                      Score     E

ref|XP_008346701.1|  PREDICTED: uncharacterized protein LOC103409667  44.3    1e-06   
ref|XP_008374285.1|  PREDICTED: 52 kDa repressor of the inhibitor...  43.9    1e-06   
ref|XP_008392221.1|  PREDICTED: zinc finger MYM-type protein 1-like   44.3    1e-06   
ref|XP_008449194.1|  PREDICTED: uncharacterized protein LOC103491145  41.6    5e-06   
ref|XP_008374280.1|  PREDICTED: 52 kDa repressor of the inhibitor...  42.0    7e-06   
ref|XP_008245511.1|  PREDICTED: zinc finger MYM-type protein 1-like   42.7    8e-06   
ref|XP_008244557.1|  PREDICTED: zinc finger MYM-type protein 1-like   39.7    2e-05   
ref|XP_009628427.1|  PREDICTED: uncharacterized protein LOC104118777  41.2    2e-05   
ref|XP_008372678.1|  PREDICTED: 52 kDa repressor of the inhibitor...  41.6    3e-05   
ref|XP_010436523.1|  PREDICTED: uncharacterized protein LOC104720293  42.0    3e-05   
ref|XP_008221405.1|  PREDICTED: 52 kDa repressor of the inhibitor...  39.3    3e-05   
ref|XP_009775297.1|  PREDICTED: zinc finger MYM-type protein 1-like   43.9    4e-05   
ref|XP_003589867.1|  hypothetical protein MTR_1g040620                41.2    5e-05   
ref|XP_009790130.1|  PREDICTED: uncharacterized protein LOC104237647  43.5    6e-05   
ref|XP_006370626.1|  hypothetical protein POPTR_0001s44370g           40.8    6e-05   
ref|XP_006373883.1|  hypothetical protein POPTR_0016s09365g           40.8    8e-05   
ref|XP_008232280.1|  PREDICTED: uncharacterized protein LOC103331437  37.7    8e-05   
ref|XP_007036045.1|  Uncharacterized protein TCM_011941               42.7    1e-04   
ref|XP_010669270.1|  PREDICTED: zinc finger MYM-type protein 1-like   41.2    1e-04   
ref|XP_006299010.1|  hypothetical protein CARUB_v10015137mg           40.4    1e-04   
ref|XP_006385221.1|  hypothetical protein POPTR_0003s01520g           40.0    1e-04   
ref|XP_006393511.1|  hypothetical protein EUTSA_v10012204mg           41.2    2e-04   
ref|XP_008377000.1|  PREDICTED: zinc finger MYM-type protein 1-like   38.1    2e-04   
ref|XP_010527308.1|  PREDICTED: zinc finger MYM-type protein 1-like   41.6    2e-04   
ref|XP_009128538.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  40.0    2e-04   
ref|XP_010558817.1|  PREDICTED: zinc finger MYM-type protein 1-li...  41.6    3e-04   
ref|XP_010670598.1|  PREDICTED: zinc finger MYM-type protein 1-like   41.6    3e-04   
ref|XP_010462772.1|  PREDICTED: uncharacterized protein LOC104743377  41.6    3e-04   
ref|XP_009138601.1|  PREDICTED: zinc finger MYM-type protein 1-like   41.2    3e-04   
ref|XP_010677877.1|  PREDICTED: zinc finger MYM-type protein 1-like   41.6    3e-04   
ref|XP_010424743.1|  PREDICTED: uncharacterized protein LOC104709899  42.4    3e-04   
ref|XP_010558811.1|  PREDICTED: uncharacterized protein LOC104827...  41.2    3e-04   
ref|XP_009803108.1|  PREDICTED: uncharacterized protein LOC104248535  36.2    4e-04   
ref|XP_006380675.1|  hypothetical protein POPTR_0007s10360g           40.0    4e-04   
ref|XP_006408662.1|  hypothetical protein EUTSA_v10002275mg           42.4    4e-04   
ref|XP_009796684.1|  PREDICTED: uncharacterized protein LOC104243222  36.2    5e-04   
ref|XP_009790128.1|  PREDICTED: uncharacterized protein LOC104237645  43.1    5e-04   
ref|XP_009111231.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  40.4    5e-04   
ref|XP_003615596.1|  Zinc finger MYM-type protein                     43.5    6e-04   
ref|XP_004308301.1|  PREDICTED: zinc finger MYM-type protein 1-like   35.4    6e-04   
ref|XP_004296334.1|  PREDICTED: uncharacterized protein LOC101297233  37.7    7e-04   
ref|XP_010484985.1|  PREDICTED: uncharacterized protein LOC104763292  38.9    7e-04   
ref|XP_009627614.1|  PREDICTED: zinc finger MYM-type protein 1-like   35.8    8e-04   
ref|XP_009607886.1|  PREDICTED: uncharacterized protein LOC104102010  35.8    8e-04   
ref|XP_006441675.1|  hypothetical protein CICLE_v10018973mg           38.1    8e-04   
ref|XP_009137705.1|  PREDICTED: zinc finger MYM-type protein 1-like   39.7    8e-04   
ref|XP_006393285.1|  hypothetical protein EUTSA_v10012261mg           37.0    8e-04   
ref|XP_010673689.1|  PREDICTED: zinc finger MYM-type protein 1-like   41.6    9e-04   
ref|XP_010672800.1|  PREDICTED: zinc finger MYM-type protein 1-like   39.3    0.001   
gb|KDO48778.1|  hypothetical protein CISIN_1g0111442mg                38.5    0.001   



>ref|XP_008346701.1| PREDICTED: uncharacterized protein LOC103409667 [Malus domestica]
Length=1071

 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428   LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
             ++K  LRNRM D  +NDCLV Y+EKDIF
Sbjct  1021  IVKNTLRNRMGDLWMNDCLVAYIEKDIF  1048


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  511   FYQISNEAVLQRFQNMKERRGIL  579
             F  I +EA++QRFQNMK RRG L
Sbjct  1048  FNSIEDEAIMQRFQNMKTRRGQL  1070



>ref|XP_008374285.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like 
[Malus domestica]
Length=869

 Score = 43.9 bits (102),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K  LRNRM D  +NDCLV Y+EKDIF
Sbjct  819  IVKNTLRNRMGDLWMNDCLVAYIEKDIF  846


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I +EA++QRFQNMK RRG L
Sbjct  846  FNSIEDEAIMQRFQNMKTRRGQL  868



>ref|XP_008392221.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica]
Length=792

 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K  LRNRM D  +NDCLV Y+EKDIF
Sbjct  742  IVKNTLRNRMGDLWMNDCLVAYIEKDIF  769


 Score = 34.7 bits (78),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            ++  F  I +EA++QRFQNMK RRG L
Sbjct  765  EKDIFNSIEDEAIMQRFQNMKTRRGQL  791



>ref|XP_008449194.1| PREDICTED: uncharacterized protein LOC103491145 [Cucumis melo]
Length=313

 Score = 41.6 bits (96),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  422  ICLIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            + +IKT  R RM D  +NDCLV Y+E+D+F
Sbjct  262  MSIIKTQFRTRMKDQWMNDCLVAYIERDLF  291


 Score = 35.4 bits (80),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRG  573
            +R  F +I NEA++ RFQNMK RRG
Sbjct  287  ERDLFDKIDNEAIMYRFQNMKSRRG  311



>ref|XP_008374280.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like 
[Malus domestica]
Length=792

 Score = 42.0 bits (97),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K  LRNRM D  +NDCLV Y+E DIF
Sbjct  742  IVKNTLRNRMXDLWMNDCLVAYIEXDIF  769


 Score = 34.7 bits (78),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I +EA++QRFQNMK RRG L
Sbjct  769  FNSIEDEAIMQRFQNMKTRRGQL  791



>ref|XP_008245511.1| PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume]
Length=788

 Score = 42.7 bits (99),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K  LRNRM D  +NDCLV Y+EKDIF
Sbjct  739  IVKNRLRNRMGDLWMNDCLVAYIEKDIF  766


 Score = 33.9 bits (76),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            ++  F  I +E V+QRFQNMK RRG L
Sbjct  762  EKDIFNSIDDEVVMQRFQNMKTRRGQL  788



>ref|XP_008244557.1| PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume]
Length=816

 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +IK  LRNRM D  LND L+ Y+E+D+F
Sbjct  667  IIKNPLRNRMGDQWLNDSLIVYIERDVF  694


 Score = 35.4 bits (80),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  I NE ++QRFQNMK RRG L
Sbjct  690  ERDVFACIDNETIMQRFQNMKTRRGQL  716



>ref|XP_009628427.1| PREDICTED: uncharacterized protein LOC104118777 [Nicotiana tomentosiformis]
Length=368

 Score = 41.2 bits (95),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  422  ICLIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            I  IK  LRNRM DD LNDCLV Y+E+ IF
Sbjct  317  IKYIKNDLRNRMDDDFLNDCLVCYIERKIF  346


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  ISN+A++ RFQ+MK RRG L
Sbjct  342  ERKIFKTISNDAIIDRFQSMKTRRGQL  368



>ref|XP_008372678.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like 
[Malus domestica]
Length=792

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K  LRN M D  +NDCLV Y+EKDIF
Sbjct  742  IVKNTLRNXMGDLWMNDCLVAYIEKDIF  769


 Score = 33.1 bits (74),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I +EA+ QRFQNMK RRG L
Sbjct  769  FNSIEDEAIXQRFQNMKTRRGQL  791



>ref|XP_010436523.1| PREDICTED: uncharacterized protein LOC104720293 [Camelina sativa]
Length=259

 Score = 42.0 bits (97),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT LRNR+ D  LNDCLV ++EK++F
Sbjct  210  IVKTSLRNRIGDQFLNDCLVSFIEKELF  237


 Score = 32.7 bits (73),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            ++  F +++NE V++RFQ+MKERR  L
Sbjct  233  EKELFEKVTNEVVMKRFQDMKERRVTL  259



>ref|XP_008221405.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like 
[Prunus mume]
Length=304

 Score = 39.3 bits (90),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +IK  LRNRM D  LND L+ Y+E+D+F
Sbjct  255  IIKNPLRNRMGDQWLNDSLIVYIERDVF  282


 Score = 35.0 bits (79),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  I NE ++QRFQNMK RRG L
Sbjct  278  ERDVFACIDNETIMQRFQNMKTRRGQL  304



>ref|XP_009775297.1| PREDICTED: zinc finger MYM-type protein 1-like [Nicotiana sylvestris]
Length=492

 Score = 43.9 bits (102),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            LIK+ LRNRM+D+ ++ CLVPYVE+ IF
Sbjct  443  LIKSELRNRMNDEFMSGCLVPYVERKIF  470


 Score = 30.4 bits (67),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRG  573
            +R  F  IS+E ++  FQ+MK RRG
Sbjct  466  ERKIFNAISDETIMNTFQDMKTRRG  490



>ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago truncatula]
Length=665

 Score = 41.2 bits (95),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
             +K  +RNRM D+ LN CLV Y+E DIF
Sbjct  616  FVKNQMRNRMGDEFLNGCLVTYIESDIF  643


 Score = 32.7 bits (73),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  + NE +LQRFQNM  RRG L
Sbjct  643  FDSVENEKILQRFQNMTSRRGKL  665



>ref|XP_009790130.1| PREDICTED: uncharacterized protein LOC104237647 [Nicotiana sylvestris]
Length=369

 Score = 43.5 bits (101),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            LIK+ LRNRM+D+ ++ CLVPYVE+ IF
Sbjct  320  LIKSELRNRMNDEFMSGCLVPYVERKIF  347


 Score = 29.6 bits (65),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRG  573
            +R  F  IS+E ++  FQ+MK RRG
Sbjct  343  ERKIFNVISDETIMNTFQDMKTRRG  367



>ref|XP_006370626.1| hypothetical protein POPTR_0001s44370g [Populus trichocarpa]
 gb|ERP67195.1| hypothetical protein POPTR_0001s44370g [Populus trichocarpa]
Length=788

 Score = 40.8 bits (94),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K+ LRNRM D  +ND LV Y+EKDIF
Sbjct  739  IVKSRLRNRMGDKWMNDSLVVYIEKDIF  766


 Score = 32.3 bits (72),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  508  FFYQISNEAVLQRFQNMKERR  570
             F +I NEA+++RFQNMK RR
Sbjct  765  IFDKIDNEAIMKRFQNMKTRR  785



>ref|XP_006373883.1| hypothetical protein POPTR_0016s09365g [Populus trichocarpa]
 gb|ERP51680.1| hypothetical protein POPTR_0016s09365g [Populus trichocarpa]
Length=750

 Score = 40.8 bits (94),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K+ LRNRM D  +ND LV Y+EKDIF
Sbjct  701  IVKSRLRNRMGDKWMNDSLVVYIEKDIF  728


 Score = 32.3 bits (72),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  508  FFYQISNEAVLQRFQNMKERR  570
             F +I NEA+++RFQNMK RR
Sbjct  727  IFDKIDNEAIMKRFQNMKTRR  747



>ref|XP_008232280.1| PREDICTED: uncharacterized protein LOC103331437 [Prunus mume]
Length=367

 Score = 37.7 bits (86),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +IK  LRNRM D  LND L+ Y+E+++F
Sbjct  318  IIKNPLRNRMGDQWLNDSLIVYIERNVF  345


 Score = 35.0 bits (79),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  I NE ++QRFQNMK RRG L
Sbjct  341  ERNVFACIGNETIMQRFQNMKTRRGQL  367



>ref|XP_007036045.1| Uncharacterized protein TCM_011941 [Theobroma cacao]
 gb|EOY20546.1| Uncharacterized protein TCM_011941 [Theobroma cacao]
Length=85

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            LIK+ LRNRM D  LNDCLV ++E+D+F
Sbjct  25   LIKSILRNRMGDVWLNDCLVTHIERDVF  52


 Score = 30.0 bits (66),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            +R  F  I NEA+++RF NMK RR
Sbjct  48   ERDVFETIDNEAIMKRFPNMKNRR  71



>ref|XP_010669270.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=550

 Score = 41.2 bits (95),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +K+ LRN M D  LNDCLV Y+E+D+F
Sbjct  502  VKSKLRNSMGDQFLNDCLVTYIERDLF  528


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            +R  F Q+S++ VL+RFQ+MK RR
Sbjct  524  ERDLFLQVSDDDVLKRFQSMKGRR  547



>ref|XP_006299010.1| hypothetical protein CARUB_v10015137mg [Capsella rubella]
 gb|EOA31908.1| hypothetical protein CARUB_v10015137mg [Capsella rubella]
Length=736

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT  RNR+ D  LNDCLV ++EKDIF
Sbjct  687  IVKTHRRNRIGDQFLNDCLVCFIEKDIF  714


 Score = 31.6 bits (70),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I+NE V+ RFQ+MK+RR +L
Sbjct  714  FKAITNETVITRFQDMKDRRMLL  736



>ref|XP_006385221.1| hypothetical protein POPTR_0003s01520g [Populus trichocarpa]
 gb|ERP63018.1| hypothetical protein POPTR_0003s01520g [Populus trichocarpa]
Length=750

 Score = 40.0 bits (92),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K+ LRNRM D  +ND LV Y+EKDIF
Sbjct  701  IVKSRLRNRMGDKWMNDSLVVYIEKDIF  728


 Score = 32.3 bits (72),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  508  FFYQISNEAVLQRFQNMKERR  570
             F +I NEA+++RFQNMK RR
Sbjct  727  IFDKIDNEAIMKRFQNMKTRR  747



>ref|XP_006393511.1| hypothetical protein EUTSA_v10012204mg [Eutrema salsugineum]
 gb|ESQ30797.1| hypothetical protein EUTSA_v10012204mg [Eutrema salsugineum]
Length=382

 Score = 41.2 bits (95),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT  RNRM D  LNDCLV +VEKD+F
Sbjct  333  IVKTDGRNRMGDQFLNDCLVCFVEKDVF  360


 Score = 30.8 bits (68),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I+NE+V++RFQ++K+R+ IL
Sbjct  360  FQTITNESVIKRFQDIKDRKIIL  382



>ref|XP_008377000.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica]
Length=491

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  I N+ V+QRFQNMK RRGIL
Sbjct  465  EREIFDGIGNDVVMQRFQNMKTRRGIL  491


 Score = 33.5 bits (75),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K  LRNRM D  +ND  V ++E++IF
Sbjct  442  ILKNRLRNRMGDQWMNDNXVIFIEREIF  469



>ref|XP_010527308.1| PREDICTED: zinc finger MYM-type protein 1-like [Tarenaya hassleriana]
Length=527

 Score = 41.6 bits (96),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
             +KT LRNR+ D  L+DCLV ++EKDIF
Sbjct  478  FVKTALRNRIGDQFLSDCLVCFIEKDIF  505


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERR  570
            F  ++NEAV+ RFQ MK RR
Sbjct  505  FQTVTNEAVMDRFQKMKTRR  524



>ref|XP_009128538.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger MYM-type protein 
1 [Brassica rapa]
Length=636

 Score = 40.0 bits (92),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT LRNR+SD  LNDC+V +V+K++F
Sbjct  587  IVKTSLRNRISDQFLNDCVVCFVKKELF  614


 Score = 31.2 bits (69),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            K+  F +++NE V++RFQNM+ RR
Sbjct  610  KKELFEKVTNEVVVKRFQNMESRR  633



>ref|XP_010558817.1| PREDICTED: zinc finger MYM-type protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=793

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
             +KT LRNR+ D  L+DCLV ++EKDIF
Sbjct  744  FVKTALRNRIGDQFLSDCLVCFIEKDIF  771


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  ++NEAV+ RFQ MK RR  L
Sbjct  771  FQTVTNEAVMDRFQKMKTRRNQL  793



>ref|XP_010670598.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=454

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  422  ICLIKTCLRNRMSDDLLNDCLVPYVEKDIFF  514
            +  +K+ LRN M D L+NDCLV ++EKD+F 
Sbjct  403  MTYVKSKLRNSMGDQLMNDCLVTFIEKDVFL  433


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERR  570
            F Q+ +E ++ RFQNMK RR
Sbjct  432  FLQVPDEDIIDRFQNMKARR  451



>ref|XP_010462772.1| PREDICTED: uncharacterized protein LOC104743377 [Camelina sativa]
Length=271

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT LRNR+ D  LNDCLV ++EK++F
Sbjct  222  IVKTSLRNRIGDKFLNDCLVSFIEKELF  249


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            ++  F +++NE V++ FQ+MKERR  L
Sbjct  245  EKELFDKVTNEIVMKMFQDMKERRITL  271



>ref|XP_009138601.1| PREDICTED: zinc finger MYM-type protein 1-like [Brassica rapa]
Length=798

 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT LRNRM D+ LNDC+V Y EK+ F
Sbjct  749  IVKTTLRNRMDDEFLNDCMVCYTEKEHF  776


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F +++N+ V++RFQ+MK+RR  L
Sbjct  776  FDEVTNDMVIKRFQDMKDRRMTL  798



>ref|XP_010677877.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=701

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIFF  514
            +K+ LRN M D  LNDCLV Y+E+D+F 
Sbjct  653  VKSKLRNSMGDQFLNDCLVTYIERDVFL  680


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            +R  F Q+S++ V++RFQ+MK RR
Sbjct  675  ERDVFLQVSDDDVIKRFQSMKGRR  698



>ref|XP_010424743.1| PREDICTED: uncharacterized protein LOC104709899 [Camelina sativa]
Length=409

 Score = 42.4 bits (98),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT LRNR+ D  LNDCLV ++EK++F
Sbjct  360  IVKTSLRNRIGDKFLNDCLVSFIEKELF  387


 Score = 28.5 bits (62),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            ++  F +++NE V++ FQ+MKERR
Sbjct  383  EKELFDKMTNEIVMKMFQDMKERR  406



>ref|XP_010558811.1| PREDICTED: uncharacterized protein LOC104827337 isoform X1 [Tarenaya 
hassleriana]
Length=283

 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
             +KT LRNR+ D  L+DCLV ++EKDIF
Sbjct  234  FVKTALRNRIGDQFLSDCLVCFIEKDIF  261


 Score = 30.0 bits (66),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  ++NEAV+ RFQ MK RR  L
Sbjct  261  FQTVTNEAVMDRFQKMKTRRNQL  283



>ref|XP_009803108.1| PREDICTED: uncharacterized protein LOC104248535 [Nicotiana sylvestris]
Length=366

 Score = 36.2 bits (82),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            IK   RN M D  LNDCLV Y+E+D+F
Sbjct  318  IKNEERNNMGDQYLNDCLVCYIERDVF  344


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRG  573
            +R  F  ISN+ ++ RFQNMK RRG
Sbjct  340  ERDVFTNISNDVIIDRFQNMKARRG  364



>ref|XP_006380675.1| hypothetical protein POPTR_0007s10360g [Populus trichocarpa]
 gb|ERP58472.1| hypothetical protein POPTR_0007s10360g [Populus trichocarpa]
Length=708

 Score = 40.0 bits (92),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K+ LRNRM D  +ND LV Y+EKDIF
Sbjct  659  IVKSRLRNRMGDKWMNDSLVVYIEKDIF  686


 Score = 30.8 bits (68),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  508  FFYQISNEAVLQRFQNMKERR  570
             F +I NE +++RFQNMK RR
Sbjct  685  IFDKIDNETIMKRFQNMKTRR  705



>ref|XP_006408662.1| hypothetical protein EUTSA_v10002275mg [Eutrema salsugineum]
 gb|ESQ50115.1| hypothetical protein EUTSA_v10002275mg [Eutrema salsugineum]
Length=771

 Score = 42.4 bits (98),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT LRNRMSD  LNDC+V +VEK++ 
Sbjct  722  IVKTVLRNRMSDQFLNDCVVCFVEKELL  749


 Score = 28.1 bits (61),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +1

Query  517  QISNEAVLQRFQNMKERRGIL  579
            +++NE V+++FQNMK R+ IL
Sbjct  751  KVTNEVVMKKFQNMKPRKIIL  771



>ref|XP_009796684.1| PREDICTED: uncharacterized protein LOC104243222 [Nicotiana sylvestris]
Length=208

 Score = 36.2 bits (82),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            IK   RN M D  LNDCLV Y+E+D+F
Sbjct  160  IKNEERNNMGDQYLNDCLVCYIERDVF  186


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  ISN+ ++ RFQNMK RRG L
Sbjct  182  ERDVFTNISNDVIIDRFQNMKARRGQL  208



>ref|XP_009790128.1| PREDICTED: uncharacterized protein LOC104237645 [Nicotiana sylvestris]
Length=240

 Score = 43.1 bits (100),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            LIK+ LRNRM+D+ ++ CLVPYVE+ IF
Sbjct  191  LIKSELRNRMNDEFMSGCLVPYVERKIF  218


 Score = 26.9 bits (58),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRG  573
            +R  F  I +E ++  FQ+MK RRG
Sbjct  214  ERKIFNAIFDETIMNTFQDMKTRRG  238



>ref|XP_009111231.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger MYM-type protein 
1 [Brassica rapa]
Length=481

 Score = 40.4 bits (93),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            L+KT  RNR+ D+ L+DCLV Y+EK++F
Sbjct  432  LVKTATRNRIEDEFLSDCLVCYIEKELF  459


 Score = 29.6 bits (65),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            ++  F  ++NE V++RFQ+M+ERR
Sbjct  455  EKELFESVTNETVVKRFQSMRERR  478



>ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago truncatula]
Length=892

 Score = 43.5 bits (101),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDI  508
            ++K+ LRNRM DD +NDCLV Y+E+D+
Sbjct  843  IVKSRLRNRMGDDWMNDCLVTYIERDV  869


 Score = 26.6 bits (57),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  517  QISNEAVLQRFQNMKERRGIL  579
            +I +E ++QRFQ M  RRG L
Sbjct  872  KIDDELIIQRFQKMATRRGHL  892



>ref|XP_004308301.1| PREDICTED: zinc finger MYM-type protein 1-like [Fragaria vesca 
subsp. vesca]
Length=702

 Score = 35.4 bits (80),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++K   RNRM D  LND L  Y+EKDIF
Sbjct  653  IVKNRTRNRMEDQWLNDSLTMYLEKDIF  680


 Score = 34.7 bits (78),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I NEA++QRFQNM  RRG L
Sbjct  680  FNDIDNEAIIQRFQNMATRRGHL  702



>ref|XP_004296334.1| PREDICTED: uncharacterized protein LOC101297233 [Fragaria vesca 
subsp. vesca]
Length=202

 Score = 37.7 bits (86),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +IK  +RNRM D  LND L  Y+EKD+F
Sbjct  153  IIKNRMRNRMGDQWLNDSLTVYLEKDVF  180


 Score = 32.3 bits (72),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRG  573
            F  I NE ++QRFQNM  RRG
Sbjct  180  FNAIDNEVIIQRFQNMAPRRG  200



>ref|XP_010484985.1| PREDICTED: uncharacterized protein LOC104763292 [Camelina sativa]
Length=411

 Score = 38.9 bits (89),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
             IKT  RNR+ D+ LN CLV ++EKD+F
Sbjct  362  FIKTHRRNRIGDEFLNGCLVCFIEKDVF  389


 Score = 30.8 bits (68),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I+NE V++RFQNMK  R +L
Sbjct  389  FNTITNETVIKRFQNMKNHRMLL  411



>ref|XP_009627614.1| PREDICTED: zinc finger MYM-type protein 1-like [Nicotiana tomentosiformis]
Length=491

 Score = 35.8 bits (81),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            IK   RN M D  LNDCL+ Y+E+D+F
Sbjct  443  IKNEERNNMGDQYLNDCLICYIERDVF  469


 Score = 33.9 bits (76),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRG  573
            +R  F  +SN+ ++ RFQNMK RRG
Sbjct  465  ERDVFTNVSNDVIIDRFQNMKARRG  489



>ref|XP_009607886.1| PREDICTED: uncharacterized protein LOC104102010 [Nicotiana tomentosiformis]
Length=406

 Score = 35.8 bits (81),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            IK   RN M D  LNDCL+ Y+E+D+F
Sbjct  358  IKNEERNNMGDQYLNDCLICYIERDVF  384


 Score = 33.9 bits (76),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERRGIL  579
            +R  F  +SN+ ++ RFQNMK RRG L
Sbjct  380  ERDVFTNVSNDVIIDRFQNMKARRGQL  406



>ref|XP_006441675.1| hypothetical protein CICLE_v10018973mg [Citrus clementina]
 gb|ESR54915.1| hypothetical protein CICLE_v10018973mg [Citrus clementina]
Length=705

 Score = 38.1 bits (87),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +K  LR+RM D+ LND LV Y+EKD+F
Sbjct  656  VKNRLRSRMGDEWLNDNLVVYIEKDVF  682


 Score = 31.6 bits (70),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I NE +LQ FQ+MK  RGIL
Sbjct  682  FDCIDNEIILQHFQHMKSHRGIL  704



>ref|XP_009137705.1| PREDICTED: zinc finger MYM-type protein 1-like [Brassica rapa]
Length=829

 Score = 39.7 bits (91),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            ++KT  RNR+ D  LNDCL+ ++EKD+F
Sbjct  780  IVKTDRRNRIGDQFLNDCLICFIEKDVF  807


 Score = 29.6 bits (65),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F +I+N  V++RFQ+MK+RR +L
Sbjct  807  FEKITNVTVMKRFQDMKDRRVLL  829



>ref|XP_006393285.1| hypothetical protein EUTSA_v10012261mg [Eutrema salsugineum]
 gb|ESQ30571.1| hypothetical protein EUTSA_v10012261mg [Eutrema salsugineum]
Length=614

 Score = 37.0 bits (84),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  428  LIKTCLRNRMSDDLLNDCLVPYVEKDIFFI  517
            ++KT   NRM D  LNDCL+ +VEKD+F I
Sbjct  565  IVKTDQCNRMGDQFLNDCLICFVEKDVFQI  594


 Score = 32.3 bits (72),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGIL  579
            F  I+NE+V++RFQ+MK+RR IL
Sbjct  592  FQIITNESVIKRFQDMKDRRIIL  614



>ref|XP_010673689.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 41.6 bits (96),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +2

Query  422  ICLIKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +  +K+ LRN M D L+NDCLV ++EKD+F
Sbjct  314  MTYVKSKLRNSMGDQLMNDCLVTFIEKDVF  343


 Score = 27.7 bits (60),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERR  570
            F Q+ ++ ++ RFQNMK RR
Sbjct  343  FLQVPDKDIIDRFQNMKARR  362



>ref|XP_010672800.1| PREDICTED: zinc finger MYM-type protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=663

 Score = 39.3 bits (90),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +K+ LRN M D  LNDCLV Y+E+++F
Sbjct  615  VKSKLRNSMGDQFLNDCLVTYIERNLF  641


 Score = 30.0 bits (66),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  499  KRYFFYQISNEAVLQRFQNMKERR  570
            +R  F Q+S++ V++RFQ+MK RR
Sbjct  637  ERNLFLQVSDDDVIKRFQSMKGRR  660



>gb|KDO48778.1| hypothetical protein CISIN_1g0111442mg, partial [Citrus sinensis]
Length=72

 Score = 38.5 bits (88),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  431  IKTCLRNRMSDDLLNDCLVPYVEKDIF  511
            +K+ LR+RM D+ LND LV Y+EKD+F
Sbjct  23   VKSRLRSRMGDEWLNDNLVVYIEKDVF  49


 Score = 31.2 bits (69),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +1

Query  511  FYQISNEAVLQRFQNMKERRGILS  582
            F  I NE +LQ FQ+MK R GIL 
Sbjct  49   FDCIDNEIILQHFQHMKSRGGILD  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 859090811640